Double-Chooz: a search for {theta}{sub 13}

Energy Technology Data Exchange (ETDEWEB)

Mention, G. [APC/PCC, College de France, 75005 Paris (France)

2005-08-15

The Double-Chooz experiment goal is to search for a non-vanishing value of the {theta}{sub 13} neutrino mixing angle. This is the last step to accomplish prior moving towards a new era of precision measurements in the lepton sector. The current best constraint on the third mixing angle comes from the CHOOZ reactor neutrino experiment sin{sup 2}(2{theta}{sub 13}) < 0.2-0.14 (90% C.L., {delta}m{sub atm}{sup 2}=2.0-2.410{sup -3} eV{sup 2}). Double-Chooz will explore the range of sin{sup 2}(2{theta}{sub 13}) from 0.2 to 0.03-0.02, within three years of data taking. The improvement of the CHOOZ result requires an increase in the statistics, a reduction of the systematic error below one percent, and a careful control of the backgrounds. Therefore, Double-Chooz will use two identical detectors, one at 150 m and another at 1.05 km distance from the Chooz nuclear cores. In addition, we will use the near detector as a 'state of the art' prototype to investigate the potential of neutrinos for monitoring the civil nuclear power plants. The plan is to start operation with two detectors in 2008, and to reach a sin{sup 2}(2{theta}{sub 13}) sensitivity of 0.05 in 2009, and 0.03-0.02 in 2011.

Computer-assisted command and control for Chooz B

International Nuclear Information System (INIS)

Anon.

1995-01-01

A new type of command and control system has been installed at the Chooz B nuclear power plant. A key feature of the system is a man/machine interface designed to provide operators with on-screen assistance more quickly than ever. (Author)

Sterile Neutrino Search with the Double Chooz Experiment

Science.gov (United States)

Hellwig, D.; Matsubara, T.; Double Chooz Collaboration

2017-09-01

Double Chooz is a reactor antineutrino disappearance experiment located in Chooz, France. A far detector at a distance of about 1 km from reactor cores is operating since 2011; a near detector of identical design at a distance of about 400 m is operating since begin 2015. Beyond the precise measurement of θ 13, Double Chooz has a strong sensitivity to so called light sterile neutrinos. Sterile neutrinos are neutrino mass states not taking part in weak interactions, but may mix with known neutrino states. In this paper, we present an analysis method to search for sterile neutrinos and the expected sensitivity with the baselines of our detectors.

Double Chooz Improved Multi-Detector Measurements

CERN Multimedia

CERN. Geneva

2016-01-01

The Double Chooz experiment (DC) is a reactor neutrino oscillation experiment running at Chooz nuclear power plant (2 reactors) in France. In 2011, DC first reported indication of non-zero θ13 with the far detector (FD) located at the maximum of oscillation effects (i.e. disappearance), thus challenging the CHOOZ non-observation limit. A robust observation of θ13 followed in 2012 by the Daya Bay experiments with multiple detector configurations. Since 2015 DC runs in a multi-detector configuration making thus the impact of several otherwise dominating systematics reduce strongly. DC’s unique almost "iso-flux" site, allows the near detector (ND) to become a direct accurate non-oscillation reference to the FD. Our first multi-detector results at MORIOND-2016 showed an intriguing deviation of θ13 with respect to the world average. We will address this issue in this seminar. The combined "reactor-θ13" measurement is expected to ...

Double Chooz: Results and Perspectives

Science.gov (United States)

Franke, A. J.

2013-04-01

The Double Chooz experiment has been observing ν from two reactor cores at the Chooz nuclear power station in Ardennes, France, with a single 10.3 m fiducial volume Gd-doped liquid scintillator detector at a flux-weighted average baseline of ˜1050 m. This article reviews results achieved with a detector live time of 227.93 days and exposure of 33.71 GW-ton-years. A total of 8,249 candidate ν events have been observed, compared to an expected 8,937 events in the null-oscillation case: this deficit is interpreted as evidence for ν disappearance. A fit to the observed neutrino rate and spectral shape gives a best-fit value of sin2(2θ13)=0.109±0.030 (stat.)±0.025 (syst.) at a mass-squared splitting of Δm312=2.32×10-3 eV. The null-oscillation hypothesis is excluded by the data at 99.8% CL (2.9σ). The Double Chooz Near Detector is under construction, and analysis efforts to measure neutrino directionality, test Lorentz violation, and measure backgrounds in situ are underway.

Development of a level-1 trigger and timing system for the Double Chooz neutrino experiment

International Nuclear Information System (INIS)

Reinhold, Bernd

2009-01-01

The measurement of the mixing angle θ 13 is the goal of several running and planned experiments. The experiments are either accelerator based (super)beam experiments (e.g. MINOS, T2K, Nova) or reactor anti-neutrino disappearance experiments (e.g. Daya Bay, RENO or Double Chooz). In order to measure or constrain θ 13 with the Double Chooz experiment the overall systematic errors have to be controlled at the one-percent or sub-percent level. The limitation of the systematic errors is achieved through various means and techniques. E.g. the experiment consists of two identical detectors at different baselines, which allow to make a differential anti-neutrino flux measurement, where basically only relative normalisation errors remain. The requirements on the systematic errors put also strong constraints on the quality of all components and materials used for both detectors, most prominently on the stability and radiopurity of the scintillator, the photomultiplier tubes, the vessels containing the detector liquids and the shielding against ambient radioactivity. The readout electronics, trigger and data acquisition system have to operate reliably as an integrated and highly efficient whole over several years. The trigger is provided by the Level-1 Trigger and Timing System, which is the subject of this thesis. It has to provide a highly efficient trigger (at the 0.1% level) for neutrino-induced events as well as for several types of background events. Its decision is realized in hardware and based on energy depositions in the muon veto and the target region. The Level-1 Trigger and Timing System furthermore provides a common System Clock and an absolute timestamp for each event. The Level-1 Trigger and Timing System consists of two types of VME modules, several Trigger Boards and a Trigger Master Board, which have been custom-designed and developed in the electronics workshop of our institute for this experiment and purpose, starting in 2005. In this thesis all

Development of a level-1 trigger and timing system for the Double Chooz neutrino experiment

Energy Technology Data Exchange (ETDEWEB)

Reinhold, Bernd

2009-02-25

The measurement of the mixing angle {theta}{sub 13} is the goal of several running and planned experiments. The experiments are either accelerator based (super)beam experiments (e.g. MINOS, T2K, Nova) or reactor anti-neutrino disappearance experiments (e.g. Daya Bay, RENO or Double Chooz). In order to measure or constrain {theta}{sub 13} with the Double Chooz experiment the overall systematic errors have to be controlled at the one-percent or sub-percent level. The limitation of the systematic errors is achieved through various means and techniques. E.g. the experiment consists of two identical detectors at different baselines, which allow to make a differential anti-neutrino flux measurement, where basically only relative normalisation errors remain. The requirements on the systematic errors put also strong constraints on the quality of all components and materials used for both detectors, most prominently on the stability and radiopurity of the scintillator, the photomultiplier tubes, the vessels containing the detector liquids and the shielding against ambient radioactivity. The readout electronics, trigger and data acquisition system have to operate reliably as an integrated and highly efficient whole over several years. The trigger is provided by the Level-1 Trigger and Timing System, which is the subject of this thesis. It has to provide a highly efficient trigger (at the 0.1% level) for neutrino-induced events as well as for several types of background events. Its decision is realized in hardware and based on energy depositions in the muon veto and the target region. The Level-1 Trigger and Timing System furthermore provides a common System Clock and an absolute timestamp for each event. The Level-1 Trigger and Timing System consists of two types of VME modules, several Trigger Boards and a Trigger Master Board, which have been custom-designed and developed in the electronics workshop of our institute for this experiment and purpose, starting in 2005. In

Installation, commissioning and performance of the trigger system of the Double Chooz experiment and the analysis of hydrogen capture neutrino events

Energy Technology Data Exchange (ETDEWEB)

Lucht, Sebastian

2013-11-18

The Double Chooz experiment is a reactor antineutrino experiment located at Chooz, a small town in the Ardennes region in the north of France close to the Belgium border. The aim of the experiment is to measure the leptonic mixing angle θ{sub 13}. The antineutrino flux is measured by two identical detectors at different distances from the reactor cores used as neutrino source, in a so called ''disappearance'' experiment. Double Chooz is a precision experiment because previous experiments indicated a small value of θ{sub 13}. Therefore, the systematic uncertainties introduced by background events and detector related components have to be as small as possible. The detector and all electronic components have been designed accordingly. The first part of this thesis describes the trigger and timing system of the Double Chooz experiment. This system triggers the data acquisition of the detector. It continuously monitors the signals of the photomultiplier tubes (PMTs) of the detector. These signals are summed for groups of PMTs (group signal) and for all PMTs (sum signal). The group signals are the input signals to the trigger system. They are discriminated by one threshold resulting in a multiplicity condition on the number of active group signal discriminators. The sum signal is discriminated by four thresholds. The default trigger configuration for the Double Chooz experiment is based on a combination on the sum signal discriminators and the multiplicity condition. In addition, the trigger system provides a common clock signal for all data acquisition components and an online event classification to allow an online data reduction. The trigger system was installed and commissioned in 2011. In this thesis the commissioning of the trigger system and its performance is presented. Furthermore the development and tests of possible improvements for the trigger system are presented and discussed. The second part of this thesis introduces a complementary

Chasing theta-13 with the Double Chooz experiment

Energy Technology Data Exchange (ETDEWEB)

Lasserre, Thierry [CEA/DSM/IRFU/SPP, Gif-sur-Yvette (France)

2009-07-01

Neutrino oscillation physics is entering a precision measurement area. The smallness of the theta-13 neutrino mixing angle is still enigmatic and should be resolved. Double Chooz will use two identical detectors near the Chooz nuclear power station to search for a non vanishing theta-13, and hopefully open the way to experiments aspiring to discover CP violation in the leptonic sector.

The double chooz reactor neutrino experiment

Energy Technology Data Exchange (ETDEWEB)

Botella, I Gil [CIEMAT, Basic Research Department, Avenida Complutense, 22, 28040 Madrid (Spain)], E-mail: ines.gil@ciemat.es

2008-05-15

The Double Chooz reactor neutrino experiment will be the next detector to search for a non vanishing {theta}{sub 13} mixing angle with unprecedented sensitivity, which might open the way to unveiling CP violation in the leptonic sector. The measurement of this angle will be based in a precise comparison of the antineutrino spectrum at two identical detectors located at different distances from the Chooz nuclear reactor cores in France. Double Chooz is particularly attractive because of its capability to measure sin{sup 2} (2{theta}{sub 13}) to 3{sigma} if sin{sup 2}(2{theta}{sub 13}) > 0.05 or to exclude sin{sup 2}(2{theta}{sub 13}) down to 0.03 at 90% C.L. for {delta}m{sup 2} = 2.5 x 10{sup -3} eV{sup 2} in three years of data taking with both detectors. The construction of the far detector starts in 2008 and the first neutrino results are expected in 2009. The current status of the experiment, its physics potential and design and expected performance of the detector are reviewed.

Sterile neutrino search with the Double Chooz experiment

Energy Technology Data Exchange (ETDEWEB)

Hellwig, Denise; Bekman, Ilja; Kampmann, Philipp; Schoppmann, Stefan; Soiron, Michael; Stahl, Achim; Wiebusch, Christopher [III. Physikalisches Institut B, RWTH Aachen (Germany)

2016-07-01

The Double Chooz experiment is a reactor neutrino disappearance experiment located at the Chooz nuclear power plant, France. It measures the electron-antineutrino flux of the two nuclear reactors with two detectors of identical design. A far detector at a distance of about 1 km is operating since 2011; a near detector at a distance of about 400 m is operating since the end of 2014. The combination of the two detectors offers sensitivity to sterile neutrino mixing parameters. Sterile neutrinos are neutrino mass states not taking part in weak interactions, but may mix with known neutrino states. This induces additional mixing angles and mass differences. This talk describes the search for sterile neutrinos and the sensitivity of Double Chooz to the mixing angle θ{sub 14}.

Double Chooz: Results and Perspectives

Energy Technology Data Exchange (ETDEWEB)

Franke, A.J., E-mail: ajfranke@nevis.columbia.edu [Columbia University, New York, New York 10027 (United States)

2013-04-15

The Double Chooz experiment has been observing ν{sup ¯}{sub e} from two reactor cores at the Chooz nuclear power station in Ardennes, France, with a single 10.3 m{sup 3} fiducial volume Gd-doped liquid scintillator detector at a flux-weighted average baseline of ∼1050 m. This article reviews results achieved with a detector live time of 227.93 days and exposure of 33.71 GW-ton-years. A total of 8,249 candidate ν{sup ¯}{sub e} events have been observed, compared to an expected 8,937 events in the null-oscillation case: this deficit is interpreted as evidence for ν{sup ¯}{sub e} disappearance. A fit to the observed neutrino rate and spectral shape gives a best-fit value of sin{sup 2}(2θ{sub 13})=0.109±0.030(stat.)±0.025(syst.) at a mass-squared splitting of Δm{sub 31}{sup 2}=2.32×10{sup −3} eV{sup 2}. The null-oscillation hypothesis is excluded by the data at 99.8% CL (2.9σ). The Double Chooz Near Detector is under construction, and analysis efforts to measure neutrino directionality, test Lorentz violation, and measure backgrounds in situ are underway.

The U238 antineutrino spectrum in the Double Chooz experiment

Energy Technology Data Exchange (ETDEWEB)

Haag, Nils; Oberauer, Lothar; Potzel, Walter; Schreckenbach, Klaus [Technische Universitaet, Muenchen (Germany); Lachenmaier, Tobias [Eberhard Karls Universitaet, Tuebingen (Germany)

2011-07-01

The DoubleChooz experiment aims at the determination of the unknown neutrino mixing parameter {Theta}{sub 13}. Two liquid scintillator detectors will measure an electron antineutrino disappearance at the Chooz site in the French ardennes. In order to improve the sensitivity, the antineutrino spectrum emitted by the Chooz reactor cores has to be determined with high accuracy. This talk focusses on the U238 spectrum, which is the only contributing spectrum, that was not measured until now. The final U238 beta spectrum is presented, and its implementation into the analysis framework is shown.

Double Chooz and non Asian efforts towards {theta}{sub 13}

Energy Technology Data Exchange (ETDEWEB)

Lasserre, Thierry [CEA/Saclay and Laboratoire Astroparticle and Cosmologie Institut de Recherche des Lois Fondamentales de l' Univers Service de Physique des Particules 91191 Gif-s-Yvette (France)], E-mail: thierry.lasserre@cea.fr

2008-11-01

Neutrino oscillation physics is entering a precision measurement area. The smallness of the {theta}{sub 13} neutrino mixing angle is still enigmatic and should be resolved. Double Chooz will use two identical detectors near the Chooz nuclear power station to search for a non vanishing {theta}{sub 13}, and hopefully open the way to experiments aspiring to discover CP violation in the leptonic sector. The Angra project aims to prevail over the Double Chooz experiment if the third neutrino oscillation channel is not discovered in the forthcoming years.

The neutrino experiment Double Chooz and data analysis with the near detector

Energy Technology Data Exchange (ETDEWEB)

Franke, Michael Werner

2016-03-07

During the last years there has been a huge progress in the field of neutrino physics. Neutrino oscillations are well established and almost all parameters, except a possible CP-violating phase, are determined to high precision. One experiment providing a precise measurement of the neutrino mixing angle θ{sub 13} is the Double Chooz reactor antineutrino experiment. The reactor antineutrinos are detected via the inverse beta decay in two identical liquid scintillator based detectors. A few years ago, the value of θ{sub 13} was unknown and only an upper limit existed. Double Chooz was the first reactor antineutrino experiment presenting a result for a nonzero value of θ{sub 13}. The value for sin{sup 2}2θ{sub 13} from the latest Double Chooz publication is 0.090{sup +0.032}{sub -0.029}. As part of this thesis, an infrastructure for filling the Double Chooz near detector was established and 190 m{sup 3} of detector liquids were prepared successfully. The filling process was optimized to allow an efficient filling of the near detector. The total operation time was reduced to only 22 days. Compared to the far detector filling time of 2 months, this is a great improvement. The development of a completely new level measurement system was as well part of this thesis. Due to the excellent performance of the level measurement system, the hard restrictions for the safety of the Double Chooz detector were met during the entire filling process. Several power glitches and network failures did not harm the system and did not result in any loss of data. These irregularities and the simple maintenance and repair possibilities certify the success of the design concept for the new level measurement system. For this thesis, data from the Double Chooz near detector with a total live time of 110.4 days was used. The mass concentrations of uranium and thorium in the near detector were determined using BiPo coincidences. These events originate from the β-decay of {sup 214}Bi and {sup

Neutrino oscillations - the Double Chooz experiment

Energy Technology Data Exchange (ETDEWEB)

Lasserre, Th. [CEA Saclay, Dept. d' Astrophysique, de Physique des Particules de Physique Nucleaire et de l' Instrumentation Associee (DSM/DAPNIA/SPP/APC), 91- Gif sur Yvette (France)

2007-07-01

{theta}{sub 13} is the mixing angle that couples the field of the neutrino number 3 (the heaviest) to the electron field. The Double Chooz experiment will use 2 identical detectors, near the Chooz nuclear reactor cores to measure the last undetermined mixing angle {theta}{sub 13}. The basic principle of the multi-detector concept is the cancellation of the reactor-induced systematic errors. The first detector will be installed in the existing underground laboratory (1050 meters away from the plant station) that was used in the first Chooz experiment in the nineties. The second detector will be constructed from 2009 in a new neutrino laboratory, located down a 45 m well that will be excavated 300 m away from the reactors. An average visible neutrino rate of 55 (550) events per day is expected to be detected inside the far (near) detector, taking into account the various inefficiencies, if no oscillations. The near detector will perform a measurement of the anti-neutrino flux and its energy spectrum with an unprecedented accuracy and for a long period (3 years). These huge statistics will also be exploited to monitor changes in the relative amounts of U{sup 235} and Pu{sup 239} in the core, paving the way to use neutrino detection for safeguards applications. (A.C.)

Making PMT halftone prints

Energy Technology Data Exchange (ETDEWEB)

Corey, J.D.

1977-05-01

In the printing process for technical reports presently used at Bendix Kansas City Division, photographs are reproduced by pasting up PMT halftone prints on the artwork originals. These originals are used to make positive-working plastic plates for offset lithography. Instructions for making good-quality halftone prints using Eastman Kodak's PMT materials and processes are given in this report. 14 figures.

Results from the Double Chooz experiment

Directory of Open Access Journals (Sweden)

Kaneda Michiru

2016-01-01

Full Text Available Recent results from the Double Chooz experiment on the neutrino mixing angle θ13 are presented. Two detectors are located at distances of 400m and 1050m from the reactor cores of the Chooz nuclear power plant, to measure the original neutrino flux from the reactor cores and the disappearance of neutrinos, respectively. The Far Detector has taken data since 2011 while the Near Detector started the data taking in 2014. The latest far detector only result with gadolinium capture events is sin2 2θ13=0.090+0.032.-0.029. Studies using hydrogen capture events also have been improved and the combined result of gadolinium and hydrogen capture events is obtained as sin2 2θ13 = 0.088 ± 0.033.

Correlated background and impact on the measurement of θ13 with the Double Chooz detector

International Nuclear Information System (INIS)

Remoto, Alberto

2012-01-01

The Double Chooz experiment uses antineutrinos emitted from the Chooz nuclear power plant (France) to measure the oscillation mixing parameter θ 13 . By using two detectors at different baselines, a precise measurement of antineutrinos disappearance is anticipated. The Far detector has been taking physics data since April 2011, while the Near detector is under construction. Data from April 13, 2011 to March 30, 2012 taken with the Far detector only have been analyzed and an indication for antineutrino disappearance, consistent with the current neutrino oscillation hypothesis, has been found. The best fit value for the neutrino mixing parameter sin 2 (2θ 13 ) is 0.109 ± 0.030(stat.) ± 0.025(syst.). This thesis present an accurate description of the Double Chooz experiment, with particular emphasis on the Far detector and its acquisition system. The main focus of the thesis is the accurate study of the correlated background affecting the Double Chooz antineutrinos sample and its impact on the measurement of the mixing parameter θ 13 . A general overview of the current experimental scenario which aim to the characterization of the neutrino oscillation is also provided, focusing on the recent results obtained in this field. (author) [fr

CHOOZ-A expert assessment program

International Nuclear Information System (INIS)

Bouat, M.; Godin, R.

1993-01-01

CHOOZ-A Nuclear Power Plant, the first French-Belgian PWR unit (300 MWe) was definitively shut down at the end of October 1991, after 24 years in operation. Since summer 1991, the steering committee of the French (EDF) Lifetime Project has initiated a large inquiry to the different technical specialists of EDF and external organizations, trying to define a wide expert assessment program on this plant. The aim is to improve the knowledge of aging mechanisms such as those observed on the 52 PWR French nuclear power plants (900 and 1,300 MWe), and contribute to the validation of non-destructive in-service testing methods. This paper presents the retained CHOOZ-A expert assessment program and technical lines followed during its set up. First major project stages are described, then technical choices are explained, and at last the final program is presented with the specific content of each expert assessment. The definitive program is scheduled for a three year period starting at the moment of final shutdown license acquisition, with a provisional total budget of more than US $10 million

Chooz B1 start-up marked by total computer control

International Nuclear Information System (INIS)

Anon.

1995-01-01

The start-up of Chooz B1, the first of EdF's latest generation 1450 MWe N4 reactors, marks the first use in a nuclear power plant of a fully computerised control room. Working in partnership with EdF, Sema Group designed and supplied the advanced command and control system for this plant. (Author)

A novel PMT test system based on waveform sampling

Science.gov (United States)

Yin, S.; Ma, L.; Ning, Z.; Qian, S.; Wang, Y.; Jiang, X.; Wang, Z.; Yu, B.; Gao, F.; Zhu, Y.; Wang, Z.

2018-01-01

Comparing with the traditional test system based on a QDC and TDC and scaler, a test system based on waveform sampling is constructed for signal sampling of the 8"R5912 and the 20"R12860 Hamamatsu PMT in different energy states from single to multiple photoelectrons. In order to achieve high throughput and to reduce the dead time in data processing, the data acquisition software based on LabVIEW is developed and runs with a parallel mechanism. The analysis algorithm is realized in LabVIEW and the spectra of charge, amplitude, signal width and rising time are analyzed offline. The results from Charge-to-Digital Converter, Time-to-Digital Converter and waveform sampling are discussed in detailed comparison.

The double chooz experiment: simulation of reactor antineutrino spectra

International Nuclear Information System (INIS)

Mueller, T.

2010-01-01

The Double Chooz experiment aims to study the oscillations of electron antineutrinos produced by the Chooz nuclear power station, located in France, in the Ardennes region. It will lead to an unprecedented accuracy on the value of the mixing angle θ 13 . Improving the current knowledge on this parameter, given by the Chooz experiment, requires a reduction of both statistical and systematic errors, that is to say not only observing a large data sample, but also controlling the experimental uncertainties involved in the production and detection of electron antineutrinos. The use of two identical detectors will cancel most of the experimental systematic uncertainties limiting the sensitivity to the value of the mixing angle. We present in this thesis, simulations of reactor antineutrino spectra that were carried out in order to control the sources of systematic uncertainty related to the production of these particles by the plant. We also discuss our work on controlling the normalization error of the experiment through the precise determination of the number of target protons by a weighing measurement and through the study of the fiducial volume of the detectors which requires an accurate modeling of neutron physics. After three years of data taking with two detectors, Double Chooz will be able to disentangle an oscillation signal for sin 2 2θ 13 ≥ 0.05 (at 3σ) or, if no oscillations are observed, to put a limit of sin 2 2θ 13 ≤ 0.03 at 90% C.L. (author) [fr

PMT Dark Noise Monitoring System for Neutrino Detector Borexino Based on the Devicenet Protocol and WEB-Access

International Nuclear Information System (INIS)

Chepurnov, A.S.; Orekhov, D.I.; Maimistov, D.A.; Sabelnikov, A.A.; Etenko, A.V.

2006-01-01

Monitoring of PMT dark noise in a neutrino detector BOREXINO is a procedure that indicates condition of the detector. Based on CAN industrial network, top level DeviceNet protocol and WEB visualization, the dark noise monitoring system having 256 channels for the internal detector and for the external muon veto was created. The system is composed as a set of controllers, converting the PMT signals to frequency and transmitting them over Can network. The software is the stack of the DeviceNet protocols, providing the data collecting and transporting. Server-side scripts build web pages of user interface and graphical visualization of data

Chooz A, First Pressurized Water Reactor to be Dismantled in France - 13445

Energy Technology Data Exchange (ETDEWEB)

Boucau, Joseph [Westinghouse Electric Company, 43 rue de l' Industrie, Nivelles (Belgium); Mirabella, C. [Westinghouse Electric France, Orsay (France); Nilsson, Lennart [Westinghouse Electric Sweden, Vaesteraas (Sweden); Kreitman, Paul J. [Westinghouse Electric Company, Lake Bluff, IL 60048 (United States); Obert, Estelle [EDF - DPI - CIDEN, Lyon (France)

2013-07-01

Nine commercial nuclear power plants have been permanently shut down in France to date, of which the Chooz A plant underwent an extensive decommissioning and dismantling program. Chooz Nuclear Power Station is located in the municipality of Chooz, Ardennes region, in the northeast part of France. Chooz B1 and B2 are 1,500 megawatt electric (MWe) pressurized water reactors (PWRs) currently in operation. Chooz A, a 305 MWe PWR implanted in two caves within a hill, began operations in 1967 and closed in 1991, and will now become the first PWR in France to be fully dismantled. EDF CIDEN (Engineering Center for Dismantling and Environment) has awarded Westinghouse a contract for the dismantling of its Chooz A reactor vessel (RV). The project began in January 2010. Westinghouse is leading the project in a consortium with Nuvia France. The project scope includes overall project management, conditioning of the reactor vessel (RV) head, RV and RV internals segmentation, reactor nozzle cutting for lifting the RV out of the pit and seal it afterwards, dismantling of the RV thermal insulation, ALARA (As Low As Reasonably Achievable) forecast to ensure acceptable doses for the personnel, complementary vacuum cleaner to catch the chips during the segmentation work, needs and facilities, waste characterization and packaging, civil work modifications, licensing documentation. The RV and RV internals will be segmented based on the mechanical cutting technology that Westinghouse applied successfully for more than 13 years. The segmentation activities cover the cutting and packaging plan, tooling design and qualification, personnel training and site implementation. Since Chooz A is located inside two caves, the project will involve waste transportation from the reactor cave through long galleries to the waste buffer area. The project will end after the entire dismantling work is completed, and the waste storage is outside the caves and ready to be shipped either to the ANDRA (French

Chooz A: a model for the dismantling of water-cooled reactors

International Nuclear Information System (INIS)

Anon.

2017-01-01

The specificity of Chooz-A, the first French pressurized water reactor (PWR), is that the reactor and its major components (pumps, exchangers and cooling circuits) are installed in 2 caves dug out in a hill slope. Chooz-A was operating from 1967 to 1991, in 1993 the fuel was removed and in 2007 EDF received the authorization to dismantle the reactor. In 2012, EDF completed the dismantling of the cave containing the elements of the cooling circuit, a cornerstone was the removing of the four 14 m high steam generators. The dismantling of the pressure vessel began in march 2017, it is the same tools and the same processes that were used for the dismantling of the pressure vessel of the Zorita plant (Spain) in 2016. The end of the Chooz-A dismantling is expected in 2022. The feedback experience will help to standardize practices for the French fleet of PWRs. (A.C.)

International Cooperation for the Dismantling of Chooz A Reactor Pressure Vessel

International Nuclear Information System (INIS)

Grenouillet, J.J.; Posivak, E.

2009-01-01

Chooz A is the first PWR that is being decommissioned in France. The main issue that is conditioning the success of the project is the Reactor Pressure Vessel (RPV) and Reactor Vessel Internals (RVI) segmentation. Whereas Chooz A is the first and unique RPV and RVI being dismantled in France, there are many similar experiences available in the world. Thus the project team was eager to cooperate with other teams facing or being faced with the same issue. A cooperation programme was established in two separate ways: - Benefiting from experience feedback from completed RPV and RVI dismantling projects, - Looking for synergy with future RPV dismantling projects for activities such as segmentation tools design, qualification and manufacturing for example. This paper describes the implementation of this programme and how the outcome of the cooperation was used for the implementation of Chooz-A RPV and RVI segmentation project. It shows also the limits of such a cooperation. (authors)

Latest results from the Double Chooz experiment

Energy Technology Data Exchange (ETDEWEB)

Goeger-Neff, Marianne [Physik Department E15, Technische Universitaet Muenchen (Germany); Collaboration: Double Chooz-Collaboration

2016-07-01

Double Chooz aims at a precise measurement of the neutrino mixing angle θ{sub 13} through the disappearance of reactor electron antineutrinos. The experiment relies on the measurement of neutrino flux and spectrum with two identical detectors at 400 m and 1000 m from the reactor cores of two nuclear power reactors. anti ν{sub e} are detected by inverse beta decay on free protons in 8.3 tons of Gd-loaded liquid scintillator, providing a unique delayed coincidence signature. Double Chooz has been running since 2011 with the far detector only, providing the first indication for non-zero θ{sub 13} with reactor antineutrinos. With a rate+shape analysis of 467.90 live days from 2011-2013 we obtain a value of sin {sup 2} 2 θ{sub 13}=0.090{sup +0.032}{sub -0.029}. Data taking with the near detector has started beginning of 2015, allowing a significant reduction of both reactor and detector related systematic uncertainties. The talk reviews the most recent results obtained with the far detector only and discuss first data from the near detector.

Double Chooz sensitivity and backgrounds studies to search for θ13 leptonic mixing angle

International Nuclear Information System (INIS)

Mention, G.

2005-06-01

The Double Chooz experiment will study the oscillations of electron antineutrinos produced by the Chooz nuclear power station to measure θ 13 mixing angle. The current knowledge on this parameter, provided ny the Chooz experiment, can be improved by reducing statistical and systematic errors. A large data sample will be collected to improve the former one. Two identical detectors will be built to cancel most of experimental systematic uncertainties involved in production and detection processes. Special care will be dedicated to backgrounds generated by natural radioactivity and cosmic ray interactions. In the hereby thesis, we describe our simulation studies to compute θ 13 sensitivity and assess the discovery potential of the experiment. We concentrated particularly on quantifying the detector related systematic errors that would limit the θ 13 sensitivity. Background related systematic errors such as the accidental events produced by the radioactivity of the photomultiplier tubes, correlated events from neutrons as well as a hypothetical background (mimicking the oscillation pattern) were taken into account. After 3 years, Double Chooz will be able to disentangle an oscillation signal for sin 2 (2*θ 13 ) > 0.05 (at 3*σ) or, if no oscillations were observed, to put a limit of sin 2 (2θ 13 ) < 0.03 at 90% C.L. (author)

Nuclear safety and radiation protection report of the Chooz nuclear facilities - 2010; Rapport sur la surete nucleaire et la radioprotection des installations nucleaires de Chooz - 2010

Energy Technology Data Exchange (ETDEWEB)

NONE

2011-06-15

This safety report was established under the article 21 of the French law no. 2006-686 of June 13, 2006 relative to nuclear safety and information transparency. It presents, first, the facilities of the Chooz nuclear power plant (Ardennes (FR)): 2 PWR reactors in operation (Chooz B, INB 139 and 144) and one partially dismantled PWR reactor (Chooz A, INB 163). Then, the nuclear safety and radiation protection measures taken regarding the facilities are reviewed: nuclear safety definition, radiation protection of intervening parties, safety and radiation protection improvement paths, crisis management, external and internal controls, technical situation of facilities, administrative procedures in progress. The incidents and accidents which occurred in 2010, are reported as well as the radioactive and non-radioactive (chemical, thermal) effluents discharge in the environment. Finally, The radioactive materials and wastes generated by the facilities are presented and sorted by type of waste, quantities and type of conditioning. Other environmental impacts (noise, microbial proliferation in cooling towers) are presented with their mitigation measures. Actions in favour of transparency and public information are presented as well. The document concludes with a glossary and a list of recommendations from the Committees for health, safety and working conditions. (J.S.)

Estimation of the systematic uncertainties of the measurement of the neutrino mixing angle θ{sub 13} related to the trigger system of the Double Chooz experiment

Energy Technology Data Exchange (ETDEWEB)

Stueken, David Anselm

2013-10-14

The Double Chooz experiment, located in the Ardennes region next to the CHOOZ-B nuclear power plant, is a reactor antineutrino experiment to measure neutrino oscillations. It has been designed as precision experiment to measure the neutrino mixing angel θ{sub 13} with highest possible accuracy due to its small value close to zero. The electron antineutrino flux emitted by the reactor cores is measured by two identical neutrino detectors located at different distances from the reactor cores. Each detector consist of a 10.3 m{sup 3} target volume filled with liquid scintillator and surrounded by 390 photomultiplier tubes. The far detector is located 1.05 km away from the reactor cores to be most sensitive to oscillation effects. The unoscillated neutrino flux is measured by the near detector located 400 m away from the reactor cores. In order to reduce background events and other sources resulting in systematic uncertainties, special requirements have been demanded for all detector components and electronic systems. In this context, a most efficiently operating data acquisition system is essential. The subsystem responsible to start data storage for events of interest is the so called ''trigger system''. The design concept of the Double Chooz trigger system introduces two redundancy concepts in order to trigger the data acquisition in the most robust and efficient way: The trigger decision is based on a combination of an energy threshold and the number of active photomultiplier tubes (multiplicity condition). Secondly, the system is divided into two identical but independently operating subsystems for most robust operations of the full system. Additionally, the two subsystem provide the possibility to measure the efficiency of the system. Apart from generating the trigger signal for the data acquisition, the system provides an online event classification in order to adjust the amount of stored data for each event type. After one and a half year

Nuclear safety and radiation protection report of the Chooz nuclear facilities - 2011

International Nuclear Information System (INIS)

2012-01-01

This safety report was established under the article 21 of the French law no. 2006-686 of June 13, 2006 relative to nuclear safety and information transparency. It presents, first, the facilities of the Chooz nuclear power plant (Ardennes (FR)): 2 PWR reactors in operation (Chooz B, INB 139 and 144) and one partially dismantled PWR reactor (Chooz A, INB 163). Then, the nuclear safety and radiation protection measures taken regarding the facilities are reviewed: nuclear safety definition, radiation protection of intervening parties, safety and radiation protection improvement paths, crisis management, external and internal controls, technical situation of facilities, administrative procedures in progress. The incidents and accidents which occurred in 2011, are reported as well as the radioactive and non-radioactive (chemical, thermal) effluents discharge in the environment. Finally, The radioactive materials and wastes generated by the facilities are presented and sorted by type of waste, quantities and type of conditioning. Other environmental impacts (noise, microbial proliferation in cooling towers) are presented with their mitigation measures. Actions in favour of transparency and public information are presented as well. The document concludes with a glossary followed by the viewpoint of the Committees for health, safety and working conditions. (J.S.)

Significance of delayed /sup 99m/Tc-PMT scintigraphy in diagnosis of hepatocellular carcinoma. Comparison between /sup 99m/Tc-PMT and /sup 67/Ga-citrate scintigraphy

Energy Technology Data Exchange (ETDEWEB)

Hasegawa, Yoshihisa; Nakano, Shunichi; Hashizume, Terumi and others

1985-03-01

The usefulness of delayed hepatobiliary imaging with /sup 99m/Tc-PMT in diagnosis of hepatocellular carcinoma was studied in 30 patients with histologically verified hepatocellular carcinoma. Of 30 patients, delayed /sup 99m/Tc-PMT images showed 13 patients (43 %) of increased radioactivity and 4 (13 %) of equilibrated radioactivity in carcinoma as compared with that in the surrounding normal liver tissues. Furthermore, 3 of 6 patients who showed no filling defects in /sup 99m/Tc-Sn colloid liver images, showed increased uptake of radioactivity in carcinoma in delayed /sup 99m/Tc-PMT images. These results suggest that the complementary use of delayed /sup 99m/Tc-PMT imaging to /sup 99m/Tc-Sn colloid liver imaging is useful for detecting hepatoma lesions. The hepatic lesions were positively visualized on /sup 99m/Tc-PMT and/or /sup 67/Ga-citrate images in 21 (70 %) of 30 patients. These results indicate that use of delayed /sup 99m/Tc-PMT and /sup 67/Ga-citrate imaging in combination is useful for positive visualization of hepatocellular carcinoma.

Synthetic Pulse Dilation - PMT Model for high bandwidth gamma measurements

Science.gov (United States)

Geppert-Kleinrath, H.; Herrmann, H. W.; Kim, Y. H.; Zylstra, A. B.; Meaney, K. D.; Lopez, F. E.; Khater, H.; Horsfield, C. J.; Gales, S.; Leatherland, A.; Hilsabeck, T.; Kilkenny, J. D.; Hares, J. D.; Dymoke-Bradshaw, T.; Milnes, J.

2017-10-01

The Cherenkov mechanism used in Gas Cherenkov Detectors (GCD) is exceptionally fast. However, the temporal resolution of GCDs, such as the Gamma Reaction History diagnostic (GRH), is limited by the current state-of-the-art photomultiplier tube (PMT) to 100 ps. The new pulse dilation - PMT (PD-PMT) for NIF allows for a temporal resolution comparable to that of the gas cell, or of 10ps. Enhanced resolution will contribute to the quest for ignition in a crucial way through precision measurement of reaction history and areal density (ρ R) history, leading to better constrained models. Features such as onset of alpha heating, shock reverberations and burn truncation due to dynamically evolving failure modes will become visible for the first time. PD-PMT will be deployed on GCD-3 at NIF in 2018. Our synthetic PD-PMT model evaluates the capabilities of these future measurements, as well as minimum yield requirements for measurements performed in a well at 3.9 m from target chamber center (TCC), and within a diagnostic inserter at 0.2m from TCC.

Nuclear safety and radiation protection report of the Chooz nuclear facilities - 2010

International Nuclear Information System (INIS)

2011-06-01

This safety report was established under the article 21 of the French law no. 2006-686 of June 13, 2006 relative to nuclear safety and information transparency. It presents, first, the facilities of the Chooz nuclear power plant (Ardennes (FR)): 2 PWR reactors in operation (Chooz B, INB 139 and 144) and one partially dismantled PWR reactor (Chooz A, INB 163). Then, the nuclear safety and radiation protection measures taken regarding the facilities are reviewed: nuclear safety definition, radiation protection of intervening parties, safety and radiation protection improvement paths, crisis management, external and internal controls, technical situation of facilities, administrative procedures in progress. The incidents and accidents which occurred in 2010, are reported as well as the radioactive and non-radioactive (chemical, thermal) effluents discharge in the environment. Finally, The radioactive materials and wastes generated by the facilities are presented and sorted by type of waste, quantities and type of conditioning. Other environmental impacts (noise, microbial proliferation in cooling towers) are presented with their mitigation measures. Actions in favour of transparency and public information are presented as well. The document concludes with a glossary and a list of recommendations from the Committees for health, safety and working conditions. (J.S.)

PMT response drift of ATLAS Tile Laser II calibration system: an introduction of a new method

CERN Document Server

Di Gregorio, Giulia

2016-01-01

In this article I describe the performance of the monitoring diodes of the Laser II system, a new system for run II used to calibrate the gain variation of PMTs in between two cesium scan. I also show a new method to measure the PMT drift response that it is compared to the method used up to now (Clermont-Ferrant) corrected with the Pisa method. The agreement between the two method is within 0.2%.

An application specific integrated circuit for multi-anode PMT

Energy Technology Data Exchange (ETDEWEB)

Gaglione, Renaud [Laboratoire de Physique Corpusculaire, 24 avenue des Landais, 63177 Aubiere (France)]. E-mail: gaglione@clermont.in2p3.fr; Bohner, Gerard [Laboratoire de Physique Corpusculaire, 24 avenue des Landais, 63177 Aubiere (France); Lecoq, Jacques [Laboratoire de Physique Corpusculaire, 24 avenue des Landais, 63177 Aubiere (France); Montarou, Gerard [Laboratoire de Physique Corpusculaire, 24 avenue des Landais, 63177 Aubiere (France); Royer, Laurent [Laboratoire de Physique Corpusculaire, 24 avenue des Landais, 63177 Aubiere (France)

2006-11-01

The main purpose of this development is to design an 'intelligent sensor', composed of one multi-anode PMT (Hamamatsu H8500), four custom front-end analog chips with embedded analog-to-digital converter and a pre-processing logical unit. The idea of this design is to improve as far as possible the treatment speed of signals of the PMT. This design must be compact to fit the PMT dimensions, in order to combine them together to form an assembly which will be used in medical imaging research, especially for gamma-ray camera at 141keV (Tc99m) with NaI(Tl) crystal.

Background-independent measurement of θ13 in Double Chooz

International Nuclear Information System (INIS)

Abe, Y.; Anjos, J.C. dos; Barriere, J.C.; Baussan, E.; Bekman, I.; Bergevin, M.; Bezerra, T.J.C.; Bezrukov, L.; Blucher, E.; Buck, C.; Busenitz, J.; Cabrera, A.; Caden, E.; Camilleri, L.; Carr, R.; Cerrada, M.; Chang, P.-J.; Chauveau, E.

2014-01-01

The oscillation results published by the Double Chooz Collaboration in 2011 and 2012 rely on background models substantiated by reactor-on data. In this analysis, we present a background-model-independent measurement of the mixing angle θ 13 by including 7.53 days of reactor-off data. A global fit of the observed antineutrino rates for different reactor power conditions is performed, yielding a measurement of both θ 13 and the total background rate. The results on the mixing angle are improved significantly by including the reactor-off data in the fit, as it provides a direct measurement of the total background rate. This reactor rate modulation analysis considers antineutrino candidates with neutron captures on both Gd and H, whose combination yields sin 2 (2θ 13 )=0.102±0.028(stat.)±0.033(syst.). The results presented in this study are fully consistent with the ones already published by Double Chooz, achieving a competitive precision. They provide, for the first time, a determination of θ 13 that does not depend on a background model

Evaluation of flat panel PMT for gamma ray imaging

International Nuclear Information System (INIS)

Pani, R.; Cinti, M.N.; Pellegrini, R.; Trotta, C.; Trotta, G.; Montani, L.; Ridolfi, S.; Garibaldi, F.; Scafe, R.; Belcari, N.; Del Guerra, A.

2003-01-01

The first position sensitive PMT, Hamamatsu R2486, developed in 1985, represented a strong technological advance for gamma-ray imaging. Hamamatsu H8500 Flat Panel PMT is the last generation position sensitive PMT: extremely compact with 2 in. active area. Its main features are: minimum peripheral dead zone (1 mm) and height of 12 mm. It was designed to be assembled in array to cover large detection area. It can represent a technical revolution for many applications in the field of gamma-ray imaging as for example nuclear medicine. This tube is based on metal channel dynode for charge multiplication and 8x8 anodes for charge collection and position calculation. In this paper we present a preliminary evaluation of the imaging performances addressed to nuclear medicine application. To this aim we have taken into account two different electronic readouts: resistive chain with Anger Camera principle and multianode readout. Flat panel PMT was coupled to CsI(Tl) and NaI(Tl) scintillation arrays. The results were also compared with the first generation PSPMT

Chooz-A Steam Generators Characterization

International Nuclear Information System (INIS)

Aitammar, Laurie

2016-01-01

EDF nuclear waste management requires a deep understanding of characterization, classification and waste sorting operations. In fact, French nuclear waste management defines several classes with specific management, treatment and storage facilities. Based on particular criteria, the more the radiological risk of the nuclear waste is important, the more its management will be complex and expensive. During the dismantling of the first French pressurized reactor Chooz-A, decontamination of the primary water circuits (not including the reactor vessel), the steam generators and the pressurizer have been carried out in order to reduce their activity levels. Thanks to these decontamination operations, and a specific characterization methodology, EDF was able to Re-classify the 4 steam generators and store them in one piece at the ANDRA Very Low Level Activity disposal facilities instead of the Low and Intermediate Level activity one. This re-classification allowed EDF to avoid important cutting and packaging processes. To characterize and declare Chooz-A SG activity, EDF-CIDEN used a methodology defined by the French institute of atomic energy, CEA. The method is based on external gamma spectrometry measurements performed with NaI collimated detectors, associated with MERCURAD simulations providing the transfer functions for the detectors and activity sources. Internal measurements are carried out with a CZT (CdZnTe) probe inside the SG tubes to refine the 3D model. In fact, the primary side represents the main source of activity, and understanding its contamination distribution is important to reduce the model and calculation uncertainties. Measurements eventually provided SG 60 Co global activity, from which the activities of other radionuclides of the spectrum were determined using scaling factors. The final activity declaration takes into account the standard deviation of the measurements in order to cover the uncertainties of the methodology. Thereby, the declaration

Background estimation of cosmic-ray induced neutrons in Chooz site water veto tank for possible future Ricochet Deployment

Science.gov (United States)

Silva, James

2017-09-01

The Ricochet experiment seeks to measure Coherent (neutral-current) Elastic Neutrino-Nucleus Scattering (CE νNS) using metallic superconducting and germanium semi-conducting detectors with sub-keV thresholds placed near a neutrino source such as the Chooz Nuclear Reactor Complex. In this poster, we present an estimate of the flux of cosmic-ray induced neutrons, which represent an important background in any (CE νNS) search, based on reconstructed cosmic ray data from the Chooz Site. We have simulated a possible Ricochet deployment at the Chooz site in GEANT4 focusing on the spallation neutrons generated when cosmic rays interact with the water tank veto that would surround our detector. We further simulate and discuss the effectiveness of various shielding configurations for optimizing the background levels for a future Ricochet deployment.

The O-methyltransferase PMT2 mediates methylation of pinosylvin in Scots pine.

Science.gov (United States)

Paasela, Tanja; Lim, Kean-Jin; Pietiäinen, Milla; Teeri, Teemu H

2017-06-01

Heartwood extractives are important determinants of the natural durability of pine heartwood. The most important phenolic compounds affecting durability are the stilbenes pinosylvin and its monomethylether, which in addition have important functions as phytoalexins in active defense. A substantial portion of the synthesized pinosylvin is 3-methoxylated but the O-methyltransferase responsible for this modification has not been correctly identified. We studied the expression of the stilbene pathway during heartwood development as well as in response to wounding of xylem and UV-C treatment of needles. We isolated and enzymatically characterized a novel O-methyltransferase, PMT2. The methylated product was verified as pinosylvin monomethylether using ultra performance liquid chromatography-tandem mass spectrometry and high performance liquid chromatography analyses. The PMT2 enzyme was highly specific for stilbenes as substrate, in contrast to caffeoyl-CoA O-methyltransferase (CCoAOMT) and PMT1 that were multifunctional. Expression profile and multifunctional activity of CCoAOMT suggest that it might have additional roles outside lignin biosynthesis. PMT1 is not involved in the stilbene pathway and its biological function remains an open question. We isolated a new specific O-methyltransferase responsible for 3-methoxylation of pinosylvin. Expression of PMT2 closely follows stilbene biosynthesis during developmental and stress induction. We propose that PMT2 is responsible for pinosylvin methylation in Scots pine (Pinus sylvestris), instead of the previously characterized methyltransferase, PMT1. © 2017 The Authors. New Phytologist © 2017 New Phytologist Trust.

Re-examining reactor vessel embrittlement at Chooz A

International Nuclear Information System (INIS)

Guilleret, J.-C.

1988-01-01

The Chooz A PWR experienced an extended shutdown in 1987/88 following indications that the reactor vessel was embrittling more rapidly than expected. Discrepancies between the expected rate and estimates of the actual rate were not easily explained. The huge body of work done since then to establish safety margins and support restart of the plant should provide a model for the owners of other older PWRs grappling with the embrittlement issue. (author)

R&D of a pioneering system for a high resolution photodetector: The VSiPMT

Science.gov (United States)

Barbato, F. C. T.; Barbarino, G.; Campajola, L.; Di Capua, F.; Mollo, C. M.; Valentini, A.; Vivolo, D.

2017-12-01

The VSiPMT (Vacuum Silicon PhotoMultiplier Tube) is an innovative design for a hybrid photodetector. The idea, born with the purpose to use a SiPM for large detection volumes, consists in replacing the classical dynode chain with a special SiPM. In this configuration, we match the large sensitive area of a photocathode with the performances of the SiPM technology, which therefore acts like an electron detector and so like a current amplifier. The excellent photon counting capability, fast response, low power consumption and the stability are among the most attractive features of the VSiPMT.We now present the progress on the realization of a 1-in. prototype and the preliminary tests we are performing on it.

Measurement of the neutrino mixing angle θ13 with the Double Chooz experiment

Science.gov (United States)

Ostrovskiy, Igor

2009-10-01

The neutrino mixing angle θ13 is last one which value is still unknown. Measuring the θ13 is important for completing our understanding of three flavor neutrino oscillations. Moreover, leptonic CP violation could only be measured in case the value of θ13 is not zero. The current best limit (^2(2θ13)Ardennes. Described in this talk, is another experiment, Double Chooz, that is being prepared at the same site. The Double Chooz experiment offers several fundamental improvements and is aiming to surpass the current limit by an order of magnitude (^2(2θ13) < 0.03). Details of the detector design, overview of systematic errors and expected sensitivity, as well as current status of the experiment are presented.

Investigation about decoupling capacitors of PMT voltage divider effects on neutron-gamma discrimination

International Nuclear Information System (INIS)

Divani, Nazila; Firoozabadi, Mohammad M.; Bayat, Esmail

2014-01-01

Scintillators are almost used in any nuclear laboratory. These detectors combine of scintillation materials, PMT and a voltage divider. Voltage dividers are different in resistive ladder design. But the effect of decoupling capacitors and damping resistors haven’t discussed yet. In this paper at first a good equilibrium circuit designed for PMT, and it was used for investigating about capacitors and resistors in much manner. Results show that decoupling capacitors have great effect on PMT output pulses. In this research, it was tried to investigate the effect of Capacitor’s value and places on PMT voltage divider in Neutron-Gamma discrimination capability. Therefore, the voltage divider circuit for R329-02 Hamamatsu PMT was made and Zero Cross method used for neutron-gamma discrimination. The neutron source was a 20Ci Am-Be. Anode and Dynode pulses and discrimination spectrum were saved. The results showed that the pulse height and discrimination quality change with the value and setting of capacitors

Optimization design of a 20-in. elliptical MCP-PMT

International Nuclear Information System (INIS)

Chen, Ping; Tian, Jinshou; Wei, Yonglin; Liu, Hulin; Sai, Xiaofeng; He, Jianping; Chen, Lin; Wang, Xing; Lu, Yu

2017-01-01

This paper describes the simulation work for optimizing the newly developed 20-in. elliptical MCP-PMT by enlarging the outside diameters of the two focusing electrodes and the open area of the glass bulb. Effects of biasing voltages applied to the two focusing electrodes and the MCP input facet are studied. With the new design of the 20 in. MCP-PMT, the transit time spread of the prototype can be less than 3 ns and the collection efficiency is as much as the present prototype.

Development of 10×10 Matrix-anode MCP-PMT

Science.gov (United States)

Yang, Jie; Li, Yongbin; Xu, Pengxiao; Zhao, Wenjin

2018-02-01

10×10 matrix-anode is developed by high-temperature co-fired ceramics (HTCC) technology. Based on the new matrix-anode, a new kind of photon counting imaging detector - 10×10 matrix-anode MCP-PMT is developed, and its performance parameters are tested. HTCC technology is suitable for the MCP-PMT's air impermeability and its baking process. Its response uniformity is better than the metal-ceramic or metal-glass sealing anode, and it is also a promising method to realize a higher density matrix-anode.

Magnetic shield of PMT used in DAMPE electromagnetic calorimeter

CERN Document Server

Wang, Peilong; Wang, Xiaolian; Xu, Zizong

2014-01-01

The magnetic characteristics of photomultiplier tube R5610A-01 are studied in this paper. The experimental data shows that the gain of R5610A-01 loses about 53% when the magnetic field is 3G along its +X axis. A cylinder of one-layer permalloy strip is able to reduce the effect of 3G magnetic field on the PMT's gain to less than 1%. A cylinder of two-layer permalloy is finally used to shield the PMT from the outside field.

PMT signal increase using a wavelength shifting paint

Energy Technology Data Exchange (ETDEWEB)

Allada, K. [Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Hurlbut, Ch. [Eljen Technology, Sweetwater, TX 79556 (United States); Ou, L.; Schmookler, B. [Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Shahinyan, A. [Yerevan Physics Institute, Yerevan (Armenia); Wojtsekhowski, B., E-mail: bogdanw@jlab.org [Thomas Jefferson National Accelerator Facility, Newport News, VA 23606 (United States)

2015-05-11

We report a 1.65 times increase of the PMT signal and a simple procedure of application of a new wavelength shifting (WLS) paint for PMTs with non-UV-transparent windows. Samples of four different WLS paints, made from hydrocarbon polymers and organic fluors, were tested on a 5-in. PMT (ET 9390KB) using Cherenkov radiation produced in fused silica disks by {sup 106}Ru electrons on a ‘table-top’ setup. The best performing paint was employed on two different types of 5-in. PMTs (ET 9390KB and XP4572B), installed in atmospheric pressure CO{sub 2} gas Cherenkov detectors, and tested using GeV electrons.

Optical Module Front-End for a Neutrino Underwater Telescope PMT interface

CERN Document Server

Lo Presti, D; Caponetto, L

2007-01-01

A proposal for a new system to capture signals in the Optical Module (OM) of an Underwater Neutrino Telescope is described. It concentrates on the problem of power consumption in relation to precision. In particular, a solution for the interface between the photomultiplier (PMT) and the front-end electronics is presented.

Measurement of the leptonic mixing parameter θ13 at the reactor antineutrino experiment Double Chooz

International Nuclear Information System (INIS)

Durand, V.

2014-01-01

The Double Chooz experiment aims at measuring the neutrino mixing parameter θ 13 by studying the oscillations of ν-bar e produced by the Chooz nuclear reactors located in France. The experimental concept consists in comparing the signal of 2 identical 10.3 m 3 detectors, allowing the cancellation of most of the experimental systematic uncertainties. The near detector, whose goal is the flux normalization and a measurement without oscillation, is expected to be delivered in 2013. The farthest detector from the source is taking data since april 2011 and is sensitive to θ 13 , which is expected to affect both the rate and the shape of measured ν-bar e . In 102 days with far detector only, 4121 ν-bar e candidates have been observed, while the expectation in case of no-oscillation is 4344 ± 165 events. This deficit is interpreted as evidence for ν-bar e disappearance. From a rate and shape analysis, it is found that sin 2 (θ 13 ) = [0.086±0.041(stat.)±0.030(syst)] with Δm 31 2 =2.4*10 -3 eV 2 , while the no-oscillation hypothesis is even excluded at 94.6%. We present in this document the concept and detection method of the Double Chooz experiment, along with its analysis strategy and first results on θ 13 . (author)

Auranofin Inhibits the Enzyme Activity of Pasteurella multocida Toxin PMT in Human Cells and Protects Cells from Intoxication

Directory of Open Access Journals (Sweden)

Stefan Carle

2017-01-01

Full Text Available The AB-type protein toxin from Pasteurella multocida (PMT contains a functionally important disulfide bond within its catalytic domain, which must be cleaved in the host cell cytosol to render the catalytic domain of PMT into its active conformation. Here, we found that the reductive potential of the cytosol of target cells, and more specifically, the activity of the thioredoxin reductase (TrxR is crucial for this process. This was demonstrated by the strong inhibitory effect of the pharmacological TrxR inhibitor auranofin, which inhibited the intoxication of target cells with PMT, as determined by analyzing the PMT-catalyzed deamidation of GTP-binding proteins (G-proteins in the cytosol of cells. The amount of endogenous substrate levels modified by PMT in cells pretreated with auranofin was reduced compared to cells treated with PMT alone. Auranofin had no inhibitory effect on the activity of the catalytic domain of constitutively active PMT in vitro, demonstrating that auranofin did not directly inhibit PMT activity, but interferes with the mode of action of PMT in cells. In conclusion, the results show that TrxR is crucial for the mode of action of PMT in mammalian cells, and that the drug auranofin can serve as an efficient inhibitor, which might be a starting point for novel therapeutic options against toxin-associated diseases.

Characterization, modelization and optimization of the Double Chooz acrylic vessels: physics impact

International Nuclear Information System (INIS)

Queval, R.

2010-01-01

Double Chooz is one of the new generation experiments designed to measure the last unknown leptonic mixing angle, θ 13 . Il studies the oscillations of electronic antineutrinos produced by the Chooz nuclear power plant. Our knowledge on θ 13 can be improved by reducing both statistical errors (increasing both the detector size and run time) and systematic errors (using identical near and far detectors). Also, special care is dedicated to analyze backgrounds generated by natural radioactivity and cosmic ray interactions. The work presented here mostly focuses on Target and Gamma Catcher acrylic vessels, in the core of the detector. A new material designed for the experiment was developed since no pre-existing material met the required conditions. This material was characterized optically, to maximize light transmission and reduce the induced dead zone. With this in mind, a physics study of the Target vessel design was performed to identify any spectral distortion or count rate modification it could induce. As far as backgrounds are concerned, the material is radio-pure enough so that the singles rate coming from acrylic is negligible compared to the one from the photomultiplier tubes. An unknown single source is coming from the external contamination in the detector, such as dust. This is why we defined cleanliness goals for the detector fabrication and integration. These goals were met, thanks to well-defined protocols and careful team work. After three years of data taking, Double Chooz could disentangle an oscillation signal at 3α for sin 2 2θ 13 ≥ 0.05 - 0.06. If no oscillations were observed, the experiment could give an upper limit on sin 2 2θ 13 of 0.02 - 0.03 at 90 % C.L. (author) [fr

Measurement of the mixing leptonic parameter θ13 at the Double Chooz reactor antineutrino experiment

International Nuclear Information System (INIS)

Durand, V.

2012-01-01

The Double Chooz experiment aims at measuring the neutrino mixing parameter θ13 by studying the oscillations of de ν-bar e produced by the Chooz nuclear reactors located in France. The experimental concept consists in comparing the signal of two identical 10.3 m 3 detectors, allowing to cancel most of the experimental systematic uncertainties. The near detector, whose goal is the flux normalization and a measurement without oscillation, is expected to be delivered in 2013. The farthest detector from the source is taking data since April 2011 and is sensitive to θ 13 , which is expected to affect both the rate and the shape of the measured de ν-bar e . In this thesis, are first presented the Double Chooz experiment, with its ν-bar e source, its detection method, and the expected signal and backgrounds. In order to perform a selection, important quantities have to be reconstructed, calibrated, and saved in data files. The channel time offsets determination, the energy and vertex reconstruction algorithm CocoReco, the reconstruction packages of the Common Trunk, and the light trees maker Cheetah are especially presented. Concerning the data analysis, all the selection cuts and results for signal and backgrounds are discussed, particularly the multiplicity cut, the multiple off time window method, the lithium veto cut, and the cosmogenic 9 Li background studies. The Double Chooz experiment observed 8,249 de ν-bar e candidates in 227.93 days in its far detector only. The reactor antineutrino flux prediction used the Bugey 4 flux measurement after correction for differences in core composition. The expectation in case of no-oscillation is 8,937 events and this deficit is interpreted as evidence for ν-bar e disappearance. From a rate and shape analysis, is found sin 2 2θ = 0,109± 0,030 (stat) ± 0,025 (syst), with Δm 2 31 = 2,32 x 10 -3 eV 2 , while the no-oscillation hypothesis is even excluded at 2.9 σ. (author) [fr

A simple method to increase effective PMT gain by amplifier circuit powered from voltage divider

International Nuclear Information System (INIS)

Popov, V.; Majewski, S.; Wojtsekhowski, B.; Guerin, D

2001-01-01

A novel concept is introduced of additional effective signal amplification by employing a dedicated circuit to process anode or dynode signals prior to sending them through a standard 50 /spl Omega/ line/cable. The circuit is entirely powered by the current flowing through the base voltage divider. Additional gain factors of 2-10 were easily achieved with preserved operation speed and rate capability up to several MHz. This additional signal boost can be used in many applications where higher gain and/or lower PMT operational voltages are desirable. For example, in the case of a PMT employed in a low input light signal (such as a Cherenkov counter), this technique will permit operation at a lower voltage and, therefore, will result in better operational PMT stability and longer PMT lifetime. At present, two experimental set-ups at Jefferson Lab are using PMT bases using this concept

Chooz nuclear facilities. 2009 annual report

International Nuclear Information System (INIS)

2010-01-01

This annual report is established on account of article 21 of the 2006-686 French law from June 13, 2006, relative to the transparency and safety in the nuclear domain. It describes, first, the nuclear facilities of Chooz, and then the measures taken to ensure their safety (personnel radioprotection, actions implemented for nuclear safety improvement, organisation in crisis situation, external and internal controls, technical assessment of the facilities, administrative procedures carried out in 2009), incidents and accidents registered in 2009, radioactive and chemical effluents released by the facilities in the environment, other pollutions, management of radioactive wastes, and, finally, the actions carried out in the domain of transparency and public information. A glossary and the viewpoint of the Committee of Hygiene, safety and working conditions about the content of the document conclude the report. (J.S.)

Measuring the θ13 mixing angle with the two Double Chooz detectors

International Nuclear Information System (INIS)

Sibille, Valerian

2016-01-01

The Double Chooz experiment aims at accurately measuring the value of the θ 13 leptonic mixing angle. To this intent, the experiment makes the most of two identical detectors - filled with gadolinium-loaded liquid scintillator - observing ν e -bar's released by the two 4.25 GWth nuclear reactors of the French Chooz power plant. The so-called 'far detector' - located at an average distance of 1050 m from the two nuclear cores - has been taking data since April 2011. The 'near detector' - at an average distance of 400 m from the cores - has monitored the reactor since December 2014. The θ 13 mixing parameter leads to an energy dependent disappearance of ν e -bar's as they propagate from the nuclear cores to the detection sites, which allows for a fit of the sin 2 2θ 13 value. By reason of correlations between the detectors and an iso-flux layout, the detection systematics and the ν e -bar flux uncertainty impairing the θ 13 measurement are dramatically suppressed. In consequence, the precision of the θ 13 measurement is dominated by the uncertainty on the backgrounds and the relative normalisation of the ν e -bar-rates. The main background originates from the decay of β n -emitters - generated by μ-spallation - within the detector itself. The energy spectra of these cosmogenic isotopes have been simulated and complemented by a diligent error treatment. These predictions have been successfully compared to the corresponding data spectra, extracted by means of an active veto, whose performance has been studied at both sites. The rate of cosmogenic background remaining within the ν e -bar candidates has also been assessed. Additionally, the normalisation of the ν e -bar rates, bound to the number of target protons within each detector, has been evaluated. All this work was part of the first Double Chooz multi-detector results, yielding sin 2 2θ 13 =0.111 ± 0.018. (author) [fr

The chooz a expert survey program and its main conclusions for plant life management

International Nuclear Information System (INIS)

Barthelet, B.; Heuze, A.; Hennart, J.C.; Havard, P.

2001-01-01

Because of the importance of PWR components life management represents for Electricity Companies, significant R and D programs are dedicated to identifying and analysing mechanisms and damage rates of the different degradation modes of these components, systems and structures. To assess R and D assumptions and to validate non destructive test results through reviews, expert survey programs on in-situ equipment may enhance the knowledge about most of the various phenomena involved. In this regard, an extensive program was launched after the Chooz A NPP was decommissioned in 1991, after 24 years in operation. This program gathered EDF, IPSN, FRAMATOME, ELECTRABEL and TRACTEBEL into partnership. The expert survey program was performed in various laboratories between 1995 and 1999 and includes: - on-site non destructive testing before sampling, - and metallurgical and mechanical tests performed on samples taken from the nuclear and non nuclear part of the unit. The expert survey program performed by Utilities in various laboratories involved the following equipment: - reactor vessel and internal equipment, - reactor coolant system (dissimilar metal welds, SS welds, cast austenitic ferritic steels), - feedwater plant piping (erosion-corrosion), - electric cables susceptible of temperature and irradiation induced ageing, - anchoring in civil engineering structures, - main primary circuit concerning activation measurement. In conclusion, the extensive Chooz A expert survey program yields numerous significant results. The main outcomes will contribute to validate non destructive tests and enhance our knowledge of some degradation mechanisms of often quite similar components present in units in operation. It is worthy to note that this program is of prime importance for operation feedback; the cost of the whole study amounts to approximately 10 Million Euros. (author)

Realization of the low background neutrino detector Double Chooz. From the development of a high-purity liquid and gas handling concept to first neutrino data

Energy Technology Data Exchange (ETDEWEB)

Pfahler, Patrick

2012-12-17

produced and, together with all other ingredients of muon veto and buffer, delivered to the experiment, where they were mixed and tuned in due consideration of the individual requirements of the different liquids. For the filling and handling of the DC-far detector, the underground laboratory was equipped with a comprehensive liquid-handling, gas-handling and monitoring-system, which provides all necessary functions to flush, fill, operate and empty the detector safely. Using these systems, the DC-far detector was flushed and filled in accordance with an especially developed sequence, which considered critical filling points and avoided unnecessary stress on the different detector vessels. By the means of this, the far detector of Double Chooz could be filled without damaging the detector vessels. In addition, it could be demonstrated that the quality and cleanliness of the detector liquids were maintained during filling. As a result of this, Double Chooz was able to acquire first neutrino data and to publish its first result of {Theta}{sub 13} with sin{sup 2}(2{Theta}{sub 13})=0.109 {+-} 0.030(stat.) {+-} 0.025(syst.).

Realization of the low background neutrino detector Double Chooz. From the development of a high-purity liquid and gas handling concept to first neutrino data

International Nuclear Information System (INIS)

Pfahler, Patrick

2012-01-01

, together with all other ingredients of muon veto and buffer, delivered to the experiment, where they were mixed and tuned in due consideration of the individual requirements of the different liquids. For the filling and handling of the DC-far detector, the underground laboratory was equipped with a comprehensive liquid-handling, gas-handling and monitoring-system, which provides all necessary functions to flush, fill, operate and empty the detector safely. Using these systems, the DC-far detector was flushed and filled in accordance with an especially developed sequence, which considered critical filling points and avoided unnecessary stress on the different detector vessels. By the means of this, the far detector of Double Chooz could be filled without damaging the detector vessels. In addition, it could be demonstrated that the quality and cleanliness of the detector liquids were maintained during filling. As a result of this, Double Chooz was able to acquire first neutrino data and to publish its first result of Θ 13 with sin 2 (2Θ 13 )=0.109 ± 0.030(stat.) ± 0.025(syst.).

Hepatobiliary scintigraphy and function test with sup(99m)Tc-N-pyridoxyl-5-methyltryptophan (sup(99m)Tc-PMT)

International Nuclear Information System (INIS)

Sugimura, Kazuro; Nishiyama, Shoji; Narabayashi, Isamu

1985-01-01

The authors studied the effectiveness of sup(99m)Tc-N-pyridoxyl-5-methyltryptophan (sup(99m)Tc-PMT) for dynamic imaging and function on 40 patients with various hepatobiliary diseases and on healthy individuals. In healthy subjects, sup(99m)Tc-PMT is rapidly removed from the blood by the parenchymal cells of the liver and is excreted through the biliary system. The imaging of the liver, bile ducts, gallbladder and intestines with sup(99m)Tc-PMT was satisfactory. There was no renal visualization. In the case of serial images of healthy individuals, the gallbladder, intrahepatic bile duct and small intestine were visualized after 18.8 +- 7.2, 8.8 +- 1.4, and 16.7 +- 6.3 min, respectively; the mean peak time on the hepatogram was 8.0 +- 5.3 min. The bile ducts of patients with liver disorders were visualized later than those of healthy individuals. Particularly in the case of severe liver parenchymal diseases, the appearance time for the bile duct was significantly delayed. However, the delays in appearance time did not correlate well with low scores on the liver function test. At 70 min after the intravenous administration of sup(99m)Tc-PMT, 2.5 +- 1.5 % of the injected dose was excreted into the urine of the healthy individuals. The urinary excretion of sup(99m)Tc-PMT by the patients with hepatobiliary diseases showed no increase, and it was not entirely related to the results of the serum function tests. However, a larger amount of sup(99m)Tc-PMT was retained in the blood of the patients with hepatobiliary diseases. The blood retention values at 20 min after injection into those with liver cirrhosis and hepatoma were significantly delayed. (author)

Equalisation of the PMT response to charge particles for the LUCID detector of the ATLAS experiment

CERN Document Server

Vittori, Camilla

2014-01-01

With a view to the Run II of LHC, 44 Hamamatsu R760 PMTs have been calibrated with a 207Bi source. The working point of each PMT has been xed in order to equalise the PMT gain at a value smaller than $10^{5}$. Studies on the reproducibility and the stability in time of such calibration permitted to reach a 5% accuracy on PMT gain. In addition, an evaluation of the relative gain of 10 modied PMTs has been performed.

In-service - pressure test of the primary circuit of the Chooz nuclear power plant

International Nuclear Information System (INIS)

Barthelemy, F.L.; Lespiaucq, P.G.

1977-01-01

A brief summary is given of the regulations governing inspection pratices of operating nuclear power plants, in France. As an example, such an inspection performed in 1976 on the Westinghouse 320 MWe PWR built in Chooz (Ardennes) is described. Emphasis is put on the administrative organization, the technical solutions, the specific problems and the difficulties encountered. (author)

Coherent neutrino scattering with low temperature bolometers at Chooz reactor complex

International Nuclear Information System (INIS)

Billard, J; Gascon, J; Jesus, M De; Carr, R; Formaggio, J A; Heine, S T; Johnston, J; Leder, A; Sibille, V; Winslow, L; Dawson, J; Lasserre, T; Figueroa-Feliciano, E; Palladino, K J; Vivier, M

2017-01-01

We present the potential sensitivity of a future recoil detector for a first detection of the process of coherent elastic neutrino nucleus scattering (CE ν NS). We use the Chooz reactor complex in France as our luminous source of reactor neutrinos. Leveraging the ability to cleanly separate the rate correlated with the reactor thermal power against (uncorrelated) backgrounds, we show that a 10 kg cryogenic bolometric array with 100 eV threshold should be able to extract a CE ν NS signal within one year of running. (paper)

Liquid scintillators and liquefied rare gases for particle detectors. Background-determination in Double Chooz and scintillation properties of liquid argon

International Nuclear Information System (INIS)

Hofmann, Martin Alexander

2012-01-01

Evidence for physics beyond the well-established standard model of particle physics is found in the sector of neutrino physics, in particular in neutrino oscillations, and in experimental hints requiring the presence of Dark Matter. Neutrino oscillations demand the neutrinos to be massive and at least four additional parameters, three mixing angles and one phase, are introduced. A non-vanishing value for the third mixing angle, θ 13 , has only recently been found, amongst others by the reactor antineutrino disappearance experiment Double Chooz. This experiment detects anti ν e 's by means of the Inverse Beta Decay (IBD), which has a clear signature that can very effectively be discriminated from most of the background. However, some background still survives the selection cuts applied to the data, partly induced by radioactivity. In order to determine the amount of radioimpurities in the detector, germanium spectroscopy measurements and neutron activation analyses have been carried out for various parts of the Double Chooz far detector. A dedicated Monte-Carlo simulation was performed to obtain the singles event rate induced by the identified radioimpurities in the fiducial volume of Double Chooz. In the present thesis, parts from the outer detector systems, as well as components of the inner detector liquids were measured. In sum, a singles rate of less than 0.35 Hz above the antineutrino detection threshold of 0.7 MeV has been found. This is by far below the design goal of Double Chooz of ∝ 20 Hz. The analysis of bismuth-polonium (BiPo) coincidences in the first Double Chooz data allows to directly determine the number of decays from the U- and the Th-decay chain in the active detector parts. Assuming radioactive equilibrium, concentrations of (1.71±0.08).10 -14 (g)/(g) for uranium and (8.16±0.49).10 -14 (g)/(g) for thorium have been found, which are also well below the design goal of Double Chooz (2.10 -13 (g)/(g)). Both gamma spectroscopy measurements and

Liquid scintillators and liquefied rare gases for particle detectors. Background-determination in Double Chooz and scintillation properties of liquid argon

Energy Technology Data Exchange (ETDEWEB)

Hofmann, Martin Alexander

2012-11-27

Evidence for physics beyond the well-established standard model of particle physics is found in the sector of neutrino physics, in particular in neutrino oscillations, and in experimental hints requiring the presence of Dark Matter. Neutrino oscillations demand the neutrinos to be massive and at least four additional parameters, three mixing angles and one phase, are introduced. A non-vanishing value for the third mixing angle, {theta}{sub 13}, has only recently been found, amongst others by the reactor antineutrino disappearance experiment Double Chooz. This experiment detects anti {nu}{sub e}'s by means of the Inverse Beta Decay (IBD), which has a clear signature that can very effectively be discriminated from most of the background. However, some background still survives the selection cuts applied to the data, partly induced by radioactivity. In order to determine the amount of radioimpurities in the detector, germanium spectroscopy measurements and neutron activation analyses have been carried out for various parts of the Double Chooz far detector. A dedicated Monte-Carlo simulation was performed to obtain the singles event rate induced by the identified radioimpurities in the fiducial volume of Double Chooz. In the present thesis, parts from the outer detector systems, as well as components of the inner detector liquids were measured. In sum, a singles rate of less than 0.35 Hz above the antineutrino detection threshold of 0.7 MeV has been found. This is by far below the design goal of Double Chooz of {proportional_to} 20 Hz. The analysis of bismuth-polonium (BiPo) coincidences in the first Double Chooz data allows to directly determine the number of decays from the U- and the Th-decay chain in the active detector parts. Assuming radioactive equilibrium, concentrations of (1.71{+-}0.08).10{sup -14}(g)/(g) for uranium and (8.16{+-}0.49).10{sup -14}(g)/(g) for thorium have been found, which are also well below the design goal of Double Chooz (2.10{sup -13

From the measurement of the θ13 mixing angle to the search for geo-neutrinos: studying νe-bare with Double Chooz and Borexino

International Nuclear Information System (INIS)

Roncin, Romain

2014-01-01

Double Chooz is a reactor neutrino oscillation experiment which aims at measuring the θ 13 mixing angle thanks to two identical detectors located at different distances from the two reactors of the Chooz nuclear power plant, in the French Ardennes. While the near detector will start taking data in fall 2014 to normalize the flux of the neutrinos emitted by the nuclear reactors, the far detector is running since April 2011 and allows to observe the neutrinos disappearance through the neutrino oscillation phenomenon. This thesis is also dedicated to the Borexino experiment which was designed to observe solar neutrinos. Due to its low background level as well as its position in a nuclear free country, Italy, Borexino is also sensitive to geo-neutrinos. This thesis presents both the Double Chooz and Borexino experiments, from the description of the detectors to the main results, with a special attention to the background and its rejection. Studies on the neutrino directionality with these two experiments are also detailed. In the case of Double Chooz, since the neutrinos are coming from the two nuclear reactors, the precision of the analysis method can be assessed. This thesis presents also for the first time the possibility to retrieve the initial direction of the neutrinos when the neutrons created in the inverse beta decay reactions are captured on hydrogen. In the case of Borexino, neutrino directionality information could facilitate the discrimination between geo-neutrinos and neutrinos from nuclear reactors. (author) [fr

Evaluation of RI images of hepatic blood flow using Tc-99m PMT

Energy Technology Data Exchange (ETDEWEB)

Fujiwara, Hiromichi; Iwasaki, Naoya; Ichikawa, Kesato

1988-03-01

To evaluate the clinical significance of RI images of hepatic blood flow using Tc-99m-PMT, analysis of the RI images and estimation of hepatic blood flow were carried out in patients with various liver diseases (37 cases). After intravenous injection of Tc-99m-PMT, hepatic accumulation curve of ROI positioned at whole liver area and time activity curve of ROI positioned at celiac artery were obtained through scintillation camera images with the computer-analysed system. Hepatic blood flow coefficient (K) was calculated from the hepatic accumulation curve. Based on the differential curve calculated from the time activity curve, chronological images of arterial, portal, parenchymal and saturated parenchymal phases were obtained. Results ; 1) K was 0.50 + 0.04, 0.35 + 0.02 and 0.26 + 0.04/min in normal type, CH type and LC type respectively. These coefficients well correlated with clinical severity of hepatic diseases. 2) Perfusional phase images of the liver became poorer in accordance with progression of liver disease, while images of spleen, portal venous system and collateral channels were more clearly obtained in liver cirrhosis. This method was shown to have a potential to understanding of severity of liver disease and hepatic blood flow dynamics.

SCOTT: A time and amplitude digitizer ASIC for PMT signal processing

Science.gov (United States)

Ferry, S.; Guilloux, F.; Anvar, S.; Chateau, F.; Delagnes, E.; Gautard, V.; Louis, F.; Monmarthe, E.; Le Provost, H.; Russo, S.; Schuller, J.-P.; Stolarczyk, Th.; Vallage, B.; Zonca, E.; KM3NeT Consortium

2013-10-01

SCOTT is an ASIC designed for the readout electronics of photomultiplier tubes developed for KM3NeT, the cubic-kilometer scale neutrino telescope in Mediterranean Sea. To digitize the PMT signals, the multi-time-over-threshold technique is used with up to 16 adjustable thresholds. Digital outputs of discriminators feed a circular sampling memory and a “first in first out” digital memory. A specific study has shown that five specifically chosen thresholds are suited to reach the required timing accuracy. A dedicated method based on the duration of the signal over a given threshold allows an equivalent timing precision at any charge. To verify that the KM3NeT requirements are fulfilled, this method is applied on PMT signals digitized by SCOTT.

Light Production in the Double Chooz Photomultiplier Tubes

Energy Technology Data Exchange (ETDEWEB)

Calvo, E.; Cerrada, M.; Crespo, J. I.; Gil-Botella, I.; Jimenez, S.; Lopez, M.; Novella, P.; Palomares, C.; Santorelli, R.; Verdugo, A.

2012-09-13

In this document we present a study of the phenomenon of light emission (called glowing) in the bases of the Hamamatsu R7081MOD-ASSY photomultiplier tubes (PMTs) used in the Double Chooz experiment. The tests have been carried out at the CIEMAT laboratories over a photomultiplier tube of the same model. We have studied the phenomenon making first a characterization of it, and then focusing on the dependence of the rate and the amount of emitted light versus voltage and temperature. In addition, we have looked for the possible existence of an ultraviolet component in the light which would be harmful for the experiment because it could be able to excite the scintillator liquid. Finally, we propose and test a method to reduce the light emission using a cover on the base of the photomultiplier tube.. (Author)

The C-terminal MIR-containing region in the Pmt1 O-mannosyltransferase restrains sporulation and is dispensable for virulence in Beauveria bassiana.

Science.gov (United States)

He, Zhangjiang; Luo, Linli; Keyhani, Nemat O; Yu, Xiaodong; Ying, Shenghua; Zhang, Yongjun

2017-02-01

Protein O-mannosyltransferases (Pmts) belong to a highly conserved protein family responsible for the initiation of O-glycosylation of many proteins. Pmts contain one dolichyl-phosphate-mannose-protein mannosyltransferases (PMT) domain and three MIR motifs (mannosyltransferase, inositol triphosphate, and ryanodine receptor) that are essential for activity in yeast. We report that in the insect fungal pathogen, Beauveria bassiana, deletion of the C-terminal Pmt1 MIR-containing region (Pmt1∆ 311-902 ) does not alter O-mannosyltransferase activity, but does increase total cell wall protein O-mannosylation levels and results in phenotypic changes in fungal development and cell wall stability. B. bassiana mutants harboring the Pmt1 ∆ 311-902 mutation displayed a significant increase in conidiation with up-regulation of conidiation-associated genes and an increase in biomass accumulation as compared to the wild-type parent. However, decreased vegetative growth and blastospore production was noted, and Pmt1 ∆ 311-902 mutants were altered in cell wall composition and cell surface features. Insect bioassays revealed little effect on virulence for the Pmt1 ∆ 311-902 strain via cuticle infection or intrahemocoel injection assays, although differences in hyphal body differentiation in the host hemolymph and up-regulation of virulence-associated genes were noted. These data suggest novel roles for Pmt1 in negatively regulating conidiation and demonstrate that the C-terminal Pmt1 MIR-containing region is dispensable for enzymatic activity and organismal virulence.

PEMANFAATAN TEPUNG SUKUN (Artocarpus altilis sp. PADA PEMBUATAN ANEKA KUDAPAN SEBAGAI ALTERNATIF MAKANAN BERGIZI UNTUK PMT-AS

Directory of Open Access Journals (Sweden)

Dewanti Putri Pratiwi

2013-11-01

Full Text Available ABSTRACTBreadfruit is valuable fruit and has a good of nutrient content, but its usage is limited by poor storage properties of fresh fruit. Processing into flour, can increase its utilization. The aim of this research was to utilize breadfruit flour in production of nutritious snack foods for School Supplementary Feeding Programme (PMT-AS. There were three products developed in this study; brownies, pia, and croquette. The research was conducted using experimental design. The proportions of breadfruit flour and wheat flour were different for each product, which brownies was formulated using 70:30, 80:20, 90:10, and 100:0; whereas pia and croquette was formulated by 50:50, 60:40, 70:30, and 80:20. Proximate analysis showed that 100 g brownies contained 409 kcal energy and 7.5 g protein, 100 g pia had 383 kcal energy and 6.7 g protein and croquette had the highest energy and protein content is 455 kcal and 9.9 g protein. In conclusion, all products were suitable as alternative snacks for PMT-AS. The products have met 300 kcal energy and 5 g protein per serving size. Considered also the cost of production, these products have fulfilled criteria to be used in PMT-AS.Keywords: breadfruit, PMT-AS, snacksABSTRAKSukun merupakan buah yang bernilai dan memiliki kandungan gizi yang baik, tetapi penggunaannya terbatas oleh penyimpanan ketika berbentuk buah segar. Sukun yang diubah ke dalam bentuk tepung dapat meningkatkan pemanfaatannya. Tujuan dari penelitian ini adalah memanfaatkan tepung sukun dalam pembuatan kudapan sebagai alternatif makanan bergizi untuk PMT-AS. Terdapat tiga produk dalam penelitian ini, yaitu brownies, pia, dan kroket. Penelitian ini menggunakan desain eksperimental. Perbandingan tepung sukun dan tepung terigu berbeda untuk masing-masing produk. Formulasi brownies adalah 70:39, 80:20, 90:10, dan 100:0, sedangkan formulasi pia dan kroket adalah 50:50, 60:40, 70:30, dan 80:20. Berdasarkan uji organoleptik diketahui bahwa produk

Characterization of cDNA for PMT: a Partial Nicotine Biosynthesis-Related Gene Isolated from Indonesian Local Tobacco (Nicotiana tabacum cv. Sindoro1

Directory of Open Access Journals (Sweden)

SESANTI BASUKI

2013-12-01

Full Text Available Nicotine is the major alkaloid compound in cultivated tobacco (Nicotiana tabacum that could potentially be converted into carcinogenic compound (nor-nicotine. The PMT gene encoding putrescine N-methyltransferase (PMT is one of the two key genes that play a prominent role in nicotine biosynthesis. The aimed of this study was to isolate and characterize the cDNA sequence originated from Indonesian local tobacco cv. Sindoro1 (Ntpmt_Sindoro1. The results showed that the Ntpmt_Sindoro1 was 1124 bp in length. This cDNA fragment encodes for 374 amino acid residues. The predicted polypeptide from the cDNA is a hidrophilic protein, and has a predicted molecular weight of 40.95 kDa. The predicted amino acids sequence also showed high similarity to the PMT gene product Nicotiana sp. available in the GenBank data base. The amino acid sequences also exert conserved residues specifically exhibited only by PMT gene originated from N. tabacum. Clustering analysis revealed that Ntpmt_Sindoro1 belongs to the same clade as the PMT3 gene, a member of the N. tabacum PMT gene family. The Ntpmt_Sindoro1 cDNA sequence covering exon1-exon8 of the PMT gene fragment has been registered in the GenBank data base, under the accession number JX978277.

Safety margins of PWR irradiated vessels - The Chooz A issue

Energy Technology Data Exchange (ETDEWEB)

Hedin, F; Barthelet, B [Electricite de France (EDF), 75 - Paris (France); Guilleret, J C

1988-12-31

In 1986, some irradiated specimen of CHOOZ A (SENA) vessel showed a significant excess of {delta} RTNDT to former previsions. The lack of data on one of the two irradiated shells, and discrepancies between dosimeters results and available previous fluence calculations whose accuracy was questionable, cause the safety authorities to require an important complementary work program before putting again the plant on the grid after 1987 fuel reloading. These works are presented and discussed. They lead to a state that a conservative to day value of the vessel RTNDT is 64 degrees Celsius and that there is no underclad defect in the vessel wall and welds. Then the plant was allowed to restart with certitude that vessel irradiation will not impair its lifetime. (author). 4 refs.

The Chooz power station: ten years of operation

International Nuclear Information System (INIS)

Teste du Bailler, Andre

1977-01-01

The switching into actual service of the Chooz plant, the first pressurized water reactor ever built in France, occurred on 3rd april 1967. Ten years later, one can establish a highly positive balance schedule of plant's operation whose availability is satisfactory, except the mechanical failure which occurred during the startup. The behavior of the equipment, in particular of the components of the primary loop, was satisfactory in its whole since it allowed the gradual increase in capacity by 15% with respect to the initial design. It allowed also the achievment of noticeable progress in the design of equipment intended for the new power stations. Interesting results have also been obtained in radioprotection, working conditions of the staff and environment protection fields. Finally, the training of the operating teams has been closely followed, whether it concerned the operators directly affected by plant operation or the trainees gathered in a school specially organized for this purpose and transferred since to a training Center [fr

A 30 ps Timing Resolution for Single Photons with Multi-pixel Burle MCP-PMT

Energy Technology Data Exchange (ETDEWEB)

Va' vra, J.; Benitez, J.; Coleman, J.; Leith, D.W.G.S.; Mazaheri, G.; Ratcliff, B.; Schwiening, J.; /SLAC

2006-07-05

We have achieved {approx}30 psec single-photoelectron and {approx}12ps for multi-photoelectron timing resolution with a new 64 pixel Burle MCP-PMT with 10 micron microchannel holes. We have also demonstrated that this detector works in a magnetic field of 15kG, and achieved a single-photoelectron timing resolution of better than 60 psec. The study is relevant for a new focusing DIRC RICH detector for particle identification at future Colliders such as the super B-factory or ILC, and for future TOF techniques. This study shows that a highly pixilated MCP-PMT can deliver excellent timing resolution.

Flat Panel PMT: advances in position sensitive photodetection

International Nuclear Information System (INIS)

Pani, R.; Pellegrini, R.; Trotta, C.; Cinti, M.N.; Bennati, P.; Trotta, G.; Iurlaro, G.; Montani, L.; Ridolfi, S.; Cusanno, F.; Garibaldi, F.

2003-01-01

Over the last ten years there was being a strong advancement in photodetection. Different application fields are involved in their use in particular high energy physics, astrophysics and nuclear medicine. They usually work by coupling a scintillation crystal and more recent scintillation arrays with pixel size as small as 0.5 mm. PSPMT represents today the most ready technology for photodetection with large detection areas and very high spatial resolution. Flat panel PMT represents the last technological advancement. Its dimension is 50x50 mm 2 with a narrow peripheral dead zone (0.5 mm final goal). Its compactness allow to assemble different modules closely packed, achieving large detection areas with an effective active area of 97%. In this paper we analyze the imaging performances of PSPMT by coupling two scintillation arrays and by light spot scanning of photocathode to evaluate the linearity position response, spatial resolution and uniformity gain response as a function of light distribution spread and the number of photoelectrons generated on photocathode. The results point out a very narrow PMT intrinsic charge spread and low cross-talk between anodes. Energy resolution and spatial resolution show a good linearity with DRF variation. An unexpected intra-anode gain variation is carried out. In this paper we present the results obtained with this PSPMT regarding imaging performances principally addressed to nuclear medicine application

Progress in RPV-examination of the Chooz-A vessel (and the French procedures, its new developments (MIS5))

Energy Technology Data Exchange (ETDEWEB)

Samman, J; Martin, E; Lacroix, R [Electricite de France (EDF), 93 - Saint-Denis (France). Groupe des Labs.

1988-12-31

This document deals with the French Chooz-A reactor. It describes the method used for in-service inspection of Reactor Pressure Vessels (RPV). The ultrasonic testing procedure is described, showing its advantages and limitations. The supplementary ultrasonic examination is also described, as well as the validation of underclad cracks detection and sizing. Historical data is also provided. (TEC).

Correlates of Protective Motivation Theory (PMT) to adolescents' drug use intention.

Science.gov (United States)

Wu, Cynthia Sau Ting; Wong, Ho Ting; Chou, Lai Yan; To, Bobby Pak Wai; Lee, Wai Lok; Loke, Alice Yuen

2014-01-03

Early onset and increasing proliferation of illicit adolescent drug-use poses a global health concern. This study aimed to examine the correlation between Protective Motivation Theory (PMT) measures and the intention to use drugs among adolescents. An exploratory quantitative correlation design and convenience sampling were adopted. A total of 318 students completed a self-reported questionnaire that solicited information related to their demographics and activities, measures of threat appraisal and coping appraisal, and the intention to use drugs. Logistic regression analysis showed that intrinsic and extrinsic rewards were significant predictors of intention. The odds ratios were equal to 2.90 (p < 0.05) and 8.04 (p < 0.001), respectively. The logistic regression model analysis resulted in a high Nagelkerke R2 of 0.49, which suggests that PMT related measures could be used in predicting drug use intention among adolescents. Further research should be conducted with non-school adolescents to confirm the application.

Correlates of Protective Motivation Theory (PMT to Adolescents’ Drug Use Intention

Directory of Open Access Journals (Sweden)

Cynthia Sau Ting Wu

2014-01-01

Full Text Available Early onset and increasing proliferation of illicit adolescent drug-use poses a global health concern. This study aimed to examine the correlation between Protective Motivation Theory (PMT measures and the intention to use drugs among adolescents. An exploratory quantitative correlation design and convenience sampling were adopted. A total of 318 students completed a self-reported questionnaire that solicited information related to their demographics and activities, measures of threat appraisal and coping appraisal, and the intention to use drugs. Logistic regression analysis showed that intrinsic and extrinsic rewards were significant predictors of intention. The odds ratios were equal to 2.90 (p < 0.05 and 8.04 (p < 0.001, respectively. The logistic regression model analysis resulted in a high Nagelkerke R2 of 0.49, which suggests that PMT related measures could be used in predicting drug use intention among adolescents. Further research should be conducted with non-school adolescents to confirm the application.

A front end ASIC for the readout of the PMT in the KM3NeT detector

International Nuclear Information System (INIS)

Gajanana, D; Gromov, V; Timmer, P; Heine, E; Kluit, R

2010-01-01

In this work, we describe the front end ASIC to readout the Photo-Multiplier-Tube of the KM3NeT detector, in detail. Stringent power budgeting, area constraints and lowering cost motivate us to design a custom front-end ASIC for reading the PMT. The ASIC amplifies the PMT signal and discriminates it against a threshold level and delivers the information via low voltage differential signals (LVDS). These LVDS signals carry highly accurate timing information of the photons . The length of the LVDS signals or Time over Threshold (ToT) gives information on the number of detected photons. A one-time programmable read-only memory (PROM) block provides unique identification to the chip. The chip communicates with the data acquisition electronics via an I 2 C bus. The data is transmitted to shore via fiber optics, where processing is done. The ASIC was fabricated in 0.35u CMOS process from AustriaMicroSystems (AMS).

Forward physics in CMS: Simulation of PMT hits in HF and Higgs mass reconstruction methods with a focus on forward jet tagging

CERN Document Server

Moeller, Anthony Richard

2014-01-01

Abnormally high energy events were seen in the Hadronic Forward (HF) calorimeter for pion and muon data during testbeam in 2004. Analysis of testbeam data suggested that such events were caused by particles traveling the entire length of HF and striking the photomultiplier (PMT) windows in the readout box behind HF. Charged particles traversing the window of the PMT emit cerenkov radiation, which creates abnormally high energy events in the data. To further study these events, a modification of the existing official CMS HF simulation was created that added the PMT windows to the simulation as sensitive detectors. In agreement with testbeam data, abnormally high energy events in the PMTs were seen in the simulation for muons and pions. The simulation was then extended to jets simulated with Pythia, and then for collision like events as well. PMT hits were seen in both of these cases. Energy sharing between PMTs for long and short fibers in HF as well as timing differences between normal HF events and PMT event...

Building a nuclear power plant from A to Z: Chooz B as an example

International Nuclear Information System (INIS)

Anon.

1994-01-01

From the design studies to the tests and reactor divergence, building a nuclear power plant involves strictly planned operations. This issue deals with the operations carried out first in the design offices and then on the site, in order to achieve such a vast and sophisticated industrial project: organizing, designing, engineering, assembling, testing, manufacturing and transporting heavy components. These various phases are shown through the example of Chooz B, a nuclear power plant with two 1.450 MW units, which is being built in the Ardennes, and whose first reactor will diverge in 1995. (author)

Cross-talk of a multi-anode PMT and attainment of a σ∼10ps TOF counter

International Nuclear Information System (INIS)

Enari, Y.; Hayasaka, K.; Hokuue, T.; Inami, K.; Ohshima, T.; Sato, N.; Akatsu, M.; Kawakami, S.; Miyabayashi, Y.; Tokuda, H.; Yanase, H.; Shimoi, H.; Fujimori, T.

2005-01-01

We extensively studied a cross-talk phenomenon that seriously deteriorates the high time-resolution of a multi-anode 16-channel linear array photo-multiplier tube (PMT); the dynode structures were modified to eliminate the cross-talk effect and to recover a time resolution of σ=70-80ps for single photons. The use of 16 anode signals of the modified PMT enabled us to attain σ=12ps for a small TOF counter of Cherenkov radiation

Optimization of the electron collection efficiency of a large area MCP-PMT for the JUNO experiment

International Nuclear Information System (INIS)

Chen, Lin; Tian, Jinshou; Liu, Chunliang; Wang, Yifang; Zhao, Tianchi; Liu, Hulin; Wei, Yonglin; Sai, Xiaofeng; Chen, Ping; Wang, Xing; Lu, Yu; Hui, Dandan; Guo, Lehui; Liu, Shulin; Qian, Sen; Xia, Jingkai; Yan, Baojun; Zhu, Na; Sun, Jianning; Si, Shuguang

2016-01-01

A novel large-area (20-inch) photomultiplier tube based on microchannel plate (MCP-PMTs) is proposed for the Jiangmen Underground Neutrino Observatory (JUNO) experiment. Its photoelectron collection efficiency C e is limited by the MCP open area fraction (A open ). This efficiency is studied as a function of the angular (θ), energy (E) distributions of electrons in the input charge cloud and the potential difference (U) between the PMT photocathode and the MCP input surface, considering secondary electron emission from the MCP input electrode. In CST Studio Suite, Finite Integral Technique and Monte Carlo method are combined to investigate the dependence of C e on θ, E and U. Results predict that C e can exceed A open , and are applied to optimize the structure and operational parameters of the 20-inch MCP-PMT prototype. C e of the optimized MCP-PMT is expected to reach 81.2%. Finally, the reduction of the penetration depth of the MCP input electrode layer and the deposition of a high secondary electron yield material on the MCP are proposed to further optimize C e .

Structural Redesigning Arabidopsis Lignins into Alkali-Soluble Lignins through the Expression of p-Coumaroyl-CoA:Monolignol Transferase PMT1

Science.gov (United States)

Sibout, Richard; Le Bris, Philippe; Cézard, Laurent

2016-01-01

Grass lignins can contain up to 10% to 15% by weight of p-coumaric esters. This acylation is performed on monolignols under the catalysis of p-coumaroyl-coenzyme A monolignol transferase (PMT). To study the impact of p-coumaroylation on lignification, we first introduced the Brachypodium distachyon Bradi2g36910 (BdPMT1) gene into Arabidopsis (Arabidopsis thaliana) under the control of the constitutive maize (Zea mays) ubiquitin promoter. The resulting p-coumaroylation was far lower than that of lignins from mature grass stems and had no impact on stem lignin content. By contrast, introducing either the BdPMT1 or the Bradi1g36980 (BdPMT2) gene into Arabidopsis under the control of the Arabidopsis cinnamate-4-hydroxylase promoter boosted the p-coumaroylation of mature stems up to the grass lignin level (8% to 9% by weight), without any impact on plant development. The analysis of purified lignin fractions and the identification of diagnostic products confirmed that p-coumaric acid was associated with lignins. BdPMT1-driven p-coumaroylation was also obtained in the fah1 (deficient for ferulate 5-hydroxylase) and ccr1g (deficient for cinnamoyl-coenzyme A reductase) lines, albeit to a lower extent. Lignins from BdPMT1-expressing ccr1g lines were also found to be feruloylated. In Arabidopsis mature stems, substantial p-coumaroylation of lignins was achieved at the expense of lignin content and induced lignin structural alterations, with an unexpected increase of lignin units with free phenolic groups. This higher frequency of free phenolic groups in Arabidopsis lignins doubled their solubility in alkali at room temperature. These findings suggest that the formation of alkali-leachable lignin domains rich in free phenolic groups is favored when p-coumaroylated monolignols participate in lignification in a grass in a similar manner. PMID:26826222

The mDOM. A multi-PMT optical module for IceCube-Gen2

Energy Technology Data Exchange (ETDEWEB)

Classen, Lew; Kappes, Alexander [Institut fur Kernphysik, Westfaelische Wilhelms-Universitaet Muenster (Germany); Karg, Timo; Kretzschmann, Axel [DESY, Zeuthen (Germany); Koelpin, Alexander; Lindner, Stefan; Roeber, Juergen [LTE, Friedrich-Alexander-Universitaet Erlangen-Nuernberg (Germany)

2016-07-01

Following the discovery of an astrophysical neutrino flux by IceCube in 2013, planning is under way for the next generation neutrino telescope at the South Pole, IceCube-Gen2, which will significantly enhance and expand IceCube's sensitivity both towards high neutrino energies as well as in the low-energy regime. In the scope of these efforts, a novel multi-PMT optical sensor is being developed which, following the KM3NeT design, consists of an array of several small PMTs inside a transparent pressure vessel. This design provides some significant advantages compared to the conventional single-PMT module design, such as an increased effective area, homogeneous coverage of the full solid angle, and intrinsic angular sensitivity. The talk presents an overview of the project and its current status, featuring hardware development, testing, and simulation efforts.

IAEA Concludes Safety Review at Chooz Nuclear Power Plant in France

International Nuclear Information System (INIS)

2013-01-01

management of corrective maintenance and leak repair to minimize backlogs and maintain plant safety; The plant should enhance the chemistry control program to cover all chemistry aspects of plant systems; The plant should enhance the process of root cause analysis of safety significant events to improve the depth of analysis of such events; and The plant should consider improving systems to allow clear identification of deficiencies in the field once they have been recognized. Chooz management expressed a determination to address all the areas identified for improvement and requested the IAEA to schedule a follow-up mission in approximately 18 months. The team delivered a draft of its recommendations, suggestions and good practices to the plant management in the form of Technical Notes for factual comments. The technical notes and comments from the plant and the French Safety Authority will be reviewed at IAEA headquarters. The final report will be submitted to the Government of France within three months. This was the 175th mission of the OSART programme, which began in 1982, and the 25th mission in France. The next OSART mission in France is scheduled at Flamanville Units 1 and 2 in 2014. Background: General information about OSART missions can be found on the IAEA Website. An OSART mission is designed as a review of programmes and activities essential to operational safety. It is not a regulatory inspection, nor is it a design review or a substitute for an exhaustive assessment of the plant's overall safety status. Experts participating in the IAEA's June 2010 International Conference on Operational Safety of Nuclear Power Plants (NPP) reviewed the experience of the OSART programme and concluded: In OSART missions NPPs are assessed against IAEA Safety Standards which reflect the current international consensus on what constitutes a high level of safety; and OSART recommendations and suggestions are of utmost importance for operational safety improvement of NPPs. The IAEA

A Study of Personal Health Record User's Behavioral Model Based on the PMT and UTAUT Integrative Perspective.

Science.gov (United States)

Hsieh, Hui-Lung; Kuo, Yu-Ming; Wang, Shiang-Ru; Chuang, Bi-Kun; Tsai, Chung-Hung

2016-12-23

The personal health record (PHR) is a system that enables borderless medical care services by combining technological innovation and human consideration. This study explored factors affecting the adoption of PHR from technical, medical, and social perspectives according to the Protection Motivation Theory (PMT) and Unified Theory of Acceptance and Use of Technology (UTAUT) model. A survey using a structured questionnaire was subsequently conducted, which produced the following results: (1) The PMT and UTAUT were effective at predicting PHR usage behaviors; (2) Perceived ease-of-use was the most decisive factor influencing the use of PHR, followed by self-efficacy and perceived usefulness; and (3) Behavioral intention for PHR was significantly and positively correlated with usage behavior. From the obtained results, this study recommends that health authorities and medical institutions promote self-efficacy in the use of PHR to improve the levels of behavioral intention and usage behavior among the people. Additionally, medical care institutions are recommended to promote health management and preventive healthcare concepts to help improve public acceptance of the PHR system as a means to self-manage their health. Finally, community centers, medical institutions, and health authorities are urged to work together to enhance public medical knowledge and pool resources for the PHR system, both of which are essential for improving the popularity of the PHR, public quality of life, and the effectiveness of health management.

Optimization of the electron collection efficiency of a large area MCP-PMT for the JUNO experiment

Energy Technology Data Exchange (ETDEWEB)

Chen, Lin, E-mail: chenlin@opt.cn [State Key Laboratory of Transient Optics and Photonics, Xi’an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi’an 710119 (China); Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Xi’an Jiaotong University, Xi’an 710049 (China); Tian, Jinshou [Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Liu, Chunliang [Xi’an Jiaotong University, Xi’an 710049 (China); Wang, Yifang; Zhao, Tianchi [Institute of High Energy Physics (IHEP) of CAS, Beijing 100049 (China); Liu, Hulin; Wei, Yonglin; Sai, Xiaofeng [Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Chen, Ping [State Key Laboratory of Transient Optics and Photonics, Xi’an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi’an 710119 (China); Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Wang, Xing; Lu, Yu [Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Hui, Dandan; Guo, Lehui [State Key Laboratory of Transient Optics and Photonics, Xi’an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi’an 710119 (China); Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Liu, Shulin; Qian, Sen; Xia, Jingkai; Yan, Baojun; Zhu, Na [Institute of High Energy Physics (IHEP) of CAS, Beijing 100049 (China); Sun, Jianning; Si, Shuguang [North Night Vision Technology (NNVT) CO., LTD, Nanjing 210110 (China); and others

2016-08-11

A novel large-area (20-inch) photomultiplier tube based on microchannel plate (MCP-PMTs) is proposed for the Jiangmen Underground Neutrino Observatory (JUNO) experiment. Its photoelectron collection efficiency C{sub e} is limited by the MCP open area fraction (A{sub open}). This efficiency is studied as a function of the angular (θ), energy (E) distributions of electrons in the input charge cloud and the potential difference (U) between the PMT photocathode and the MCP input surface, considering secondary electron emission from the MCP input electrode. In CST Studio Suite, Finite Integral Technique and Monte Carlo method are combined to investigate the dependence of C{sub e} on θ, E and U. Results predict that C{sub e} can exceed A{sub open}, and are applied to optimize the structure and operational parameters of the 20-inch MCP-PMT prototype. C{sub e} of the optimized MCP-PMT is expected to reach 81.2%. Finally, the reduction of the penetration depth of the MCP input electrode layer and the deposition of a high secondary electron yield material on the MCP are proposed to further optimize C{sub e}.

Characterization of large-area photomultipliers under low magnetic fields: Design and performance of the magnetic shielding for the Double Chooz neutrino experiment

International Nuclear Information System (INIS)

Calvo, E.; Cerrada, M.; Fernandez-Bedoya, C.; Gil-Botella, I.; Palomares, C.; Rodriguez, I.; Toral, F.; Verdugo, A.

2010-01-01

A precise quantitative measurement of the effect of low magnetic fields in Hamamatsu R7081 photomultipliers has been performed. These large-area photomultipliers will be used in the Double Chooz neutrino experiment. A magnetic shielding has been developed for these photomultipliers. Its design and performance is also reported in this paper.

Proof-of-principle study of a small animal PET/field-cycled MRI combined system using conventional PMT technology

International Nuclear Information System (INIS)

Peng Hao; Handler, William B.; Scholl, Timothy J.; Simpson, P.J.; Chronik, Blaine A.

2010-01-01

There are currently several approaches to the development of combined PET/MRI systems, all of which need to address adverse interactions between the two systems. Of particular relevance to the majority of proposed PET/MRI systems is the effect that static and dynamic magnetic fields have on the performance of PET detection systems based on photomultiplier tubes (PMTs). In the work reported in this paper, performance of two conventional PMTs has been systematically investigated and characterized as a function of magnetic field exposure conditions. Detector gain, energy resolution, time resolution, and efficiency were measured for static field exposures between 0 and 6.3 mT. Additionally, the short-term recovery and long-term stability of gain and energy resolution were measured in the presence of repeatedly applied dynamic magnetic fields changing at 4 T/s. It was found that the detectors recovered normal operation within several milliseconds following the end of large pulsed magnetic fields. In addition, the repeated applications of large pulsed magnetic fields did not significantly affect detector stability. Based on these results, we implemented a proof-of-principle PET/field-cycled MRI (FCMRI) system for small animal imaging using commercial PMT-based PET detectors. The first PET images acquired within the PET/FCMRI system are presented. The image quality, in terms of spatial resolution, was compared between standalone PET and the PET/FCMRI system. Finally, the relevance of these results to various aspects of PET/MRI system design is discussed.

A Study of Personal Health Record User’s Behavioral Model Based on the PMT and UTAUT Integrative Perspective

Directory of Open Access Journals (Sweden)

Hui-Lung Hsieh

2016-12-01

Full Text Available The personal health record (PHR is a system that enables borderless medical care services by combining technological innovation and human consideration. This study explored factors affecting the adoption of PHR from technical, medical, and social perspectives according to the Protection Motivation Theory (PMT and Unified Theory of Acceptance and Use of Technology (UTAUT model. A survey using a structured questionnaire was subsequently conducted, which produced the following results: (1 The PMT and UTAUT were effective at predicting PHR usage behaviors; (2 Perceived ease-of-use was the most decisive factor influencing the use of PHR, followed by self-efficacy and perceived usefulness; and (3 Behavioral intention for PHR was significantly and positively correlated with usage behavior. From the obtained results, this study recommends that health authorities and medical institutions promote self-efficacy in the use of PHR to improve the levels of behavioral intention and usage behavior among the people. Additionally, medical care institutions are recommended to promote health management and preventive healthcare concepts to help improve public acceptance of the PHR system as a means to self-manage their health. Finally, community centers, medical institutions, and health authorities are urged to work together to enhance public medical knowledge and pool resources for the PHR system, both of which are essential for improving the popularity of the PHR, public quality of life, and the effectiveness of health management.

A Study of Personal Health Record User’s Behavioral Model Based on the PMT and UTAUT Integrative Perspective

Science.gov (United States)

Hsieh, Hui-Lung; Kuo, Yu-Ming; Wang, Shiang-Ru; Chuang, Bi-Kun; Tsai, Chung-Hung

2016-01-01

The personal health record (PHR) is a system that enables borderless medical care services by combining technological innovation and human consideration. This study explored factors affecting the adoption of PHR from technical, medical, and social perspectives according to the Protection Motivation Theory (PMT) and Unified Theory of Acceptance and Use of Technology (UTAUT) model. A survey using a structured questionnaire was subsequently conducted, which produced the following results: (1) The PMT and UTAUT were effective at predicting PHR usage behaviors; (2) Perceived ease-of-use was the most decisive factor influencing the use of PHR, followed by self-efficacy and perceived usefulness; and (3) Behavioral intention for PHR was significantly and positively correlated with usage behavior. From the obtained results, this study recommends that health authorities and medical institutions promote self-efficacy in the use of PHR to improve the levels of behavioral intention and usage behavior among the people. Additionally, medical care institutions are recommended to promote health management and preventive healthcare concepts to help improve public acceptance of the PHR system as a means to self-manage their health. Finally, community centers, medical institutions, and health authorities are urged to work together to enhance public medical knowledge and pool resources for the PHR system, both of which are essential for improving the popularity of the PHR, public quality of life, and the effectiveness of health management. PMID:28025557

Electron optics design of an 8-in. spherical MCP-PMT

Energy Technology Data Exchange (ETDEWEB)

Chen, Ping, E-mail: chenping@opt.cn [Key Laboratory of Ultra-fast photoelectric Diagnostics Technology, Xi’an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences, Xi’an 710119 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Collaborative Innovation Center of Extreme Optics, Shanxi University, Taiyuan 030006, Shanxi (China); Tian, Jinshou [Key Laboratory of Ultra-fast photoelectric Diagnostics Technology, Xi’an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences, Xi’an 710119 (China); Collaborative Innovation Center of Extreme Optics, Shanxi University, Taiyuan 030006, Shanxi (China); Qian, Sen; Zhao, Tianchi [Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); Liu, Hulin; Wei, Yonglin; Sai, Xiaofeng; He, Jianping; Wang, Xing; Lu, Yu [Key Laboratory of Ultra-fast photoelectric Diagnostics Technology, Xi’an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences, Xi’an 710119 (China); Chen, Lin; Guo, Lehui; Pei, Chengquan; Hui, Dandan [Key Laboratory of Ultra-fast photoelectric Diagnostics Technology, Xi’an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences, Xi’an 710119 (China); University of Chinese Academy of Sciences, Beijing 100049 (China)

2017-03-11

This paper discusses the electron optical system of an 8-in. spherical MCP-PMT. The MCP assembly, the supporting pole and the supply voltages are carefully designed to optimize the photoelectron collection efficiency and the transit time spread. Coating the MCP nickel-chromium electrode with an additional high secondary emission material is employed to make a breakthrough on the collection efficiency. With the simulation software CST, the Finite Integration method and the Monte Carlo method are combined to evaluate the collection efficiency, the time properties and the Earth's magnetic field effects. Simulation results show that the photocathode active solid angle is over 3.5 πsr, the average collection efficiency can exceed 95% with the coated MCP and the mean transit time spread is 2.2 ns for a typical electric potential of 500 V applied between the photocathode and the MCP input facet. The prototype and the measured single photoelectron spectrum are also presented.

Dual parameter analysis of CsI:Tl/PMT with a digital oscilloscope

CERN Document Server

Devol, T A; Fjeld, R A

1999-01-01

Scintillation pulses from alpha-particle and gamma-ray excited CsI:Tl were recorded with a photomultiplier tube and digital oscilloscope card in single parameter (pulse shape or pulse height) and dual parameter (simultaneous pulse shape and pulse height) modes. A 2.8x1.3x1.3 cm sup 3 CsI:Tl crystal was coupled to a Burle 8850 photomultiplier tube (PMT) and excited with sup 1 sup 4 sup 8 Gd (E subalpha=3.18 MeV) and sup 1 sup 3 sup 7 Cs (E subgamma=0.662 MeV). The timing pulses (50 OMEGA terminated dynode signal) from the PMT base were directly input to a GaGe CompuScope 8012A/PCI sup T sup M (12-bit, 50 MHz dual channel digital oscilloscope card) that resided in a P6-300 MHz personal computer. Individual digitized pulses were processed via a LabVIEW sup T sup M V 4.1 interface to the oscilloscope. The ratio of the charge collected over a short time interval to the total charge collected was used for the single parameter pulse shape spectrum while the total charge collected was used for the single parameter pu...

Cosmic-muon characterization and annual modulation measurement with Double Chooz detectors

Science.gov (United States)

Abrahão, T.; Almazan, H.; dos Anjos, J. C.; Appel, S.; Baussan, E.; Bekman, I.; Bezerra, T. J. C.; Bezrukov, L.; Blucher, E.; Brugière, T.; Buck, C.; Busenitz, J.; Cabrera, A.; Camilleri, L.; Carr, R.; Cerrada, M.; Chauveau, E.; Chimenti, P.; Corpace, O.; Crespo-Anadón, J. I.; Dawson, J. V.; Dhooghe, J.; Djurcic, Z.; Dracos, M.; Etenko, A.; Fallot, M.; Franco, D.; Franke, M.; Furuta, H.; Gil-Botella, I.; Giot, L.; Givaudan, A.; Gögger-Neff, M.; Gómez, H.; Gonzalez, L. F. G.; Goodman, M.; Hara, T.; Haser, J.; Hellwig, D.; Hourlier, A.; Ishitsuka, M.; Jochum, J.; Jollet, C.; Kale, K.; Kampmann, P.; Kaneda, M.; Kaplan, D. M.; Kawasaki, T.; Kemp, E.; de Kerret, H.; Kryn, D.; Kuze, M.; Lachenmaier, T.; Lane, C.; Laserre, T.; Lastoria, C.; Lhuillier, D.; Lima, H.; Lindner, M.; López-Castaño, J. M.; LoSecco, J. M.; Lubsandorzhiev, B.; Maeda, J.; Mariani, C.; Maricic, J.; Matsubara, T.; Mention, G.; Meregaglia, A.; Miletic, T.; Minotti, A.; Nagasaka, Y.; Navas-Nicolás, D.; Novella, P.; Oberauer, L.; Obolensky, M.; Onillon, A.; Oralbaev, A.; Palomares, C.; Pepe, I.; Pronost, G.; Reinhold, B.; Rybolt, B.; Sakamoto, Y.; Santorelli, R.; Schönert, S.; Schoppmann, S.; Sharankova, R.; Sibille, V.; Sinev, V.; Skorokhvatov, M.; Soiron, M.; Soldin, P.; Stahl, A.; Stancu, I.; Stokes, L. F. F.; Strait, M.; Suekane, F.; Sukhotin, S.; Sumiyoshi, T.; Sun, Y.; Svoboda, B.; Tonazzo, A.; Veyssiere, C.; Vivier, M.; Wagner, S.; Wiebusch, C.; Wurm, M.; Yang, G.; Yermia, F.; Zimmer, V.

2017-02-01

A study on cosmic muons has been performed for the two identical near and far neutrino detectors of the Double Chooz experiment, placed at ~120 and ~300 m.w.e. underground respectively, including the corresponding simulations using the MUSIC simulation package. This characterization has allowed us to measure the muon flux reaching both detectors to be (3.64 ± 0.04) × 10-4 cm-2s-1 for the near detector and (7.00 ± 0.05) × 10-5 cm-2s-1 for the far one. The seasonal modulation of the signal has also been studied observing a positive correlation with the atmospheric temperature, leading to an effective temperature coefficient of αT = 0.212 ± 0.024 and 0.355 ± 0.019 for the near and far detectors respectively. These measurements, in good agreement with expectations based on theoretical models, represent one of the first measurements of this coefficient in shallow depth installations.

Cosmic-muon characterization and annual modulation measurement with Double Chooz detectors

International Nuclear Information System (INIS)

Abrahão, T.; Anjos, J.C. dos; Almazan, H.; Buck, C.; Appel, S.; Baussan, E.; Brugière, T.; Bekman, I.; Bezerra, T.J.C.; Bezrukov, L.; Blucher, E.; Busenitz, J.; Cabrera, A.; Camilleri, L.; Carr, R.; Cerrada, M.; Chauveau, E.; Chimenti, P.

2017-01-01

A study on cosmic muons has been performed for the two identical near and far neutrino detectors of the Double Chooz experiment, placed at ∼120 and ∼300 m.w.e. underground respectively, including the corresponding simulations using the MUSIC simulation package. This characterization has allowed us to measure the muon flux reaching both detectors to be (3.64 ± 0.04) × 10 −4 cm −2 s −1 for the near detector and (7.00 ± 0.05) × 10 −5 cm −2 s −1 for the far one. The seasonal modulation of the signal has also been studied observing a positive correlation with the atmospheric temperature, leading to an effective temperature coefficient of α T = 0.212 ± 0.024 and 0.355 ± 0.019 for the near and far detectors respectively. These measurements, in good agreement with expectations based on theoretical models, represent one of the first measurements of this coefficient in shallow depth installations.

Cross Talk Study to the Single Photon Response of a Flat Panel PMT for the RICH Upgrade at LHCb

CERN Multimedia

Arnaboldi, C; Calvi, M; Fanchini, E; Gotti, C; Maino, M; Matteuzzi, C; Perego, D L; Pessina, G; Wang, J C

2009-01-01

The Ring Imaging CHerenkov, RICH, detector at LHCb is now readout by Hybrid Photon Detectors. In view of its upgrade a possible option is the adoption of the flat panel Photon Multipliers Tubes, PMT. An important issue for the good determination of the rings produced in the sensitive media is a negligible level of cross talk. We have experimentally studied the cross talk from the 64x64 pixels of the H9500 PMT from Hamamatsu. Results have shown that at the single photon signal level, as expected at LHCb, the statistics applied to the small number of electrons generated at the first dynode of the PMT chain leads to a cross talk mechanism that must be interpreted in term of the percentage of the number of induced signals rather than on the amplitude of the induced signals. The threshold to suppress cross talk must be increased to a significant fraction of the single photon signal for the worst case. The number of electrons generated at the first dynode is proportional to the biasing voltage. Measurements have sh...

Dimensionless parameterization of lidar for laser remote sensing of the atmosphere and its application to systems with SiPM and PMT detectors.

Science.gov (United States)

Agishev, Ravil; Comerón, Adolfo; Rodriguez, Alejandro; Sicard, Michaël

2014-05-20

In this paper, we show a renewed approach to the generalized methodology for atmospheric lidar assessment, which uses the dimensionless parameterization as a core component. It is based on a series of our previous works where the problem of universal parameterization over many lidar technologies were described and analyzed from different points of view. The modernized dimensionless parameterization concept applied to relatively new silicon photomultiplier detectors (SiPMs) and traditional photomultiplier (PMT) detectors for remote-sensing instruments allowed predicting the lidar receiver performance with sky background available. The renewed approach can be widely used to evaluate a broad range of lidar system capabilities for a variety of lidar remote-sensing applications as well as to serve as a basis for selection of appropriate lidar system parameters for a specific application. Such a modernized methodology provides a generalized, uniform, and objective approach for evaluation of a broad range of lidar types and systems (aerosol, Raman, DIAL) operating on different targets (backscatter or topographic) and under intense sky background conditions. It can be used within the lidar community to compare different lidar instruments.

The treatment of low level effluents by flocculation and settling at the Chooz nuclear power plant

International Nuclear Information System (INIS)

Petteau, J.L.; Roofthooft, R.

1989-01-01

At the Chooz plant, radioactive effluents were formerly treated by evaporation, but because throughput was low, another method was studied. After laboratory tests, a 500 L/h flocculation and settling pilot plant was constructed, followed later by a 5 m 3 /h installation. The main isotopes eliminated are caesium-134 and caesium-137. Flocculation with copper ferrocyanide reduces the total activity to less than 500 Bq/L. The installation described in the paper was commissioned in 1984 and has been in industrial operation since 1985, processing all types of effluent. The evaporator can be set aside for boric acid recovery. (author). 3 figs, 1 tab

Cosmic-muon characterization and annual modulation measurement with Double Chooz detectors

Energy Technology Data Exchange (ETDEWEB)

Abrahão, T.; Anjos, J.C. dos [Centro Brasileiro de Pesquisas Físicas, Rio de Janeiro, RJ, 22290-180 (Brazil); Almazan, H.; Buck, C. [Max-Planck-Institut für Kernphysik, 69117 Heidelberg (Germany); Appel, S. [Physik Department, Technische Universität München, 85748 Garching (Germany); Baussan, E.; Brugière, T. [IPHC, Université de Strasbourg, CNRS/IN2P3, 67037 Strasbourg (France); Bekman, I. [III. Physikalisches Institut, RWTH Aachen University, 52056 Aachen (Germany); Bezerra, T.J.C. [SUBATECH, CNRS/IN2P3, Université de Nantes, Ecole des Mines de Nantes, 44307 Nantes (France); Bezrukov, L. [Institute of Nuclear Research of the Russian Academy of Sciences, Moscow 117312 (Russian Federation); Blucher, E. [The Enrico Fermi Institute, The University of Chicago, Chicago, Illinois 60637 (United States); Busenitz, J. [Department of Physics and Astronomy, University of Alabama, Tuscaloosa, Alabama 35487 (United States); Cabrera, A. [AstroParticule et Cosmologie, Université Paris Diderot, CNRS/IN2P3, CEA/IRFU, Observatoire de Paris, Sorbonne Paris Cité, 75205 Paris Cedex 13 (France); Camilleri, L.; Carr, R. [Columbia University, New York, New York 10027 (United States); Cerrada, M. [Centro de Investigaciones Energéticas, Medioambientales y Tecnológicas, CIEMAT, 28040, Madrid (Spain); Chauveau, E. [Research Center for Neutrino Science, Tohoku University, Sendai 980-8578 (Japan); Chimenti, P., E-mail: hgomez@apc.univ-paris7.fr [Universidade Federal do ABC, UFABC, Santo André, SP, 09210-580 (Brazil); and others

2017-02-01

A study on cosmic muons has been performed for the two identical near and far neutrino detectors of the Double Chooz experiment, placed at ∼120 and ∼300 m.w.e. underground respectively, including the corresponding simulations using the MUSIC simulation package. This characterization has allowed us to measure the muon flux reaching both detectors to be (3.64 ± 0.04) × 10{sup −4} cm{sup −2}s{sup −1} for the near detector and (7.00 ± 0.05) × 10{sup −5} cm{sup −2}s{sup −1} for the far one. The seasonal modulation of the signal has also been studied observing a positive correlation with the atmospheric temperature, leading to an effective temperature coefficient of α {sub T} = 0.212 ± 0.024 and 0.355 ± 0.019 for the near and far detectors respectively. These measurements, in good agreement with expectations based on theoretical models, represent one of the first measurements of this coefficient in shallow depth installations.

Determination of the direction to a source of antineutrinos via inverse beta decay in Double Chooz

Science.gov (United States)

Nikitenko, Ya.

2016-11-01

To determine the direction to a source of neutrinos (and antineutrinos) is an important problem for the physics of supernovae and of the Earth. The direction to a source of antineutrinos can be estimated through the reaction of inverse beta decay. We show that the reactor neutrino experiment Double Chooz has unique capabilities to study antineutrino signal from point-like sources. Contemporary experimental data on antineutrino directionality is given. A rigorous mathematical approach for neutrino direction studies has been developed. Exact expressions for the precision of the simple mean estimator of neutrinos' direction for normal and exponential distributions for a finite sample and for the limiting case of many events have been obtained.

PERILAKU MAKAN MURID SEKOLAH DASAR PENERIMA PMT-AS DI DESA CIHEULEUT DAN PASIR GAOK KABUPATEN BOGOR

Directory of Open Access Journals (Sweden)

Hermina Hermina

2012-11-01

Full Text Available FOOD CONSUMPTION BEHAVIOR OF ELEMENTARY SCHOOL PUPILS PARTICIPATING IN "PMT-AS" PROGRAM AT THE CIHEULEUT AND PASIR GAOK VILLAGE DISTRICT OF BOGOR.Objective: To collect informations regarding actual food consumption behaviour of the pupils, i.e. to develop right message to improve food consumption and nutrition status of the pupils.Results: Most of the pupils have not been applying good and acceptable food consumption behavior, i.e. quantitatively and qualitatively as well; their dietary food consumption patterns relatively monotoneous, vegetables are consumted very limited and also protein sources are less varieties. Snack foods which are usually consumed at school are less varieties and relatively unsafe.Conclusions: There are important messages developed to improve food consumption and nutrition status of the pupils, i.e. eat breakfast before go to school, have complete meal 2-3 times a day and consumed vegetables every day.Key Words: food consumption behavior, school suplementary feeding program (PMT-AS, nutrition education, elementary school pupils

Assessment of hepatic functional reserve for hepatic resection using 99mTc-PMT scintigraphy in comparison with 99mTc-GSA scintigraphy

International Nuclear Information System (INIS)

Sakuma, Atsushi

2000-01-01

99m Tc-diethylenetriamine-pentaacetic acid-galactosyl human serum albumin( 99m Tc-GSA) scintigraphy has been reported as a useful study of hepatic functional reserve recently. We have performed 99m Tc-N-pyridoxyl-5-methyl-tryptophan( 99m Tc-PMT) and 99m Tc-GSA preoperatively for evaluation of hepatic functional reserve and compared the usefulness of those scintigraphy study. Twenty-four patients who were the candidates of hepatic resection underwent 99m Tc-PMT scintigraphy preoperatively. Hepatic blood flow coefficient (K value), the amount of hepatic blood flow (HBF), and the ratio of portal blood flow (PVR) were computed. 99m Tc-GSA scintigraphy was also performed within two weeks of the 99m Tc-PMT scintigraphy, and the ratio of disappearance (HH 15 ) and the hepatic uptake ratio (LHL 15 ) were computed. The relationship between K value, HBF, PVR, HH 15 and LHL 15 was analyzed. Their correlation with other liver function tests was also examined. K value and HBF did not show statistically significant correlations with HH 15 and LHL 15 , PVR correlated statistically significantly HH 15 and LHL 15 . K value correlated with the preoperative values of cholinesterase, Fischer ratio, γ-globulin, ICGR 15 , albumin, and platelet count. There was a statistically significant correlation between LHL 15 and the value of cholinesterase, γ-globulin, platelet count, and Fischer ratio. When the liver resection of subsegmentectomy or more was indicated in 10 patients, nine patients had LHL 15 value less than 0.9 which delineated possibility of poor prognosis. However, judging from K value and HBF, liver resection was considered feasible and it was all successfully performed, resulting in good prognosis. From this study, it is suspected that 99m Tc-GSA scintigraphy reflect the severity of liver fibrosis and the amount of portal blood flows, and 99m Tc-PMT scintigraphy reflect the hepatic blood flow and ability of protein synthesis. It was proved that 99m Tc-PMT scintigraphy is

Investigation of a Multi-Anode Microchannel Plate PMT for Time-of-Flight PET

Science.gov (United States)

Choong, Woon-Seng

2010-10-01

We report on an investigation of a mulit-anode microchannel plate PMT for time-of-flight PET detector modules. The primary advantages of an MCP lie in its excellent timing properties (fast rise time and low transit time spread), compact size, and reasonably large active area, thus making it a good candidate for TOF applications. In addition, the anode can be segmented into an array of collection electrodes with fine pitch to attain good position sensitivity. In this paper, we investigate using the Photonis Planacon MCP-PMT with a pore size of 10 μm to construct a PET detector module, specifically for time-of-flight applications. We measure the single electron response by exciting the Planacon with pulsed laser diode. We also measure the performance of the Planacon as a PET detector by coupling a 4 mm×4 mm×10 mm LSO crystal to individual pixel to study its gain uniformity, energy resolution, and timing resolution. The rise time of the Planacon is 440 ps with pulse duration of about 1 ns. A transit time spread of 120 ps FWHM is achieved. The gain is fairly uniform across the central region of the Planacon, but drops off by as much as a factor of 2.5 around the edges. The energy resolution is fairly uniform across the Planacon with an average value of 18.6 ± 0.7% FWHM. While the average timing resolution of 252 ± 7 ps FWHM is achieved in the central region of the Planacon, it degrades to 280 ± 9 ps FWHM for edge pixels and 316 ± 15 ps FWHM for corner pixels. We compare the results with measurements performed with a fast timing conventional PMT (Hamamatsu R-9800). We find that the R9800, which has significantly higher PDE, has a better timing resolution than the Planacon. Furthermore, we perform detector simulations to calculate the improvement that can be achieved with a higher PDE Planacon. The calculation shows that the Planacon can achieve significantly better timing resolution if it can attain the same PDE as the R-9800, while only a 30% improvement is

Flash-ADCs test, optimization of the detector design and development of a new concept of spatial reconstruction in the double chooz neutrino oscillation experiment

International Nuclear Information System (INIS)

Akiri, T.

2010-09-01

Double Chooz (DC) is a reactor neutrino oscillation experiment whose purpose is the measurement of the last unknown mixing angle θ 13 . It inherits from the past Chooz experiment which was limited by the statistical and systematic errors at the same extent of about 2.8%. To lower the statistical error, the DC detector target mass has been increased and a longer exposure is foreseen while the lowering of the systematic error is ensured by the use of two identical detectors. One will be located in the vicinity of the reactor cores to monitor the flux and spectrum of the ν-bar e emitted whereas the other one will be located where the effect of the oscillation is expected to be maximal. They are respectively so-called 'near' and 'far' detectors. The expected errors are 0.5% (stat.) and 0.6% (syst.) for a measurement down to sin 2 (2*θ 13 ) = 0.05 (θ 13 6.5 degrees) at three standard deviations after three years of data taking. The far detector is expected for November 2010 while the near detector will be operational in mid-2012. This thesis presents first a hardware work consisting in testing the Flash-ADCs that are the core of the main acquisition system of the experiment. Subsequently, it presents analyses performed on Monte Carlo simulations towards the optimization of the detector design. This work was composed of analyses to choose some detector components with the appropriate natural radioactivity contamination, analyses for the best achievable energy resolution and the most stable and robust way of triggering. The work on the optimization of the detector together with the acquired knowledge on the Flash-ADCs led us to envisage the possibility of a new spatial reconstruction based on the time of flight. All these contributions to the experiment are described in details throughout this manuscript. (author)

A high resolution animal PET scanner using compact PS-PMT detectors

International Nuclear Information System (INIS)

Watanabe, M.; Okada, H.; Shimizu, K.; Omura, T.

1996-01-01

A new high resolution PET scanner dedicated to animal studies has been designed, built and tested. The system utilizes 240 block detectors, each of which consists of a new compact position-sensitive photomultiplier tube (PS-PMT) and an 8 x 4 BGO array. A total number of 7,680 crystals (480 per ring) are positioned to form a 508 mm diameter of 16 detector rings with 7.2 mm pitch and 114 mm axial field of view (FOV). The system is designed to perform activation studies using a monkey in a sitting position. The data can be acquired in either 2D or 3D mode, where the slice collimators are retracted in 3D mode. The transaxial resolution is 2.6 mm FWHM at the center of the FOV, and the average axial resolution on the axis of the ring is 3.3 mm FWHM in the direct slice and 3.2 mm FWHM in the cross slice. The scatter fraction, sensitivity and count rate performance were evaluated for a 10 cm diameter cylindrical phantom. The total system sensitivity is 2.3 kcps/kBq/ml in 2D mode and 22.8 kcps/kBq/ml in 3D mode. The noise equivalent count rate with 3D mode is equivalent to that with 2D mode at five times higher radioactivity level. The applicable imaging capabilities of the scanner was demonstrated by animal studies with a monkey

ATLAS TileCal Sub-Module Production at UIUC - Photos of Prototype PMT Test Setup

CERN Multimedia

Errede, Steve

2001-01-01

Photo 1 - Entrance to the lab. Photo 2 - A shot of the center of the lab. Photo 3 - The back of the lab. The Dark Box: Photo 4 - A view of the outside of the Dark Box along with its dry nitrogen system. Photo 5 - A view of the inside of the Dark Box. Photo 6 - The LED holder, beam splitter (removed in this shot), and a pulsing circuit. Photo 7 - The PMT holder. Photo 8 - A possible design for a Stepper Motor controlled filter wheel. Photo 9 - Polishing area for the optical fibers. R&D Work on Stepper Motor/Motion Control: Photo 10 - The complete prototype of the Stepper Motor setup. Photo 11 - The prototype of the Main Stepper Motor Driver Board. Photo 12 - The prototype of the Stepper Motor Power Amplifer. Photo 13 - The prototype of the Stepper Motor LabPC + Interface Board.

Faktor – Faktor yang Berhubungan demgan Pemberian Makanan Tambahan (PMT pada Bayi Usia (0-6 Bulan di Wilayah Kerja Puskesmas Garuda Kelurahan Tangkerang Tengah Kota Pekanbaru

Directory of Open Access Journals (Sweden)

Meliza Rasyid

2017-12-01

Full Text Available Pemberian Makanan Tambahan (PMT pada bayi adalah pemberian makanan atau minuman yang mengandung zat gizi pada bayi atau anak usia 6-24 bulan untuk memenuhi kebutuhan gizi setelah pemberian ASI Eksklusif. Pencapaian angka pemberian ASI eksklusif di Provinsi Riau Tahun 2011 adalah 45,9%, tahun 2012 meningkat menjadi 46,2%. Cakupan ASI Eksklusif Puskesmas tahun 2012 sebesar 60,4%, tahun 2013 menurun menjadi 32,5%. Tujuan penelitian untuk mengetahui faktor-faktor yang berhubungan dengan pemberian makanan tambahan (PMT pada bayi usia (0-6 bulan di Wilayah Kerja Puskesmas Garuda Kelurahan Tangkerang Tengah Kota Pekanbaru. Penelitian ini bersifat analitik kuantitatif observasional dengan desain (cross sectional dengan variable dependen pemberian makanan tambahan (PMT dan variabel independen (pendidikan, pekerjaan, pengetahua, dan sumber informasi. Populasi dalam penelitian ini adalah seluruh ibu-ibu yang memiliki bayi usia (0-6 bulan sebanyak 388 orang dengan sampel sebagian ibu-ibu yang memiliki bayi usia (0-6 bulan sebanyak 128. Teknik pengambilan sampel adalah quota sampling. Jenis data terdiri dari data primer dan data sekunder. Pengumpulan data primer diperoleh langsung dari pengamatan di lapangan melalui wawancara dengan alat pengukuran kuesioner. Analisis yang digunakan adalah analisis univariat, bivariat dengan uji Chi-square dan multivariat. Hasil penelitian menunjukkan terdapat hubungan antara pendidikan dengan Pemberian Makanan Tambahan dengan (P value 0,032, POR 95% CI = 2,338 1,137-4,808, pengetahuan dengan (P value 0,002, nilai POR 95% CI = 3,844 1,710-8,639 Disarankan ke instansi terkait untuk meningkatkan program komunikasi, informasi, dan edukasi (KIE, menjalin kerja sama lintas program dan lintas sektor, lebih aktif memberikan informasi kepada ibu yang memiliki bayi usia (0-6 bulan dengan pendidikan dan pengetahuan yang masih rendah salah satunya melalui penyuluhan tentang pemberian makanan tambahan (PMT.   Kata Kunci

Programmable integrated front-end for SiPM/PMT PET detectors with continuous scintillating crystal

OpenAIRE

Herrero Bosch, Vicente; Monzó Ferrer, José María; Ros García, Ana; Aliaga Varea, Ramón José; González Martínez, Antonio Javier; Montoliu, C.; Colom Palero, Ricardo José; Benlloch Baviera, Jose María

2012-01-01

AMIC architecture has been introduced in previous works in order to provide a generic and expandable solution for implementing large number of outputs SiPM array/PMT detectors. The underlying idea in AMIC architecture is to calculate the moments of the detected light distribution in an analog fashion. These moments provide information about energy, x/y position, etc. of the light distribution of the detected event. Moreover this means that a small set of signals contains most of the informati...

Pengaruh pemberian makanan tambahan (PMT pada ibu hamil terhadap berat lahir bayi

Directory of Open Access Journals (Sweden)

Hana Shafiyyah Zulaidah

2014-10-01

Full Text Available Background: Anemia causes fetal growth disorders that affect birth weight. Antenatal care (ANC coverage and provision of high Fe if not followed by a decrease in the incidence of anemia can result indirectly in the risk of low birth weight. Supplementary feeding is expected to resolve the issue. Objective: To assess the effect of supplementary feeding on the third trimester of pregnancy on birth weight. Method: This was a quantitative study with a study design of quasi-experiment and non-equivalent control group. The given intervention was fish-processed feeding for 30 days. The study population was pregnant women in the third trimester in all health centers in the City of Yogyakarta and the samples were 104 pregnant women in some health centers with convenience sampling technique. The subjects were divided into two, namely the treatment group (PMT and the comparison group (non-PMT. Birth weight was weighed immediately after the baby was born. Statistical analysis used t-test and logistic regression. Results: The mean birth weight of infants in the treatment group and the comparison group was 3248 g and 2974 g, respectively, so that the difference in the mean birth weight of both groups was 274 g (p=0.0002; 95%C:131-416. Thus, supplementary feeding was shown significantly affect the birth weight. The extraneous variables that significantly influenced birth weight were pregnancy interval. Other extraneous variables were age, mid-upper-arm circumference (MUAC, education, occupation, economic status, parity, protein intake, compliance of Fe tablet intake, antenatal care, gestational age at delivery and anemia status were not proven statistically significant to affect birth weight. Conclusion: Supplementary feeding effect on birth weight.

Assessment the Effect of Educational Intervention on Preventive Behaviors of Home Accidents in Mothers with Children Less than 5- Year Based on Protection Motivation Theory (PMT

Directory of Open Access Journals (Sweden)

Farbod Ebadi Fardazar

2016-07-01

Full Text Available Background: The accidents are the leading cause of morbidity and mortality among children in in the world. The aim of this study was to determine the effect of Educational intervention on promotion of prevention behaviors of home accidents in mothers with children less than 5- year based on protection motivation theory (PMT in 2015. Materials and Methods: In this controlled interventional study 190 mothers with children less than 5 years were participated (95 in intervention group and 95 in control group.The data collection tool was researcher made questionnaire based on the structures of PMT. After done pre-test and the results obtained from it, appropriate educational intervention designed and was conducted only in intervention group. Then two months after the educational intervention, evaluation was done and data analysis was using SPSS-20. Results: Statistically significant difference was found between mean scores of all structures of PMT in intervention and control groups after the educational intervention (P

A PMT mass testing facility for the JUNO experiment

Energy Technology Data Exchange (ETDEWEB)

Tietzsch, Alexander; Alsheimer, Isabell; Blum, David; Lachenmaier, Tobias; Sterr, Tobias [Physikalisches Institut, Universitaet Tuebingen (Germany); Bein, Bosse; Bick, Daniel; Ebert, Joachim; Hagner, Caren; Rebber, Henning; Steppat, Lisa; Wonsak, Bjoern [Institut fuer Experimentalphysik, Universitaet Hamburg (Germany)

2016-07-01

The JUNO (Jiangmen Underground Neutrino Observatory) experiment will be one of the big neutrino oscillation experiments starting in the next years. The main goal of JUNO is the determination of the neutrino mass hierarchy. To detect the sub-dominant effects in the oscillation pattern which depend on the mass hierarchy, the JUNO detector is planned with almost 20 kt fiducial volume, high light yield and energy resolution of better than 3%. In order to reach this, roughly 17000 newly developed high QE PMTs for the central detector, and additionally 2000 for the veto will be used. Each PMT has to be tested and characterized before it will be mounted in the experiment. This talk gives an overview on our plans and strategy for the mass test of all PMTs, and on the current status of the experimental test setup and next steps. The testing facility is developed in a cooperation between the Physical Institutes in Tuebingen and Hamburg within the JUNO collaboration.

Assessment of hepatic functional reserve for hepatic resection using {sup 99m}Tc-PMT scintigraphy in comparison with {sup 99m}Tc-GSA scintigraphy

Energy Technology Data Exchange (ETDEWEB)

Sakuma, Atsushi [Dokkyo Univ. School of Medicine, Mibu, Tochigi (Japan)

2000-03-01

{sup 99m}Tc-diethylenetriamine-pentaacetic acid-galactosyl human serum albumin({sup 99m}Tc-GSA) scintigraphy has been reported as a useful study of hepatic functional reserve recently. We have performed {sup 99m}Tc-N-pyridoxyl-5-methyl-tryptophan({sup 99m}Tc-PMT) and {sup 99m}Tc-GSA preoperatively for evaluation of hepatic functional reserve and compared the usefulness of those scintigraphy study. Twenty-four patients who were the candidates of hepatic resection underwent {sup 99m}Tc-PMT scintigraphy preoperatively. Hepatic blood flow coefficient (K value), the amount of hepatic blood flow (HBF), and the ratio of portal blood flow (PVR) were computed. {sup 99m}Tc-GSA scintigraphy was also performed within two weeks of the {sup 99m}Tc-PMT scintigraphy, and the ratio of disappearance (HH{sub 15}) and the hepatic uptake ratio (LHL{sub 15}) were computed. The relationship between K value, HBF, PVR, HH{sub 15} and LHL{sub 15} was analyzed. Their correlation with other liver function tests was also examined. K value and HBF did not show statistically significant correlations with HH{sub 15} and LHL{sub 15}, PVR correlated statistically significantly HH{sub 15} and LHL{sub 15}. K value correlated with the preoperative values of cholinesterase, Fischer ratio, {gamma}-globulin, ICGR{sub 15}, albumin, and platelet count. There was a statistically significant correlation between LHL{sub 15} and the value of cholinesterase, {gamma}-globulin, platelet count, and Fischer ratio. When the liver resection of subsegmentectomy or more was indicated in 10 patients, nine patients had LHL{sub 15} value less than 0.9 which delineated possibility of poor prognosis. However, judging from K value and HBF, liver resection was considered feasible and it was all successfully performed, resulting in good prognosis. From this study, it is suspected that {sup 99m}Tc-GSA scintigraphy reflect the severity of liver fibrosis and the amount of portal blood flows, and {sup 99m}Tc-PMT scintigraphy

Promoting scopolamine biosynthesis in transgenic Atropa belladonna plants with pmt and h6h overexpression under field conditions.

Science.gov (United States)

Xia, Ke; Liu, Xiaoqiang; Zhang, Qiaozhuo; Qiang, Wei; Guo, Jianjun; Lan, Xiaozhong; Chen, Min; Liao, Zhihua

2016-09-01

Atropa belladonna is one of the most important plant sources for producing pharmaceutical tropane alkaloids (TAs). T1 progeny of transgenic A. belladonna, in which putrescine N-methyltransferase (EC. 2.1.1.53) from Nicotiana tabacum (NtPMT) and hyoscyamine 6β-hydroxylase (EC. 1.14.11.14) from Hyoscyamus niger (HnH6H) were overexpressed, were established to investigate TA biosynthesis and distribution in ripe fruits, leaves, stems, primary roots and secondary roots under field conditions. Both NtPMT and HnH6H were detected at the transcriptional level in transgenic plants, whereas they were not detected in wild-type plants. The transgenes did not influence the root-specific expression patterns of endogenous TA biosynthetic genes in A. belladonna. All four endogenous TA biosynthetic genes (AbPMT, AbTRI, AbCYP80F1 and AbH6H) had the highest/exclusive expression levels in secondary roots, suggesting that TAs were mainly synthesized in secondary roots. T1 progeny of transgenic A. belladonna showed an impressive scopolamine-rich chemotype that greatly improved the pharmaceutical value of A. belladonna. The higher efficiency of hyoscyamine conversion was found in aerial than in underground parts. In aerial parts of transgenic plants, hyoscyamine was totally converted to downstream alkaloids, especially scopolamine. Hyoscyamine, anisodamine and scopolamine were detected in underground parts, but scopolamine and anisodamine were more abundant than hyoscyamine. The exclusively higher levels of anisodamine in roots suggested that it might be difficult for its translocation from root to aerial organs. T1 progeny of transgenic A. belladonna, which produces scopolamine at very high levels (2.94-5.13 mg g(-1)) in field conditions, can provide more valuable plant materials for scopolamine production. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

Muon background studies for shallow depth Double - Chooz near detector

Energy Technology Data Exchange (ETDEWEB)

Gómez, H. [Laboratoire Astroparticule et Cosmologie (APC) - Université Paris 7. Paris (France)

2015-08-17

Muon events are one of the main concerns regarding background in neutrino experiments. The placement of experimental set-ups in deep underground facilities reduce considerably their impact on the research of the expected signals. But in the cases where the detector is installed on surface or at shallow depth, muon flux remains high, being necessary their precise identification for further rejection. Total flux, mean energy or angular distributions are some of the parameters that can help to characterize the muons. Empirically, the muon rate can be measured in an experiment by a number of methods. Nevertheless, the capability to determine the muons angular distribution strongly depends on the detector features, while the measurement of the muon energy is quite difficult. Also considering that on-site measurements can not be extrapolated to other sites due to the difference on the overburden and its profile, it is necessary to find an adequate solution to perform the muon characterization. The method described in this work to obtain the main features of the muons reaching the experimental set-up, is based on the muon transport simulation by the MUSIC software, combined with a dedicated sampling algorithm for shallow depth installations based on a modified Gaisser parametrization. This method provides all the required information about the muons for any shallow depth installation if the corresponding overburden profile is implemented. In this work, the method has been applied for the recently commissioned Double - Chooz near detector, which will allow the cross-check between the simulation and the experimental data, as it has been done for the far detector.

Muon background studies for shallow depth Double - Chooz near detector

International Nuclear Information System (INIS)

Gómez, H.

2015-01-01

Muon events are one of the main concerns regarding background in neutrino experiments. The placement of experimental set-ups in deep underground facilities reduce considerably their impact on the research of the expected signals. But in the cases where the detector is installed on surface or at shallow depth, muon flux remains high, being necessary their precise identification for further rejection. Total flux, mean energy or angular distributions are some of the parameters that can help to characterize the muons. Empirically, the muon rate can be measured in an experiment by a number of methods. Nevertheless, the capability to determine the muons angular distribution strongly depends on the detector features, while the measurement of the muon energy is quite difficult. Also considering that on-site measurements can not be extrapolated to other sites due to the difference on the overburden and its profile, it is necessary to find an adequate solution to perform the muon characterization. The method described in this work to obtain the main features of the muons reaching the experimental set-up, is based on the muon transport simulation by the MUSIC software, combined with a dedicated sampling algorithm for shallow depth installations based on a modified Gaisser parametrization. This method provides all the required information about the muons for any shallow depth installation if the corresponding overburden profile is implemented. In this work, the method has been applied for the recently commissioned Double - Chooz near detector, which will allow the cross-check between the simulation and the experimental data, as it has been done for the far detector

Protecting children from myopia: a PMT perspective for improving health marketing communications.

Science.gov (United States)

Lwin, May O; Saw, Seang-Mei

2007-01-01

This research examined the predictive utility of the protection motivation theory (PMT) model for myopia prevention amongst children. An integrative model for myopia prevention behavior of parents was first developed in the context of theory and survey instruments then refined using information gathered from two focus groups. Empirical data then was collected from parents of primary school children in Singapore, a country with one of the highest rates of myopia in the world, and analyzed using structural equation modeling (SEM). Our findings revealed that coping appraisal variables were more significantly associated with protection motivation, relative to threat appraisal variables. In particular, perceived self-efficacy was the strongest predictor of parental intention to enforce good visual health behaviors, while perceived severity was relatively weak. Health marketing communications and public policy implications are discussed.

Clinical evaluation of the scoring of optical findings with technetium-99m-N-pyridoxyl-5-methyl-tryptophan (PMT) hepatobiliary scintigraphy for fulminant hepatitis

International Nuclear Information System (INIS)

Uchiyama, Katsuhiro; Kuniyasu, Yoshio; Niio, Yasuo

1998-01-01

Fulminant hepatitis is one of the most life-threatening diseases for which adequate medical therapy does not exist. Then, we evaluated the usefulness of technetium-99m-N-pyridoxyl-5-methyl-tryptophan (PMT) hepatobiliary scintigraphy to estimate the diagnosis and prognosis of fulminant hepatitis. In total 60 patients, 23 with fulminant hepatitis (FH), 25 with severe acute hepatitis (SAH) and 12 with acute hepatitis (AH), computer data acquisition by gamma-camera system started just after the injection of 185 MBq 99m Tc-PMT. The optical finding score which included cardiac blood pool remaining time (0-3), distribution of radioactivity in the liver (0-3), extrahepatic bile duct (EHBD) and intestine appearance time (0-3) were studied. The cardiac blood pool remaining time score was 2.8±0.5 in FH, 2.2±0.8 in SAH, 0.9±1.1 in AH. The intrahepatic distribution score was 2.1±0.8 in FH, 0.3±0.6 in SAH, 0.1±0.3 in AH. The EHBD and intestine appearance time score was 1.9±1.1 in FH, 1.5±1.2 in SAH, 0.3±0.6 in AH. The total score was 6.7±1.4 in FH, 4.0±1.6 in SAH, 1.3±1.3 in AH. There were significantly statistical differences among three groups. While, the cardiac blood pool remaining time score was 3.0±0 in 14 hospital death patients (HD), 1.9±1.0 in 46 alive patients (AL). The intrahepatic distribution score was 2.2±0.8 in HD, 0.5±0.9 in AL. The EHBD and intestine appearance time score was 2.1±1.2 in HD, 1.2±1.1 in AL. The total score was 7.3±1.3 in HD, 3.6±2.2 in AL. There were significantly statistical differences in these groups. The optimal finding score of 99m Tc-PMT hepatobiliary scintigraphy was useful in establishing the diagnosis and prognosis of FH. (author)

High-Resolution Imaging System (HiRIS) based on H9500 PSPMT

International Nuclear Information System (INIS)

Trotta, C.; Massari, R.; Trinci, G.; Palermo, N.; Boccalini, S.; Scopinaro, F.; Soluri, A.

2008-01-01

The H8500 PhotoMultiplier Tube (PMT) from Hamamatsu has been used in the last years to assemble several scintigraphic devices in order to achieve high-resolution gamma cameras. If the detector is coupled to discrete scintillator with millimetric pixel size, the resulting charge distribution that emerges is not properly sampled by its anodes (6x6 mm 2 ). The new position sensitive PMT H9500, with its 3x3 mm 2 anodes, allows a better charge distribution sampling, improving both spatial resolution and linearity of the system. In this paper, we investigate the imaging performances of the H9500 PMT coupled with a CsI(Tl) array having 1 mm pixel size and compare the results with the same scintillator coupled with H8500 PMT. A portable imaging system named HiRIS (High-Resolution Imaging System) was then realized using a miniaturized readout electronic. Thanks to its lightness, it can be easily used in Medical Imaging. We used HiRIS, together with a rotating system, to carry out a tomographic reconstruction of the biodistribution of a radiopharmaceutical in rats

Chooz-B1, the new Electricite de France PWR: calculation scheme of neutron leakages from the reactor cavity

International Nuclear Information System (INIS)

Champion, G.; Thiriet, A.; Vergnaud, T.; Bourdet, L.; Nimal, J.C.; Brandicourt, G.

1987-04-01

A new calculation scheme has been set up to assess the neutron field characteristics inside French PWR. In order to take into account multiple neutron scattering and the complexity of the reactor geometry, the use of Monte-Carlo methods have been heavily increased. They are coupled with classical SN.-methods. The main goal aimed at was to find out the neutron field characteristics at the level of the reactor pit openings. These radiation reference sources will be used to check the neutron shielding efficiencies. The new calculation scheme has been applied to CHOOZ-B1, the first unit of the new N4 program. The former results have been compared with the measurement results related to PALUEL-I and II PWR, two units of the previous P4 program. Although the core and the geometry are not entirely similar, it is possible to check with confidence the calculation results along the vessel and at the core midplane level with the measurement results at the same locations. It appears that they are in good agreement. Consequently, the new calculation scheme appears reliable

The data acquisition system for a SPECT with cylindrical detector

International Nuclear Information System (INIS)

Jin Yongjie; Liu Yinong; Li Yuanjing

1995-01-01

The data acquisition and position estimation system has been developed for a multi-crystal SPECT with modular cylindrical detector. The electronics screen photon energy determines the detector module stricken by incident photon. The relevant PMT outputs are digitized and passed onto a Pentium PC. Then PMT gain normalization, detector bar identification, energy correction, event coordinates calculation and linearity correction are real-time performed by the PC. The system has been employed in clinical brain imaging

Lessons learned from ten years of terrestrial radio - ecological monitoring campaigns conducted around chooz NPP between 1995 and 2005

International Nuclear Information System (INIS)

Burton, O.; Bourdon, M; Aubinet, M.; Calande, E. C.; Tomasevszky, D.; Sombre, L.

2006-01-01

Radio-ecological monitoring campaigns around the Chooz PWR nuclear power plant (Ardennes - France), located at a few kilometres of the Belgian border, have been conducted on the Belgian territory, between 1995 and 2005, with the aim of observing the concentrations of radionuclides of major environmental significance in soils and agricultural products and their time evolution. The following conclusions are drawn from these campaigns : - the time evolution of the observed radioactivity levels remains rather constant ; - except 1 4C which is of natural origin but is also released in airborne discharges of nuclear power plants, the artificial isotopes still significantly detected in the agricultural ecosystem are the 1 37Cs (generated by the Chernobyl accident and the military test explosions) and the 9 0Sr (generated by the military test explosions) ; - grass remains the best indicator of contamination of the agricultural ecosystem by 1 37Cs and 9 0Sr ; - the major contributors to the total soil and plant activities are from far radionuclides of natural origin, the major contributor being 4 0K

A system for the characterization of the HAWC PMTs sensitivity

Science.gov (United States)

Langarica, R.; Lara, G.; Martinez, L. A.; Tinoco, S.; Alfaro, R.; Iriarte, A.; Sandoval, A.; Vanegas, P.

2012-07-01

The HAWC Project is a very high-energy gamma-ray observatory under construction at the Sierra Negra volcano (4100 meters above sea level) in the Pico de Orizaba National Park located in central Mexico. HAWC will reuse the 900 Hamamatsu R5912 photomultipliers (PMTs) from Milagro Observatory for the 300 Water Cherenkov Detectors. In order to characterize their present performance it is necessary to scan the active area of the photocathode by measuring its efficiency and gain. A characterization system was designed and manufactured to achieve an automated measurement of over 100 points distributed on the PMT active spherical surface. Preliminary results show the variation of QE of PMTs with respect of the position of incoming photons, as well as the changes in the PMTs response due to the Earth's magnetic field and gain vs. high voltage. The system allows automated PMT characterization improving its performance, reliability, precision and repeatability. In this work we present the characterization system and preliminary results on the PMT efficiency.

Investigation of the Chooz-A nuclear power plant bolts

International Nuclear Information System (INIS)

Monnet, I.; Decroix, G.M.; Dubuisson, P.; Reuchet, J.; Morlent, O.

2002-01-01

In Pressurised Water Reactor, some baffle-former bolts in austenitic stainless steel, are submitted to an important Intergranular cracking. This cracking may be attributed to the irradiation hardening during in pile service. As part of its concern of safety related to the ageing of the plant and, in particular, to the behaviour of the internals, IRSN wished to take part in the expertise Program on CHOOZ A power nuclear plant, within the framework of a convention with EDF, which provided the baffle-bolts. Examinations of these bolts, after 140 000 of in pile service, were carried out by the laboratories of the CEA. Hardness profiles were carried out on four bolts, which were irradiated at different doses, ranging from 0 to 22 dpa. The bolt of the core barrel, considered as unirradiated, shows a constant value of hardness, equal to the value of unirradiated material, all along the bolt and a slight increase in the head of the screw. The axial profile of hardness carried out on an irradiated bolt shows that there is a gradient of hardness between the most irradiated part (400 Hv) and the least irradiated part (270 Hv). The hardness of this bolt starts to evolve at 2.5 dpa and the maximum of hardening is reached for the most irradiated part (3.6 dpa). The hardness profile on the most irradiated bolt (between 10 and 22 dpa) indicate that hardness is homogeneous all along the bolt, 400 Hv. It confirms the existence of a threshold dose beyond which hardness does not vary any more, this threshold is estimated to be between 3.6 dpa and 10 dl Microstructural examinations of these bolts led us to conclude that hardening is correlated to dislocation microstructure. Indeed, the examination of the bolt of the core barrel confirms that this bolt is hardly unirradiated since the initial network of dislocations was not modified and that only some rare dislocation loops were observed. This is in agreement with hardness results showing no hardening of this bolt. On the two more

The performance of a high speed pipelined photomultiplier readout system in the Fermilab KTe V experiment

International Nuclear Information System (INIS)

Whitmore, J.

1997-08-01

The KTeV fixed target experiment at Fermilab is using an innovative scheme for reading out its 3100 channel CsI electromagnetic calorimeter. This pipelined readout system digitizes photomultiplier tube (PMT) signals over a 16-bit dynamic range with 8-bits of resolution at 53 MHz. The crucial element of the system is a custom Bi-CMOS integrated circuit which, in conjunction with an 8-bit Flash ADC, integrates and digitizes the PMT signal charge over each 18.9 nsec clock cycle (53 MHz) in a deadtimeless fashion.The digitizer circuit is local to the PMT base, and has an in-situ charge integration noise figure of 3 fC/sample. In this article, the readout system will be described and its performance including noise, cross-talk, linearity, stability, and reliability will be discussed

Utilization of FADC for reconstruction and analysis of the background data in the Chooz neutrino experiment

International Nuclear Information System (INIS)

Veron, Didier

1997-01-01

This thesis describes a particular contribution to the Chooz experiment. The latter looks for the oscillations, over a distance of 1 km, of antineutrons emitted by two nuclear reactors. The electron-type antineutrinos are detected through their inverse beta interaction with a target's proton. The neutron is detected through its capture by a gadolinium nucleus revealed by an 8 MeV gamma emission. In the first part we describe the reconstruction of events as simulated by the GIANT software. We show that the positron's and neutron's stopping point can actually be reconstructed with an accuracy of 10 and 20 cm respectively. In the second part, we proceed to the analysis of the calibration's data as recorded with Fast Wave Form Digitizers. This confirms the reliability of the Monte-Carlo results and allows measurement of both the neutrons' capture probability and time by the target gadolinium. The last part deals with the background (reactor turned off) data analysis and the pin-pointing of its various sources. In order to reduce their contribution, we define spatial cuts. These cuts' reliability is validated by analysis of data obtained not only with a neutron source, but also with neutrons issued from cosmic rays. We end up with a background contribution of two to three events per day, about ten times less than the expected neutrino rate at full reactor power. (author)

Online Data Monitoring Framework Based on Histogram Packaging in Network Distributed Data Acquisition Systems

International Nuclear Information System (INIS)

Konno, T; Ishitsuka, M; Kuze, M; Cabarera, A; Sakamoto, Y

2011-01-01

O nline monitor frameworkis a new general software framework for online data monitoring, which provides a way to collect information from online systems, including data acquisition, and displays them to shifters far from experimental sites. 'Monitor Server', a core system in this framework gathers the monitoring information from the online subsystems and the information is handled as collections of histograms named H istogram Package . Monitor Server broadcasts the histogram packages to 'Monitor Viewers', graphical user interfaces in the framework. We developed two types of the viewers with different technologies: Java and web browser. We adapted XML based file for the configuration of GUI components on the windows and graphical objects on the canvases. Monitor Viewer creates its GUIs automatically with the configuration files.This monitoring framework has been developed for the Double Chooz reactor neutrino oscillation experiment in France, but can be extended for general application to be used in other experiments. This document reports the structure of the online monitor framework with some examples from the adaption to the Double Chooz experiment.

Decree no. 96-927 from October 16, 1996 giving permission to Electricite de France to operate the Ardennes nuclear power plant including the basic nuclear installations no. 1 (reactor and auxiliary circuits), no. 2 (radioactive effluents processing plant) and no. 3 (fuel storage building), located on the territory of Chooz town (Ardennes)

International Nuclear Information System (INIS)

Borotra, F.

1996-01-01

This decree from the French ministry of industry and postal services gives to Electricite de France (EDF) the official permission to operate the Chooz nuclear power plant previously operated by the French-Belgium nuclear energy Society of the Ardennes. The operation will follow the conditions previously imposed to this Society. (J.S.)

Validation of GEANT3 simulation studies with a dual-head PMT ClearPET TM prototype

CERN Document Server

Ziemons, K; Streun, M; Pietrzyk, U

2004-01-01

The ClearPET TM project is proposed by working groups of the Crystal Clear Collaboration (CCC) to develop a 2/sup nd/ generation high performance small animal positron emission tomograph (PET). High sensitivity and high spatial resolution is foreseen for the ClearPET TM camera by using a phoswich arrangement combining mixed lutetium yttrium aluminum perovskite (LuYAP:Ce) and lutetium oxyorthosilicate (LSO) scintillating crystals. Design optimizations for the first photomultiplier tube (PMT) based ClearPET camera are done with a Monte-Carlo simulation package implemented on GEANT3 (CERN, Geneva, Switzerland). A dual-head prototype has been built to test the frontend electronics and was used to validate the implementation of the GEANT3 simulation tool. Multiple simulations were performed following the experimental protocols to measure the intrinsic resolution and the sensitivity profile in axial and radial direction. Including a mean energy resolution of about 27.0% the simulated intrinsic resolution is about (...

Utilization of FADC for reconstruction and analysis of the background data in the Chooz neutrino experiment; Utilisation des FADC pour la reconstruction et l`analyse des donnees de bruit de fond dans l`experience neutrino de Chooz

Energy Technology Data Exchange (ETDEWEB)

Veron, Didier [Universite Claude Bernard, 69 - Lyon (France)

1997-03-25

This thesis describes a particular contribution to the Chooz experiment. The latter looks for the oscillations, over a distance of 1 km, of antineutrons emitted by two nuclear reactors. The electron-type antineutrinos are detected through their inverse beta interaction with a target`s proton. The neutron is detected through its capture by a gadolinium nucleus revealed by an 8 MeV gamma emission. In the first part we describe the reconstruction of events as simulated by the GIANT software. We show that the positron`s and neutron`s stopping point can actually be reconstructed with an accuracy of 10 and 20 cm respectively. In the second part, we proceed to the analysis of the calibration`s data as recorded with Fast Wave Form Digitizers. This confirms the reliability of the Monte-Carlo results and allows measurement of both the neutrons` capture probability and time by the target gadolinium. The last part deals with the background (reactor turned off) data analysis and the pin-pointing of its various sources. In order to reduce their contribution, we define spatial cuts. These cuts` reliability is validated by analysis of data obtained not only with a neutron source, but also with neutrons issued from cosmic rays. We end up with a background contribution of two to three events per day, about ten times less than the expected neutrino rate at full reactor power. (author) 81 refs., 152 figs.,43 tabs.

Computer-based expert system aids underground mine planning

Energy Technology Data Exchange (ETDEWEB)

Britton, S.G.

1987-04-01

Artificial intelligence (AI) systems have been rapidly expanded over the last few years to aid in the decision making processes in a whole range of industries, including the use of machines for operating in high risk/dangerous areas such as at the working faces in longwall mining. Using Prolog software a program for mine management is being developed called CHOOZ. This system can help managers identify staffing problems and change manpower shifts to cope with unexpected labor problems such as absenteeism and sickness. All the programs have been developed for the IBM PC microcomputer.

Design and simulation of a novel method for determining depth-of-interaction in a PET scintillation crystal array using a single-ended readout by a multi-anode PMT

International Nuclear Information System (INIS)

Ito, Mikiko; Sim, Kwang-Souk; Lee, Jae Sung; Park, Min-Jae; Hong, Seong Jong

2010-01-01

PET detectors with depth-of-interaction (DOI) encoding capability allow high spatial resolution and high sensitivity to be achieved simultaneously. To obtain DOI information from a mono-layer array of scintillation crystals using a single-ended readout, the authors devised a method based on light spreading within a crystal array and performed Monte Carlo simulations with individual scintillation photon tracking to prove the concept. A scintillation crystal array model was constructed using a grid method. Conventional grids are constructed using comb-shaped reflector strips with rectangular teeth to isolate scintillation crystals optically. However, the authors propose the use of triangularly shaped teeth, such that scintillation photons spread only in the x-direction in the upper halves of crystals and in the y-direction in lower halves. DOI positions can be estimated by considering the extent of two-dimensional light dispersion, which can be determined from the multiple anode outputs of a position-sensitive PMT placed under the crystal array. In the main simulation, a crystal block consisting of a 29 x 29 array of 1.5 mm x 1.5 mm x 20 mm crystals and a multi-anode PMT with 16 x 16 pixels were used. The effects of crystal size and non-uniform PMT output gain were also explored by simulation. The DOI resolution estimated for 1.5 x 1.5 x 20 mm 3 crystals was 2.16 mm on average. Although the flood map was depth dependent, each crystal was well identified at all depths when a corner of the crystal array was irradiated with 511 keV gamma rays (peak-to-valley ratio ∼9:1). DOI resolution was better than 3 mm up to a crystal length of 28 mm with a 1.5 x 1.5 mm 2 or 2.0 x 2.0 mm 2 crystal surface area. The devised light-sharing method allowed excellent DOI resolutions to be obtained without the use of dual-ended readout or multiple crystal arrays.

Simulation of the electron collection efficiency of a PMT based on the MCP coated with high secondary yield material

Energy Technology Data Exchange (ETDEWEB)

Chen, Lin, E-mail: chenlin@opt.cn [State Key Laboratory of Transient Optics and Photonics, Xi' an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi' an 710119 (China); Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Xi' an Jiaotong University, Xi' an 710049 (China); Collaborative Innovation Center of Extreme Optics, Shanxi University, Taiyuan 030006 (China); Tian, Jinshou [State Key Laboratory of Transient Optics and Photonics, Xi' an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi' an 710119 (China); Collaborative Innovation Center of Extreme Optics, Shanxi University, Taiyuan 030006 (China); Zhao, Tianchi [Institute of High Energy Physics (IHEP) of CAS, Beijing 100049 (China); Liu, Chunliang [Xi' an Jiaotong University, Xi' an 710049 (China); Liu, Hulin; Wei, Yonglin; Sai, Xiaofeng [State Key Laboratory of Transient Optics and Photonics, Xi' an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi' an 710119 (China); Chen, Ping [State Key Laboratory of Transient Optics and Photonics, Xi' an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi' an 710119 (China); Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Wang, Xing; Lu, Yu [State Key Laboratory of Transient Optics and Photonics, Xi' an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi' an 710119 (China); Hui, Dandan [State Key Laboratory of Transient Optics and Photonics, Xi' an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi' an 710119 (China); Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China)

2016-11-01

Owning to the serious loss of photoelectrons striking at the input electrode of traditional microchannel plate (MCP), photoelectron collection efficiency (CE) of photomultiplier tubes based on MCP (MCP-PMTs) fluctuates around the MCP open area fraction and cannot make a breakthrough. Depositing a thin film of high secondary electron yield material on the MCP is proposed as an effective approach to improve the CE. The available simulation and experimental data to validate it, however, is sparse. In our work, a three-dimensional small area MCP model is developed in CST Studio Suite to evaluate the collection efficiencies of PMTs based on the traditional MCP and the coated one, respectively. Results predict that CE of the PMT based on the coated MCP has a significant increase and a better uniformity, which is expected to reach 100%.

Automatic test system of the photomultipliers

International Nuclear Information System (INIS)

Shiino, Kazuo; Kono, Koji; Ishii, Takanobu; Kasai, Seiji; Yamada, Sakue; Kitamura, Shoichi.

1990-03-01

A test system of R580 photomultipliers (PMTs) was constructed for the ZEUS experiment HERA. In this report, we will describe the general feature of the test system, each component of the setup, the procedure of the measurements, the data analyses and the results of the first 800 PMT measurements. (author)

Pulse Shape Tuning in Neutrino Detector Scintillator Systems

Energy Technology Data Exchange (ETDEWEB)

Aberle, Ch.; Buck, Ch.; Hartmann, F.X.; Schoenert, St. [Max Planck Institute for Nuclear Physics, Heidelberg (Germany); Hartmann, F.X. [Hartmann Scientific, City of Virginia Beach, Virginia (United States)

2009-07-01

Full text of publication follows: A new light yield model based on energy transfer pathways in codoped organic liquid scintillator systems is created and used to determine experimentally non-radiative energy transfer rate constants from which time dependent light pulse shapes and total light yields are predicted for multi-component liquids. Such constants determine effective Forster-Dexter critical concentrations. A surprising discovery regarding the critical concentration in n-dodecane permits tuning the pulse shape for different regions in the Double Chooz neutrino detector. (authors)

Measurement of θ_1_3 in Double Chooz using neutron captures on hydrogen with novel background rejection techniques

International Nuclear Information System (INIS)

Abe, Y.; Appel, S.; Abrahão, T.; Almazan, H.

2016-01-01

The Double Chooz collaboration presents a measurement of the neutrino mixing angle θ_1_3 using reactor ν̄_e observed via the inverse beta decay reaction in which the neutron is captured on hydrogen. This measurement is based on 462.72 live days data, approximately twice as much data as in the previous such analysis, collected with a detector positioned at an average distance of 1050 m from two reactor cores. Several novel techniques have been developed to achieve significant reductions of the backgrounds and systematic uncertainties. Accidental coincidences, the dominant background in this analysis, are suppressed by more than an order of magnitude with respect to our previous publication by a multi-variate analysis. These improvements demonstrate the capability of precise measurement of reactor ν̄_e without gadolinium loading. Spectral distortions from the ν̄_e reactor flux predictions previously reported with the neutron capture on gadolinium events are confirmed in the independent data sample presented here. A value of sin"2 2θ_1_3=0.095_−_0_._0_3_9"+"0"."0"3"8(stat+syst) is obtained from a fit to the observed event rate as a function of the reactor power, a method insensitive to the energy spectrum shape. A simultaneous fit of the hydrogen capture events and of the gadolinium capture events yields a measurement of sin"2 2θ_1_3=0.088±0.033(stat+syst).

Analysis and Toxicity of Plain (PMP) and Blended (PMT) Indian Pan Masala (PM).

Science.gov (United States)

Nigam, Suresh Kumar; Venkatakrishna-Bhatt, H

2013-02-01

Betel leaf combined with areca nut is known as betel quid pan masala (PM), and tobacco with areca nut, catechu and lime is pan masala (PMT) blended with gulkhand. These narcotics are popular among young and old individuals. A prima facia chemical analysis and a toxicity assessment of PM in mice were conducted to study the relationship between longtime consumption of PM and health hazards. Chemical analysis of different types of PM was done employing HPLC, GLC, AAS, ES, TLC, GCMS and sequential extraction for PAH, pesticides, metals and minerals, electrolytes, drugs and xenobiotics. Ethanolic PM extracts were tested by IP and PO routes in inbred Swiss mice. PAH, which are known xenobiotics for pre-cancerous lesions, were significantly high (peffect on blood and organ weights (kidney, heart, spleen and liver), but we did observe attenuated testis. However, in the bone marrow of the mice, chromosomes were most affected in the mice fed PM-Zarda blend for 3 months. The chromosomal abnormalities included ploidy, loss, breaks, gaps, deletions and exchanges in ring chromosomes. The PM caused sperm head anomalies (narrow, blunt, triangular and banana shapes), and the sperm were irregular, amorphous, tailless and rudimentary, with the maximum effect among the groups fed PM for 3 months. Significantly higher levels (p<0.01) of testis glycogen, cholesterol and protein were found. The group fed for 16 days showed no change in red blood corpuscles (RBC), white blood corpuscles (WBC), hemoglobin and erythrocyte sedimentation counts.

Noise Filter Studies for CMS Forward Hadron Calorimeter (HF) Between Old and New PMT's Using Data in 2012

CERN Document Server

Dumanoglu, Isa; Gurpinar, Emine; Kunori, Shuichi; Lezki, Samet; Tali, Bayram

2016-01-01

During the data taking before 2012 some abnormal events which have higher signals than expected were observed. Most of these were due to muons. When a muon hits the PMT glass window it creates a huge signal. To eliminate this kind of events 24 old HF PMTs (Hamamatsu R7525) in HF Minus at iphi 43 (corresponds to one sector) were replaced with new multi anode PMTs (Hamamatsu multi anode R7600) which have thin glass windows. These new PMTs were installed and tested in H2 test beam area in 2009 [1]. To check whether these new PMTs perform better than the old ones data taken in 2012 were analyzed using various predefined noise filters. Noisy rechits percentage was found to be around 6-7 \\% for the new PMTs while it varies between 29-66 \\% for the old PMTs for various trigger selections and for HFLongShortFilter after an energy cut of 500GeV [2].

QUALITY ASSESSMENT OF CONFOCAL MICROSCOPY SLIDE-BASED SYSTEMS: INSTABLITY

Science.gov (United States)

Background: All slide-based fluorescence cytometry detections systems basically include an excitation light source, intermediate optics, and a detection device (CCD or PMT). Occasionally, this equipment becomes unstable, generating unreliable and inferior data. Methods: A num...

Experimental modal analysis of the steam inlet pipe to the Chooz B1 high pressure turbine

International Nuclear Information System (INIS)

Guihot, O.; Anne, J.P.; Chartain, G.; Le Pironnec, D.

1993-05-01

This report presents the results of the modal analysis carried out on one of the steam inlet pipe of the high pressure turbine of the Chooz B1 power plant. This experimental analysis is made within the frame of the research and development project ''dynamical, acoustical and aerodynamical behaviour of the turbogenerator N4''. This research program provides amongst others, numerical studies with the software CIRCUS and ASTER, in order to verify the dynamical behaviour of the designed inlet pipe. The numerical models will be updated from results of the experimental modal analysis to improve the numerical representation of this pipe. All the identified modes in the frequency band [5.2000] Hz are presented in the report. The modal characteristics of the main modes are detailed. Further analysis have been made, in order ease the updating of the numerical models. They consisted in an analysis of the evolution of the dynamical behaviour due to a change of the boundary conditions of the inlet valve frame on one hand and resulting from the presence of an additional mass on the pipe, at the level of the middle flange, on the other hand. The analysis made in low frequency range shows that the pipe is thoroughly embedded in the frame of the high pressure turbine. On the other hand, the boundary conditions on the inlet valve frame are more difficult to determine, because the dynamical behaviour of the valve frame and the upper pipe can not be uncoupled from the considered pipe. The main shell modes of ranks 2, 3 and 4 have been very accurately identified. The most relevant modes to update the numerical models are given. (authors). 48 figs., 18 tabs., 4 refs

Development and evaluation of a Gamma Camera tuning system

International Nuclear Information System (INIS)

Arista Romeu, E. J.; Diaz Garcia, A.; Osorio Deliz, J. F.

2015-01-01

Correct operation of conventional analogue Gamma Cameras implies a good conformation of the position signals that correspond to a specific photo-peak of the radionuclide of interest. In order to achieve this goal the energy spectrum from each photo multiplier tube (PMT) has to be set within the same energy window. For this reason a reliable tuning system is an important part of all gamma cameras processing systems. In this work is being tested and evaluated a new prototype of tuning card that was developed and setting up for this purpose. The hardware and software of the circuit allow the regulation if each PMT high voltage. By this means a proper gain control for each of them is accomplished. The Tuning Card prototype was simulated in a virtual model and its satisfactory operation was proven in a Siemens Orbiter Gamma Camera. (Author)

PCR method for the rapid detection and discrimination of Legionella spp. based on the amplification of pcs, pmtA, and 16S rRNA genes.

Science.gov (United States)

Janczarek, Monika; Palusińska-Szysz, Marta

2016-05-01

Legionella bacteria are organisms of public health interest due to their ability to cause pneumonia (Legionnaires' disease) in susceptible humans and their ubiquitous presence in water supply systems. Rapid diagnosis of Legionnaires' disease allows the use of therapy specific for the disease. L. pneumophila serogroup 1 is the most common cause of infection acquired in community and hospital environments. The non-L. pneumophila infections are likely under-detected because of a lack of effective diagnosis. In this work, simplex and duplex PCR assays with the use of new molecular markers pcs and pmtA involved in phosphatidylcholine synthesis were specified for rapid and cost-efficient identification and distinguishing Legionella species. The sets of primers developed were found to be sensitive and specific for reliable detection of Legionella belonging to the eight most clinically relevant species. Among these, four primer sets I, II, VI, and VII used for duplex-PCRs proved to have the highest identification power and reliability in the detection of the bacteria. Application of this PCR-based method should improve detection of Legionella spp. in both clinical and environmental settings and facilitate molecular typing of these organisms.

Program Management Tool

Science.gov (United States)

Gawadiak, Yuri; Wong, Alan; Maluf, David; Bell, David; Gurram, Mohana; Tran, Khai Peter; Hsu, Jennifer; Yagi, Kenji; Patel, Hemil

2007-01-01

The Program Management Tool (PMT) is a comprehensive, Web-enabled business intelligence software tool for assisting program and project managers within NASA enterprises in gathering, comprehending, and disseminating information on the progress of their programs and projects. The PMT provides planning and management support for implementing NASA programmatic and project management processes and requirements. It provides an online environment for program and line management to develop, communicate, and manage their programs, projects, and tasks in a comprehensive tool suite. The information managed by use of the PMT can include monthly reports as well as data on goals, deliverables, milestones, business processes, personnel, task plans, monthly reports, and budgetary allocations. The PMT provides an intuitive and enhanced Web interface to automate the tedious process of gathering and sharing monthly progress reports, task plans, financial data, and other information on project resources based on technical, schedule, budget, and management criteria and merits. The PMT is consistent with the latest Web standards and software practices, including the use of Extensible Markup Language (XML) for exchanging data and the WebDAV (Web Distributed Authoring and Versioning) protocol for collaborative management of documents. The PMT provides graphical displays of resource allocations in the form of bar and pie charts using Microsoft Excel Visual Basic for Application (VBA) libraries. The PMT has an extensible architecture that enables integration of PMT with other strategic-information software systems, including, for example, the Erasmus reporting system, now part of the NASA Integrated Enterprise Management Program (IEMP) tool suite, at NASA Marshall Space Flight Center (MSFC). The PMT data architecture provides automated and extensive software interfaces and reports to various strategic information systems to eliminate duplicative human entries and minimize data integrity

Design and study of photomultiplier pulse-shaping amplifier powered by the current flowing through a voltage divider

International Nuclear Information System (INIS)

Vladimir Popov

2003-01-01

A new version of Photomultiplier Tube (PMT) pulse amplifier, entirely powered by the current flowing through the base voltage divider, was designed and tested. This amplifier was designed for application in the JLAB G0 Experiment E00-006 as a part of high voltage base for XP2262 Photonis PMT. According to JLAB G0 experiment requirement, these PMT's operate with plastic scintillators at high counting rate (about MHz). Tests in JLAB experimental Hall C indicate that low energy gamma background cause up to 0.1 mA of PMT average anode current (without amplifier). At this radiation condition, PMT gain decreases by 50% within about 1 month of operation. The amplifier needs to reduce PMT anode current and to shape PMT anode pulse prior to sending it through a long cable line (more then 400 ft of RG-213 and RG-58 coax cables). Shaping of the PMT output pulse helps to reduce attenuation effect of the long cable line without significant reduction of timing accuracy. The results of this study of designed amplifier and PMT plus amplifier system are presented

Studying the muon background component in the Double Chooz experiment

Energy Technology Data Exchange (ETDEWEB)

Dietrich, Dennis

2013-03-28

The reactor anti-neutrino experiment Double Chooz (DC) will measure the third neutrino mixing angle θ{sub 13} with very high precision. This mixing angle is connected to fundamental questions in particle physics beyond the current Standard Model. In DC neutrinos are detected via the Inverse Beta Decay reaction, which provides a clean signal distinguishable from most backgrounds. However, as neutrino interactions in the detector are very rare and an interfering muon background is present, a proper understanding and reduction of this background is mandatory. This is crucial because muons create fast neutrons and βn-emitters which lead to background capable of mimicking the neutrino interaction in the detector. This thesis covers different analysis topics related to the cosmic ray muon background at the DC far site. The thesis covers the identification of muons, the applied rejection technique and the determination of the muon rate at DC far site. Utilizing the muon rejection cuts of the neutrino analysis a muon rate of 13 s{sup -1} in the Inner Detector (ID) and of 46 s{sup -1} in the Inner Muon Veto (IV) was found. The efficiency of the IV to identify and reject cosmic ray muons was measured and a value greater than 99.97% has been found. The stability of the determined muon rates was examined and a seasonal modulation was found, compatible with a variation of the temperature profile of the atmosphere over the year. The parameter describing the strength between the relationship of temperature and muon rate change, the effective temperature coefficient was obtained: αT=0.39±0.01(stat.)±0.02(syst.). This gave the opportunity to measure the atmospheric kaon to pion ratio with the DC far detector which was found to be r(K/π)=0.14±0.06. Additional variations of muon rate with surface pressure were found and the barometric coefficient describing this effect was measured as βp=-0.59±0.20(stat.)±0.10(syst.) permille /mbar. Another central theme of this work was

Studying the muon background component in the Double Chooz experiment

International Nuclear Information System (INIS)

Dietrich, Dennis

2013-01-01

The reactor anti-neutrino experiment Double Chooz (DC) will measure the third neutrino mixing angle θ 13 with very high precision. This mixing angle is connected to fundamental questions in particle physics beyond the current Standard Model. In DC neutrinos are detected via the Inverse Beta Decay reaction, which provides a clean signal distinguishable from most backgrounds. However, as neutrino interactions in the detector are very rare and an interfering muon background is present, a proper understanding and reduction of this background is mandatory. This is crucial because muons create fast neutrons and βn-emitters which lead to background capable of mimicking the neutrino interaction in the detector. This thesis covers different analysis topics related to the cosmic ray muon background at the DC far site. The thesis covers the identification of muons, the applied rejection technique and the determination of the muon rate at DC far site. Utilizing the muon rejection cuts of the neutrino analysis a muon rate of 13 s -1 in the Inner Detector (ID) and of 46 s -1 in the Inner Muon Veto (IV) was found. The efficiency of the IV to identify and reject cosmic ray muons was measured and a value greater than 99.97% has been found. The stability of the determined muon rates was examined and a seasonal modulation was found, compatible with a variation of the temperature profile of the atmosphere over the year. The parameter describing the strength between the relationship of temperature and muon rate change, the effective temperature coefficient was obtained: αT=0.39±0.01(stat.)±0.02(syst.). This gave the opportunity to measure the atmospheric kaon to pion ratio with the DC far detector which was found to be r(K/π)=0.14±0.06. Additional variations of muon rate with surface pressure were found and the barometric coefficient describing this effect was measured as βp=-0.59±0.20(stat.)±0.10(syst.) permille /mbar. Another central theme of this work was the extrapolation

Analog Readout and Digitizing System for ATLAS TileCal Demonstrator

CERN Document Server

Tang, F; The ATLAS collaboration

2014-01-01

The TileCal Demonstrator is a prototype for a future upgrade to the ATLAS hadron calorimeter when the Large Hadron Collider increases luminosity in year 2023 (HL-LHC). It will be used for functionality and performance tests. The Demonstrator has 48 channels of upgraded readout and digitizing electronics and a new digital trigger capability, but is backwards-compatible with the present detector system insofar as it also provides analog trigger signals. The Demonstrator is comprised of 4 identical mechanical mini-drawers, each equipped with up to 12 photomultipliers (PMTs). The on-detector electronics includes 45 Front-End Boards, each serving an individual PMT; 4 Main Boards, each to control and digitize up to 12 PMT signals, and 4 corresponding high-speed Daughter Boards serving as data hubs between on-detector and off-detector electronics. The Demonstrator is fully compatible with the present system, accepting ATLAS triggers, timing and slow control commands for the data acquisition, detector control, and de...

Electronics and Calibration system for the CMS Beam Halo Monitor

CERN Document Server

Tosi, Nicolò; Fabbri, Franco L; Finkel, Alexey; Orfanelli, Stella; Loos, R; Montanari, Alessandro; Rusack, R; Stickland, David P

2014-01-01

In the context of increasing luminosity of LHC, it will be important to accurately measure the Machine Induced Background. A new monitoring system will be installed in the cavern of the Compact Muon Solenoid (CMS) experiment for measuring the beam background at high radius. This detector is composed of synthetic quartz Cherenkov radiators, coupled to fast photomultiplier tubes (PMT). The readout chain of this detector will make use of many components developed for the Phase 1 upgrade to the CMS Hadron Calorimeter electronics, with a dedicated firmware and readout adapted to the beam monitoring requirements. The PMT signal will be digitized by a charge integrating ASIC (QIE10), providing both the signal rise time and the charge integrated over one bunch crossing. The backend electronics will record bunch-by-bunch histograms, which will be published to CMS and the LHC using the newly designed CMS beam instrumentation specific DAQ. A calibration monitoring system has been designed to generate triggered pulses of...

The upgrade of the laser calibration system for the ATLAS hadron calorimeter TileCal

CERN Document Server

Spalla, Margherita; The ATLAS collaboration

2014-01-01

The Tile Calorimeter (TileCal), the central section of the hadronic calorimeter of the ATLAS experiment, is a key detector component to detect hadrons, jets and taus and to measure the missing transverse energy. TileCal is built of steel and scintillating tiles coupled to optical fibers and read‐out by photomultipliers (PMT). The performance of TileCal relies on a continuous, high resolution calibration of the individual response of the 10,000 channels forming the detector. The calibration is based on a three level architecture: a charge injection system used to monitor the full electronics chain including front-end amplifiers, digitizers and event builder blocks for each individual channel; a distributed optical system using laser pulses to excite all PMTs; and a mobile Cesium radiative source which is driven through the detector cell floating inside a pipe system. This architecture allows for a cascade calibration of the electronics, of the PMT and electronics, and of full chain including the active detec...

Upgrade Analog Readout and Digitizing System for ATLAS TileCal Demonstrator

CERN Document Server

Tang, F; Anderson, K; Bohm, C; Hildebrand, K; Muschter, S; Oreglia, M

2015-01-01

The TileCal Demonstrator is a prototype for a future upgrade to the ATLAS hadron calorimeter when the Large Hadron Collider increases luminosity in year 2023 (HL-LHC). It will be used for functionality and performance tests. The Demonstrator has 48 channels of upgraded readout and digitizing electronics and a new digital trigger capability, but is backwards-compatible with the present detector system insofar as it also provides analog trigger signals. The Demonstrator is comprised of 4 identical mechanical mini-drawers, each equipped with up to 12 photomultipliers (PMTs). The on-detector electronics includes 45 Front-End Boards, each serving an individual PMT; 4 Main Boards, each to control and digitize up to 12 PMT signals, and 4 corresponding high-speed Daughter Boards serving as data hubs between on-detector and off-detector electronics. The Demonstrator is fully compatible with the present system, accepting ATLAS triggers, timing and slow control commands for the data acquisition, detector control, and de...

Arf6-Dependent Intracellular Trafficking of Pasteurella multocida Toxin and pH-Dependent Translocation from Late Endosomes

Directory of Open Access Journals (Sweden)

Tracy P. M. Chong

2011-03-01

Full Text Available The potent mitogenic toxin from Pasteurella multocida (PMT is the major virulence factor associated with a number of epizootic and zoonotic diseases caused by infection with this respiratory pathogen. PMT is a glutamine-specific protein deamidase that acts on its intracellular G-protein targets to increase intracellular calcium, cytoskeletal, and mitogenic signaling. PMT enters cells through receptor-mediated endocytosis and then translocates into the cytosol through a pH-dependent process that is inhibited by NH4Cl or bafilomycin A1. However, the detailed mechanisms that govern cellular entry, trafficking, and translocation of PMT remain unclear. Co-localization studies described herein revealed that while PMT shares an initial entry pathway with transferrin (Tfn and cholera toxin (CT, the trafficking pathways of Tfn, CT, and PMT subsequently diverge, as Tfn is trafficked to recycling endosomes, CT is trafficked retrograde to the ER, and PMT is trafficked to late endosomes. Our studies implicate the small regulatory GTPase Arf6 in the endocytic trafficking of PMT. Translocation of PMT from the endocytic vesicle occurs through a pH-dependent process that is also dependent on both microtubule and actin dynamics, as evidenced by inhibition of PMT activity in our SRE-based reporter assay, with nocodazole and cytochalasin D, respectively, suggesting that membrane translocation and cytotoxicity of PMT is dependent on its transfer to late endosomal compartments. In contrast, disruption of Golgi-ER trafficking with brefeldin A increased PMT activity, suggesting that inhibiting PMT trafficking to non-productive compartments that do not lead to translocation, while promoting formation of an acidic tubulovesicle system more conducive to translocation, enhances PMT translocation and activity.

The system SnTe-InSe

International Nuclear Information System (INIS)

Gurshumov, A.P.; Alidzhanov, M.A.; Aliev, A.S.; Gadzhiev, T.G.; Mamedov, N.A.

1986-01-01

This paper discusses the nature of the interaction and physicochemical properties of the alloys of the system SnTe-InSe. The DTA was performed on an NTR-74 pyrometer, XPA on a Dron-2.0 diffractometer and MSA on an MIM-7 metallographic microscope. The microhardness of the samples was determined on a PMT-3 microhardness tester. The congruently melting compound SnInTeSe and solid solutions based on the starting components are formed in the system

First Tests of a New Fast Waveform Digitizer for PMT Signal Read-out from Liquid Argon Dark Matter Detectors

Science.gov (United States)

Szelc, A. M.; Canci, N.; Cavanna, F.; Cortopassi, A.; D'Incecco, M.; Mini, G.; Pietropaolo, F.; Romboli, A.; Segreto, E.; Acciarri, R.

A new generation Waveform Digitizer board as been recently made available on the market by CAEN. The new board CAEN V1751 with 8 Channels per board, 10 bit, 1 GS/s Flash ADC Waveform Digitizer (or 4 channel, 10 bit, 2 GS/s Flash ADC Waveform Digitizer -Dual Edge Sampling mode) with threshold and Auto-Trigger capabilities provides an ideal (relatively low-cost) solution for reading signals from liquid Argon detectors for Dark Matter search equipped with an array of PMTs for the detection of scintillation light. The board was extensively used in real experimental conditions to test its usefulness for possible future uses and to compare it with a state of the art digital oscilloscope. As results, PMT Signal sampling at 1 or 2 GS/s is appropriate for the reconstruction of the fast component of the signal scintillation in Argon (characteristic time of about 4 ns) and the extended dynamic range, after a small customization, allows for the detection of signals in the range of energy needed. The bandwidth is found to be adequate and the intrinsic noise is very low.

Characterization of the Pichia pastoris protein-O-mannosyltransferase gene family.

Directory of Open Access Journals (Sweden)

Juergen H Nett

Full Text Available The methylotrophic yeast, Pichiapastoris, is an important organism used for the production of therapeutic proteins. However, the presence of fungal-like glycans, either N-linked or O-linked, can elicit an immune response or enable the expressed protein to bind to mannose receptors, thus reducing their efficacy. Previously we have reported the elimination of β-linked glycans in this organism. In the current report we have focused on reducing the O-linked mannose content of proteins produced in P. pastoris, thereby reducing the potential to bind to mannose receptors. The initial step in the synthesis of O-linked glycans in P. pastoris is the transfer of mannose from dolichol-phosphomannose to a target protein in the yeast secretory pathway by members of the protein-O-mannosyltransferase (PMT family. In this report we identify and characterize the members of the P. pastoris PMT family. Like Candida albicans, P. pastoris has five PMT genes. Based on sequence homology, these PMTs can be grouped into three sub-families, with both PMT1 and PMT2 sub-families possessing two members each (PMT1 and PMT5, and PMT2 and PMT6, respectively. The remaining sub-family, PMT4, has only one member (PMT4. Through gene knockouts we show that PMT1 and PMT2 each play a significant role in O-glycosylation. Both, by gene knockouts and the use of Pmt inhibitors we were able to significantly reduce not only the degree of O-mannosylation, but also the chain-length of these glycans. Taken together, this reduction of O-glycosylation represents an important step forward in developing the P. pastoris platform as a suitable system for the production of therapeutic glycoproteins.

A time-domain fluorescence diffusion optical tomography system for breast tumor diagnosis

Science.gov (United States)

Zhang, Wei; Gao, Feng; Wu, LinHui; Ma, Wenjuan; Yang, Fang; Zhou, Zhongxing; Zhang, Limin; Zhao, Huijuan

2011-02-01

A prototype time-domain fluorescence diffusion optical tomography (FDOT) system using near-infrared light is presented. The system employs two pulsed light sources, 32 source fibers and 32 detection channels, working separately for acquiring the temporal distribution of the photon flux on the tissue surface. The light sources are provided by low power picosecond pulsed diode lasers at wavelengths of 780 nm and 830 nm, and a 1×32-fiber-optic-switch sequentially directs light sources to the object surface through 32 source fibers. The light signals re-emitted from the object are collected by 32 detection fibers connected to four 8×1 fiber-optic-switch and then routed to four time-resolved measuring channels, each of which consists of a collimator, a filter wheel, a photomultiplier tube (PMT) photon-counting head and a time-correlated single photon counting (TCSPC) channel. The performance and efficacy of the designed multi-channel PMT-TCSPC system are assessed by reconstructing the fluorescent yield and lifetime images of a solid phantom.

4th International Conference on New Photo-Detectors

CERN Document Server

2016-01-01

The purpose of this Conference is to discuss new ideas and recent developments in photo-detectors and their applications in various fields: high energy physics, neutrino physics, particle and astroparticle physics, nuclear physics, nuclear medicine and industry. The main topics of the Conference relate to APD, SiPM, PMT, Hybrid PMT, MCP-PMT, and electronics: front-end and readout of large systems.

Options and strategies in decontamination for decommissioning: after safe enclosure or directly after shutdown. Experiences in 2012; Opciones y Estrategias en Descontaminacion para el Desmantelamiento: Desmantelamiento aplazado o inmediato. Experiencias en 2012

Energy Technology Data Exchange (ETDEWEB)

Sempere Belda, L.; Topf, C.; Moreira do Amaral, J. P.

2013-07-01

During the last years AREVA has been performing numerous large scale chemical decontaminations, including the simultaneous decontamination of the complete primary circuit and auxiliary systems ('Full System Decontamination'). Three of them have were completed during the course of the last twelve months, in the nuclear power plants of Chooz A in France and of Unterweser and Neckarwestheim 1 in Germany. This paper compares the consequences for the performance of the decontamination derived from the different decommissioning philosophies adopted: Immediate decommissioning after ceasing operation in the case of Unterweser and Neckarwestheim 1, and delayed dismantlement after safe enclosure (SAFSTORE) in the case of Chooz A. The authors, responsible for the application and process control also from a technical point of view, comment on the results obtained and on the differences between these approaches.

The system of high-voltage power PMT for experiments at the JINR Nuclotron

International Nuclear Information System (INIS)

Piyadin, S.M.; Ladygin, V.P.; Pilyar, A.V.; Reznikov, S.G.; Janek, M.

2015-01-01

An 8-channel high-voltage power system based on the use of the module «Wenzel Elektronik N1130» is described. Specifications of control modules 8DAC-12 and 8ADC-14 designed for the high-voltage systems in CAMAC standard are presented. This system is designed to provide the power for the detectors used in physics experiments at the JINR Nuclotron.

A computer based I and C to improve nuclear power plant operation and safety

International Nuclear Information System (INIS)

Appell, Bernard; Beltranda, Guy

1995-01-01

Chooz B1 is the head of 1400 MW N4 series (up to now, a programme of 4 identical units have been ordered) will be put on the French national grid this year (1995). Hot tests were performed last autumn. Loading fuel is scheduled in June 95. Chooz B2 will follow 6 months later. This nuclear power plant series is fully French designed. It comprises, compared to the former 1300 MW series, evolution concerning mainly the turbine, the steam generators, the primary pumps, the I and C and the man machine interface. A major improvement for the plant operation and safety is the computerised I and C which comprises the protection system (specific controllers), the process automation system (off the shelf equipment), the computer based and conventional man machine interfaces associated. These systems were put in service last year. This paper is focused on them. (author)

The electronics system for the LBNL positron emission mammography (PEM) camera

CERN Document Server

Moses, W W; Baker, K; Jones, W; Lenox, M; Ho, M H; Weng, M

2001-01-01

Describes the electronics for a high-performance positron emission mammography (PEM) camera. It is based on the electronics for a human brain positron emission tomography (PET) camera (the Siemens/CTI HRRT), modified to use a detector module that incorporates a photodiode (PD) array. An application-specified integrated circuit (ASIC) services the photodetector (PD) array, amplifying its signal and identifying the crystal of interaction. Another ASIC services the photomultiplier tube (PMT), measuring its output and providing a timing signal. Field-programmable gate arrays (FPGAs) and lookup RAMs are used to apply crystal-by-crystal correction factors and measure the energy deposit and the interaction depth (based on the PD/PMT ratio). Additional FPGAs provide event multiplexing, derandomization, coincidence detection, and real-time rebinning. Embedded PC/104 microprocessors provide communication, real-time control, and configure the system. Extensive use of FPGAs make the overall design extremely flexible, all...

Comparison of (31)P saturation and inversion magnetization transfer in human liver and skeletal muscle using a clinical MR system and surface coils.

Science.gov (United States)

Buehler, Tania; Kreis, Roland; Boesch, Chris

2015-02-01

(31)P MRS magnetization transfer ((31)P-MT) experiments allow the estimation of exchange rates of biochemical reactions, such as the creatine kinase equilibrium and adenosine triphosphate (ATP) synthesis. Although various (31)P-MT methods have been successfully used on isolated organs or animals, their application on humans in clinical scanners poses specific challenges. This study compared two major (31)P-MT methods on a clinical MR system using heteronuclear surface coils. Although saturation transfer (ST) is the most commonly used (31)P-MT method, sequences such as inversion transfer (IT) with short pulses might be better suited for the specific hardware and software limitations of a clinical scanner. In addition, small NMR-undetectable metabolite pools can transfer MT to NMR-visible pools during long saturation pulses, which is prevented with short pulses. (31)P-MT sequences were adapted for limited pulse length, for heteronuclear transmit-receive surface coils with inhomogeneous B1 , for the need for volume selection and for the inherently low signal-to-noise ratio (SNR) on a clinical 3-T MR system. The ST and IT sequences were applied to skeletal muscle and liver in 10 healthy volunteers. Monte-Carlo simulations were used to evaluate the behavior of the IT measurements with increasing imperfections. In skeletal muscle of the thigh, ATP synthesis resulted in forward reaction constants (k) of 0.074 ± 0.022 s(-1) (ST) and 0.137 ± 0.042 s(-1) (IT), whereas the creatine kinase reaction yielded 0.459 ± 0.089 s(-1) (IT). In the liver, ATP synthesis resulted in k = 0.267 ± 0.106 s(-1) (ST), whereas the IT experiment yielded no consistent results. ST results were close to literature values; however, the IT results were either much larger than the corresponding ST values and/or were widely scattered. To summarize, ST and IT experiments can both be implemented on a clinical body scanner with heteronuclear transmit-receive surface coils; however, ST results are

The electronics, trigger and data acquisition system for the liquid argon time projection chamber of the DarkSide-50 search for dark matter

Energy Technology Data Exchange (ETDEWEB)

Agnes, P.; Albuquerque, I. F. M.; Alexander, T.; Alton, A. K.; Arisaka, K.; Asner, D. M.; Ave, M.; Back, H. O.; Baldin, B.; Biery, K.; Bocci, V.; Bonfini, G.; Bonivento, W.; Bossa, M.; Bottino, B.; Brigatti, A.; Brodsky, J.; Budano, F.; Bussino, S.; Cadeddu, M.; Cadoni, M.; Calaprice, F.; Canci, N.; Candela, A.; Cao, H.; Caravati, M.; Cariello, M.; Carlini, M.; Catalanotti, S.; Cataudella, V.; Cavalcante, P.; Chepurnov, A.; Cicaló, C.; Cocco, A. G.; Covone, G.; Crippa, L.; D' Angelo, D.; D' Incecco, M.; Davini, S.; de Candia, A.; Cecco, S. De; Deo, M. De; Filippis, G. De; Rosa, G. De; Vincenzi, M. De; Derbin, A.; Devoto, A.; Eusanio, F. Di; Dionisi, C.; Pietro, G. Di; Edkins, E.; Empl, A.; Fan, A.; Fiorillo, G.; Fomenko, K.; Forster, G.; Franco, D.; Gabriele, F.; Galbiati, C.; Giagu, S.; Giganti, C.; Giovanetti, G. K.; Goretti, A. M.; Granato, F.; Grandi, L.; Gromov, M.; Guan, M.; Guardincerri, Y.; Hackett, B. R.; Herner, K. R.; Hughes, D.; Humble, P.; Hungerford, E. V.; Ianni, A.; Ianni, A.; James, I.; Johnson, T. N.; Keeter, K.; Kendziora, C. L.; Kobychev, V.; Koh, G.; Korablev, D.; Korga, G.; Kubankin, A.; Li, X.; Lissia, M.; Loer, B.; Lombardi, P.; Longo, G.; Luitz, S.; Ma, Y.; Machado, A.; Machulin, I. N.; Mandarano, A.; Mari, S. M.; Maricic, J.; Marini, L.; Martoff, C. J.; Meyers, P. D.; Miletic, T.; Milincic, R.; Montanari, D.; Monte, A.; Montuschi, M.; Monzani, M. E.; Mosteiro, P.; Mount, B. J.; Muratova, V. N.; Musico, P.; Agasson, A. Navrer; Nelson, A.; Odrowski, S.; Oleinik, A.; Orsini, M.; Ortica, F.; Pagani, L.; Pallavicini, M.; Pantic, E.; Parmeggiano, S.; Pelczar, K.; Pelliccia, N.; Pocar, A.; Pordes, S.; Pugachev, D. A.; Qian, H.; Randle, K.; Ranucci, G.; Razeti, M.; Razeto, A.; Reinhold, B.; Renshaw, A. L.; Rescigno, M.; Riffard, Q.; Romani, A.; Rossi, B.; Rossi, N.; Rountree, S. D.; Sablone, D.; Saggese, P.; Saldanha, R.; Sands, W.; Sangiorgio, S.; Savarese, C.; Schlitzer, B.; Segreto, E.; Semenov, D. A.; Shields, E.; Singh, P. N.; Skorokhvatov, M. D.; Smirnov, O.; Sotnikov, A.; Stanford, C.; Suvorov, Y.; Tartaglia, R.; Tatarowicz, J.; Testera, G.; Tonazzo, A.; Trinchese, P.; Unzhakov, E. V.; Verducci, M.; Vishneva, A.; Vogelaar, R. B.; Wada, M.; Walker, S.; Wang, H.; Wang, Y.; Watson, A. W.; Westerdale, S.; Wojcik, M. M.; Xiang, X.; Xiao, X.; Xu, J.; Yang, C.; Yoo, J.; Zavatarelli, S.; Zec, A.; Zhong, W.; Zhu, C.; Zuzel, G.

2017-12-01

The DarkSide-50 experiment at the Laboratori Nazionali del Gran Sasso is a search for dark matter using a dual phase time projection chamber with 50 kg of low radioactivity argon as target. Light signals from interactions in the argon are detected by a system of 38 photo-multiplier tubes (PMTs), 19 above and 19 below the TPC volume inside the argon cryostat. We describe the electronics which processes the signals from the photo-multipliers, the trigger system which identifies events of interest, and the data-acquisition system which records the data for further analysis. The electronics include resistive voltage dividers on the PMTs, custom pre-amplifiers mounted directly on the PMT voltage dividers in the liquid argon, and custom amplifier/discriminators (at room temperature). After amplification, the PMT signals are digitized in CAEN waveform digitizers, and CAEN logic modules are used to construct the trigger, the data acquisition system for the TPC is based on the Fermilab "artdaq" software. The system has been in operation since early 2014.

Correction of distortions in a discontinuous image

International Nuclear Information System (INIS)

Geagan, M.J.; Chase, B.B.; Muehllehner, G.

1994-01-01

Large area position-sensitive NaI detectors have been successfully applied to positron emission tomography (PET). Typical PET studies involve detector singles rates in excess of 500 kcps, which can lead to pile-up and image degradation as a function of countrate. Better high countrate performance can be achieved with a local centroid algorithm, in which the position of each event is calculated from a small group of photomultipliers (PMTs) immediately surrounding the PMT with the highest signal (the peak PMT). The local centroid contains most of the light from the scintillation. If a local centroid of only seven PMTs is used, the position resolution becomes quite stable at high countrates, however, discontinuities appear in the detector flood image as events cluster around each PMT. We therefore developed a method for distortion correction of a discontinuous flood image. For each PMT on the detector, a peak PMT domain is defined. The peak PMT domain is the area on the detector where that PMT could have the highest signal. The peak PMT domains overlap slightly, so that all combinations of peak PMT and position are represented. A collimated source is moved through a regular grid of points - a template - over each peak PMT region. A short collection is performed at each point, and the real and measured position data are recorded. For each point in the spatial range of a given PMT, distortion correction offsets are computed by interpolating between the data points which correspond to that PMT. This new method has been implemented and evaluated. System resolution has been measured at low and high countrates. The high countrate resolution is better with the new method, with no degradation in low countrate resolution. The axial sensitivity profile is also more stable at high countrates, compared to the previously developed method. 3-D brain phantom images show a clear improvement in image quality at high countrates. ((orig.))

Operation of ADITYA Thomson scattering system: measurement of temperature and density

International Nuclear Information System (INIS)

Thomas, Jinto; Pillai, Vishal; Singh, Neha; Patel, Kiran; Lingeshwari, G.; Hingrajiya, Zalak; Kumar, Ajai

2015-01-01

ADITYA Thomson scattering (TS) system is a single point measurement system operated using a 10 J ruby laser and a 1 meter grating spectrometer. Multi-slit optical fibers are arranged at the image plane of the spectrometer so that each fiber slit collects 2 nm band of scattered spectrum. Each slit of the fiber bundle is coupled to high gain Photomultiplier tubes (PMT). Standard white light source is used to calibrate the optical fiber transmission and the laser light itself is used to calibrate the relative gain of the PMT. Rayleigh scattering has been performed for the absolute calibration of the TS system. The temperature of ADITYA plasma has been calculated using the conventional method of estimation (calculated using the slope of logarithmic intensity vs the square of delta lambda). It has been observed that the core temperature of ADITYA Tokamak plasma is in the range of 300 to 600 eV for different plasma shots and the density 2-3 X 10 13 /cc. The time evolution of the plasma discharge has been studied by firing the laser at different times of the discharge assuming the shots are identical. In some of the discharges, the velocity distribution appears to be non Maxwellian. (author)

A remotely triggered fast neutron detection instrument based on a plastic organic scintillator

Science.gov (United States)

Jones, A. R.; Aspinall, M. D.; Joyce, M. J.

2018-02-01

A detector system for the characterization of radiation fields of both fast neutrons and γ rays is described comprising of a gated photomultiplier tube (PMT), an EJ299-33 solid organic scintillator detector, and an external trigger circuit. The objective of this development was to conceive a means by which the PMT in such a system can be actuated remotely during the high-intensity bursts of pulsed γ-ray contamination that can arise during active interrogation procedures. The system is used to detect neutrons and γ rays using established pulse-shape discrimination (PSD) techniques. The gating circuit enables the PMT to be switched off remotely. This is compatible with use during intense radiation transients to avoid saturation and the disruption of the operation of the PMT during the burst. Data are presented in the form of pulse-height spectra and PSD scatter plots for the system triggered with a strobed light source. These confirm that the gain of the system and the throughput for both triggered and un-triggered scenarios are as expected, given the duty cycle of the stimulating radiation. This demonstrates that the triggering function does not perturb the system response of the detector.

A new type gamma-ray spectrum monitoring system

CERN Document Server

Cheng Bo; Zhou Jian Bin; Zhang Zhi Ming; Tong Yun Fu

2002-01-01

This new radiation monitoring system can be used to monitor the radiation of building materials and the radiation of atmosphere, to explore and evaluate rock for building in the field, and this system can be used to monitor the gamma irradiation near the nuclear establishments in the average situation and in the serious situation of the radiation incident have happened. The control core of this monitoring system is SCM-AT89C52, and gamma-ray sensing head consists of scintillator phi 50 mm x 50 mm NaI(Tl) and PMT GDB44. This system can be used to measure the whole gamma-ray spectrum of 256 channels

Design and Demonstration of a Miniature Lidar System for Rover Applications

Science.gov (United States)

Robinson, Benjamin

2010-01-01

A basic small and portable lidar system for rover applications has been designed. It uses a 20 Hz Nd:YAG pulsed laser, a 4-inch diameter telescope receiver, a custom-built power distribution unit (PDU), and a custom-built 532 nm photomultiplier tube (PMT) to measure the lidar signal. The receiving optics have been designed, but not constructed yet. LabVIEW and MATLAB programs have also been written to control the system, acquire data, and analyze data. The proposed system design, along with some measurements, is described. Future work to be completed is also discussed.

A novel portable system for detecting and measuring tritium

International Nuclear Information System (INIS)

Barillari, Domenico

2007-01-01

A novel tritium detector configuration is described based on the anthracene scintillation method. Tritium-bearing samples are applied to a plate-bearing finely sublimed anthracene crystals and viewed in a field-able PMT-based reader against a standard plate. A microprocessor-based control and signal analysis system delivers a reading with a sensitivity of better than 5 nCi 3 H in approximately 3 min, and 2.3 nCi in 10 min of counting

Dosimetry and fluence calculations on french PWR vessels comparisons between experiments and calculations

International Nuclear Information System (INIS)

Nimal, J.C.; Bourdet, L.; Guilleret, J.C.; Hedin, F.

1988-01-01

Fluence and damage calculations on PWR pressure vessels and irradiation test specimens are presented for two types of reactor: the franco-belgian (reactor CHOOZ) and the french reactors (CPY program). Comparisons with measurements are given for activation foils and fission detectors; most of them are about irradiation test specimen locations; comparisons are made for the Chooz plant on vessel stainless steel samplings and in the reactor pit

Fluorescence detection system for microfluidic droplets

Science.gov (United States)

Chen, Binyu; Han, Xiaoming; Su, Zhen; Liu, Quanjun

2018-05-01

In microfluidic detection technology, because of the universality of optical methods in laboratory, optical detection is an attractive solution for microfluidic chip laboratory equipment. In addition, the equipment with high stability and low cost can be realized by integrating appropriate optical detection technology on the chip. This paper reports a detection system for microfluidic droplets. Photomultiplier tubes (PMT) is used as a detection device to improve the sensitivity of detection. This system improves the signal to noise ratio by software filtering and spatial filter. The fluorescence intensity is proportional to the concentration of the fluorescence and intensity of the laser. The fluorescence micro droplets of different concentrations can be distinguished by this system.

Vaccination with Recombinant Non-transmembrane Domain of Protein Mannosyltransferase 4 Improves Survival during Murine Disseminated Candidiasis.

Science.gov (United States)

Wang, Li; Yan, Lan; Li, Xing Xing; Xu, Guo Tong; An, Mao Mao; Jiang, Yuan Ying

2015-01-01

Candida albicans is the most common cause of invasive fungal infections in humans. The C. albicans cell wall proteins play an important role in crucial host-fungus interactions and might be ideal vaccine targets to induce protective immune response in host. Meanwhile, protein that is specific to C. albicans is also an ideal target of vaccine. In this study, 11 proteins involving cell wall biosynthesis, yeast-to-hypha formation, or specific to C. albicans were chosen and were successfully cloned, purified and verified. The immune protection of vaccination with each recombinant protein respectively in preventing systemic candidiasis in BALB/c mice was assessed. The injection of rPmt4p vaccination significantly increased survival rate, decreased fungal burdens in the heart, liver, brain, and kidneys, and increased serum levels of both immunoglobulin G (IgG) and IgM against rPmt4p in the immunized mice. Histopathological assessment demonstrated that rPmt4p vaccination protected the tissue structure, and decreased the infiltration of inflammatory cells. Passive transfer of the rPmt4p immunized serum increased survival rate against murine systemic candidiasis and significantly reduced organ fungal burden. The immune serum enhanced mouse neutrophil killing activity by directly neutralizing rPmt4p effects in vitro. Levels of interleukin (IL)-4, IL-10, IL-12p70, IL-17A and tumor necrosis factor (TNF)-α in serum were higher in the immunized mice compared to those in the adjuvant control group. In conclusion, our results suggested that rPmt4p vaccination may be considered as a potential vaccine candidate against systemic candidiasis.

Data acquisition architecture and online processing system for the HAWC gamma-ray observatory

Science.gov (United States)

Abeysekara, A. U.; Alfaro, R.; Alvarez, C.; Álvarez, J. D.; Arceo, R.; Arteaga-Velázquez, J. C.; Ayala Solares, H. A.; Barber, A. S.; Baughman, B. M.; Bautista-Elivar, N.; Becerra Gonzalez, J.; Belmont-Moreno, E.; BenZvi, S. Y.; Berley, D.; Bonilla Rosales, M.; Braun, J.; Caballero-Lopez, R. A.; Caballero-Mora, K. S.; Carramiñana, A.; Castillo, M.; Cotti, U.; Cotzomi, J.; de la Fuente, E.; De León, C.; DeYoung, T.; Diaz-Cruz, J.; Diaz Hernandez, R.; Díaz-Vélez, J. C.; Dingus, B. L.; DuVernois, M. A.; Ellsworth, R. W.; Fiorino, D. W.; Fraija, N.; Galindo, A.; Garfias, F.; González, M. M.; Goodman, J. A.; Grabski, V.; Gussert, M.; Hampel-Arias, Z.; Harding, J. P.; Hui, C. M.; Hüntemeyer, P.; Imran, A.; Iriarte, A.; Karn, P.; Kieda, D.; Kunde, G. J.; Lara, A.; Lauer, R. J.; Lee, W. H.; Lennarz, D.; León Vargas, H.; Linares, E. C.; Linnemann, J. T.; Longo Proper, M.; Luna-García, R.; Malone, K.; Marinelli, A.; Marinelli, S. S.; Martinez, O.; Martínez-Castro, J.; Martínez-Huerta, H.; Matthews, J. A. J.; McEnery, J.; Mendoza Torres, E.; Miranda-Romagnoli, P.; Moreno, E.; Mostafá, M.; Nellen, L.; Newbold, M.; Noriega-Papaqui, R.; Oceguera-Becerra, T.; Patricelli, B.; Pelayo, R.; Pérez-Pérez, E. G.; Pretz, J.; Rivière, C.; Rosa-González, D.; Ruiz-Velasco, E.; Ryan, J.; Salazar, H.; Salesa Greus, F.; Sanchez, F. E.; Sandoval, A.; Schneider, M.; Silich, S.; Sinnis, G.; Smith, A. J.; Sparks Woodle, K.; Springer, R. W.; Taboada, I.; Toale, P. A.; Tollefson, K.; Torres, I.; Ukwatta, T. N.; Villaseñor, L.; Weisgarber, T.; Westerhoff, S.; Wisher, I. G.; Wood, J.; Yapici, T.; Yodh, G. B.; Younk, P. W.; Zaborov, D.; Zepeda, A.; Zhou, H.

2018-04-01

The High Altitude Water Cherenkov observatory (HAWC) is an air shower array devised for TeV gamma-ray astronomy. HAWC is located at an altitude of 4100 m a.s.l. in Sierra Negra, Mexico. HAWC consists of 300 Water Cherenkov Detectors, each instrumented with 4 photomultiplier tubes (PMTs). HAWC re-uses the Front-End Boards from the Milagro experiment to receive the PMT signals. These boards are used in combination with Time to Digital Converters (TDCs) to record the time and the amount of light in each PMT hit (light flash). A set of VME TDC modules (128 channels each) is operated in a continuous (dead time free) mode. The TDCs are read out via the VME bus by Single-Board Computers (SBCs), which in turn are connected to a gigabit Ethernet network. The complete system produces ≈500 MB/s of raw data. A high-throughput data processing system has been designed and built to enable real-time data analysis. The system relies on off-the-shelf hardware components, an open-source software technology for data transfers (ZeroMQ) and a custom software framework for data analysis (AERIE). Multiple trigger and reconstruction algorithms can be combined and run on blocks of data in a parallel fashion, producing a set of output data streams which can be analyzed in real time with minimal latency (system and the real-time data processing system. The performance of these systems is also discussed.

ATLAS TileCal Sub-Module Production at UIUC

CERN Multimedia

Errede, Steve

2001-01-01

Photos of Current PMT Test Setup: Photo 1 - View of the PC, Electronics Rack and PMT Dark Box Photo 2 - Another View of the PC, Electronics Rack and PMT Dark Box. Photo 3 - Overhead shot of PMT Grid inside PMT Dark Box. Photo 4 - View of inside of PMT Light Box.

Forward Period Analysis Method of the Periodic Hamiltonian System.

Directory of Open Access Journals (Sweden)

Pengfei Wang

Full Text Available Using the forward period analysis (FPA, we obtain the period of a Morse oscillator and mathematical pendulum system, with the accuracy of 100 significant digits. From these results, the long-term [0, 1060] (time unit solutions, ranging from the Planck time to the age of the universe, are computed reliably and quickly with a parallel multiple-precision Taylor series (PMT scheme. The application of FPA to periodic systems can greatly reduce the computation time of long-term reliable simulations. This scheme provides an efficient way to generate reference solutions, against which long-term simulations using other schemes can be tested.

Design of remote laser-induced fluorescence system's acquisition circuit

Science.gov (United States)

Wang, Guoqing; Lou, Yue; Wang, Ran; Yan, Debao; Li, Xin; Zhao, Xin; Chen, Dong; Zhao, Qi

2017-10-01

Laser-induced fluorescence system(LIfS) has been found its significant application in identifying one kind of substance from another by its properties even it's thimbleful, and becomes useful in plenty of fields. Many superior works have reported LIfS' theoretical analysis , designs and uses. However, the usual LIPS is always constructed in labs to detect matter quite closely, for the system using low-power laser as excitation source and charge coupled device (CCD) as detector. Promoting the detectivity of LIfS is of much concern to spread its application. Here, we take a high-energy narrow-pulse laser instead of commonly used continuous wave laser to operate sample, thus we can get strong fluorescent. Besides, photomultiplier (PMT) with high sensitivity is adopted in our system to detect extremely weak fluorescence after a long flight time from the sample to the detector. Another advantage in our system, as the fluorescence collected into spectroscopy, multiple wavelengths of light can be converted to the corresponding electrical signals with the linear array multichannel PMT. Therefore, at the cost of high-powered incentive and high-sensitive detector, a remote LIFS is get. In order to run this system, it is of importance to turn light signal to digital signal which can be processed by computer. The pulse width of fluorescence is deeply associated with excitation laser, at the nanosecond(ns) level, which has a high demand for acquisition circuit. We design an acquisition circuit including, I/V conversion circuit, amplifying circuit and peak-holding circuit. The simulation of circuit shows that peak-holding circuit can be one effective approach to reducing difficulty of acquisition circuit.

Neutrino Interactions

Energy Technology Data Exchange (ETDEWEB)

Kamyshkov, Yuri [Univ. of Tennesse, Knoxville, TN (United States); Handler, Thomas [Univ. of Tennesse, Knoxville, TN (United States)

2016-10-24

The neutrino group of the University of Tennessee, Knoxville was involved from 05/01/2013 to 04/30/2015 in the neutrino physics research funded by DOE-HEP grant DE-SC0009861. Contributions were made to the Double Chooz nuclear reactor experiment in France where second detector was commissioned during this period and final series of measurements has been started. Although Double Chooz was smaller experimental effort than competitive Daya Bay and RENO experiments, its several advantages make it valuable for understanding of systematic errors in measurements of neutrino oscillations. Double Chooz was the first experiment among competing three that produced initial result for neutrino angle θ₁₃ measurement, giving other experiments the chance to improve measured value statistically. Graduate student Ben Rybolt defended his PhD thesis on the results of Double Chooz experiment in 2015. UT group has fulfilled all the construction and analysis commitments to Double Chooz experiment, and has withdrawn from the collaboration by the end of the mentioned period to start another experiment. Larger effort of UT neutrino group during this period was devoted to the participation in another DOE-HEP project - NOvA experiment. The 14,000-ton "FAR" neutrino detector was commissioned in northern Minnesota in 2014 together with 300-ton "NEAR" detector located at Fermilab. Following that, the physics measurement program has started when Fermilab accelerator complex produced the high-intensity neutrino beam propagating through Earth to detector in MInnessota. UT group contributed to NOvA detector construction and developments in several aspects. Our Research Associate Athanasios Hatzikoutelis was managing (Level 3 manager) the construction of the Detector Control System. This work was successfully accomplished in time with the commissioning of the detectors. Group was involved in the development of the on-line software and study of the signatures of the cosmic ray backgrounds

Neutrino Interactions

International Nuclear Information System (INIS)

Kamyshkov, Yuri; Handler, Thomas

2016-01-01

The neutrino group of the University of Tennessee, Knoxville was involved from 05/01/2013 to 04/30/2015 in the neutrino physics research funded by DOE-HEP grant DE-SC0009861. Contributions were made to the Double Chooz nuclear reactor experiment in France where second detector was commissioned during this period and final series of measurements has been started. Although Double Chooz was smaller experimental effort than competitive Daya Bay and RENO experiments, its several advantages make it valuable for understanding of systematic errors in measurements of neutrino oscillations. Double Chooz was the first experiment among competing three that produced initial result for neutrino angle θ_1_3 measurement, giving other experiments the chance to improve measured value statistically. Graduate student Ben Rybolt defended his PhD thesis on the results of Double Chooz experiment in 2015. UT group has fulfilled all the construction and analysis commitments to Double Chooz experiment, and has withdrawn from the collaboration by the end of the mentioned period to start another experiment. Larger effort of UT neutrino group during this period was devoted to the participation in another DOE-HEP project - NOvA experiment. The 14,000-ton 'FAR' neutrino detector was commissioned in northern Minnesota in 2014 together with 300-ton 'NEAR' detector located at Fermilab. Following that, the physics measurement program has started when Fermilab accelerator complex produced the high-intensity neutrino beam propagating through Earth to detector in MInnessota. UT group contributed to NOvA detector construction and developments in several aspects. Our Research Associate Athanasios Hatzikoutelis was managing (Level 3 manager) the construction of the Detector Control System. This work was successfully accomplished in time with the commissioning of the detectors. Group was involved in the development of the on-line software and study of the signatures of the cosmic ray backgrounds

Étude des antineutrinos de réacteurs : mesure de l'angle de mélange leptonique θ₁₃ et recherche d'éventuels neutrinos stériles

OpenAIRE

Collin, Antoine

2014-01-01

The Double Chooz experiment aims to measure the θ₁₃ mixing angle through the disappearance—induced by the oscillation phenomenon—of anti-neutrinos produced by the Chooz nuclear reactors. In order to reduce systematic uncertainties, the experiment relies on the relative comparison of detected signals in two identical liquid scintillator detectors. The near one, giving the normalization of the emitted flux, is currently being built and will be delivered in spring 2014. The far detector, sensiti...

LSNR Airborne LIDAR Mapping System Design and Early Results (Invited)

Science.gov (United States)

Shrestha, K.; Carter, W. E.; Slatton, K. C.

2009-12-01

Low signal-to-noise ratio (LSNR) detection techniques allow for implementation of airborne light detection and range (LIDAR) instrumentation aboard platforms with prohibitive power, size, and weight restrictions. The University of Florida has developed the Coastal Area Tactical-mapping System (CATS), a prototype LSNR LIDAR system capable of single photon laser ranging. CATS is designed to operate in a fixed-wing aircraft flying 600 m above ground level, producing 532 nm, 480 ps, 3 μJ output pulses at 8 kHz. To achieve continuous coverage of the terrain with 20 cm spatial resolution in a single pass, a 10x10 array of laser beamlets is scanned. A Risley prism scanner (two rotating V-coated optical wedges) allows the array of laser beamlets to be deflected in a variety of patterns, including conical, spiral, and lines at selected angles to the direction of flight. Backscattered laser photons are imaged onto a 100 channel (10x10 segmented-anode) photomultiplier tube (PMT) with a micro-channel plate (MCP) amplifier. Each channel of the PMT is connected to a multi-stop 2 GHz event timer. Here we report on tests in which ranges for known targets were accumulated for repeated laser shots and statistical analyses were applied to evaluate range accuracy, minimum separation distance, bathymetric mapping depth, and atmospheric scattering. Ground-based field test results have yielded 10 cm range accuracy and sub-meter feature identification at variable scan settings. These experiments also show that a secondary surface can be detected at a distance of 15 cm from the first. Range errors in secondary surface identification for six separate trials were within 7.5 cm, or within the timing resolution limit of the system. Operating at multi-photon sensitivity may have value for situations in which high ambient noise precludes single-photon sensitivity. Low reflectivity targets submerged in highly turbid waters can cause detection issues. CATS offers the capability to adjust the

Some activities in France related to life management of nuclear power plants

International Nuclear Information System (INIS)

Petrequin, P.

1998-01-01

Significant events concerned with life management of NPPs in France were: replacement of steam generators of TRICASTIN 1 NPP, defect detected in the emergency cooling system of DAMPIERRE 1 reactor and expertise of decommissioned CHOOZ A reactor. Programs in progress described in this report are: irradiation of materials for internal components and fracture toughness studies of irradiated materials

A computer - aided system for the the E.D.F. 1400 MW. Nuclear power plants control

International Nuclear Information System (INIS)

Beltranda, G.; Philipps, C.

1988-01-01

The future E.D.F. 1400 MW nuclear power plants (due to be commissioned in 1991 at CHOOZ) are provided with a control and instrumentation system including the following levels: - sensors and actuators (LEVEL 0): this is the interface of the elementary acquisition and control signals; - the programmable logical and numerical controllers (LEVEL 1) for the logical control sequences and analog adjustment sequences for the whole equipment of the facilities; - the control room (LEVEL 2) including the computer-aided operation system as well as the wall mimic diagram and the auxiliary panel directly connected to the controllers. This is the processing and control conversational level; - the maintenance and site computer-aided systems (LEVEL 3). This paper aims at describing the computer-aided operation system (called KIC N4), its main functions, its architecture and the solutions retained as regards its softwares and the high-quality of data required. The achievement of this system has been entrusted by EDF to the SEMA. METRA/CIMSA-SINTRA grouping, among which SEMA.METRA is the leading company

A low-power high dynamic range front-end ASIC for imaging calorimeters

CERN Document Server

Bagliesi, M G; Marrocchesi, P S; Meucci, M; Millucci, V; Morsani, F; Paoletti, R; Pilo, F; Scribano, A; Turini, N; Valle, G D

2002-01-01

High granularity calorimeters with shower imaging capabilities require dedicated front-end electronics. The ICON 4CH and VA4 PMT chip-set is suitable for very high dynamic range systems with strict noise requirements. The ICON 4CH is a 4 channel input, 12 channel output ASIC designed for use in a multi-anode photomultiplier system with very large dynamic range and low-noise requirements. Each of the four input signals to the ASIC is split equally into three branches by a current conveyor. Each of the three branches is scaled differently: 1:1, 1:8 and 1:80. The signal is read out by a 12 channel low noise/low power high dynamic range charge sensitive preamplifier-shaper circuit (VA4-PMT chip), with simultaneous sample- and-hold, multiplexed analog read-out, calibration facilities. Tests performed in our lab with a PMT are reported in terms of linearity, dynamic range and cross-talk of the system. (5 refs).

Mucoadhesive and pH-sensitive thiolated Eudragit microspheres for oral delivery of Pasteurella multocida antigens containing dermonecrotoxin.

Science.gov (United States)

Islam, Mohammad Ariful; Jiang, Hu-Lin; Quan, Ji-Shan; Arote, Rohidas B; Kang, Mi-Lan; Yoo, Han-Sang; Yun, Cheol-Heui; Choi, Yun-Jaie; Cho, Chong-Su

2011-05-01

In this study, cysteine was conjugated to the Eudragit to have mucoadhesive and pH-sensitive properties. Pasteurella multocida dermonecrotoxin (PMT) is a major virulence factor as a causative agent of atrophic rhinitis (AR) in swine and, therefore, inactivated P. multocida was used as a candidate vaccine in the current study. PMT-loaded thiolated Eudragit microspheres (TEMS) prepared using W/O/W emulsion-solvent evaporation method were characterized to assess their efficacy in oral vaccination. PMT-loaded TEMS were observed as spherical shapes with smooth surfaces and average particle sizes were 5.2 +/- 0.55 microm. The loading efficiency of PMT in the TEMS was about 75.3%. A significantly higher percentage of PMT from PMT-loaded TEMS was released at pH 7.4 than at pH 1.5. Murine macrophage stimulated with PMT-loaded TEMS facilitated a gradual secretion of tumor necrosis factor-alpha and nitric oxide as immune stimulatory mediators in a time dependent manner, suggesting that the released PMT from PMT-loaded TEMS had immune stimulating activity of AR vaccine in vitro.

Interaction of promethazine and adiphenine to human hemoglobin: A comparative spectroscopic and computational analysis

Science.gov (United States)

Maurya, Neha; ud din Parray, Mehraj; Maurya, Jitendra Kumar; Kumar, Amit; Patel, Rajan

2018-06-01

The binding nature of amphiphilic drugs viz. promethazine hydrochloride (PMT) and adiphenine hydrochloride (ADP), with human hemoglobin (Hb) was unraveled by fluorescence, absorbance, time resolved fluorescence, fluorescence resonance energy transfer (FRET) and circular dichroism (CD) spectral techniques in combination with molecular docking and molecular dynamic simulation methods. The steady state fluorescence spectra indicated that both PMT and ADP quenches the fluorescence of Hb through static quenching mechanism which was further confirmed by time resolved fluorescence spectra. The UV-Vis spectroscopy suggested ground state complex formation. The activation energy (Ea) was observed more in the case of Hb-ADP than Hb-PMT interaction system. The FRET result indicates the high probability of energy transfer from β Trp37 residue of Hb to the PMT (r = 2.02 nm) and ADP (r = 2.33 nm). The thermodynamic data reveal that binding of PMT with Hb are exothermic in nature involving hydrogen bonding and van der Waal interaction whereas in the case of ADP hydrophobic forces play the major role and binding process is endothermic in nature. The CD results show that both PMT and ADP, induced secondary structural changes of Hb and unfold the protein by losing a large helical content while the effect is more pronounced with ADP. Additionally, we also utilized computational approaches for deep insight into the binding of these drugs with Hb and the results are well matched with our experimental results.

Identification of O-mannosylated virulence factors in Ustilago maydis.

Directory of Open Access Journals (Sweden)

Alfonso Fernández-Álvarez

Full Text Available The O-mannosyltransferase Pmt4 has emerged as crucial for fungal virulence in the animal pathogens Candida albicans or Cryptococcus neoformans as well as in the phytopathogenic fungus Ustilago maydis. Pmt4 O-mannosylates specific target proteins at the Endoplasmic Reticulum. Therefore a deficient O-mannosylation of these target proteins must be responsible for the loss of pathogenicity in pmt4 mutants. Taking advantage of the characteristics described for Pmt4 substrates in Saccharomyces cerevisiae, we performed a proteome-wide bioinformatic approach to identify putative Pmt4 targets in the corn smut fungus U. maydis and validated Pmt4-mediated glycosylation of candidate proteins by electrophoretic mobility shift assays. We found that the signalling mucin Msb2, which regulates appressorium differentiation upstream of the pathogenicity-related MAP kinase cascade, is O-mannosylated by Pmt4. The epistatic relationship of pmt4 and msb2 showed that both are likely to act in the same pathway. Furthermore, constitutive activation of the MAP kinase cascade restored appressorium development in pmt4 mutants, suggesting that during the initial phase of infection the failure to O-mannosylate Msb2 is responsible for the virulence defect of pmt4 mutants. On the other hand we demonstrate that during later stages of pathogenic development Pmt4 affects virulence independently of Msb2, probably by modifying secreted effector proteins. Pit1, a protein required for fungal spreading inside the infected leaf, was also identified as a Pmt4 target. Thus, O-mannosylation of different target proteins affects various stages of pathogenic development in U. maydis.

Insights into the molecular mechanisms of Polygonum multiflorum Thunb-induced liver injury: a computational systems toxicology approach.

Science.gov (United States)

Wang, Yin-Yin; Li, Jie; Wu, Zeng-Rui; Zhang, Bo; Yang, Hong-Bin; Wang, Qin; Cai, Ying-Chun; Liu, Gui-Xia; Li, Wei-Hua; Tang, Yun

2017-05-01

An increasing number of cases of herb-induced liver injury (HILI) have been reported, presenting new clinical challenges. In this study, taking Polygonum multiflorum Thunb (PmT) as an example, we proposed a computational systems toxicology approach to explore the molecular mechanisms of HILI. First, the chemical components of PmT were extracted from 3 main TCM databases as well as the literature related to natural products. Then, the known targets were collected through data integration, and the potential compound-target interactions (CTIs) were predicted using our substructure-drug-target network-based inference (SDTNBI) method. After screening for hepatotoxicity-related genes by assessing the symptoms of HILI, a compound-target interaction network was constructed. A scoring function, namely, Ascore, was developed to estimate the toxicity of chemicals in the liver. We conducted network analysis to determine the possible mechanisms of the biphasic effects using the analysis tools, including BiNGO, pathway enrichment, organ distribution analysis and predictions of interactions with CYP450 enzymes. Among the chemical components of PmT, 54 components with good intestinal absorption were used for analysis, and 2939 CTIs were obtained. After analyzing the mRNA expression data in the BioGPS database, 1599 CTIs and 125 targets related to liver diseases were identified. In the top 15 compounds, seven with Ascore values >3000 (emodin, quercetin, apigenin, resveratrol, gallic acid, kaempferol and luteolin) were obviously associated with hepatotoxicity. The results from the pathway enrichment analysis suggest that multiple interactions between apoptosis and metabolism may underlie PmT-induced liver injury. Many of the pathways have been verified in specific compounds, such as glutathione metabolism, cytochrome P450 metabolism, and the p53 pathway, among others. Hepatitis symptoms, the perturbation of nine bile acids and yellow or tawny urine also had corresponding pathways

A Resettable Keypad Lock with Visible Readout Based on Closed Bipolar Electrochemistry and Electrochromic Poly(3-methylthiophene) Films.

Science.gov (United States)

Wang, Lei; Lian, Wenjing; Liu, Hongyun

2016-03-24

A closed bipolar electrode (BPE) system was developed with electrochromic poly(3-methylthiophene) (PMT) films electropolymerized on the ITO/rGO electrode as one pole of BPE in the reporting reservoir and the bare ITO electrode as another pole of BPE in the analyte reservoir, in which rGO represents reduced graphene oxide. Under a suitable driving voltage (Vtot), the electrochemical reduction/oxidation of electroactive probes, such as H2O2/glutathione (Glu), in the analyte reservoir could induce the reversible color change of PMT films in the reporting reservoir between blue and red. Based on this, a keypad lock with H2O2 , Glu, and Vtot =-3.0 V as the three inputs and the color change of PMT films as the visible output was established. This system was easily operated and did not need to synthesize the complex compounds or DNA molecules. The security system was easy to reset and could be used repeatedly. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Development of the LBNL positron emission mammography camera

International Nuclear Information System (INIS)

Huber, Jennifer S.; Choong, Woon-Seng; Wang, Jimmy; Maltz, Jonathon S.; Qi, Jinyi; Mandelli, Emanuele; Moses, William W.

2002-01-01

We present the construction status of the LBNL Positron Emission Mammography (PEM) camera, which utilizes a PET detector module with depth of interaction measurement consisting of 64 LSO crystals (3x3x30 mm3) coupled on one end to a single photomultiplier tube (PMT) and on the opposite end to a 64 pixel array of silicon photodiodes (PDs). The PMT provides an accurate timing pulse, the PDs identify the crystal of interaction, the sum provides a total energy signal, and the PD/(PD+PMT) ratio determines the depth of interaction. We have completed construction of all 42 PEM detector modules. All data acquisition electronics have been completed, fully tested and loaded onto the gantry. We have demonstrated that all functions of the custom IC work using the production rigid-flex boards and data acquisition system. Preliminary detector module characterization and coincidence data have been taken using the production system, including initial images

Test of the photon detection system for the LHCb RICH Upgrade in a charged particle beam

CERN Document Server

Baszczyk, M.K.

2017-01-16

The LHCb detector will be upgraded to make more efficient use of the available luminosity at the LHC in Run III and extend its potential for discovery. The Ring Imaging Cherenkov detectors are key components of the LHCb detector for particle identification. In this paper we describe the setup and the results of tests in a charged particle beam, carried out to assess prototypes of the upgraded opto-electronic chain from the Multi-Anode PMT photosensor to the readout and data acquisition system.

Physicochemical and Sensory Properties of Appenzeller Cheese Supplemented with Powdered Microcapsule of Tomato Extract during Ripening

Science.gov (United States)

Kwak, Hae-Soo; Chimed, Chogsom; Yoo, Sang-Hun

2016-01-01

The objective of this study was to determine the physicochemical and sensory properties of Appenzeller cheese supplemented with different concentrations (0, 1, 2, 3, and 4%, w/w) of powdered microcapsules of tomato extracts (PMT) during ripening at 14℃ for 6 mon. The particle sizes of PMT ranged from 1 to 10 m diameter with an average particle size of approximately 2 m. Butyric acid (C4) concentrations of PMT-added Appenzeller cheese were significantly higher than that of the control. Lactic acid bacteria counts in the cheese were not significantly influenced by ripening time from 0 to 6 mon or the concentrations (0-4%, w/w) of PMT. In terms of texture, the hardness of PMT-added Appenzeller cheese was significantly increased compared to the control. The gumminess and chewiness of PMT-added Appenzeller cheese were similar to those of the control. However, both cohesiveness and springiness of PMT-added Appenzeller cheese were slightly decreased. In sensory analysis, bitterness and sourness of Appenzeller cheese were not significantly changed after supplementation of PMT, but sweetness of the cheese was significantly increased after increasing the ripening time from 0 to 6 mon and increasing the concentration from 1 to 4% (w/w). Based on these results, the addition of the concentrations (1-4%, w/w) of PMT to Appenzeller cheese can be used to develop functional Appenzeller cheese. PMID:27194934

Volcanic eruptions and the increases in the stratospheric aerosol content: Lidar measurements from 1982 to 1986

Science.gov (United States)

Hayashida, S.; Iikura, Y.; Shimizu, H.; Sasano, Y.; Nakane, H.; Sugimoto, N.; Matsui, I.; Takeuchi, N.

1986-01-01

The results of the observation for stratospheric aerosols which were carried out since the autumn of 1982 by using the NIES large lidar are described. Specifications of the lidar system are shown. The lidar has two wavelenghts of 1.06 and 0.53 micrometers. The 0.53 micrometer is mainly used for the stratospheric aerosols, because the PMT for 0.53 micrometers has higher sensitivity that that for 1.06 micrometers and the total efficiency is higher in the former. A switching circuit is used to control the PMT gain for avoiding signal induced noise in PMT. For the last four years, the stratospheric aerosol layer which was significantly perturbed by the El Chichon volcanic eruption was observed. The scattering ratio profiles observed from 1982 through 1983 are given.

Was the Scanner Calibration Slide used for its intended purpose?

Directory of Open Access Journals (Sweden)

Zong Yaping

2011-04-01

Full Text Available Abstract In the article, Scanner calibration revisited, BMC Bioinformatics 2010, 11:361, Dr. Pozhitkov used the Scanner Calibration Slide, a key product of Full Moon BioSystems to generate data in his study of microarray scanner PMT response and proposed a mathematic model for PMT response 1. In the end, the author concluded that "Full Moon BioSystems calibration slides are inadequate for performing calibration," and recommended "against using these slides." We found these conclusions are seriously flawed and misleading, and his recommendation against using the Scanner Calibration Slide was not properly supported.

Calibration and Process of Signal of Photomultiplier Tube in Rayleigh Scattering of Supersonic Jet Clusters

International Nuclear Information System (INIS)

Lu Jianfeng; Liu Meng; Han Jifeng; Li Jia; Luo Xiaobing; Miao Jingwei; Yang Chaowen

2009-01-01

In the experiments of Rayleigh scattering of gas-jet clusters, the signal amplitude of PMT is not only affected by duster itself, but also by the intensity of light source and work voltage of PMT. When the back pressure of cluster source varies from 10 atm to about 100atm, the signal amplitude of PMT may be from linear to nonlinear. In order to solve the problem, signal calibration of PMT under different intensifies of light and voltage of PMT has been done. The relationship between the amplitude of signal and intensities of light as well as voltage of PMT has been obtained. The function of scatter factor of Ar clusters with the back pressure of cluster source is gotten experimentally, and agrees with related experimental and theoretical results. (authors)

Pharmacomechanical Thrombectomy in Paget–Schroetter Syndrome

Energy Technology Data Exchange (ETDEWEB)

Kärkkäinen, Jussi M., E-mail: jkarkkai@gmail.com [Kuopio University Hospital, Heart Center (Finland); Nuutinen, Henrik [Kuopio University Hospital, Department of Surgery (Finland); Riekkinen, Teemu [Kuopio University Hospital, Heart Center (Finland); Sihvo, Eero [Central Finland Central Hospital, Department of Surgery (Finland); Turtiainen, Johanna [North Karelia Central Hospital, Department of Surgery (Finland); Saari, Petri [Kuopio University Hospital, Department of Clinical Radiology (Finland); Mäkinen, Kimmo [Kuopio University Hospital, Heart Center (Finland); Manninen, Hannu [Kuopio University Hospital, Department of Clinical Radiology (Finland)

2016-09-15

PurposeThe purpose of the study was to evaluate feasibility of pharmacomechanical thrombectomy (PMT) in the treatment of Paget–Schroetter syndrome (PSS) followed by thoracoscopic or open surgical decompression of the subclavian vein.MethodsTwenty-two out of 27 consecutive patients with PSS received PMT using the Trellis-8 peripheral infusion system (Covidien) between 2010 and 2014. Subsequent surgery was performed in 18 of those patients, 9 patients were treated with thoracoscopic, 7 patients with subclavicular, and 2 patients with transaxillary first rib resection, 4 patients were treated with PMT and anticoagulation alone. Technical success, complications, and patency were registered.ResultsPMT was successful in 21 (95 %) patients; 1 patient with unsatisfactory lysis received further catheter-directed thrombolysis, which, however, did not improve the result. The mean endovascular procedure time was 105 ± 33 min (range 70–200 min), and the required median amount of thrombolytic agent was 500,000 international unit (IU; range 250,000–1,000,000 IU). Adjunctive balloon venoplasty and aspiration were used in 18 (82 %) and 7 (32 %) cases, respectively. One patient had an intimal tear of the subclavian vein that was discovered and repaired during surgery. There were no other complications related to the endovascular procedure. At follow-up, 18 of 21 patients (86 %) with follow-up imaging available had patent subclavian vein, and all except 1 of the 22 patients were asymptomatic. The mean follow-up time was 25 ± 17 months.ConclusionsIn experienced hands, PMT is effective for early thrombus removal in PSS. Surgical decompression must be considered after PMT.

A double photomultiplier Compton camera and its readout system for mice imaging

Energy Technology Data Exchange (ETDEWEB)

Fontana, Cristiano Lino [Physics Department Galileo Galilei, University of Padua, Via Marzolo 8, Padova 35131 (Italy) and INFN Padova, Via Marzolo 8, Padova 35131 (Italy); Atroshchenko, Kostiantyn [Physics Department Galileo Galilei, University of Padua, Via Marzolo 8, Padova 35131 (Italy) and INFN Legnaro, Viale dell' Universita 2, Legnaro PD 35020 (Italy); Baldazzi, Giuseppe [Physics Department, University of Bologna, Viale Berti Pichat 6/2, Bologna 40127, Italy and INFN Bologna, Viale Berti Pichat 6/2, Bologna 40127 (Italy); Bello, Michele [INFN Legnaro, Viale dell' Universita 2, Legnaro PD 35020 (Italy); Uzunov, Nikolay [Department of Natural Sciences, Shumen University, 115 Universitetska str., Shumen 9712, Bulgaria and INFN Legnaro, Viale dell' Universita 2, Legnaro PD 35020 (Italy); Di Domenico, Giovanni [Physics Department, University of Ferrara, Via Saragat 1, Ferrara 44122 (Italy) and INFN Ferrara, Via Saragat 1, Ferrara 44122 (Italy)

2013-04-19

We have designed a Compton Camera (CC) to image the bio-distribution of gamma-emitting radiopharmaceuticals in mice. A CC employs the 'electronic collimation', i.e. a technique that traces the gamma-rays instead of selecting them with physical lead or tungsten collimators. To perform such a task, a CC measures the parameters of the Compton interaction that occurs in the device itself. At least two detectors are required: one (tracker), where the primary gamma undergoes a Compton interaction and a second one (calorimeter), in which the scattered gamma is completely absorbed. Eventually the polar angle and hence a 'cone' of possible incident directions are obtained (event with 'incomplete geometry'). Different solutions for the two detectors are proposed in the literature: our design foresees two similar Position Sensitive Photomultipliers (PMT, Hamamatsu H8500). Each PMT has 64 output channels that are reduced to 4 using a charge multiplexed readout system, i.e. a Series Charge Multiplexing net of resistors. Triggering of the system is provided by the coincidence of fast signals extracted at the last dynode of the PMTs. Assets are the low cost and the simplicity of design and operation, having just one type of device; among drawbacks there is a lower resolution with respect to more sophisticated trackers and full 64 channels Readout. This paper does compare our design of our two-Hamamatsu CC to other solutions and shows how the spatial and energy accuracy is suitable for the inspection of radioactivity in mice.

Improvement of Equipment reliability for Auxiliary Feed Water System

Energy Technology Data Exchange (ETDEWEB)

Deok, Lee Sang; Kwan, Lee Yong [KEPCO International Nuclear Graduate School, Ulsan (Korea, Republic of)

2013-10-15

According to AP913 ER) of INPO, Number of the event related to equipment is higher than others like external or human performance. In the top 25 systems, Auxiliary feed water system is the seventh highest among systems. AWFS consists of many component and complex system and Main Function of AFWS is to supply feedwater to the steam generators for the removal of heat from the RCS(Reactor Coolant System) in event the main feedwater system is unavailable following a transient or accident. Reliability of component means how well operate on demands and monitoring is necessary to keep track of condition of component. If component performance is lower than the required value, corrective action for failure mode should be done. The objective of this study is focused to improve of AF pump by adding the tasks of SHR(System Health Report) into the task of system engineer walkdown of PMT(Preventive Maintenance Template). Increasing the reliability of AF pump will contribute to improvement of reliability of AFWS. Based on operating history, there was high vibration of AF pump during performance test. In that case, there were a lot of maintenance works for normal operation of AF pump. Vibration problem related pump can't be detected by tasks of SE walkdown because it's not running during normal operation except for surveillance test. CHR(Component Health Report) of AF pump in AFWS can be made from necessary part which means monitoring and functional failure because problem of Stand-by pump can be covered by conducting monitoring and analysis of functional failure. To improve reliability of AF pump, walkdown of PMT and SHR should be conducted both in accordance with surveillance test frequency. Health of AF pump based on operation history can be verified first and then can find out which parts of pump are weak. Finally, weak part can be managed intensively and failure can be reduced according to SE walkdown. But this work can be risky and burdensome because all parts of

Reactor anti-neutrinos: measurement of the θ13 leptonic mixing angle and search for potential sterile neutrinos

International Nuclear Information System (INIS)

Collin, A.

2014-01-01

The Double Chooz experiment aims to measure the θ 13 mixing angle through the disappearance -induced by the oscillation phenomenon - of anti-neutrinos produced by the Chooz nuclear reactors. In order to reduce systematic uncertainties, the experiment relies on the relative comparison of detected signals in two identical liquid scintillator detectors. The near one, giving the normalization of the emitted flux, is currently being built and will be delivered in spring 2014. The far detector, sensitive to θ 13 , is located at about one kilometer and is taking data since 2011. In this first phase of the experiment, the far detector data are compared to a prediction of the emitted neutrino flux to estimate θ 13 . In this thesis, the Double Chooz experiment and its analysis are presented, especially the background studies and the rejection of parasitic signals due to light emitted by photo-multipliers. Neutron fluxes between the different detector volumes impact the definition of the fiducial volume of neutrino interactions and the efficiency of detection. Detailed studies of these effects are presented. As part of the Double Chooz experiment, studies were performed to improve the prediction of neutrino flux emitted by reactors. This work revealed a deficit of observed neutrino rates in the short baseline experiments of last decades. This deficit could be explained by an oscillation to a sterile state. The Stereo project aims to observe a typical signature of oscillations: the distortion of neutrino spectra both in energy and baseline. This thesis presents the detector concept and simulations as well as sensitivity studies. Background sources and the foreseen shielding are also discussed. (author) [fr

Health Risk Perceptions and Exercise in Older Adulthood: An Application of Protection Motivation Theory.

Science.gov (United States)

Ruthig, Joelle C

2016-09-01

Protection Motivation Theory (PMT) was applied to explore the relationship between perceived risk of acute health crises and intent to exercise. Interviews of 351 community-living older adults assessed prior physical activity (PPA), all PMT components, and exercise intent. A multi-group structural equation model revealed gender differences in PMT predictors of exercise intent. PPA, age, self-efficacy, and response efficacy directly predicted men's intent. Women's PPA and age predicted PMT components of self-efficacy and response costs, which predicted intent. Findings have implications for devising interventions to enhance physical activity in later life by targeting different PMT components for older men and women. © The Author(s) 2014.

Catheter-directed thrombolysis and pharmacomechanical thrombectomy improve midterm outcome in acute iliofemoral deep vein thrombosis

Directory of Open Access Journals (Sweden)

Tzu-Ting Kuo

2017-02-01

Conclusion: CDT and PMT have similar venous outcomes in patients with acute iliofemoral DVT, although PTS is less severe following PMT than after CDT. We propose that early and thorough removal of thrombus, using either CDT or PMT, is beneficial to prevent PTS.

Gain monitoring of telescope array photomultiplier cameras for the first 4 years of operation

Energy Technology Data Exchange (ETDEWEB)

Shin, B.K., E-mail: bkshin@hanyang.ac.kr [Hanyang University, Seongdong-gu, Seoul (Korea, Republic of); Tokuno, H.; Tsunesada, Y. [Tokyo Institute of Technology, Meguro, Tokyo (Japan); Abu-Zayyad, T. [University of Utah, High Energy Astrophysics Institute, Salt Lake City, UT (United States); Aida, R. [University of Yamanashi, Interdisciplinary Graduate School of Medicine and Engineering, Kofu, Yamanashi (Japan); Allen, M.; Anderson, R. [University of Utah, High Energy Astrophysics Institute, Salt Lake City, UT (United States); Azuma, R. [Tokyo Institute of Technology, Meguro, Tokyo (Japan); Barcikowski, E.; Belz, J.W.; Bergman, D.R.; Blake, S.A.; Cady, R. [University of Utah, High Energy Astrophysics Institute, Salt Lake City, UT (United States); Cheon, B.G., E-mail: bgcheon@hanyang.ac.kr [Hanyang University, Seongdong-gu, Seoul (Korea, Republic of); Chiba, J. [Tokyo University of Science, Noda, Chiba (Japan); Chikawa, M. [Kinki University, Higashi Osaka, Osaka (Japan); Cho, E.J. [Hanyang University, Seongdong-gu, Seoul (Korea, Republic of); Cho, W.R. [Yonsei University, Seodaemun-gu, Seoul (Korea, Republic of); Fujii, H. [Institute of Particle and Nuclear Studies, KEK, Tsukuba, Ibaraki (Japan); Fujii, T. [Osaka City University, Osaka, Osaka (Japan); and others

2014-12-21

The stability of the gain of the photomultiplier (PMT) camera for the Fluorescence Detector (FD) of the Telescope Array experiment was monitored using an {sup 241}Am loaded scintillator pulsers (YAP) and a diffused xenon flasher (TXF) for a selected set of 35 PMT-readout channels. From the monitoring of YAP pulses over four years of FD operation, we found slow monotonic drifts of PMT gains at a rate of −1.7∼+1.7%/year. An average of the PMT gains over the 35 channels stayed nearly constant with a rate of change measured at −0.01±0.31(stat)±0.21(sys)%/year. No systematic decrease of the PMT gain caused by the night sky background was observed. Monitoring by the TXF also tracked the PMT gain drift of the YAP at 0.88±0.14(stat)%/year.

Design and simulations for RFPI system test jig

International Nuclear Information System (INIS)

Keshwani, Rajesh; Khole, Shailesh; Sujo, C.I.; Shukla, Hitesh; Afaash, M.; Bharade, Sandeep; Joshi, Gopal

2015-01-01

RFPI system for condition monitoring and protection of RF systems of LEHIPA has been designed. The intention of this system is to protect and monitor different high power RF components. The system consists of variety of analog and digital cards to process, acquire and monitor signals from RF sensors, photo multiplier tubes (PMT), field emission probes, photo sensors, etc. The system can also accept and process digital inputs or contacts and analog input signals from other subsystems, indicating their status. It comprises of analog signal processing electronics, condition monitoring, data acquisition and fault reporting features. Since RFPI system should process and take action within prescribed time limit, the testing of system is critical issue. In order to carry out stand-alone field testing of such elaborate electronic system, variety of carefully designed electronic test circuit with suitable rangeability is required. These include fast current sources, fast amplifiers, fast rectifiers, etc. This paper elaborates on specifications, design approach, circuit design and simulations for various circuits used in test jig

Light scattering by ultrasonically-controlled small particles: system design, calibration, and measurement results

Science.gov (United States)

Kassamakov, Ivan; Maconi, Göran; Penttilä, Antti; Helander, Petteri; Gritsevich, Maria; Puranen, Tuomas; Salmi, Ari; Hæggström, Edward; Muinonen, Karri

2018-02-01

We present the design of a novel scatterometer for precise measurement of the angular Mueller matrix profile of a mm- to µm-sized sample held in place by sound. The scatterometer comprises a tunable multimode Argon-krypton laser (with possibility to set 1 of the 12 wavelengths in visible range), linear polarizers, a reference photomultiplier tube (PMT) for monitoring the beam intensity, and a micro-PMT module mounted radially towards the sample at an adjustable radius. The measurement angle is controlled by a motor-driven rotation stage with an accuracy of 15'. The system is fully automated using LabVIEW, including the FPGA-based data acquisition and the instrument's user interface. The calibration protocol ensures accurate measurements by using a control sphere sample (diameter 3 mm, refractive index of 1.5) fixed first on a static holder followed by accurate multi-wavelength measurements of the same sample levitated ultrasonically. To demonstrate performance of the scatterometer, we conducted detailed measurements of light scattered by a particle derived from the Chelyabinsk meteorite, as well as planetary analogue materials. The measurements are the first of this kind, since they are obtained using controlled spectral angular scattering including linear polarization effects, for arbitrary shaped objects. Thus, our novel approach permits a non-destructive, disturbance-free measurement with control of the orientation and location of the scattering object.

Molecular cloning and functional expression of a stress-induced multifunctional O-methyltransferase with pinosylvin methyltransferase activity from Scots pine (Pinus sylvestris L.).

Science.gov (United States)

Chiron, H; Drouet, A; Claudot, A C; Eckerskorn, C; Trost, M; Heller, W; Ernst, D; Sandermann, H

2000-12-01

Formation of pinosylvin (PS) and pinosylvin 3-O-monomethyl ether (PSM), as well as the activities of stilbene synthase (STS) and S-adenosyl-1-methionine (SAM):pinosylvin O-methyltransferase (PMT), were induced strongly in needles of Scots pine seedlings upon ozone treatment, as well as in cell suspension cultures of Scots pine upon fungal elicitation. A SAM-dependent PMT protein was purified and partially characterised. A cDNA encoding PMT was isolated from an ozone-induced Scots pine cDNA library. Southern blot analysis of the genomic DNA suggested the presence of a gene family. The deduced protein sequence showed the typical highly conserved regions of O-methyltransferases (OMTs), and average identities of 20-56% to known OMTs. PMT expressed in Escherichia coli corresponded to that of purified PMT (40 kDa) from pine cell cultures. The recombinant enzyme catalysed the methylation of PS, caffeic acid, caffeoyl-CoA and quercetin. Several other substances, such as astringenin, resveratrol, 5-OH-ferulic acid, catechol and luteolin, were also methylated. Recombinant PMT thus had a relatively broad substrate specificity. Treatment of 7-year old Scots pine trees with ozone markedly increased the PMT mRNA level. Our results show that PMT represents a new SAM-dependent OMT for the methylation of stress-induced pinosylvin in Scots pine needles.

Application of the protection motivation theory in predicting cigarette smoking among adolescents in China.

Science.gov (United States)

Yan, Yaqiong; Jacques-Tiura, Angela J; Chen, Xinguang; Xie, Nianhua; Chen, Jing; Yang, Niannian; Gong, Jie; Macdonell, Karen Kolmodin

2014-01-01

Reducing tobacco use among adolescents in China represents a significant challenge for global tobacco control. Existing behavioral theories developed in the West - such as the Protection Motivation Theory (PMT) - may be useful tools to help tackle this challenge. We examined the relationships between PMT factors and self-reported cigarette smoking behavior and intention among a random sample of vocational high school students (N=553) in Wuhan, China. Tobacco-related perceptions were assessed using the PMT Scale for Adolescent Smoking. Among the total sample, 45% had initiated cigarette smoking, and 25% smoked in the past month. Among those who never smoked, 15% indicated being likely or very likely to smoke in a year. Multiple regression modeling analysis indicated the significance of the seven PMT constructs, the four PMT perceptions and the two PMT pathways in predicting intention to smoke and actual smoking behavior. Overall, perceived rewards of smoking, especially intrinsic rewards, were consistently positively related to smoking intentions and behavior, and self-efficacy to avoid smoking was negatively related to smoking. The current study suggests the utility of PMT for further research examining adolescent smoking. PMT-based smoking prevention and clinical smoking cessation intervention programs should focus more on adolescents' perceived rewards from smoking and perceived efficacy of not smoking to reduce their intention to and actual use of tobacco. © 2013.

Clinical evaluation of sup(99m)Tc-N-pyridoxyl-5-methyltryptophan hepatobiliary scintigraphy in hepatocellular carcinoma

International Nuclear Information System (INIS)

Kashiwagi, Toru; Azuma, Masayoshi; Matsuda, Hiroyuki; Yoshioka, Hiroaki; Ishizu, Hiroshi; Mitsutani, Natsuki; Koizumi, Takeo; Kobayashi, Yasushi

1985-01-01

We have assessed the diagnostic value of sup(99m)Tc-N-pyridoxyl-5-methyltryptophan (sup(99m)Tc-PMT) hepatobiliary scintigraphy in 28 patients with hepatocellular carcinoma (HCC) who had obvious filling defects on sup(99m)Tc-phytate liver scintigram. Uptake of sup(99m)Tc-PMT in obvious defects on sup(99m)Tc-phytate liver scintigram was observed in 16 out of 28 patients (57.1 %). Most of HCC with sup(99m)Tc-PMT uptake were histologically well-differenciated. However, well-differenciated HCC did not always take up sup(99m)Tc-PMT. No correlation was observed between sup(99m)Tc-PMT uptake in the tumor and levels of serum alpha-fetoprotein. Patients with high alpha-fetoprotein level (>3000 ng/ml) were only 9 patients (32.1 %) in our study. By the combined results of sup(99m)Tc-PMT hepatobiliary scintigraphy and alpha-fetoprotein level (>3000 ng/ml), diagnostic rate for HCC was markedly elevated up to 75 %. Therefore, it is considered that sup(99m)Tc-PMT hepatobiliary scintigraphy is clinically useful for specific diagnosis of HCC. Furthermore, it provides the information for invasion of HCC into the bile duct. (author)

Clinical evaluation of sup(99m)Tc-N-pyridoxyl-5-methyltryptophan hepatobiliary scintigraphy in hepatocellular carcinoma

Energy Technology Data Exchange (ETDEWEB)

Kashiwagi, Toru; Azuma, Masayoshi; Matsuda, Hiroyuki; Yoshioka, Hiroaki; Ishizu, Hiroshi; Mitsutani, Natsuki; Koizumi, Takeo; Kobayashi, Yasushi

1985-09-01

We have assessed the diagnostic value of sup(99m)Tc-N-pyridoxyl-5-methyltryptophan (sup(99m)Tc-PMT) hepatobiliary scintigraphy in 28 patients with hepatocellular carcinoma (HCC) who had obvious filling defects on sup(99m)Tc-phytate liver scintigram. Uptake of sup(99m)Tc-PMT in obvious defects on sup(99m)Tc-phytate liver scintigram was observed in 16 out of 28 patients (57.1 %). Most of HCC with sup(99m)Tc-PMT uptake were histologically well-differenciated. However, well-differenciated HCC did not always take up sup(99m)Tc-PMT. No correlation was observed between sup(99m)Tc-PMT uptake in the tumor and levels of serum alpha-fetoprotein. Patients with high alpha-fetoprotein level (>3000 ng/ml) were only 9 patients (32.1 %) in our study. By the combined results of sup(99m)Tc-PMT hepatobiliary scintigraphy and alpha-fetoprotein level (>3000 ng/ml), diagnostic rate for HCC was markedly elevated up to 75 %. Therefore, it is considered that sup(99m)Tc-PMT hepatobiliary scintigraphy is clinically useful for specific diagnosis of HCC. Furthermore, it provides the information for invasion of HCC into the bile duct.

The central pixel of the MAGIC telescope for optical observations

Science.gov (United States)

Lucarelli, F.; Barrio, J. A.; Antoranz, P.; Asensio, M.; Camara, M.; Contreras, J. L.; Fonseca, M. V.; Lopez, M.; Miranda, J. M.; Oya, I.; Reyes, R. De Los; Firpo, R.; Sidro, N.; Goebel, F.; Lorenz, E.; Otte, N.

2008-05-01

The MAGIC telescope has been designed for the observation of Cherenkov light generated in Extensive Air Showers initiated by cosmic particles. However, its 17 m diameter mirror and optical design makes the telescope suitable for direct optical observations as well. In this paper, we report about the development of a system based on the use of a dedicated photo-multiplier (PMT) for optical observations. This PMT is installed in the centre of the MAGIC camera (the so-called central pixel). An electro-to-optical system has been developed in order to transmit the PMT output signal by an optical fibre to the counting room, where it is digitized and stored for off-line analysis. The performance of the system using the optical pulsation of the Crab nebula as calibration source is presented. The time required for a 5σ detection of the Crab pulsar in the optical band is less than 20 s. The central pixel will be mainly used to perform simultaneous observations of the Crab pulsar both in the optical and γ-ray regimes. It will also allow for periodic testing of the precision of the MAGIC timing system using the Crab rotational optical pulses as a very precise timing reference.

A readout system for the wavelength-shifting optical module

Energy Technology Data Exchange (ETDEWEB)

Foesig, Carl-Christian; Boeser, Sebastian [Johannes Gutenberg-Universitaet, Mainz (Germany); Collaboration: IceCube-Collaboration

2016-07-01

The success of IceCube and the plans for an IceCube-Gen2 stimulate the development of new photo sensors. The approach of the Wavelength-shifting Optical Module is to provide a device which has a low dark noise rate combined with a high detection efficiency. A small PMT is used to detect red shifted photons guided in a coated PMMA tube, originally emitted by a wavelength shifting coating that absorbs photons in the UV Region. We have studied several PMTs for their usability with the IceCube-Gen2 readout system. Relevant parameters are the pulse widths in relation to the bandwidth of the IceCube-Gen2 readout electronics and the dark noise rates.

Structure and function of C-terminal catalytic region of pasteurella multocida toxin

International Nuclear Information System (INIS)

Kitadokoro, Kengo; Kamitami, Shigeki; Horiguchi, Yasuhiko

2008-01-01

Pasteurella multocida toxin (PMT) is one of virulence factors responsible for the pathogenesis in some Pasteurellosis. We determined the crystal structure of the C-terminal region of PMT (C-PMT), which carries an intracellularly active moiety. The overall structure of C-PMT displays three different domains designated C1, C2 and C3. We found in the C3 domain the Cys-His-Asp catalytic triad that is organized only when the Cys is released from a disulfide bond. The steric alignment of the triad corresponded well to that of papain or other enzymes carrying the Cys-His-Asp triad. Our results demonstrate that PMT is an enzymatic toxin carrying the cysteine-protease like catalytic triad, which is organized only under reducing conditions. (author)

Transport mechanisms of hepatic uptake and bile excretion in clinical hepatobiliary scintigraphy with 99mTc-N-pyridoxyl-5-methyltryptophan

International Nuclear Information System (INIS)

Kobayashi, Masato; Nakanishi, Takeo; Nishi, Kodai; Higaki, Yusuke; Okudaira, Hiroyuki; Ono, Masahiro; Tsujiuchi, Takafumi; Mizutani, Asuka; Nishii, Ryuichi; Tamai, Ikumi; Arano, Yasushi; Kawai, Keiichi

2014-01-01

Introduction: In clinical hepatobiliary scintigraphy, 99m Tc-N-pyridoxyl-5-methyltryptophan ( 99m Tc-PMT) is an effective radiotracer among the 99m Tc-pyridoxylaminates. However, the mechanisms of human hepatic uptake and bile excretion transport of 99m Tc-PMT have not been determined. We thus investigated the transport mechanisms of human hepatic uptake and bile excretion in hepatobiliary scintigraphy with 99m Tc-PMT. Methods: Four solute carrier (SLC) transporters involved in hepatic uptake were evaluated using human embryonic kidney (HEK) and HeLa cells with high expression of SLC transporters (organic anion transporting polypeptide (OATP)1B1, OATP1B3, OATP2B1, organic anion transporters (OAT)2 and organic cation transporters (OCT)1) after 5 min of 99m Tc-PMT incubation. Metabolic analysis of 99m Tc-PMT was performed using pooled human liver S9. Adenosine triphosphate (ATP)-binding cassette (ABC) transporters for bile excretion were examined using hepatic ABC transporter vesicles human expressing multiple drug resistance 1 (MDR1), multidrug resistance-associated protein 2 (MRP2), breast cancer resistance protein or bile salt export pump. 99m Tc-PMT was incubated for 1, 3 and 5 min with ATP or adenosine monophosphate and these vesicles. SPECT scans were performed in normal and Eisai hyperbilirubinemic (EHBR) model rats, deficient in Mrp2 transporters, without and with verapamil (rat Mdr1 and human MDR1 inhibitor) after intravenous injection of 99m Tc-PMT. Results: Uptake of 99m Tc-PMT in HEK293/OATP1B1 and HeLa/OATP1B3 was significantly higher than that in HEK293- and HeLa-mock cells. 99m Tc-PMT was not metabolized in the human liver S9. In vesicles with high expression of ABC transporters, uptake of MDR1 or MRP2 was significantly higher at all incubation times. Bile excretion of 99m Tc-PMT was also identified by comparison between normal and EHBR rats with and without verapamil on in-vivo imaging. Conclusions: Human hepatic uptake of 99m Tc-PMT was transferred

Characterizing ICF Neutron Scintillation Diagnostics on the nTOF line at SUNY Geneseo

Science.gov (United States)

Lawson-Keister, Pat; Padawar-Curry, Jonah; Visca, Hannah; Fletcher, Kurt; Padalino, Stephen; Sangster, T. Craig; Regan, Sean

2015-11-01

Neutron scintillator diagnostics for ICF and HEDP can be characterized using the neutron time-of-flight (nTOF) line on Geneseo's 1.7 MV tandem Pelletron accelerator. Neutron signals can be differentiated from gamma signals by employing coincidence methods. A 1.8-MeV beam of deuterons incident on a deuterated polyethylene target produces neutrons via the 2H(d,n)3He reaction. Neutrons emerging at a lab angle of 88° have an energy of 2.96 MeV; the 3He ions associated with these neutrons are detected at a scattering angle of 43° using a surface barrier detector. The time of flight of the neutron can be measured by using the 3He detection as a ``start'' signal and the scintillation detection as a ``stop'' signal. This time of flight requirement is used to identify the 2.96-MeV neutron signals in the scintillator. To measure the light curve produced by these monoenergetic neutrons, two photomultiplier (PMT) tubes are attached to the scintillator. The full aperture PMT establishes the nTOF coincidence. The other PMT is fitted with a pinhole to collect single events. The time between the full aperture PMT signal and the arrival of the signal in the pinhole PMT is used to determine the light curve for the scintillator. This system will enable the neutron response of various scintillators to be compared. Supported in part by the Department of Energy National Nuclear Security Administration under Award Number DE-NA0001944.

A new FPGA-based time-over-threshold system for the time of flight detectors at the BGO-OD experiment

Energy Technology Data Exchange (ETDEWEB)

Freyermuth, Oliver [Physikalisches Institut, Nussallee 12, D-53115 Bonn (Germany); Collaboration: BGO-OD-Collaboration

2015-07-01

The BGO-OD experiment at the ELSA accelerator facility at Bonn is built for the systematic investigation of meson photoproduction in the GeV region. It features the unique combination of a central, highly segmented BGO crystal calorimeter covering almost 4π in acceptance and a forward magnetic spectrometer complemented by time of flight walls. The readout of the ToF scintillator bars was upgraded to an FPGA-based VME-board equipped with discriminator mezzanines including per-channel remotely adjustable thresholds. A firmware was developed combining a time-over-threshold (ToT) measurement by implementing a dual-edge TDC, a configurable meantimer trigger logic including a special cosmics trigger, adjustable input delays and gateable scalers, all inside a single electronics module. An experimentally obtained relation between ToT and slope of a PMT signal can be used for a time walk correction to achieve time resolutions comparable to a classical chain of CFD and standard TDC. Additionally, the time-over-threshold information can be exploited for gain matching and allows to monitor online the gain-stability and check for electronics problems such as pulse reflections or baseline jitter. The system is well-suited for a wide range of PMT-based fast detectors with many channels and further applications foreseen.

Introduction of leadership training based on PM theory at a nuclear power plant. An analysis of leadership, morale and self-efficacy

Energy Technology Data Exchange (ETDEWEB)

Yoshida, Michio [Kumamoto Univ. (Japan). Dept. of Physics; Yoshiyama, Naohiro; Misumi, Emiko; Matsuda, Ryosuke; Misumi, Jyuji; Hiraki, Tadao; Sakurai, Yukihiro

1997-09-01

PM leadership training(PMT) course was introduced into three nuclear power plants for the purpose of accident prevention. PMT is a six-month training course consisting of three parts, i.e., lecture, PM survey, and participants` practice at their workplace. The major aim of PMT is to change participants` leadership behavior into PM-type that is the most desirable for group effectiveness. In this study, we examined the effects of PMT on participants` leadership, subordinates` morale and participants` self-efficacy. Participants were fifty-six supervisors working in operation or maintenance in each nuclear power plant. The supervisors have eight hundred forty five subordinates in all. The major results were as follows: (1) Not only participants` leadership Performance(P) and Maintenance(M) behavior was strengthened, but also their subordinates` morale increased during PMT`s 6-month course. (2) Strengthening both P and M behavior was the most effective in building up subordinates` morale, especially in teamwork, meeting satisfaction, and communication. (3) Participants` self-efficacy was related with the strength of their P behavior and subordinates` group morale. These results show that PMT course is effective in accident prevention in nuclear power plants. Finally, we discuss some future problems of the development of PMT in nuclear power plants. (author)

Maternal-fetal disease information as a source of exercise motivation during pregnancy.

Science.gov (United States)

Gaston, Anca; Prapavessis, Harry

2009-11-01

A Protection Motivation Theory (PMT) framework was used to examine whether information about the role of exercise in preventing maternal-fetal disease served as a meaningful source of exercise motivation. Pregnant women (n = 208) were randomly assigned into one of three conditions: PMT, attention control, and noncontact control. Women in the PMT group read a brochure about the benefits of exercise during pregnancy incorporating the major components of PMT; perceived vulnerability (PV), perceived severity (PS), response efficacy (RE), and self-efficacy (SE). Participants in the attention-control condition read a brochure about diet. Following treatment, all participants completed measures of their beliefs toward maternal-fetal disease and exercise, goal intention (GI), and implementation intention (IMI). One week later, a measure of self-reported exercise behavior was collected. Main outcome measures were PMT variables (PV, PS, RE, and SE), GI, IMI, and follow-up physical activity. Participants assigned to the PMT-present group reported significantly higher PS, RE, SE, GI, and increased exercise behavior. PS, RE, and SE predicted GI, GI predicted IMI, and IMI predicted exercise behavior. Information grounded in PMT is effective in influencing pregnant women's beliefs and intentions as well as changing their initial behavior. PsycINFO Database Record (c) 2009 APA, all rights reserved.

The effect of the rotational orientation of circular photomultipliers in a PET camera block detector design

International Nuclear Information System (INIS)

Uribe, J.; Wong, Wai-Hoi; Hu, Guoju

1996-01-01

This is a study of the effects of geometric asymmetries in circular photomultipliers (PMT) on the design of PET position-sensitive block detectors. The dynodes of linear-focus circular PMT's are asymmetric relative to the axis of the photocathode, despite the rotational symmetry of the photocathode. Hence, there are regional photocathode differences in the anode signal, which affect the decoding characteristics of position sensitive block detectors. This orientation effect, as well as the effect of introducing light diffusers, are studied in a block detector design (BGO) using the PMT-quadrant-sharing configuration. The PMT studied is the Philips XP-1911 (19mm diameter). Seven symmetrical and representative orientations of the four decoding PMT were investigated, as well as one asymmetric orientation. The measurements performed include block-composite pulse-height spectra and crystal decoding maps. Two orientation effects were observed: (A) distortion variation in decoding maps, and (B) decoding resolution variation. The introduction of circular plastic pieces, used as light diffusers, prove to be useful by improving the decoding of crystals on the periphery of the detector block and minimizing distortion in the decoding map. These measurements have shown optimal PMT orientations for the PMT-quadrant-sharing design, as well as for conventional block designs

Introduction of leadership training based on PM theory at a nuclear power plant. An analysis of leadership, morale and self-efficacy

International Nuclear Information System (INIS)

Yoshida, Michio; Yoshiyama, Naohiro; Misumi, Emiko; Matsuda, Ryosuke; Misumi, Jyuji; Hiraki, Tadao; Sakurai, Yukihiro.

1997-01-01

PM leadership training(PMT) course was introduced into three nuclear power plants for the purpose of accident prevention. PMT is a six-month training course consisting of three parts, i.e., lecture, PM survey, and participants' practice at their workplace. The major aim of PMT is to change participants' leadership behavior into PM-type that is the most desirable for group effectiveness. In this study, we examined the effects of PMT on participants' leadership, subordinates' morale and participants' self-efficacy. Participants were fifty-six supervisors working in operation or maintenance in each nuclear power plant. The supervisors have eight hundred forty five subordinates in all. The major results were as follows: (1) Not only participants' leadership Performance(P) and Maintenance(M) behavior was strengthened, but also their subordinates' morale increased during PMT's 6-month course. (2) Strengthening both P and M behavior was the most effective in building up subordinates' morale, especially in teamwork, meeting satisfaction, and communication. (3) Participants' self-efficacy was related with the strength of their P behavior and subordinates' group morale. These results show that PMT course is effective in accident prevention in nuclear power plants. Finally, we discuss some future problems of the development of PMT in nuclear power plants. (author)

The LUCID detector ATLAS luminosity monitor and its electronic system

CERN Document Server

AUTHOR|(INSPIRE)INSPIRE-00378808; The ATLAS collaboration

2016-01-01

Starting from 2015 LHC is performing a new run, at higher center of mass energy (13 TeV) and with 25 ns bunch-spacing. The ATLAS luminosity monitor LUCID has been completely renewed, both on detector design and in the electronics, in order to cope with the new running conditions. The new detector electronics is presented, featuring a new read-out board (LUCROD), for signal acquisition and digitization, PMT-charge integration and single-side luminosity measurements, and the revisited LUMAT board for side-A-side-C combination. The contribution covers the new boards design, the firmware and software developments, the implementation of luminosity algorithms, the optical communication between boards and the integration into the ATLAS TDAQ system.

Acute Pancreatitis after Percutaneous Mechanical Thrombectomy: Case Report and Review of the Literature

International Nuclear Information System (INIS)

Hershberger, Richard C.; Bornak, Arash; Aulivola, Bernadette; Mannava, Krishna

2011-01-01

Purpose: We describe a case of severe acute pancreatitis after percutaneous mechanical thrombectomy (PMT) and review the literature for the occurrence of this complication. Materials and Methods: A 53-year-old man with a history of bilateral external iliac artery stent placement sought care for acute onset of lifestyle-limiting left claudication. Angiography confirmed left external iliac stent occlusion, and PMT with the AngioJet Xpeedior catheter (Possis Medical, Minneapolis MN) was performed. Results: After PMT of the occluded external iliac artery, a residual in-stent stenosis required the placement of a second iliac stent. The procedure was complicated by severe acute pancreatitis. Other causes of pancreatitis were eliminated during the patient’s hospital stay. A literature review revealed nine cases of acute pancreatitis after PMT. Conclusion: Although rare, pancreatitis can be a devastating complication of PMT. The development of pancreatitis seems to be related to the products of extensive hemolysis triggering an inflammatory process. To prevent this complication, we recommend that close attention be paid to the duration and extent of PMT, thereby avoiding extensive hemolysis and subsequent complications.

The LCLS Undulator Beam Loss Monitor Readout System

Energy Technology Data Exchange (ETDEWEB)

Dusatko, John; Browne, M.; Fisher, A.S.; Kotturi, D.; Norum, S.; Olsen, J.; /SLAC

2012-07-23

The LCLS Undulator Beam Loss Monitor System is required to detect any loss radiation seen by the FEL undulators. The undulator segments consist of permanent magnets which are very sensitive to radiation damage. The operational goal is to keep demagnetization below 0.01% over the life of the LCLS. The BLM system is designed to help achieve this goal by detecting any loss radiation and indicating a fault condition if the radiation level exceeds a certain threshold. Upon reception of this fault signal, the LCLS Machine Protection System takes appropriate action by either halting or rate limiting the beam. The BLM detector consists of a PMT coupled to a Cherenkov radiator located near the upstream end of each undulator segment. There are 33 BLMs in the system, one per segment. The detectors are read out by a dedicated system that is integrated directly into the LCLS MPS. The BLM readout system provides monitoring of radiation levels, computation of integrated doses, detection of radiation excursions beyond set thresholds, fault reporting and control of BLM system functions. This paper describes the design, construction and operational performance of the BLM readout system.

Evolution of the key alkaloid enzyme putrescine N-methyltransferase from spermidine synthase.

Directory of Open Access Journals (Sweden)

Anne eJunker

2013-07-01

Full Text Available Putrescine N-methyltransferases (PMTs are the first specific enzymes of the biosynthesis of nicotine and tropane alkaloids. PMTs transfer a methyl group onto the diamine putrescine from S-adenosyl-L-methionine (SAM as coenzyme. PMT proteins have presumably evolved from spermidine synthases (SPDSs, which are ubiquitous enzymes of polyamine metabolism. SPDS use decarboxylated SAM as coenzyme to transfer an aminopropyl group onto putrescine. In an attempt to identify possible and necessary steps in the evolution of PMT from SPDS, homology based modeling of Datura stramonium SPDS1 and PMT was employed to gain deeper insight in the preferred binding positions and conformations of the substrate and the alternative coenzymes. Based on predictions of amino acids responsible for the change of enzyme specificities, sites of mutagenesis were derived. PMT activity was generated in Datura stramonium SPDS1 after few amino acid exchanges. Concordantly, Arabidopsis thaliana SPDS1 was mutated and yielded enzymes with both, PMT and SPDS activities. Kinetic parameters were measured for enzymatic characterization. The switch from aminopropyl to methyl transfer depends on conformational changes of the methionine part of the coenzyme in the binding cavity of the enzyme. The rapid generation of PMT activity in SPDS proteins and the wide-spread occurrence of putative products of N-methylputrescine suggest that PMT activity is present frequently in the plant kingdom.

Charge reconstruction in large-area photomultipliers

Science.gov (United States)

Grassi, M.; Montuschi, M.; Baldoncini, M.; Mantovani, F.; Ricci, B.; Andronico, G.; Antonelli, V.; Bellato, M.; Bernieri, E.; Brigatti, A.; Brugnera, R.; Budano, A.; Buscemi, M.; Bussino, S.; Caruso, R.; Chiesa, D.; Corti, D.; Dal Corso, F.; Ding, X. F.; Dusini, S.; Fabbri, A.; Fiorentini, G.; Ford, R.; Formozov, A.; Galet, G.; Garfagnini, A.; Giammarchi, M.; Giaz, A.; Insolia, A.; Isocrate, R.; Lippi, I.; Longhitano, F.; Lo Presti, D.; Lombardi, P.; Marini, F.; Mari, S. M.; Martellini, C.; Meroni, E.; Mezzetto, M.; Miramonti, L.; Monforte, S.; Nastasi, M.; Ortica, F.; Paoloni, A.; Parmeggiano, S.; Pedretti, D.; Pelliccia, N.; Pompilio, R.; Previtali, E.; Ranucci, G.; Re, A. C.; Romani, A.; Saggese, P.; Salamanna, G.; Sawy, F. H.; Settanta, G.; Sisti, M.; Sirignano, C.; Spinetti, M.; Stanco, L.; Strati, V.; Verde, G.; Votano, L.

2018-02-01

Large-area PhotoMultiplier Tubes (PMT) allow to efficiently instrument Liquid Scintillator (LS) neutrino detectors, where large target masses are pivotal to compensate for neutrinos' extremely elusive nature. Depending on the detector light yield, several scintillation photons stemming from the same neutrino interaction are likely to hit a single PMT in a few tens/hundreds of nanoseconds, resulting in several photoelectrons (PEs) to pile-up at the PMT anode. In such scenario, the signal generated by each PE is entangled to the others, and an accurate PMT charge reconstruction becomes challenging. This manuscript describes an experimental method able to address the PMT charge reconstruction in the case of large PE pile-up, providing an unbiased charge estimator at the permille level up to 15 detected PEs. The method is based on a signal filtering technique (Wiener filter) which suppresses the noise due to both PMT and readout electronics, and on a Fourier-based deconvolution able to minimize the influence of signal distortions—such as an overshoot. The analysis of simulated PMT waveforms shows that the slope of a linear regression modeling the relation between reconstructed and true charge values improves from 0.769 ± 0.001 (without deconvolution) to 0.989 ± 0.001 (with deconvolution), where unitary slope implies perfect reconstruction. A C++ implementation of the charge reconstruction algorithm is available online at [1].

ATLAS Tile calorimeter calibration and monitoring systems

CERN Document Server

Boumediene, Djamel Eddine; The ATLAS collaboration

2017-01-01

The ATLAS Tile Calorimeter (TileCal) is the central section of the hadronic calorimeter of the ATLAS experiment and provides important information for reconstruction of hadrons, jets, hadronic decays of tau leptons and missing transverse energy. This sampling calorimeter uses steel plates as absorber and scintillating tiles as active medium. The light produced by the passage of charged particles is transmitted by wavelength shifting fibres to photomultiplier tubes (PMTs). PMT signals are then digitized at 40 MHz and stored on detector and are only transferred off detector once the first level trigger acceptance has been confirmed. The readout is segmented into about 5000 cells (longitudinally and transversally), each of them being read out by two PMTs in parallel. To calibrate and monitor the stability and performance of each part of the readout chain, a set of calibration systems is used. The TileCal calibration system comprises Cesium radioactive sources, laser, charge injection elements and an integrator b...

Environmental Measurement While Drilling System for Real-Time Field Screening of Contaminants

International Nuclear Information System (INIS)

Lockwood, G.J.; Normann, R.A.; Williams, C.V.

1999-01-01

-thallium activated crystal coupled to a photomultiplier tube (PMT). The output of the PMT goes to a multichannel analyzer (MCA).The MCA data is transmitted to the surface via a signal conditioning and transmitter board similar to that used with the GMT. The EMWD system is described and the results of the GRS field tests and field demonstration are presented

Political micro-targeting: a Manchurian candidate or just a dark horse?

Directory of Open Access Journals (Sweden)

Balázs Bodó

2017-12-01

Full Text Available Political micro-targeting (PMT has become a popular topic both in academia and in the public discussions after the surprise results of the 2016 US presidential election, the UK vote on leaving the European Union, and a number of general elections in Europe in 2017. Yet, we still know little about whether PMT is a tool with such destructive potential that it requires close societal control, or if it’s “just” a new phenomenon with currently unknown capacities, but which can ultimately be incorporated into our political processes.   In this article we identify the points where we think we need to further develop our analytical capacities around PMT. We argue that we need to decouple research from the US context, and through more non-US and comparative research we need to develop a better understanding of the macro, meso, and micro level factors that affect the adoption and success of PMTs across different countries. One of the most under-researched macro-level factors is law. We argue that PMT research must develop a better understanding of law, especially in Europe, where the regulatory frameworks around platforms, personal data, political and commercial speech do shape the use and effectiveness of PMT. We point out that the incorporation of such new factors calls for the sophistication of research designs, which currently rely too much on qualitative methods, and use too little of the data that exists on PMT. And finally, we call for distancing PMT research from the hype surrounding the new PMT capabilities, and the moral panics that quickly develop around its uses.

Performance of 8- and 12-dynode stage multianode photo-multipliers

Energy Technology Data Exchange (ETDEWEB)

Bibby, J.H. [University of Oxford, Oxford (United Kingdom); Buckley, A. [Cavendish Laboratory, University of Cambridge, Cambridge (United Kingdom); Chamonal, R.J.U. [University of Edinburgh, Edinburgh (United Kingdom)]. E-mail: chamonal@ph.ed.ac.uk; Easo, S. [CCLRC, Rutherford Aplleton Laboratory, Chilton, Didcot, Oxfordshire (United Kingdom); Eisenhardt, S. [University of Edinburgh, Edinburgh (United Kingdom); Gibson, V. [Cavendish Laboratory, University of Cambridge, Cambridge (United Kingdom); Harnew, N. [University of Oxford, Oxford (United Kingdom); Muheim, F. [University of Edinburgh, Edinburgh (United Kingdom); Howard, A. [Imperial College, London (United Kingdom); Lawrence, J. [University of Edinburgh, Edinburgh (United Kingdom); Pickford, A. [University of Glasgow, Glasgow (United Kingdom); Plackett, R. [Imperial College, London (United Kingdom); Price, D.R. [Imperial College, London (United Kingdom); Rademacker, J. [University of Oxford, Oxford (United Kingdom); Smale, N. [University of Oxford, Oxford (United Kingdom); Soler, F.J.P. [University of Glasgow, Glasgow (United Kingdom); CCLRC, Rutherford Aplleton Laboratory, Chilton, Didcot, Oxfordshire (United Kingdom); Somerville, L. [University of Oxford, Oxford (United Kingdom); Storey, J. [Cavendish Laboratory, University of Cambridge, Cambridge (United Kingdom); Websdale, D. [Imperial College, London (United Kingdom); Wotton, S. [Cavendish Laboratory, University of Cambridge, Cambridge (United Kingdom)

2006-11-01

We report on studies of 64-channel Multianode Photo-Multiplier Tubes (MaPMTs) as photo-detectors for Ring Imaging CHerenkov (RICH) counters. The newly available 8-dynode stage MaPMT was tested in particle beams at CERN. The MaPMT signals were read out directly with the Beetle1.2 chip which was designed for the LHCb environment and operates at 40MHz. The photon yield and signal losses were determined for a cluster of 3x3 close-packed MaPMTs. The performance of the 8-dynode stage MaPMT was compared to that of the 12-dynode stage MaPMT which has a larger intrinsic gain.

Piers cooling towers. From first idess to realizations

International Nuclear Information System (INIS)

Bozetto, P.; Tzincoca, A.

1988-01-01

After a first part consecrated at the historical aspect of vertical piers cooling towers the second part indicates the experience pulled of the Chooz and Golfech cooling towers conception and realization [fr

A test of an adherence-enhancing adjunct to physiotherapy steeped in the protection motivation theory.

Science.gov (United States)

Bassett, Sandra F; Prapavessis, Harry

2011-07-01

The primary aim of this study was to test the effect of a Protection Motivation Theory (PMT)-based patient education intervention on physiotherapy patients' beliefs about their injury and physiotherapy, intentions to adhere, rehabilitation adherence, and ankle function. A secondary aim was to explore the relationships between the patients' injury and physiotherapy beliefs, intentions, adherence behaviours, and ankle function. A randomized controlled trial was undertaken in New Zealand; 71 people with ankle sprains were allocated to either PMT present video information or two control groups (non-PMT information about ankle sprains and no formal information) before commencing their course of physiotherapy. The two information groups watched a video about ankle sprains and physiotherapy before answering the Beliefs about Ankle Sprains and Physiotherapy Scale and behavioural intentions questionnaires that measured the PMT constructs. Adherence was assessed at each treatment and ankle function was measured before and after the physiotherapy program. After viewing the video, the PMT present information group's beliefs about severity, vulnerability, and response efficacy were significantly higher than the other two groups. The groups did not differ significantly on their self-efficacy, intentions, rehabilitation adherence, and post-physiotherapy program ankle function. Significant correlations existed between the patients' PMT-based beliefs and intentions, intentions and adherence, and adherence and post-physiotherapy ankle function. With the exception of self-efficacy, the findings indicate that persuasive information grounded in PMT does enhance physiotherapy patients' beliefs about their injury and treatment.

Specific diagnosis of hepatocellular carcinoma by delayed hepatobiliary imaging

International Nuclear Information System (INIS)

Hasegawa, Y.; Nakano, S.; Ibuka, K.

1986-01-01

For assessment of the value of delayed hepatobiliary imaging with technetium 99m (/sup 99m/Tc)-(Sn)-N-pyridoxyl-5-methyltryptophan (/sup 99m/Tc-PMT) for specific diagnosis of hepatocellular carcinoma, 88 patients with various malignant and benign liver diseases (49 with hepatocellular carcinoma, 4 with cholangiocellular carcinoma, 10 with metastatic liver carcinoma, 2 with liver cysts, 2 with liver hemangioma, 1 with liver abscess, 2 with intrahepatic lithiasis, 12 with liver cirrhosis, and 6 with chronic hepatitis) were studied. In 20 (41%) of the 49 patients with hepatocellular carcinoma, greater uptake of /sup 99m/Tc-PMT by the tumor than by the surrounding liver tissue was seen in delayed hepatobiliary images, whereas in eight patients (16%), equilibrated uptake was seen. No increased uptake of the radioisotope by hepatic lesions was seen in 21 patients with localized liver diseases other than hepatoma. Moreover, in 18 patients with diffuse liver diseases, no focal accumulation of the radioisotope was seen in delayed /sup 99m/Tc-PMT images. In addition, of 28 patients with hepatocellular carcinoma in whom the serum alpha-fetoprotein level showed little or no increase, 12 showed increased uptake of /sup 99m/Tc-PMT by the tumor. In assessing delayed /sup 99m/Tc-PMT images, however, it was necessary to consider following complications: accumulation of tracer in obstructed and dilated biliary trees; retention of radioactivity in nonneoplastic liver tissues; difficulties in evaluating /sup 99m/Tc-PMT uptake by small hepatic tumors; overlapping of radioactivity in the gut and gallbladder in delayed /sup 99m/Tc-PMT images of tumors. This study indicates that delayed /sup 99m/Tc-PMT images can be useful in the diagnosis of hepatocellular carcinoma

Asking the Right Questions: Action Learning and PMT 401

Science.gov (United States)

2016-08-01

program aimed at improving leadership, critical thinking , problem solving and decision­making skills. Participants in this rigorous, in­residence...problem • Skill Development • Urgent and complex problems requiring unique systems thinking • Groups charged with implementing the solution as...most pressing organi­ zational issues: problem solving, organizational learning, team building, leadership development, and professional growth and

Predicting short and long-term exercise intentions and behaviour in patients with coronary artery disease: A test of protection motivation theory.

Science.gov (United States)

Tulloch, Heather; Reida, Robert; D'Angeloa, Monika Slovinec; Plotnikoff, Ronald C; Morrina, Louise; Beatona, Louise; Papadakisa, Sophia; Pipe, Andrew

2009-03-01

The purpose of this study was to examine the utility of protection motivation theory (PMT) in the prediction of exercise intentions and behaviour in the year following hospitalisation for coronary artery disease (CAD). Patients with documented CAD (n = 787), recruited at hospital discharge, completed questionnaires measuring PMT's threat (i.e. perceived severity and vulnerability) and coping (i.e. self-efficacy, response efficacy) appraisal constructs at baseline, 2 and 6 months, and exercise behaviour at baseline, 6 and 12 months post-hospitalisation. Structural equation modelling showed that the PMT model of exercise at 6 months had a good fit with the empirical data. Self-efficacy, response efficacy, and perceived severity predicted exercise intentions, which, in turn predicted exercise behaviour. Overall, the PMT variables accounted for a moderate amount of variance in exercise intentions (23%) and behaviour (20%). In contrast, the PMT model was not reliable for predicting exercise behaviour at 12 months post-hospitalisation. The data provided support for PMT applied to short-term, but not long-term, exercise behaviour among patients with CAD. Health education should concentrate on providing positive coping messages to enhance patients' confidence regarding exercise and their belief that exercise provides health benefits, as well as realistic information about disease severity.

Plant Defensins NaD1 and NaD2 Induce Different Stress Response Pathways in Fungi

Directory of Open Access Journals (Sweden)

Peter M. Dracatos

2016-09-01

Full Text Available Nicotiana alata defensins 1 and 2 (NaD1 and NaD2 are plant defensins from the ornamental tobacco that have antifungal activity against a variety of fungal pathogens. Some plant defensins interact with fungal cell wall O-glycosylated proteins. Therefore, we investigated if this was the case for NaD1 and NaD2, by assessing the sensitivity of the three Aspergillus nidulans (An O-mannosyltransferase (pmt knockout (KO mutants (An∆pmtA, An∆pmtB, and An∆pmtC. An∆pmtA was resistant to both defensins, while An∆pmtC was resistant to NaD2 only, suggesting NaD1 and NaD2 are unlikely to have a general interaction with O-linked side chains. Further evidence of this difference in the antifungal mechanism was provided by the dissimilarity of the NaD1 and NaD2 sensitivities of the Fusarium oxysporum f. sp. lycopersici (Fol signalling knockout mutants from the cell wall integrity (CWI and high osmolarity glycerol (HOG mitogen-activated protein kinase (MAPK pathways. HOG pathway mutants were sensitive to both NaD1 and NaD2, while CWI pathway mutants only displayed sensitivity to NaD2.

A unified analysis of the reactor neutrino program towards the measurement of the θ13 mixing angle

International Nuclear Information System (INIS)

Mention, G.; Motta, D.; Lasserre, Th.

2007-04-01

We present in this article a detailed quantitative discussion of the measurement of the leptonic mixing angle θ 13 through currently scheduled reactor neutrino oscillation experiments. We thus focus on Double Chooz (Phase I and II), Daya Bay (Phase I and II) and RENO experiments. We perform a unified analysis, including systematics, backgrounds and accurate experimental setup in each case. Each identified systematic error and background impact has been assessed on experimental setups following published data when available and extrapolating from Double Chooz acquired knowledge otherwise. After reviewing the experiments, we present a new analysis of their sensitivities to sin 2 (2θ 13 ) and study the impact of the different systematics based on the pulls approach. Through this generic statistical analysis we discuss the advantages and drawbacks of each experimental setup. (authors)

A unified analysis of the reactor neutrino program towards the measurement of the {theta}{sub 13} mixing angle

Energy Technology Data Exchange (ETDEWEB)

Mention, G [DAPNIA/SPP, CEA Saclay, 91191 Gif sur Yvette (France)

2008-05-15

We presented a detailed quantitative discussion of the measurement of the leptonic mixing angle {theta}{sub 13} through currently scheduled reactor neutrino oscillation experiments. We focussed on Double Chooz (Phase I and II), Daya Bay (Phase I and II) and RENO experiments. We performed a unified analysis, including systematics, backgrounds and accurate experimental setup in each case. Each identified systematical uncertainty and background impact has been assessed on experimental setups following published data when available and extrapolating from Double Chooz acquired knowledge otherwise. We sum up, here, a new common analysis of their sensitivities to sin{sup 2}(2{theta}{sub 13}) and study the impact of the different systematics based on the pulls approach. Through this generic statistical analysis we discuss the advantages and drawbacks of each experimental setup.

The Upgraded Calibration System for the Scintillator-PMT Tile Hadronic Calorimeter of the ATLAS experiment at CERN/LHC

CERN Document Server

Chakraborty, Dhiman; The ATLAS collaboration

2017-01-01

The ATLAS Tile Calorimeter (TileCal) is the central section of the hadronic calorimeter of the ATLAS experiment and provides important information for reconstruction of hadrons, jets, hadronic decays of tau leptons and missing transverse energy in highest energy proton-proton and heavy-ion collisions at CERN’s Large Hadron Collider. This sampling calorimeter uses steel plates as absorber and scintillating tiles as active medium. The light produced by the passage of charged particles is transmitted by wavelength shifting fibres to photomultiplier tubes (PMTs) located on the outside of the calorimeter. The readout is segmented into about 5000 cells (longitudinally and transversally), each read out by two PMTs in parallel. A multi-component calibration system is employed to calibrate and monitor the stability and performance of each part of the readout chain during data taking. The TileCal calibration system comprises Cesium radioactive sources, laser and charge injection elements and it allows to monitor and ...

The upgraded calibration system for the scintillator-PMT Tile Hadronic Calorimeter of the ATLAS experiment at CERN/LHC

CERN Document Server

Chakraborty, Dhiman; The ATLAS collaboration

2017-01-01

The ATLAS Tile Calorimeter (TileCal) is the central section of the hadronic calorimeter of the ATLAS experiment and provides important information for reconstruction of hadrons, jets, hadronic decays of tau leptons and missing transverse energy in highest energy proton-proton and heavy-ion collisions at CERN’s Large Hadron Collider. This sampling calorimeter uses steel plates as absorber and scintillating tiles as active medium. The light produced by the passage of charged particles is transmitted by wavelength shifting fibres to photomultiplier tubes (PMTs) located on the outside of the calorimeter. The readout is segmented into about 5000 cells (longitudinally and transversally), each read out by two PMTs in parallel. A multi-component calibration system is employed to calibrate and monitor the stability and performance of each part of the readout chain during data taking. The TileCal calibration system comprises Cesium radioactive sources, laser and charge injection elements and it allows to monitor and ...

Effect of cyclic, low dose pyrimethamine treatment in patients with Late Onset Tay Sachs: an open label, extended pilot study.

Science.gov (United States)

Osher, Etty; Fattal-Valevski, Aviva; Sagie, Liora; Urshanski, Nataly; Sagiv, Nadav; Peleg, Leah; Lerman-Sagie, Tally; Zimran, Ari; Elstein, Deborah; Navon, Ruth; Valevski, Avi; Stern, Naftali

2015-04-17

Late Onset Tay- Sachs disease (LOTS) is a rare neurodegenerative lysosomal storage disease which results from mutations in the gene encoding the α subunit (HEXA) of β-hexosaminidase enzyme (HexA). At the present time, no effective treatment exists for LOTS and other neurodegenerative diseases involving the central nerve system (CNS). Pyrimethamine (PMT) was previously shown to act as a HexA chaperone in human fibroblasts in vitro carrying some (e.g., αG269S), but not all LOTS-related mutations. The present study assessed the effect of cyclic, low dose and long term pyrimethamine treatment on HexA in subjects with LOTS. In an open label trial in 4 LOTS patients, PMT was initiated at an average daily dose of ~2.7 mg and administered cyclically guided by blood lymphocyte HexA activity for a mean duration of 82.8 (±22.5; SD) weeks (~1.5 year). HexA activity rose in all subjects, with a mean peak increase of 2.24 folds (±0.52; SD) over baseline activity (range 1.87-3). The mean treatment time required to attain this peak was of 15.7 (±4.8; SD) weeks. Following increase in activity, HexA gradually declined with the continued use of PMT, which was then stopped, resulting in the return of HexA activity to baseline. A second cycle of PMT treatment was then initiated, resulting again in an increase in HexA activity. Three of the patients experienced a measurable neuropsychiatric deterioration whereas one subject remained entirely stable. Cyclic low dose of PMT can increase HexA activity in LOTS patients. However, the observed increase is repeatedly transient and not associated with discernible beneficial neurological or psychiatric effects.

Calcium carbonate overdose

Science.gov (United States)

Tums overdose; Calcium overdose ... Calcium carbonate can be dangerous in large amounts. ... Products that contain calcium carbonate are certain: Antacids (Tums, Chooz) Mineral supplements Hand lotions Vitamin and mineral supplements Other products may also contain ...

The protection motivation theory within the stages of the transtheoretical model - stage-specific interplay of variables and prediction of exercise stage transitions.

Science.gov (United States)

Lippke, Sonia; Plotnikoff, Ronald C

2009-05-01

Two different theories of health behaviour have been chosen with the aim of theory integration: a continuous theory (protection motivation theory, PMT) and a stage model (transtheoretical model, TTM). This is the first study to test whether the stages of the TTM moderate the interrelation of PMT-variables and the mediation of motivation, as well as PMT-variables' interactions in predicting stage transitions. Hypotheses were tested regarding (1) mean patterns, stage pair-comparisons and nonlinear trends using ANOVAs; (2) prediction-patterns for the different stage groups employing multi-group structural equation modelling (MSEM) and nested model analyses; and (3) stage transitions using binary logistic regression analyses. Adults (N=1,602) were assessed over a 6 month period on their physical activity stages, PMT-variables and subsequent behaviour. (1) Particular mean differences and nonlinear trends in all test variables were found. (2) The PMT adequately fitted the five stage groups. The MSEM revealed that covariances within threat appraisal and coping appraisal were invariant and all other constrains were stage-specific, i.e. stage was a moderator. Except for self-efficacy, motivation fully mediated the relationship between the social-cognitive variables and behaviour. (3) Predicting stage transitions with the PMT-variables underscored the importance of self-efficacy. Only when threat appraisal and coping appraisal were high, stage movement was more likely in the preparation stage. Results emphasize stage-specific differences of the PMT mechanisms, and hence, support the stage construct. The findings may guide further theory building and research integrating different theoretical approaches.

Upgrade of the ATLAS hadronic Tile Calorimeter for the High luminosity LHC

CERN Document Server

Rodriguez Bosca, Sergi; The ATLAS collaboration

2017-01-01

The Tile Calorimeter is the hadronic calorimeter covering the central region of the ATLAS detector at the Large Hadron Collider. It is a scintillator-steel sampling calorimeter read out via wavelength shifting fibers coupled to photomultiplier tubes (PMT). The PMT signals are digitized and stored on detector until a trigger is received. The High-Luminosity phase of LHC (HL-LHC) expected to begin in year 2026 requires new electronics to meet the requirements of a 1 MHz trigger, higher ambient radiation, and for better performance under higher pileup. All the TileCal on- and off-detector electronics will be replaced during the shutdown of 2024-2025. PMT signals from every TileCal cell will be digitized and sent directly to the back-end electronics, where the signals are reconstructed, stored, and sent to the first level of trigger at a rate of 40 MHz. This will provide better precision of the calorimeter signals used by the trigger system and will allow the development of more complex trigger algorithms. Change...

Upgrade of the ATLAS hadronic Tile Calorimeter for the High luminosity LHC

CERN Document Server

Rodriguez Bosca, Sergi; The ATLAS collaboration

2017-01-01

The Tile Calorimeter is the hadronic calorimeter covering the central region of the ATLAS detector at the Large Hadron Collider. It is a scintillator-steel sampling calorimeter read out via wavelength shifting fibers coupled to photomultiplier tubes (PMT). The PMT signals are digitized and stored on detector until a trigger is received. The High-Luminosity phase of LHC (HL-LHC)expected to begin in year 2026 requires new electronics to meet the requirements of a 1 MHz trigger, higher ambient radiation, and for better performance under higher pileup. All the TileCal on- and off-detector electronics will be replaced during the shutdown of 2024-2025. PMT signals from every TileCal cell will be digitized and sent directly to the back-end electronics, where the signals are reconstructed, stored, and sent to the first level of trigger at a rate of 40 MHz. This will provide better precision of the calorimeter signals used by the trigger system and will allow the development of more complex trigger algorithms. Changes...

PERANAN PEMBERIAN MAKANAN TAMBAHAN PADA ANAK UMUR 6 – 23 BULAN PADA SAAT KRISIS EKONOMI

Directory of Open Access Journals (Sweden)

Sandjaja -

2014-09-01

Full Text Available THE IMPACT OF FOOD SUPPLEMENTATION FOR CHILDREN AGED 6-23 MONTHS DURING ECONOMIC CRISIS Supplementary feeding program (PMT for children aged 6-23 months of poor families (Gakin is a sub-component of Social Safety Net – Health Sector (SSN-HS following economic crisis that hit Indonesia the end of 1997. It is intended to provide additional food and prevent deteriorating impact of nutritional status of the target. The main objective of the study was to determine the impact of PMT for children on malnutrition and growth as compared with that for children not receiving PMT. The design of the study is case control. Case was children of poor family who had or ever had received PMT for three months provided by SSN-HS in the last six months. Control was children of near poor families but who had never received PMT. Matching criteria for case and control were age, sex, and residence of the family. The study was conducted in West Java, Central Java, South Kalimantan covering 1014 cases and 1014 controls and their families. Data on child collected were current weight and height, and retrospective weight in the last 10 months. Other data collected were characteristics of chlidren and therir families including socioeconomic status, clinical examination, dietary intake including food suplement. Program implementation of PMT varied among study areas on selection criteria for child beneficiaries in addition to poor families, duration of PMT, method of distribution, type of food. There were similar characteristics between case and control in age, sex, breastfeeding, morbidity except for socioeconomic status of the family, age of father, educational attainment of parents. Foods distributed for 6-11 month old samples included supplementary food, foodstuff, cooked (rice/flour porridge+egg. Foods for 12-23 month old samples more varied than food suplement for 6-11 months old children. Nutrient content of food distributed was 268 Kcal for energy and 9.2 grams

E3 Success Story - Plastic Molding Technology, Inc.

Science.gov (United States)

Customer surveys prompted PMT to address new areas which included sustainability issues and reduction goals for energy, water and solid wastes; they were looking for a way to link their reduction projects into their system.

Protection motivation theory and physical activity: a longitudinal test among a representative population sample of Canadian adults.

Science.gov (United States)

Plotnikoff, Ronald C; Rhodes, Ryan E; Trinh, Linda

2009-11-01

The purpose of this study was to examine the Protection Motivation Theory (PMT) to predict physical activity (PA) behaviour in a large, population-based sample of adults. One thousand six hundred and two randomly selected individuals completed two telephone interviews over two consecutive six-month periods assessing PMT constructs. PMT explained 35 per cent and 20 per cent of the variance in intention and behaviour respectively. Coping cognitions as moderators of threat explained 1 per cent of the variance in intention and behaviour. Age and gender as moderators of threat did not provide additional variance in the models. We conclude that salient PMT predictors (e.g. self-efficacy) may guide the development of effective PA interventions in the general population.

Characterization of photo-multiplier tube as ex-vessel radiation detector in tokamak

Science.gov (United States)

Jo, Jungmin; Cheon, MunSeong; Kim, Junghee; An, YoungHwa; Park, Seungil; Chung, Kyoung-Jae; Hwang, Y. S.

2017-09-01

Feasibility of using conventional photo-multiplier tubes (PMTs) without a scintillator as an ex-vessel radiation detector in a tokamak environment is studied. Basic irradiation tests using standard gamma ray sources and a d-d neutron generator showed that the PMT is responding both to gamma photons and neutrons, possibly due to the direct generation of secondary electrons inside the PMT by the impingement of high energy photons. Because of the selective sensitivity of the PMT to hard x-ray and neutrons in ohmic and neutral beam injected plasmas, respectively, it is shown that the PMT with certain configuration can be utilized either to monitor the fluctuation in the fusion neutron generation rate or to study the behavior of runaway electrons in tokamaks.

Calibration and Performance of the ATLAS Tile Calorimeter During the Run 2 of the LHC

CERN Document Server

Solovyanov, Oleg; The ATLAS collaboration

2017-01-01

The Tile Calorimeter (TileCal) is a hadronic calorimeter covering the central region of the ATLAS experiment at the LHC. It is a non-compensating sampling calorimeter comprised of steel and scintillating plastic tiles which are read-out by photomultiplier tubes (PMT). The TileCal is regularly monitored and calibrated by several di erent calibration systems: a Cs radioactive source that illuminates the scintillating tiles directly, a laser light system to directly test the PMT response, and a charge injection system (CIS) for the front-end electronics. These calibrations systems, in conjunction with data collected during proton-proton collisions, provide extensive monitoring of the instrument and a means for equalizing the calorimeter response at each stage of the signal propagation. The performance of the calorimeter and its calibration has been established with cosmic ray muons and the large sample of the proton-proton collisions to study the energy response at the electromagnetic scale, probe of the hadroni...

Study of various photomultiplier tubes with muon beams and Cerenkov light produced in electron showers

International Nuclear Information System (INIS)

2010-01-01

The PMTs of the CMS Hadron Forward calorimeter were found to generate a large size signal when their windows were traversed by energetic charged particles. This signal, which is due to Cerenkov light production at the PMT window, could interfere with the calorimeter signal and mislead the measurements. In order to find a viable solution to this problem, the response of four different types of PMTs to muons traversing their windows at different orientations is measured at the H2 beam-line at CERN. Certain kinds of PMTs with thinner windows show significantly lower response to direct muon incidence. For the four anode PMT, a simple and powerful algorithm to identify such events and recover the PMT signal using the signals of the quadrants without window hits is also presented. For the measurement of PMT responses to Cerenkov light, the Hadron Forward calorimeter signal was mimicked by two different setups in electron beams and the PMT performances were compared with each other. Superior performance of particular PMTs was observed.

Laboratory tests of the response stability of the ATLAS Tile Calorimeter photomultipliers

CERN Document Server

AUTHOR|(INSPIRE)INSPIRE-00216540; The ATLAS collaboration; Leone, Sandra; Scuri, Fabrizio

2017-01-01

High performance of the ATLAS Tile Calorimeter response is achieved with a multi- stage calibration. One step of the calibration is based on measurements of the response to laser pulse excitation of the PMTs used to read out the calorimeter cells. A facility to study the PMT stability response is operating in the PISA-INFN laboratories since 2015. Goals of the tests are to study the time evolution of the PMT response as a function of the integrated anode charge and to compare test bench results with the observed response drifts of the Tile Calorimeter PMTs during LHC Run I and Run II. A new statistical approach was used to measure the drift of the absolute PMT gain. A new procedure which combines studies of the time evolution of the global PMT responses and of the individual PMT gains was adopted to derive the evolution of the cathode quantum efficiency. The experimental setup of the Pisa facility is described and the first results obtained by testing about 30 PMTs Hamamatsu model R7877 (a special evolution f...

The ATLAS Tile Calorimeter experience with 10,000 readout photomultipliers operating since the start of the p-p collisions at LHC

CERN Document Server

Lazar, Hadar; The ATLAS collaboration

2017-01-01

The channels of TileCal, the hadron calorimeter of the Atlas experiment at the LHC, is readout with 8-stage fine-mesh PhotoMulTipliers (PMTs), a special version of the Hamamatsu model R5900. About 10000 PMTs are operating in TileCal. The PMT response stability allows to calibrate accurately the calorimeter and to achieve high performance of the energy reconstruction of the cells. Currently, no PMT replacement is foreseen before completion of the High Luminosity program of the LHC collider in the next decade. In this perspective, a number of measurements and tests are in progress to qualify the PMT robustness in terms of lifetime and response stability. Data from the Tile calibration procedure for the detector PMTs and from laboratory tests of spare PMTs are being analysed. Results on PMT failures, gain loss and quantum efficiency loss are presented. Analysis is focused on the study of the observed down-drift with time of the PMT response as a function of the integrated anode charge, and depending on the indiv...

Study of Various Photomultiplier Tubes for Window Events: Upgrade R\\&D for CMS Hadron Forward Calorimeters

CERN Document Server

Bilki, Burak

2010-01-01

The PMTs of the CMS Hadron Forward calorimeter were found to generate a large amount of signal when their windows were traversed by energetic charged particles. This signal, which is due to \\u{C}erenkov light production at the PMT window, could interfere with the calorimeter signal and mislead the measurements. In order to find a viable solution to this problem, the response of different types of PMTs to muons traversing their windows at different orientations is measured at the H2 beam-line at CERN. Certain kinds of PMTs with thinner windows show significantly lower response to direct muon incidence. For one specific type -the four anode PMT- a simple and powerful algorithm to identify such events and recover the PMT signal using the signals of the quadrants without window hits is also presented. For the measurement of PMT responses to \\u{C}erenkov light, the Hadron Forward calorimeter signal was mimicked by two different setups in electron beams and the PMT performances were compared with each other. Superi...

The ATLAS Tile Calorimeter experience with 10,000 readout photomultipliers operating since the start of the $p-p$ collisions at LHC

CERN Document Server

AUTHOR|(SzGeCERN)802259; The ATLAS collaboration

2017-01-01

The channels of TileCal, the hadron calorimeter of the Atlas experiment at the LHC, is readout with 8-stage fine-mesh PhotoMulTipliers (PMTs), a special version of the Hamamatsu model R5900. About 10000 PMTs are operating in TileCal. The PMT response stability allows to calibrate accurately the calorimeter and to achieve high performance of the energy reconstruction of the cells. Currently, no PMT replacement is foreseen before completion of the High Luminosity program of the LHC collider in the next decade. In this perspective, a number of measurements and tests are in progress to qualify the PMT robustness in terms of lifetime and response stability. Data from the Tile calibration procedure for the detector PMTs and from laboratory tests of spare PMTs are being analysed. Results on PMT failures, gain loss and quantum efficiency loss are presented. Analysis is focused on the study of the observed down-drift with time of the PMT response as a function of the integrated anode charge, and depending on the indiv...

Laboratory tests of the response stability of the ATLAS Tile Calorimeter photomultipliers

CERN Document Server

Kazanin, Vassili; The ATLAS collaboration; Scuri, Fabrizio

2017-01-01

High performance of the ATLAS Tile Calorimeter response is achieved with a multi-stage calibration. One step of the calibration is based on measurements of the response to laser pulse excitation of the PMTs used to read out the calorimeter cells. A facility to study the PMT stability response is operating in the PISA-INFN laboratories since 2015. Goals of the tests are to study the time evolution of the PMT response as a function of the integrated anode charge and to compare test bench results with the observed response drifts of the Tile Calorimeter PMTs during LHC Run I and Run II. A new statistical approach was used to measure the drift of the absolute PMT gain. A new procedure which combines studies of the time evolution of the global PMT responses and of the individual PMT gains was adopted to derive the evolution of the cathode quantum efficiency. The experimental setup of the Pisa facility is described and the first results obtained by testing about 30 PMTs Hamamatsu model R7877 (a special evolution fo...

SPE analysis of high efficiency PMTs for the DEAP-3600 dark matter detector

International Nuclear Information System (INIS)

Olsen, Kevin; Hallin, Aksel

2011-01-01

The Dark matter Experiment using Argon Pulse-shape discrimination is a collaborative effort to develop a next-generation, tonne-scale dark matter detector at SNOLAB. The detector will feature a single-phase liquid argon (LAr) target surrounded by an array of 266 photomultiplier tubes (PMTs). A new high-efficiency Hamamatsu R877-100 PMT has been delivered to the University of Alberta for evaluation by the DEAP collaboration. The increase in efficiency could lead to a much greater light yield, but other experiments have reported a slower rise time. We have placed the PMT in a small dark box and had a base and preamplifier designed to be used with either an oscilloscope or a multi-channel analyzer. With this setup we have demonstrated the PMT's ability to distinguish single photo-electrons (SPE) and characterized the PMT by measuring the SPE pulse height spectrum, the peak-to-valley ratio, the dark pulse rate, the baseline, time resolution and SPE efficiency for varying the high voltage supplied to the PMT.

New development of EPICS based data acquisition system for H-Alpha diagnostic

Energy Technology Data Exchange (ETDEWEB)

Lee, Taegu, E-mail: glory@nfri.re.kr; Lee, Woongryol; Son, Souhun; Park, Jinseop

2015-10-15

Highlights: • The H-Alpha DAQ system was modified to measure the low current signal from the PMT. • We developed a new H-Alpha data acquisition system with a CPCI based digitizer. • We developed a signal conditioning box for converting the current to voltage. • The new signal condition box (SCB) has three input range level (400 nA, 1 μA and 2 μA). • It was successfully performed and stably operates more than the previous DAQ system. - Abstract: The H-Alpha diagnostic system has been developed to measure the line integrated intensity in the direction of toroidal and poloidal. The data acquisition (DAQ) system for H-Alpha diagnostics of the Korea Superconducting Tokamak Advanced Research (KSTAR) at the beginning of the first plasma in 2008 was developed with VME form factor digitizer in the Linux OS platform. The VME digitizer module of H-Alpha data acquisition system was modified to measure the low current signal from the photo-multiplier tubes (PMT). The input maximum current values of modified digitizer module are 400 nA and low current data is expressed as the value of the voltage between −10 V and +10 V. At first time, there was no problem to measure H-Alpha signal, but it could not measure the H-Alpha data signal as the KSTAR Plasma density increased. It exceeds digitizer input range, which means the H-Alpha signal is over 400 nA, so we should manually change the resistor on the digitizer board to measure the 400 nA over current. This is not easy to do and showed instability in the long time operation with high sampling data acquisition. In order to overcome these weak points, a new H-Alpha data acquisition system has been developed with a compact PCI (cPCI) based digitizer and a signal conditioning box for converting the current to voltage in the Linux OS platform. The new data acquisition system was developed based on Experimental Physics and Industrial Control System (EPICS) framework like other KSTAR diagnostics with standard framework (SFW

The effect of adding Coping Power Program-Sweden to Parent Management Training-effects and moderators in a randomized controlled trial.

Science.gov (United States)

Helander, Maria; Lochman, John; Högström, Jens; Ljótsson, Brjánn; Hellner, Clara; Enebrink, Pia

2018-04-01

For children with oppositional defiant disorder (ODD), Parent Management Training (PMT) is a recommended treatment in addition to child Cognitive Behavioral Therapy (child-CBT). There is however a lack of studies investigating the additive effect of group-based child-CBT to PMT for children between 8 and 12 years. The current study investigated the incremental effect of group-based child-CBT, based on the Coping Power Program, when added to the Swedish group-based PMT program KOMET. Outcomes were child behavior problems, child prosocial behavior, parenting skills and the moderating effect of child characteristics. One hundred and twenty children 8-12 years with ODD or Disruptive Behavioral Disorder NOS and their parents were randomized either to combined child-CBT and PMT (n = 63) or to PMT only (n = 57) in Swedish Child- and Adolescent Psychiatric settings. Participants were assessed pre- and post-treatment using semi-structured interviews and child- and parent ratings. After treatment, behavior problems were reduced in both groups. Prosocial behavior were significantly more improved in the combined treatment. Parenting skills were improved in both groups. In moderator analyses, behavior problems and prosocial behavior improved significantly more in the combined treatment compared to PMT only in the group of children with high levels of ODD symptoms. Copyright © 2018 Elsevier Ltd. All rights reserved.

New methods of data calibration for high power-aperture lidar.

Science.gov (United States)

Guan, Sai; Yang, Guotao; Chang, Qihai; Cheng, Xuewu; Yang, Yong; Gong, Shaohua; Wang, Jihong

2013-03-25

For high power-aperture lidar sounding of wide atmospheric dynamic ranges, as in middle-upper atmospheric probing, photomultiplier tubes' (PMT) pulse pile-up effects and signal-induced noise (SIN) complicates the extraction of information from lidar return signal, especially from metal layers' fluorescence signal. Pursuit for sophisticated description of metal layers' characteristics at far range (80~130km) with one PMT of high quantum efficiency (QE) and good SNR, contradicts the requirements for signals of wide linear dynamic range (i.e. from approximate 10(2) to 10(8) counts/s). In this article, Substantial improvements on experimental simulation of Lidar signals affected by PMT are reported to evaluate the PMTs' distortions in our High Power-Aperture Sodium LIDAR system. A new method for pile-up calibration is proposed by taking into account PMT and High Speed Data Acquisition Card as an Integrated Black-Box, as well as a new experimental method for identifying and removing SIN from the raw Lidar signals. Contradiction between the limited linear dynamic range of raw signal (55~80km) and requirements for wider acceptable linearity has been effectively solved, without complicating the current lidar system. Validity of these methods was demonstrated by applying calibrated data to retrieve atmospheric parameters (i.e. atmospheric density, temperature and sodium absolutely number density), in comparison with measurements of TIMED satellite and atmosphere model. Good agreements are obtained between results derived from calibrated signal and reference measurements where differences of atmosphere density, temperature are less than 5% in the stratosphere and less than 10K from 30km to mesosphere, respectively. Additionally, approximate 30% changes are shown in sodium concentration at its peak value. By means of the proposed methods to revert the true signal independent of detectors, authors approach a new balance between maintaining the linearity of adequate signal (20

Protection motivation theory and the prediction of physical activity among adults with type 1 or type 2 diabetes in a large population sample.

Science.gov (United States)

Plotnikoff, Ronald C; Lippke, Sonia; Trinh, Linda; Courneya, Kerry S; Birkett, Nick; Sigal, Ronald J

2010-09-01

To investigate the utility of the protection motivation theory (PMT) for explaining physical activity (PA) in an adult population with type 1 diabetes (T1D) and type 2 diabetes (T2D). Cross-sectional and 6-month longitudinal analysis using PMT. Two thousand three hundred and eleven individuals with T1D (N=697) and T2D (N=1,614) completed self-report PMT constructs of vulnerability, severity, response efficacy, self-efficacy, and intention, and PA behaviour at baseline and 6-month follow-up. Multi-group structural equation modelling was conducted to: (1) test the fit of the PMT structure; (2) determine the similarities and differences in the PMT structure between the two types of diabetes; and (3) examine the explained variance and compare the strength of association of the PMT constructs in predicting PA intention and behaviour. The findings provide evidence for the utility of the PMT in both diabetes samples (chi(2)/df=1.27-4.08, RMSEA=.02-.05). Self-efficacy was a stronger predictor of intention (beta=0.64-0.68) than response efficacy (beta=0.14-0.16) in individuals with T1D or T2D. Severity was significantly related to intention (beta=0.06) in T2D individuals only, whereas vulnerability was not significantly related to intention or PA behaviour. Self-efficacy (beta's=0.20-0.28) and intention (beta's=0.12-0.30) were significantly associated with PA behaviour. Promotion of PA behaviour should primarily target self-efficacy to form intentions and to change behaviour. In addition, for individuals with T2D, severity information should be incorporated into PA intervention materials in this population.

Sub-aquatic response of a scintillator, fibre optic and silicon photomultiplier based radiation sensor

Energy Technology Data Exchange (ETDEWEB)

Jackson, Sarah F., E-mail: s.f.jackson@lancaster.ac.uk [Engineering Department, Lancaster University, Lancaster (United Kingdom); Monk, Stephen D., E-mail: s.monk@lancaster.ac.uk [Engineering Department, Lancaster University, Lancaster (United Kingdom); Stanley, Steven J., E-mail: steven.j.stanley@nnl.co.uk [National Nuclear Laboratory, A709 Springfields, Preston (United Kingdom); Lennox, Kathryn, E-mail: kathryn.lennox@nnl.co.uk [National Nuclear Laboratory, A709 Springfields, Preston (United Kingdom)

2014-07-01

We describe an attempt at the utilisation of two low level light sensors to improve on the design of a dose monitoring system, specifically for underwater applications with consideration for the effects of water attenuation. The gamma radiation ‘RadLine{sup ®}’ detector consists of an inorganic scintillating crystal coupled to a fibre optic cable which transports scintillation photons, up to hundreds of metres, to an optical sensor. Analysed here are two contemporary technologies; SensL's MiniSL a silicon photomultiplier (SiPM) and a Sens-Tech photon counting photomultiplier tube (PMT). A clinical radiotherapy linear accelerator (linac) is implemented as test beam, subjecting the RadLine{sup ®} to a highly controlled dose rate (ranging from 0 Sv h{sup −1} to 320 Sv h{sup −1}), averaging at 2 MeV in energy. The RadLine's underwater dose monitoring capabilities are tested with the aid of epoxy resin ‘solid water’ phantom blocks, used as a substitute for water. Our results show that the MiniSL SiPM is unsuitable for this application due to extremely high background noise levels, however the Sens-Tech PMT performs satisfactorily and the detected dose rate due to the effects of water attenuation compares strongly with MCNP simulation data and NIST database values. We conclude that the PMT shows promise for its ultimate use in the First Generation Magnox Storage Pond (FGMSP) on the Sellafield site. - Highlights: • RadLine{sup ®} consists of a scintillating crystal coupled to a fibre optic cable and photon detector. • Here the dose monitoring system is trialled with SiPM and PMT type photon detectors. • A clinical linear accelerator (linac) is used as a test beam. • Sub-aquatic response is compared to Monte Carlo simulations and the NIST database.

An exact formula to describe the amplification process in a photomultiplier tube

International Nuclear Information System (INIS)

Rademacker, Jonas

2002-01-01

An analytical function is derived that exactly describes the amplification process due to a series of discrete, Poisson-like amplifications like those in a photo multiplier tube (PMT). A numerical recipe is provided that implements this function as a computer program. It is shown how the program can be used as the core element of a faster, simplified routine to fit PMT spectra with high efficiency. The functionality of the method is demonstrated by fitting both, Monte Carlo generated and measured PMT spectra

Atmospheric, Long Baseline, and Reactor Neutrino Data Constraints on θ13

Science.gov (United States)

Roa, J. E.; Latimer, D. C.; Ernst, D. J.

2009-08-01

An atmospheric neutrino oscillation tool that uses full three-neutrino oscillation probabilities and a full three-neutrino treatment of the Mikheyev-Smirnov-Wolfenstein effect, together with an analysis of the K2K, MINOS, and CHOOZ data, is used to examine the bounds on θ13. The recent, more finely binned, Super-K atmospheric data are employed. For L/Eν≳104km/GeV, we previously found significant linear in θ13 terms. This analysis finds θ13 bounded from above by the atmospheric data while bounded from below by CHOOZ. The origin of this result arises from data in the previously mentioned very long baseline region; here, matter effects conspire with terms linear in θ13 to produce asymmetric bounds on θ13. Assuming CP conservation, we find θ13=-0.07-0.11+0.18 (90% C.L.).

A unified analysis of the reactor neutrino program towards the measurement of the {theta}{sub 13} mixing angle

Energy Technology Data Exchange (ETDEWEB)

Mention, G.; Motta, D. [DAPNIA/SPP, CEA Saclay, 91191 Gif sur Yvette (France); Lasserre, Th. [DAPNIA/SPP, CEA Saclay, 91191 Gif sur Yvette (France); Laboratoire Astroparticule et Cosmologie (APC), Paris (France)

2007-04-15

We present in this article a detailed quantitative discussion of the measurement of the leptonic mixing angle {theta}{sub 13} through currently scheduled reactor neutrino oscillation experiments. We thus focus on Double Chooz (Phase I and II), Daya Bay (Phase I and II) and RENO experiments. We perform a unified analysis, including systematics, backgrounds and accurate experimental setup in each case. Each identified systematic error and background impact has been assessed on experimental setups following published data when available and extrapolating from Double Chooz acquired knowledge otherwise. After reviewing the experiments, we present a new analysis of their sensitivities to sin{sup 2}(2{theta}{sub 13}) and study the impact of the different systematics based on the pulls approach. Through this generic statistical analysis we discuss the advantages and drawbacks of each experimental setup. (authors)

Analysis of Information Requirements and Design of the Consolidated AFIT Database and Information System (CADIS) with an AFIT/CI Implementation Design.

Science.gov (United States)

1982-12-01

STUDENT INVOICES STUDENT UEADER (DI) VOUCHER NUMBER VOUCHER AMOUNT PMT CODE INCLUSI \\ DATES DATE-POSTED AMOUNT REQUESTED TE-. TYPE RE, AKS LINE FUN tI i...CODE INCLUSI ’ . DATES DATE POSTED AOUN_ REQUESTED TERM TYPE RE ,1KS LINE FUN

Phosphaturic mesenchymal tumor of the brain without tumor-induced osteomalacia in an 8-year-old girl: case report.

Science.gov (United States)

Ellis, Mark B; Gridley, Daniel; Lal, Suresh; Nair, Geetha R; Feiz-Erfan, Iman

2016-05-01

Phosphaturic mesenchymal tumor (mixed connective tissue variant) (PMT-MCT) are tumors that may cause tumor-induced osteomalacia and rarely appear intracranially. The authors describe the case of an 8-year-old girl who was found to have PMT-MCT with involvement of the cerebellar hemisphere and a small tumor pedicle breaching the dura mater and involving the skull. This was removed surgically in gross-total fashion without further complication. Histologically the tumor was confirmed to be a PMT-MCT. There was no evidence of tumor-induced osteomalacia. At the 42-month follow-up, the patient is doing well, has no abnormalities, and is free of recurrence. PMT-MCTs are rare tumors that may involve the brain parenchyma. A gross-total resection may be effective to cure these lesions.

Evaluating the fall risk among elderly population by choice step reaction test

Directory of Open Access Journals (Sweden)

Wang D

2016-08-01

Full Text Available Donghai Wang,1 Jian Zhang,1 Yuliang Sun,2 Wenfei Zhu,2 Shiliu Tian,1 Yu Liu1 1Key Laboratory of Exercise and Health Sciences of the Ministry of Education, Shanghai University of Sport, Shanghai, People’s Republic of China; 2School of Physical Education, Shaanxi Normal University, Xian, People’s Republic of China Abstract: Falls during daily activities are often associated with injuries and physical disabilities, thereby affecting quality of life among elder adults. Balance control, which is crucial in avoiding falls, is composed of two elements: muscle strength and central nervous system (CNS control. A number of studies have reported that reduced muscle strength raises the risk of falling. However, to date there has been only limited research focused on the relationship between fall risk and the CNS. This study aimed to investigate the relationship between CNS and risk of falling among the elderly. A total of 140 elderly people (92 females and 48 males were divided into faller and nonfaller groups based on questionnaire responses concerning falls in their daily life. Participants undertook a choice step reaction test in which they were required to respond to random visual stimuli using foot movements as fast as possible in the left or right directions. Response time was quantified as premotor time (PMT and motor time (MT. In addition, the participants’ electromyography data were recorded during the choice step reaction test. A maximal isokinetic torque test was also performed. PMT was greater in the fallers than in the nonfallers group. There was a significant difference between fall status and direction on PMT. PMT of the left limb in nonfallers was faster than the right, but in fallers there was no difference between left and right limbs. A similar phenomenon was also observed for MT. There were significant differences between fallers and nonfallers in maximum isokinetic torque at knee and ankle joints. The correct rate of PMT was

Digitization of instrumentation and control in nuclear power plants

International Nuclear Information System (INIS)

Hofmann, A.; Buschhorn, W.; Pache, K.; Kimmel, W.; Hoeing, M.

1997-01-01

Unit 1 of the Chooz NPP was connected to the grid in August 1996. Unit 2 will soon be connected. In the western part of the center of France, not far from the town Poitiers, there is an identical construction site where likewise two NPP units are being erected. The French firm Sema Group is the supplier of the control and monitoring system (KIC) and as the prime contractor also is responsible for coordination of work and cooperation with the firm Hartmann and Braun. Hartmann and Braun developed the Contronic E automation system and are one of the major instrumentation and control suppliers for these units. (orig./DG) [de

Large TileCal magnetic field simulation

International Nuclear Information System (INIS)

Nessi, M.; Bergsma, F.; Vorozhtsov, S.B.; Borisov, O.N.; Lomakina, O.V.; Karamysheva, G.A.; Budagov, Yu.A.

1994-01-01

The ATLAS magnetic field map has been estimated in the presence of the hadron tile calorimeter. This is an important issue in order to quantify the needs for individual PMT shielding, the effect on the scintillator light yield and its implications on the calibration. The field source is based on a central solenoid and 8 superconducting air-core toroidal coils. The maximum induction value in the scintillating tiles does not exceed 6 mT. When an iron plate is used to close the open drawer window the field inside the PMT near to the extended barrel edge does not exceed 0.6 mT. Estimation of ponder motive force distribution, acting on individual units of the system was performed. VF electromagnetic software OPERA-TOSCA and CERN POISCR code were used for the field simulation of the system. 10 refs., 4 figs

Design of a cathodoluminescence image generator using a Raspberry Pi coupled to a scanning electron microscope

Science.gov (United States)

Benítez, Alfredo; Santiago, Ulises; Sanchez, John E.; Ponce, Arturo

2018-01-01

In this work, an innovative cathodoluminescence (CL) system is coupled to a scanning electron microscope and synchronized with a Raspberry Pi computer integrated with an innovative processing signal. The post-processing signal is based on a Python algorithm that correlates the CL and secondary electron (SE) images with a precise dwell time correction. For CL imaging, the emission signal is collected through an optical fiber and transduced to an electrical signal via a photomultiplier tube (PMT). CL Images are registered in a panchromatic mode and can be filtered using a monochromator connected between the optical fiber and the PMT to produce monochromatic CL images. The designed system has been employed to study ZnO samples prepared by electrical arc discharge and microwave methods. CL images are compared with SE images and chemical elemental mapping images to correlate the emission regions of the sample.

Improvements in detection system for pulse radiolysis facility

CERN Document Server

Rao, V N; Manimaran, P; Mishra, R K; Mohan, H; Mukherjee, T; Nadkarni, S A; Sapre, A V; Shinde, S J; Toley, M

2002-01-01

This report describes the improvements made in the detection system of the pulse radiolysis facility based on a 7 MeV Linear Electron Accelerator (LINAC) located in the Radiation Chemistry and Chemical Dynamics Division of Bhabha Atomic Research Centre. The facility was created in 1986 for kinetic studies of transient species whose absorption lies between 200 and 700 nm. The newly developed detection circuits consist of a silicon (Si) photodiode (PD) detector for the wavelength range 450-1100 nm and a germanium (Ge) photodiode detector for the wavelength range 900-1600 nm. With these photodiode-based detection set-up, kinetic experiments are now routinely carried out in the wavelength range 450-1600 nm. The performance of these circuits has been tested using standard chemical systems. The rise time has been found to be 150 ns. The photo-multiplier tube (PMT) bleeder circuit has been modified. A new DC back-off circuit has been built and installed in order to avoid droop at longer time scales. A steady baselin...

Ionic liquid-assisted electrochemical determination of pyrimethanil using reduced graphene oxide conjugated to flower-like NiCo{sub 2}O{sub 4}

Energy Technology Data Exchange (ETDEWEB)

Yang, Lijun; Hu, Yandong; Wang, Qiong; Dong, Yuanyuan; Zhang, Lei, E-mail: zhanglei63@126.com

2016-09-07

The novel hierarchical flower-like superstructure NiCo{sub 2}O{sub 4}/reduced graphene oxide (rGO) hybrids have been successfully synthesized with a facile one-step hydrothermal process for the determination of fungicide pyrimethanil (PMT). For comparison, various structures of NiCo{sub 2}O{sub 4}/rGO including hexagonal nanoplates and nanorods were also synthesized. Among them, three-dimensional (3D) flower-like NiCo{sub 2}O{sub 4}/rGO exhibited the highest electrocatalytic activity for the oxidation of PMT. With the synergistic effect of [OMIM]PF{sub 6} ionic liquid (IL), the electrochemical sensor film (NiCo{sub 2}O{sub 4}/rGO/IL) further facilitated interfacial electron transfer and enhanced electrocatalytic activity for the oxidation of PMT. Under the optimum conditions, the electrochemical sensor exhibited two linear ranges of 0.1–10.0 μmol/L and 20.0–140 μmol/L for PMT with a low detection concentration of 11.0 nmol/L. Besides, the interference, repeatability, reproducibility and stability measurements were also evaluated. The proposed method was successfully applied to the detection of PMT in water, seawater, fruits and vegetables with good recovery ranging from 93% to 105%, and possessed potential applications in the analysis of real samples. - Highlights: • A novel sensor based on layered flower-like NiCo{sub 2}O{sub 4}/rGO/IL hybrid was fabricated. • Various structures of NiCo{sub 2}O{sub 4}/rGO were synthesized for electrocatalytic comparison. • 3D structure NiCo{sub 2}O{sub 4}/rGO/IL/GCE displayed superior electrocatalytic activity for PMT. • The sensor showed a much wider linear range and a lower detection limit than others. • The method was satisfactorily applied to detection of PMT in real samples.

Colon cancer information as a source of exercise motivation for relatives of patients with colon cancer.

Science.gov (United States)

McGowan, Erin L; Prapavessis, Harry

2010-12-01

Using a Protection Motivation Theory (PMT) framework, this study examined whether factual colon cancer information is a meaningful source of exercise motivation for relatives of patients with colon cancer. One hundred sixty-six inactive relatives were randomly assigned to one of two treatment conditions: PMT group (intervention); and non-PMT group (attention control). At baseline (T1) participants completed demographic information, a questionnaire designed to assess their beliefs toward exercise and colon cancer as well as their exercise intentions. At T2 (one week following T1) participants watched one of two DVD videos that were created for the study. The intervention DVD contained exercise and colon cancer information that was yoked within the four major components of PMT: perceived vulnerability (PV); perceived severity (PS); response efficacy (RE); and self-efficacy (SE), while the attention control DVD contained general diet and cancer information. Immediately following watching the DVD, participants completed the same measures as in T1. Participants assigned to the PMT intervention group showed significant improvement in PV, RE, SE and exercise intentions, whereas participants assigned to the attention control group showed significant improvement only in RE. RE, SE, and PS made significant and unique contributions to prediction of exercise intention. Overall, the results of the present study demonstrate that a single exposure media intervention grounded in a PMT framework can change individuals' exercise and colon cancer beliefs, as well as change their exercise intentions. Implications of these findings and direction for future research are discussed.

ASIC design in the KM3NeT detector

International Nuclear Information System (INIS)

Gajanana, D; Gromov, V; Timmer, P

2013-01-01

In the KM3NeT project [1], Cherenkov light from the muon interactions with transparent matter around the detector, is used to detect neutrinos. Photo multiplier tubes (PMT) used as photon sensor, are housed in a glass sphere (aka Optical Module) to detect single photons from the Cherenkov light. The PMT needs high operational voltage ( ∼ 1.5 kV) and is generated by a Cockroft-Walton (CW) multiplier circuit. The electronics required to control the PMT's and collect the signals is integrated in two ASIC's namely: 1) a front-end mixed signal ASIC (PROMiS) for the readout of the PMT and 2) an analog ASIC (CoCo) to generate pulses for charging the CW circuit and to control the feedback of the CW circuit. In this article, we discuss the two integrated circuits and test results of the complete setup. PROMiS amplifies the input charge, converts it to a pulse width and delivers the information via LVDS signals. These LVDS signals carry accurate information on the Time of arrival ( 2 C bus. This unique combination of the ASIC's results in a very cost and power efficient PMT base design.

The nucleus is an intracellular propagator of tensile forces in NIH 3T3 fibroblasts

Science.gov (United States)

Alam, Samer G.; Lovett, David; Kim, Dae In; Roux, Kyle J.; Dickinson, Richard B.; Lele, Tanmay P.

2015-01-01

ABSTRACT Nuclear positioning is a crucial cell function, but how a migrating cell positions its nucleus is not understood. Using traction-force microscopy, we found that the position of the nucleus in migrating fibroblasts closely coincided with the center point of the traction-force balance, called the point of maximum tension (PMT). Positioning of the nucleus close to the PMT required nucleus–cytoskeleton connections through linker of nucleoskeleton-to-cytoskeleton (LINC) complexes. Although the nucleus briefly lagged behind the PMT following spontaneous detachment of the uropod during migration, the nucleus quickly repositioned to the PMT within a few minutes. Moreover, traction-generating spontaneous protrusions deformed the nearby nucleus surface to pull the nuclear centroid toward the new PMT, and subsequent retraction of these protrusions relaxed the nuclear deformation and restored the nucleus to its original position. We propose that the protruding or retracting cell boundary transmits a force to the surface of the nucleus through the intervening cytoskeletal network connected by the LINC complexes, and that these forces help to position the nucleus centrally and allow the nucleus to efficiently propagate traction forces across the length of the cell during migration. PMID:25908852

Predicting adherence to eye patching in children with amblyopia: an application of protection motivation theory.

Science.gov (United States)

Norman, Paul; Searle, Aidan; Harrad, Richard; Vedhara, Kav

2003-02-01

This study reports an application of protection motivation theory (PMT) to the prediction of parental adherence to eye patching recommendations for children with amblyopia over a 2-month period. The study also considered the role of past behaviour in PMT. A total of 151 parents of children with amblyopia who were attending follow-up appointments for orthoptic treatment participated. They completed questionnaires based on PMT to assess their beliefs about amblyopia and eye patching. Of the parents, 105 were contacted again at 2-month follow-up to obtain a measure of adherence to the recommended treatment for their child. PMT was found to be predictive of adherence intentions and behaviour at 2-month follow-up. Regression analyses revealed perceived vulnerability, response efficacy and self-efficacy to be significant predictors of protection motivation, whereas perceived vulnerability and response costs were significant predictors of adherence behaviour. Past adherence behaviour was found to have a direct effect on future adherence behaviour over and above the influence of PMT. The results are discussed in relation to the sufficiency of PMTas a model of adherence behaviour. The practical implications for attempts to increase adherence to eye patching among children with amblyopia are outlined.

Influence of ursodeoxycholic acid on hepatobiliary scintigraphy with /sup 99m/Tc-N-pyridoxyl-5-methyltryptophan in chronic liver diseases

Energy Technology Data Exchange (ETDEWEB)

Hayakawa, Tomihiro; Katagiri, Kenji; Shiraki, Shigehiro and others

1988-11-01

Hepatobiliary scintigraphy using /sup 99m/Tc-N-pyridoxyl-5-methyltryptophan (PMT) was used to elucidate the effect of ursodeoxycholic acid (UDCA) treatment on chronic liver diseases. After UDCA administration, the peak of the hepatic uptake-excretion curve of /sup 99m/Tc-PMT (peak time) was significantly shortened. Serum ..gamma..-GTP level also improved during UDCA therapy. These results suggest that UDCA enhances uptake especially of anions like /sup 99m/Tc-PMT, and increases their secretion into bile. Consequently, UDCA may be pharmachologically useful for chronic liver diseases.

The influence of ursodeoxycholic acid on hepatobiliary scintigraphy with 99mTc-N-pyridoxyl-5-methyltryptophan in chronic liver diseases

International Nuclear Information System (INIS)

Hayakawa, Tomihiro; Katagiri, Kenji; Shiraki, Shigehiro

1988-01-01

Hepatobiliary scintigraphy using 99m Tc-N-pyridoxyl-5-methyltryptophan (PMT) was used to elucidate the effect of ursodeoxycholic acid (UDCA) treatment on chronic liver diseases. After UDCA administration, the peak of the hepatic uptake-excretion curve of 99m Tc-PMT (peak time) was significantly shortened. Serum γ-GTP level also improved during UDCA therapy. These results suggest that UDCA enhances uptake especially of anions like 99m Tc-PMT, and increases their secretion into bile. Consequently, UDCA may be pharmachologically useful for chronic liver diseases. (author)

Atmospheric, Long Baseline, and Reactor Neutrino Data Constraints on θ13

International Nuclear Information System (INIS)

Roa, J. E.; Ernst, D. J.; Latimer, D. C.

2009-01-01

An atmospheric neutrino oscillation tool that uses full three-neutrino oscillation probabilities and a full three-neutrino treatment of the Mikheyev-Smirnov-Wolfenstein effect, together with an analysis of the K2K, MINOS, and CHOOZ data, is used to examine the bounds on θ 13 . The recent, more finely binned, Super-K atmospheric data are employed. For L/E ν > or approx. 10 4 km/GeV, we previously found significant linear in θ 13 terms. This analysis finds θ 13 bounded from above by the atmospheric data while bounded from below by CHOOZ. The origin of this result arises from data in the previously mentioned very long baseline region; here, matter effects conspire with terms linear in θ 13 to produce asymmetric bounds on θ 13 . Assuming CP conservation, we find θ 13 =-0.07 -0.11 +0.18 (90% C.L.).

Atmospheric, long baseline, and reactor neutrino data constraints on theta_{13}.

Science.gov (United States)

Roa, J E; Latimer, D C; Ernst, D J

2009-08-07

An atmospheric neutrino oscillation tool that uses full three-neutrino oscillation probabilities and a full three-neutrino treatment of the Mikheyev-Smirnov-Wolfenstein effect, together with an analysis of the K2K, MINOS, and CHOOZ data, is used to examine the bounds on theta_{13}. The recent, more finely binned, Super-K atmospheric data are employed. For L/E_{nu} greater, similar 10;{4} km/GeV, we previously found significant linear in theta_{13} terms. This analysis finds theta_{13} bounded from above by the atmospheric data while bounded from below by CHOOZ. The origin of this result arises from data in the previously mentioned very long baseline region; here, matter effects conspire with terms linear in theta_{13} to produce asymmetric bounds on theta_{13}. Assuming CP conservation, we find theta_{13} = -0.07_{-0.11};{+0.18} (90% C.L.).

First photoelectron timing error evaluation of a new scintillation detector model

International Nuclear Information System (INIS)

Petrick, N.; Clinthorne, N.H.; Rogers, W.L.; Hero, A.O. III

1991-01-01

In this paper, a general timing system model for a scintillation detector developed is experimentally evaluated. The detector consists of a scintillator and a photodetector such as a photomultiplier tube or an avalanche photodiode. The model uses a Poisson point process to characterize the light output from the scintillator. This timing model was used to simulate a BGO scintillator with a Burle 8575 PMT using first photoelectron timing detection. Evaluation of the model consisted of comparing the RMS error from the simulations with the error from the actual detector system. The authors find that the general model compares well with the actual error results for the BGO/8575 PMT detector. In addition, the optimal threshold is found to be dependent upon the energy of the scintillation. In the low energy part of the spectrum, the authors find a low threshold is optimal while for higher energy pulses the optimal threshold increases

First photoelectron timing error evaluation of a new scintillation detector model

International Nuclear Information System (INIS)

Petrick, N.; Clinthorne, N.H.; Rogers, W.L.; Hero, A.O. III

1990-01-01

In this paper, a general timing system model for a scintillation detector that was developed, is experimentally evaluated. The detector consists of a scintillator and a photodetector such as a photomultiplier tube or an avalanche photodiode. The model uses a Poisson point process to characterize the light output from the scintillator. This timing model was used to simulated a BGO scintillator with a Burle 8575 PMT using first photoelectron timing detection. Evaluation of the model consisted of comparing the RMS error from the simulations with the error from the actual detector system. We find that the general model compares well with the actual error results for the BGO/8575 PMT detector. In addition, the optimal threshold is found to be dependent upon the energy of the scintillation. In the low energy part of the spectrum, we find a low threshold is optimal while for higher energy pulses the optimal threshold increases

Using the EPRI Risk-Informed ISI Methodology on Piping Systems in Forsmark 3

International Nuclear Information System (INIS)

O'Regan, Patrick; Moody, Jim; Loetman, Jan; Sandstedt, Johan

2010-12-01

The objective of this project was a pilot plant demonstration of the EPRI RI-ISI Methodology to selected systems at Forsmark, Unit 3 (F3). This scope of this study encompasses five systems and is based upon F3 implementation of SKIFs guidance as well as other consideration as documented in the PMT program. As described in section 2, five systems were selected for evaluation. These systems were selected because they allow this project to focus on a number of issues of interest in developing a RI-ISI methodology and RI-ISI program. This includes the following: - Several different types of degradation may be identified, - Several different types of 'consequence of failure' may be identified, - Different types of safety systems are evaluated - Non-safety systems are evaluated Using the results of this application, insights and comparisons between SKIFS and the EPRI methodologies' are provided including the following: - Consequence of pressure boundary failure (PBF) as described in Section 3.14. - Degradation mechanism evaluation as described in Section 4.8. - Risk ranking as described in Section 5. - Element selection for inspection as described in Section 6. - Risk impact as described in Section 7

Using the EPRI Risk-Informed ISI Methodology on Piping Systems in Forsmark 3

Energy Technology Data Exchange (ETDEWEB)

O' Regan, Patrick (Electric Power Research Inst., Knoxville, TN (United States)); Moody, Jim (JHM Consulting, Strafford (United States)); Loetman, Jan (Forsmarks Kraftgrupp AB (Sweden)); Sandstedt, Johan (Risk Pilot AB, Stockholm (Sweden))

2010-12-15

The objective of this project was a pilot plant demonstration of the EPRI RI-ISI Methodology to selected systems at Forsmark, Unit 3 (F3). This scope of this study encompasses five systems and is based upon F3 implementation of SKIFs guidance as well as other consideration as documented in the PMT program. As described in section 2, five systems were selected for evaluation. These systems were selected because they allow this project to focus on a number of issues of interest in developing a RI-ISI methodology and RI-ISI program. This includes the following: - Several different types of degradation may be identified, - Several different types of 'consequence of failure' may be identified, - Different types of safety systems are evaluated - Non-safety systems are evaluated Using the results of this application, insights and comparisons between SKIFS and the EPRI methodologies' are provided including the following: - Consequence of pressure boundary failure (PBF) as described in Section 3.14. - Degradation mechanism evaluation as described in Section 4.8. - Risk ranking as described in Section 5. - Element selection for inspection as described in Section 6. - Risk impact as described in Section 7

CSIR NLC - South Africa - mobile LIDAR - system description

CSIR Research Space (South Africa)

Sivakumar, V

2008-05-01

Full Text Available to an altitude of 3 km with a ruby laser [4], and in 1970, Inaba and Kobayasi [5] and Kobayasi and Inaba [6][7], with the same laser, performed spectral analysis of nitrogen, oxygen and several pollutants. Since these pioneering attempts, laser remote... 532 nm) Beam Expander 3 x (optional) Pulse width 7 ns Pulse repetition rate 10 Hz Beam Divergence 0.2 mRad Receiver Telescope type Newtonian Diameter 404 mm Field of View 1 mRad PMT...

Effects of Workplace Parent Management Training on Marital and Job Satisfaction among Iranian Working Parents

Directory of Open Access Journals (Sweden)

Masoumeh Mousavi

2017-11-01

Full Text Available BackgroundShifting the focus of parent management training (PMT to parents and discussing implications for maximizing the outcomes of PMT for the entire family is new and promising.ObjectiveWe aimed to examine the efficacy of work place PMT on job and marital satisfaction among staff members of an academic center.MethodsWe held 8 PMT sessions (1.5 h each for 20 staff members who were parents to children in the age range of 2–12 years. Dyadic Adjustment Scale (DAS and Occupational Descriptive Index [Health and Safety Executive (HSE] were used for baseline and post-intervention data gathering. DAS higher scores indicate higher marital adjustment satisfaction and higher HSE scores indicate higher occupational stress. To analyze changes in HSE and DAS scores over time, paired t-test and Wilcoxon signed rank test were used, respectively.ResultsAll DAS subscales show significant increased from baseline to the final session except for affectional expression which was not significant. We found no significant changes in total or subscale HSE scores among participants.ConclusionFindings of this study underscore the role of psycho-education usage in work environment and provide evidence about the importance of designing interventions concerning working parents. Implications of PMT are discussed in the text.

Plastic-film mulching and urea types affect soil CO2 emissions and grain yield in spring maize on the Loess Plateau, China.

Science.gov (United States)

Liu, Qiaofei; Chen, Yu; Li, Weiwei; Liu, Yang; Han, Juan; Wen, Xiaoxia; Liao, Yuncheng

2016-06-22

A 2-year field experiment was conducted on maize (Zea mays L.) to explore effective ways to decrease soil CO2 emissions and increase grain yield. Treatments established were: (1) no mulching with urea, (2) no mulching with controlled release fertiliser (CRF), (3) transparent plastic-film mulching (PMt) with urea, (4) PMt with CRF, (5) black plastic-film mulching (PMb) with urea, and (6) PMb with CRF. During the early growth stages, soil CO2 emissions were noted as PMt > PMb > no mulching, and this order was reversed in the late growth stages. This trend was the result of topsoil temperature dynamics. There were no significant correlations noted between soil CO2 emissions and soil temperature and moisture. Cumulative soil CO2 emissions were higher for the PMt than for the PMb, and grain yield was higher for the PMb treatments than for the PMt or no mulching treatments. The CRF produced higher grain yield and inhibited soil CO2 emissions. Soil CO2 emissions per unit grain yield were lower for the BC treatment than for the other treatments. In conclusion, the use of black plastic-film mulching and controlled release fertiliser not only increased maize yield, but also reduced soil CO2 emissions.

HIV/STD risk behaviors and perceptions among rural-to-urban migrants in China.

Science.gov (United States)

Li, Xiaoming; Fang, Xiaoyi; Lin, Danhua; Mao, Rong; Wang, Jing; Cottrell, Lesley; Harris, Carole; Stanton, Bonita

2004-12-01

Data from 2,153 sexually active rural-to-urban migrants in China were analyzed to examine the relationship between the movement of rural-to-urban migration and increased HIV/STD (sexually transmitted disease) risk and the applicability of constructs of a Western-based theory of behavioral change to the study population. Measurements included migrant mobility, sexual risk, and the seven constructs of the protection motivation theory (PMT). Data in the current study suggest that high mobility among rural-to-urban migrants was associated with increased sexual risk. The PMT constructs are applicable in identifying perceptions and attitudes associated with sexual risk behaviors in this culturally distinct population. Increased sexual risk was associated with increased perceptions of extrinsic rewards, intrinsic rewards, and response cost. Also consistent with PMT, increased sexual risk was associated with perceptions of decreased severity, vulnerability, response efficacy, and self-efficacy. After controlling for a number of key confounding factors, all seven PMT constructs were associated with sexual risk in the manner posited by the theory. The association between mobility and sexual risk underscores the importance of effective HIV/STD prevention efforts among this vulnerable population. The social cognitive theories including the PMT may form a logical base for prevention intervention programs targeting rural-to-urban migrants in China.

Determinants of Skin Cancer Preventive Behaviors Among Rural Farmers in Iran: an Application of Protection Motivation Theory.

Science.gov (United States)

Babazadeh, Towhid; Nadrian, Haidar; Banayejeddi, Morteza; Rezapour, Baratali

2017-09-01

Skin cancer is one of the most prevalent cancers, worldwide, which happens more among those with more sunlight exposure like farmers. The aim of this study was to explore the determinants of skin cancer preventive behaviors (SCPBs) among rural farmers using Protection Motivation Theory (PMT). In this cross-sectional study, multistage random sampling was employed to enroll 238 farmers referring to rural health houses (HH) in Chaldoran County, Iran. A valid and reliable instrument based on PMT variables was used. Significant correlations were found between all PMT variables with SCPBs (p Protection Motivation and SCPBs as outcome variables. Predictors for these two outcome variables were classified in two different blocks according to their natures. Demographic characteristics (p > 0.05) and PMT constructs (p Protection Motivation, respectively. Also, no significant effect was found on SCPBs by demographic variables, in the first block (∆R 2  = 0.025); however, in the second block, Perceived Susceptibility (p = 0.000), Rewards (p = 0.022), Self-efficacy (p = 0.000), and Response Cost (p = 0.001) were significant predictors of SCPBs (∆R 2  = 0.432). Health care providers may consider PMT as a framework for developing educational interventions aiming at improving SCPBs among rural farmers.

Construction of prototype of on-line analyzer detection system for coal on belt conveyor using neutron activation technique

International Nuclear Information System (INIS)

Rony Djokorayono; Agus Cahyono; MP Indarzah; SG Usep; Sukandar

2015-01-01

The use of on-line neutron activation technique for coal analysis is proposed as an alternative method for analysis based on sampling technique. Compared to this conventional technique, the on-line neutron activation technique has much shorter time of analysis and more accurate results. The construction of detection system prototype for the on-line analyzer is described in this paper. This on-line analyzer consists of detection system, data acquisition system, and computer console. This detection system comprises several modules, i.e. NaI(Tl) scintillation detector completed with a photomultiplier tube (PMT), pre-amplifier, single channel analyzer (SCA), and analog signal transmitter and pulse counter processor. The construction processes of these four modules include the development of configuration block, lay out, and selection of electronic components. The modules have been integrated and tested. This detection system was tested using radioactive element Zn-65 having energy of 1115.5 keV and activity of 1 μCi. The test results show that the prototype of the on-line analyzer detection system has functioned as expected. (author)

Massive Pulmonary Embolism: Treatment with the Rotarex Thrombectomy System

International Nuclear Information System (INIS)

Liu Sheng; Shi Haibin; Gu Jianping; Yang Zhengqiang; Chen Liang; Lou Wensheng; He Xu; Zhou Weizhong; Zhou Chungao; Zhao Linbo; Xia Jinguo; Li Linsun

2011-01-01

This study was designed to evaluate the efficacy and safety of percutaneous mechanical thrombectomy (PMT) for acute massive pulmonary embolism (PE). Fourteen patients (8 men, 6 women) with a mean age of 55.4 (range, 38–71) years with acute massive PE were initially diagnosed by computed tomography (CT) and confirmed by pulmonary angiography. All patients presented with acute PE symptoms and hemodynamic compromise. Each patient was treated with Straub Rotarex thrombectomy device and five patients received additional thrombolysis. Technique success and clinical improvement were achieved in all patients without major complications. The mean pulmonary artery pressure (PAP) decreased from 37.6 ± 6.6 to 29 ± 6.4 mmHg (P 2 (PaO 2 ) increased from 61.1 ± 9.2 to 88 ± 5.1 mmHg (P < 0.01). The Miller index was 0.67 ± 0.11 and 0.37 ± 0.13 (P < 0.01), respectively, before and after PMT (P < 0.01). Eleven patients had no recurrence of PE on a mean follow-up of 28.3 months, whereas the other three patients were lost to follow-up. The preliminary experience in our series suggests that the Straub Rotarex thrombectomy device, which has been utilized in peripheral arteries, also is useful for the treatment of acute massive PE.

Fulltext PDF

Indian Academy of Sciences (India)

Infrastructure of the new neutrino experiment at a nuclear power station near the village of Chooz. IReproduced with permission from CERN Courier). Wolfgang Pauli. 11900 -1958 ). IllIustration by Prema Iyer). EditoriciJ r. ~ie! Editor'~ column. NMukundo . Wolfgang Pauli. NMukundo. Classroom. 79. Exchange and Sign-.

Protection motivation theory and physical activity in the general population: a systematic literature review.

Science.gov (United States)

Bui, Linh; Mullan, Barbara; McCaffery, Kirsten

2013-01-01

An appropriate theoretical framework may be useful for guiding the development of physical activity interventions. This review investigates the effectiveness of the protection motivation theory (PMT), a model based on the cognitive mediation processes of behavioral change, in the prediction and promotion of physical activity participation. A literature search was conducted using the databases MEDLINE, PsycINFO, PubMed, and Web of Science, and a manual search was conducted on relevant reference lists. Studies were included if they tested or applied the PMT, measured physical activity, and sampled from healthy populations. A total of 20 studies were reviewed, grouped into four design categories: prediction, stage discrimination, experimental manipulation, and intervention. The results indicated that the PMT's coping appraisal construct of self-efficacy generally appears to be the most effective in predicting and promoting physical activity participation. In conclusion, the PMT shows some promise, however, there are still substantial gaps in the evidence.

Using a combined protection motivation theory and health action process approach intervention to promote exercise during pregnancy.

Science.gov (United States)

Gaston, Anca; Prapavessis, Harry

2014-04-01

Despite the benefits of exercise during pregnancy, many expectant mothers are inactive. This study examined whether augmenting a protection motivation theory (PMT) intervention with a Health Action Process Approach can enhance exercise behavior change among pregnant women. Sixty inactive pregnant women were randomly assigned to one of three treatment groups: PMT-only, PMT + action-planning, and PMT + action-and-coping-planning. Week-long objective (accelerometer) and subjective (self-report) exercise measures were collected at baseline, and at 1- and 4-weeks post-intervention. Repeated-measures ANOVAs demonstrated that while all participants reported increased exercise from baseline to 1-week post-intervention, participants in both planning groups were significantly more active (p < .001) than those in the PMT-only group by 4-weeks post-intervention (η (2) = .13 and .15 for accelerometer and self-report data, respectively). In conclusion, augmenting a PMT intervention with action or action-and-coping-planning can enhance exercise behavior change in pregnant women.

Multiple cis-regulatory elements are involved in the complex regulation of the sieve element-specific MtSEO-F1 promoter from Medicago truncatula.

Science.gov (United States)

Bucsenez, M; Rüping, B; Behrens, S; Twyman, R M; Noll, G A; Prüfer, D

2012-09-01

The sieve element occlusion (SEO) gene family includes several members that are expressed specifically in immature sieve elements (SEs) in the developing phloem of dicotyledonous plants. To determine how this restricted expression profile is achieved, we analysed the SE-specific Medicago truncatula SEO-F1 promoter (PMtSEO-F1) by constructing deletion, substitution and hybrid constructs and testing them in transgenic tobacco plants using green fluorescent protein as a reporter. This revealed four promoter regions, each containing cis-regulatory elements that activate transcription in SEs. One of these segments also contained sufficient information to suppress PMtSEO-F1 transcription in the phloem companion cells (CCs). Subsequent in silico analysis revealed several candidate cis-regulatory elements that PMtSEO-F1 shares with other SEO promoters. These putative sieve element boxes (PSE boxes) are promising candidates for cis-regulatory elements controlling the SE-specific expression of PMtSEO-F1. © 2012 German Botanical Society and The Royal Botanical Society of the Netherlands.

Predictors of Iranian women's intention to first papanicolaou test practice: An application of protection motivation theory.

Science.gov (United States)

Dehdari, T; Hassani, L; Shojaeizadeh, D; Hajizadeh, E; Nedjat, S; Abedini, M

2016-01-01

Given the importance of papanicolaou (Pap) test in the early detection and timely treatment of cervical cancer, present study was designed to determine predictors of a sample of Iranian women's intention to first Pap test practice based on the protection motivation theory (PMT) variables. In this cross-sectional study, a total of 240 women referral to the 30 primary health care clinics were selected. They completed a developed scale based on PMT variables including intention, perceived vulnerability and severity, fear, response costs, response efficacy and self-efficacy. Path analysis was used to determine the association between predictive factors and intention. The results showed that PMT had goodness of fit with a χ2/df = 2.37, df = 28, P= 0.001 and RMSEA = 0.076. PMT explained 42% of the variance in women's intention to get first Pap smear test. Self-efficacy (b = 0.55, Ptheory-based educational interventions associated with Pap testing among women.

Rhetorical Dissent as an Adaptive Response to Classroom Problems: A Test of Protection Motivation Theory

Science.gov (United States)

Bolkan, San; Goodboy, Alan K.

2016-01-01

Protection motivation theory (PMT) explains people's adaptive behavior in response to personal threats. In this study, PMT was used to predict rhetorical dissent episodes related to 210 student reports of perceived classroom problems. In line with theoretical predictions, a moderated moderation analysis revealed that students were likely to voice…

Risk of Porphyromonas gingivalis recolonization during the early period of periodontal maintenance in initially severe periodontitis sites.

Science.gov (United States)

Fujise, Osamu; Miura, Mayumi; Hamachi, Takafumi; Maeda, Katsumasa

2006-08-01

Porphyromonas gingivalis is considered a critical pathogen of periodontal diseases including recurrent periodontitis. The profound effects of active periodontal treatment (APT) on P. gingivalis elimination were previously demonstrated and revealed that the subsequent P. gingivalis-free or -suppressed status seems to be maintained during early periodontal maintenance (PMT). The aim of the present study was to show the occurrence of microbial recolonization during this early PMT period. In total, 128 sites from 11 generalized chronic periodontitis patients and one generalized aggressive periodontitis patient underwent clinical and microbiologic examination at baseline (Exam-I), after APT (Exam-II), and in PMT (Exam-III). Exam-III was carried out an average of 4.5 +/- 3.5 months after Exam-II. Detection and quantification of putative pathogens were performed using a polymerase chain reaction-based method. The PMT used was effective in maintaining the clinical conditions improved by APT. However, in microbiological examinations, Exam-III showed higher detection frequency and levels of P. gingivalis than Exam-II. This suggests that a P. gingivalis recolonization started in the early PMT period. P. gingivalis-increased sites then showed significantly more severe signs of periodontitis in Exam-I than P. gingivalis-stable sites (bleeding on probing frequency: 76.7% versus 56.5%; suppuration frequency: 41.9% versus 12.9%). On the other hand, in Exam-II, no significant differences of clinical parameters were noted between P. gingivalis-increased and -stable sites. Severe periodontitis sites before APT seemed to place them at risk of P. gingivalis recolonization in the early PMT period, and this microbial restoration could be a cause of recurrent periodontitis.

Reliable and redundat FPGAbased read-out design in the ATLAS TileCal Demonstrator

CERN Document Server

Akerstedt, H; The ATLAS collaboration

2014-01-01

The TileCal Demonstrator is a prototype for a future upgrade to the ATLAS hadron calorimeter when the Large Hadron Collider increases its luminosity in year 2023 (HL-LHC). It will be used for functionality and performance tests. The Demonstrator has 48 channels of upgraded readout and digitizing electronics and a new digital trigger capability, but stays backwards compatible with the present detector system by providing analog trigger signals. The Demonstrator is comprised of 4 identical “mini-drawers”, each equipped with up to 12 photomultipliers (PMTs). The on-detector electronics includes 45 Front-End Boards, each serving an individual PMT; 4 Main Boards, each to control and digitize the 12 PMT signals, and 4 corresponding high-speed Daughter Boards serving as data hubs between on-detector and off-detector electronics. The Demonstrator is fully compatible with the present system, accepting ATLAS triggers, timing and slow control commands for the data acquisition, detector control, and detector operatio...

BABAR IFR Replacement R and D

CERN Document Server

Berry, M

2003-01-01

The Instrumented Flux Return (IFR) of the BaBar detector will soon need to be replaced by a more robust muon detection system. Scintillator bars with embedded Wavelength Shifting (WLS) fibers and Limited Streamer Tubes are two replacement technology options. The scintillator bars are tested for attenuation length; and causes for the large width of the Photo Multiplier Tube (PMT) signal are analyzed by Monte Carlo simulation. Cooling techniques for Avalanche Photo Diodes (APD) are investigated. The fairly high attenuation length coupled with the narrow PMT signal make the scintillator a viable option for a muon detecting system. Continuing work will focus on increasing timing resolution using an APD to read the signal from the WLS fibers, and investigating the lifetime of the APD. The ability to read a signal from the LST on external copper strips is tested and signals are found to be clearly distinguishable from noise. The voltage is compared to count rate to find that the optimal operating voltage for the LS...

Time-resolved laser-induced fluorescence system

Science.gov (United States)

Bautista, F. J.; De la Rosa, J.; Gallegos, F. J.

2006-02-01

Fluorescence methods are being used increasingly in the measurement of species concentrations in gases, liquids and solids. Laser induced fluorescence is spontaneous emission from atoms or molecules that have been excited by laser radiation. Here we present a time resolved fluorescence instrument that consists of a 5 μJ Nitrogen laser (337.1 nm), a sample holder, a quartz optical fiber, a spectrometer, a PMT and a PC that allows the measurement of visible fluorescence spectra (350-750 nm). Time response of the system is approximately 5 ns. The instrument has been used in the measurement of colored bond paper, antifreeze, diesel, cochineal pigment and malignant tissues. The data acquisition was achieved through computer control of a digital oscilloscope (using General Purpose Interface Bus GPIB) and the spectrometer via serial (RS232). The instrument software provides a graphic interface that lets make some data acquisition tasks like finding fluorescence spectra, and fluorescence lifetimes. The software was developed using the Lab-View 6i graphic programming package and can be easily managed in order to add more functions to it.

Performance comparison of scintillators for alpha particle detectors

Energy Technology Data Exchange (ETDEWEB)

Morishita, Yuki [Graduate School of Medicine, Nagoya University, 1-1-20 Daiko-Minami, Higashi-ku, Nagoya, Aichi 461-8673 (Japan); Japan Atomic Energy Agency, Muramatsu 4-33, Tokai-mura, Ibaraki 319-1194 (Japan); Yamamoto, Seiichi [Graduate School of Medicine, Nagoya University, 1-1-20 Daiko-Minami, Higashi-ku, Nagoya, Aichi 461-8673 (Japan); Izaki, Kenji [Japan Atomic Energy Agency, Muramatsu 4-33, Tokai-mura, Ibaraki 319-1194 (Japan); Kaneko, Junichi H.; Toui, Kohei; Tsubota, Youichi; Higuchi, Mikio [Graduate School of Engineering, Hokkaido University, Kita 13, Nishi 8, Kita-ku, Sapporo, Hokkaido 060-8628 (Japan)

2014-11-11

Scintillation detectors for alpha particles are often used in nuclear fuel facilities. Alpha particle detectors have also become important in the research field of radionuclide therapy using alpha emitters. ZnS(Ag) is the most often used scintillator for alpha particle detectors because its light output is high. However, the energy resolution of ZnS(Ag)-based scintillation detectors is poor because they are not transparent. A new ceramic sample, namely the cerium doped Gd{sub 2}Si{sub 2}O{sub 7} (GPS) scintillator, has been tested as alpha particle detector and its performances have been compared to that one of three different scintillating materials: ZnS(Ag), GAGG and a standard plastic scintillator. The different scintillating materials have been coupled to two different photodetectors, namely a photomultiplier tube (PMT) and a Silicon Photo-multiplier (Si-PM): the performances of each detection system have been compared. Promising results as far as the energy resolution performances (10% with PMT and 14% with Si-PM) have been obtained in the case of GPS and GAGG samples. Considering the quantum efficiencies of the photodetectors under test and their relation to the emission wavelength of the different scintillators, the best results were achieved coupling the GPS with the PMT and the GAGG with the Si-PM.

Occulting Light Concentrators in Liquid Scintillator Neutrino Detectors

Science.gov (United States)

Buizza Avanzini, Margherita; Cabrera, Anatael; Dusini, Stefano; Grassi, Marco; He, Miao; Wu, Wenjie

2017-09-01

The experimental efforts characterizing the era of precision neutrino physics revolve around collecting high-statistics neutrino samples and attaining an excellent energy and position resolution. Next generation liquid-based neutrino detectors, such as JUNO, HyperKamiokande, etc, share the use of a large target mass, and the need of pushing light collection to the edge for maximal calorimetric information. Achieving high light collection implies considerable costs, especially when considering detector masses of several kt. A traditional strategy to maximize the effective photo-coverage with the minimum number of PMTs relies on Light Concentrators (LC), such as Winston Cones. In this paper, the authors introduce a novel concept called Occulting Light Concentrators (OLC), whereby a traditional LC gets tailored to a conventional PMT, by taking into account its single-photoelectron collection efficiency profile and thus occulting the worst performing portion of the photocathode. Thus, the OLC shape optimization takes into account not only the optical interface of the PMT, but also the maximization of the PMT detection performances. The light collection uniformity across the detector is another advantage of the OLC system. By considering the case of JUNO, we will show OLC capabilities in terms of light collection and energy resolution.

Evaluation of triggering schemes for KM3NeT

Energy Technology Data Exchange (ETDEWEB)

Seitz, T., E-mail: Thomas.Seitz@physik.uni-erlangen.de [Erlangen Centre for Astroparticle Physics, Erwin-Rommel-Str. 1, 91058 Erlangen (Germany); Herold, B., E-mail: Bjoern.Herold@physik.uni-erlangen.de [Erlangen Centre for Astroparticle Physics, Erwin-Rommel-Str. 1, 91058 Erlangen (Germany); Shanidze, R., E-mail: shanidze@physik.uni-erlangen.de [Erlangen Centre for Astroparticle Physics, Erwin-Rommel-Str. 1, 91058 Erlangen (Germany)

2013-10-11

The future neutrino telescope KM3NeT, to be built in the Mediterranean Sea, will be the largest of its kind. It will include nearly two hundred thousand photomultiplier tubes (PMT) mounted in multi-PMT digital optical modules (DOM). The dominant source of the PMT signals is decays of {sup 40}K and marine fauna bioluminescence. Selection of neutrino and muon events from this continuous optical background signals requires the implementation of fast and efficient triggers. Various schemes for the filtering of background data and the selection of neutrino and muon events were evaluated for the KM3NeT telescope using Monte Carlo simulations.

Development of continuous detectors for a high resolution animal PET system

International Nuclear Information System (INIS)

Siegel, S.; Cherry, S.R.; Ricci, A.R.; Shao, Y.; Phelps, M.E.

1995-01-01

The authors propose a design for a high resolution, gamma-camera style detector that is suitable for use in a positron emission tomograph dedicated to small animal research. Through Monte Carlo simulation the authors modeled the performance of a detector composed of one 76.2 x 76.2 x 8 mm thick LSO crystal coupled to a 3 in. square position sensitive photomultiplier tube (PS-PMT). The authors investigated the effect of optical coupling compounds, surface treatment and dept of interaction on the quantity (efficiency) and distribution (spread) of scintillation photons reaching the photocathode. They also investigated linearization of the position response. The authors propose a PET system consisting of fourteen of these detectors in 2 rings, yielding a 16 cm diameter by 15 cm long tomograph. It would operate in 3-D mode subtending a 68% solid angle to the center. The expected spatial resolution is (≤2 mm), with a system efficiency of ∼ 10% at the center (200 keV lower threshold) and a singles count rate capability of approximately 10 6 cps per detector

Percutaneous Mechanical Thrombectomy Treatment of Acute Superior Mesenteric Artery Embolism

Directory of Open Access Journals (Sweden)

Z. Zhang

Full Text Available : Objective/Background: This report presents a superior mesenteric artery (SMA embolism managed by percutaneous mechanical thrombectomy (PMT. Methods: A 61 year old woman diagnosed with SMA embolism was admitted. Emboli were found in the middle and distal segments of the SMA on abdominal computed tomography angiography. Under local anaesthesia, a 6 F Rotarex system was used to remove the emboli via left brachial artery access. Emboli were successfully removed and patency was restored to the SMA and its branches. Results: Post-operatively, the patient's symptoms were significantly relieved. No post-operative complications were observed and no discomfort was documented during follow-up. Conclusion: Endovascular treatment of SMA embolism using PMT is a feasible and alternative option. Keywords: Acute mesenteric ischaemia, Embolism, Endovascular treatment, Percutaneous mechanical thrombectomy, Superior mesenteric artery

Transmission-Line Readout with Good Time and Space Resolutions for Planacon MCP-PMTs

CERN Document Server

Tang, F; Byrum, K; Drake, G; Ertley, C; Frisch, H; Genat, J-F; May, E

2008-01-01

With commercially-available multi-anode microchannel plate photomultiplier tubes (MCP-PMT) and electronics, resolutions significantly better than 10 psec have been achieved in small systems with a few readout channels[1,2]. For large-scale time-of-flight systems used in particle physics, which may cover tens of square meters, a solution must be found with a manageable number of electronics channels and low total power consumption on the readout electronics without degrading the system timing resolution. We present here the design of a transmission-line readout for a Photonis Planacon MCP-PMT that has these characteristics. The tube, which is 5 cm square, is characterized by signal pulse rise times in the order of 200 psec and transit time spreads (TTS) in the order of 25 psec[1, 2]. The model 85011-011 MCP has 1024 anode pads laid out in an array of 32 by 32 on the back of the tube. The proposed readout is implemented on a Rogers 4350B printed circuit board with 32 parallel 50-ohm transmission lines on 1.6 mm...

Global Insight into Lysine Acetylation Events and Their Links to Biological Aspects in Beauveria bassiana, a Fungal Insect Pathogen

Science.gov (United States)

Wang, Zhi-Kang; Cai, Qing; Liu, Jin; Ying, Sheng-Hua; Feng, Ming-Guang

2017-01-01

Lysine acetylation (Kac) events in filamentous fungi are poorly explored. Here we show a lysine acetylome generated by LC-MS/MS analysis of immunoaffinity-based Kac peptides from normal hyphal cells of Beauveria bassiana, a fungal entomopathogen. The acetylome comprised 283 Kac proteins and 464 Kac sites. These proteins were enriched to eight molecular functions, 20 cellular components, 27 biological processes, 20 KEGG pathways and 12 subcellular localizations. All Kac sites were characterized as six Kac motifs, including a novel motif (KacW) for 26 Kac sites of 17 unknown proteins. Many Kac sites were predicted to be multifunctional, largely expanding the fungal Kac events. Biological importance of identified Kac sites was confirmed through functional analysis of Kac sites on Pmt1 and Pmt4, two O-mannosyltransferases. Singular site mutations (K88R and K482R) of Pmt1 resulted in impaired conidiation, attenuated virulence and decreased tolerance to oxidation and cell wall perturbation. These defects were close to or more severe than those caused by the deletion of pmt1. The Pmt4 K360R mutation facilitated colony growth under normal and stressful conditions and enhanced the fungal virulence. Our findings provide the first insight into the Kac events of B. bassiana and their links to the fungal potential against insect pests. PMID:28295016

Protection motivation theory and social distancing behaviour in response to a simulated infectious disease epidemic.

Science.gov (United States)

Williams, Lynn; Rasmussen, Susan; Kleczkowski, Adam; Maharaj, Savi; Cairns, Nicole

2015-01-01

Epidemics of respiratory infectious disease remain one of the most serious health risks facing the population. Non-pharmaceutical interventions (e.g. hand-washing or wearing face masks) can have a significant impact on the course of an infectious disease epidemic. The current study investigated whether protection motivation theory (PMT) is a useful framework for understanding social distancing behaviour (i.e. the tendency to reduce social contacts) in response to a simulated infectious disease epidemic. There were 230 participants (109 males, 121 females, mean age 32.4 years) from the general population who completed self-report measures assessing the components of PMT. In addition, participants completed a computer game which simulated an infectious disease epidemic in order to provide a measure of social distancing behaviour. The regression analyses revealed that none of the PMT variables were significant predictors of social distancing behaviour during the simulation task. However, fear (β = .218, p < .001), response efficacy (β = .175, p < .01) and self-efficacy (β = .251, p < .001) were all significant predictors of intention to engage in social distancing behaviour. Overall, the PMT variables (and demographic factors) explain 21.2% of the variance in intention. The findings demonstrated that PMT was a useful framework for understanding intention to engage in social distancing behaviour, but not actual behaviour during the simulated epidemic. These findings may reflect an intention-behaviour gap in relation to social distancing behaviour.

Psychosocial Correlates of HIV Protection Motivation among Black Adolescents in Venda, South Africa

Science.gov (United States)

Boer, Henk; Mashamba, M. Tshilidzi

2005-01-01

We assessed the usefulness of the theory of planned behavior (TPB) and protection motivation theory (PMT) to predict intended condom use among 201 adolescents from Venda, South Africa. Results indicated that both the TPB and the PMT could significantly predict intended condom use, although the level of explained variance was limited. Hierarchical…

Implementation of 3D tomographic visualisation through planar ICT data from experimental gamma-ray tomographic system

International Nuclear Information System (INIS)

Umesh Kumar; Singh, Gursharan; Ravindran, V.R.

2001-01-01

Industrial Computed Tomography (ICT) is one of the latest methods of non-destructive testing and examination. Different prototypes of Computed Industrial Tomographic Imaging System (CITIS) have been developed and experimental data have been generated in Isotope Applications Division. The experimental gamma-rays based tomographic imaging system comprises of beam generator containing approx. 220 GBq (6 Curies) of 137 Cs, a single NaI(Tl) -PMT integral assembly in a thick shielding and associated electronics, stepper motor controlled mechanical manipulator, collimators and required software. CITIS data is normally acquired in one orientation of the sample. It may be sometimes required to view a tomographic plane in a different orientation. Also, 3D visualization may be required with the available 2D data set. All these can be achieved by processing the available data. We have customized some of the routines for this purpose provided IDL (Integrated Data Language) package to suit our requirements. The present paper discusses methodology adopted for this purpose with an illustrative example. (author)

Impact of intense x-ray pulses on a NaI(Tl)-based gamma camera

Science.gov (United States)

Koppert, W. J. C.; van der Velden, S.; Steenbergen, J. H. L.; de Jong, H. W. A. M.

2018-03-01

In SPECT/CT systems x-ray and γ-ray imaging is performed sequentially. Simultaneous acquisition may have advantages, for instance in interventional settings. However, this may expose a gamma camera to relatively high x-ray doses and deteriorate its functioning. We studied the NaI(Tl) response to x-ray pulses with a photodiode, PMT and gamma camera, respectively. First, we exposed a NaI(Tl)-photodiode assembly to x-ray pulses to investigate potential crystal afterglow. Next, we exposed a NaI(Tl)-PMT assembly to 10 ms LED pulses (mimicking x-ray pulses) and measured the response to flashing LED probe-pulses (mimicking γ-pulses). We then exposed the assembly to x-ray pulses, with detector entrance doses of up to 9 nGy/pulse, and analysed the response for γ-pulse variations. Finally, we studied the response of a Siemens Diacam gamma camera to γ-rays while exposed to x-ray pulses. X-ray exposure of the crystal, read out with a photodiode, revealed 15% afterglow fraction after 3 ms. The NaI(Tl)-PMT assembly showed disturbances up to 10 ms after 10 ms LED exposure. After x-ray exposure however, responses showed elevated baselines, with 60 ms decay-time. Both for x-ray and LED exposure and after baseline subtraction, probe-pulse analysis revealed disturbed pulse height measurements shortly after exposure. X-ray exposure of the Diacam corroborated the elementary experiments. Up to 50 ms after an x-ray pulse, no events are registered, followed by apparent energy elevations up to 100 ms after exposure. Limiting the dose to 0.02 nGy/pulse prevents detrimental effects. Conventional gamma cameras exhibit substantial dead-time and mis-registration of photon energies up to 100 ms after intense x-ray pulses. This is due PMT limitations and due to afterglow in the crystal. Using PMTs with modified circuitry, we show that deteriorative afterglow effects can be reduced without noticeable effects on the PMT performance, up to x-ray pulse doses of 1 nGy.

Meiosis and SUMO

DEFF Research Database (Denmark)

Holm, Lærke Rebekka

to target proteins can be catalyzed by the SUMO E3 ligase Pli1. In this study we investigate the role of Pli1 and Pmt3 during meiotic differentiation and at repetitive DNA during mitotic growth. Target proteins for Pmt3 are many; however, Pli1 has a meiosis-specic function regulating meiotic recombination...

Maternal Attributions and Expressed Emotion as Predictors of Attendance at Parent Management Training

Science.gov (United States)

Peters, Sarah; Calam, Rachel; Harrington, Richard

2005-01-01

Background: The effectiveness of parent management training (PMT) as a treatment for child behaviour problems is reduced by high attrition rates. One difficulty with engaging mothers is that, by definition, PMT is directed at the parent, yet many parents believe the "cause" of the problem lies within the child. Hence the model of therapy offered…

Phase1 upgrade of the CMS-HF Calorimeter

CERN Document Server

Gulmez, Erhan

2016-01-01

In this presentation, results of the Phase I upgrade of the CMS Hadron Forward Calorimeter (HF) are discussed. The CMS-HF Calorimeter was using regular PMTs. Cherenkov light produced in the quartz fibers embedded in the iron absorber was read out with the PMTs. However, occasionally, stray muons hitting the PMT windows cause Cherenkov radiation in the PMT itself and produce large signals. These large signals mimic a very high-energy particle and are tagged as important by the trigger. To reduce this problem, PMTs had to be replaced. The four-anode PMTs that were chosen have thinner windows; thereby reducing the Cherenkov radiation in the PMT window. As part of the upgrade, the read-out electronics is to be replaced so that the PMTs are read out in two channels by connecting each pair of anodes to a single channel. Information provided by these two channels will help us reject the false signals due to the stray muons since the Cherenkov radiation in the PMT window is more likely to produce a signal only in one...

Extension of photomultiplier tube dynamic range for the LHAASO-KM2A electromagnetic particle detectors

Energy Technology Data Exchange (ETDEWEB)

Lv, Hongkui, E-mail: lvhk@ihep.ac.cn [Key Laboratory of Particle Astrophysics, Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Sheng, Xiangdong; He, Huihai; Liu, Jia [Key Laboratory of Particle Astrophysics, Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); Zhang, Zhongquan [Shandong University, Jinan 250100 (China); Hou, Chao; Zhao, Jing [Key Laboratory of Particle Astrophysics, Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China)

2015-05-01

In the Large High Altitude Air Shower Observatory (LHAASO), the 1 km{sup 2} array (KM2A) requires linear measurement of optical intensity with a wide dynamic range. Over 5000 photomultiplier tubes (PMTs) are employed in this experiment and developed as “two outputs” device (anode and dynode) to meet the relevant requirements. In this study, the linearity of the anode and the eighth dynode (DY8), which is limited by space charge effects and mainly related to the relative dynode voltage ratios of the PMT divider, is examined. A voltage divider for the Hamamatsu R11102 PMT is designed and a dramatically enhanced linearity is demonstrated. Test results show that this design can cover a wide dynamic range from 20 to 2×10{sup 5} photoelectrons and achieve a peak anode current of 380 mA at a PMT gain of 10{sup 5}, which satisfies the requirements of KM2A electromagnetic particle detectors. The circuit design has been successfully simulated using the simulation software Multisim. The details of PMT performance tests and simulations are described.

Extension of photomultiplier tube dynamic range for the LHAASO-KM2A electromagnetic particle detectors

Science.gov (United States)

Lv, Hongkui; Sheng, Xiangdong; He, Huihai; Liu, Jia; Zhang, Zhongquan; Hou, Chao; Zhao, Jing

2015-05-01

In the Large High Altitude Air Shower Observatory (LHAASO), the 1 km2 array (KM2A) requires linear measurement of optical intensity with a wide dynamic range. Over 5000 photomultiplier tubes (PMTs) are employed in this experiment and developed as "two outputs" device (anode and dynode) to meet the relevant requirements. In this study, the linearity of the anode and the eighth dynode (DY8), which is limited by space charge effects and mainly related to the relative dynode voltage ratios of the PMT divider, is examined. A voltage divider for the Hamamatsu R11102 PMT is designed and a dramatically enhanced linearity is demonstrated. Test results show that this design can cover a wide dynamic range from 20 to 2×105 photoelectrons and achieve a peak anode current of 380 mA at a PMT gain of 105, which satisfies the requirements of KM2A electromagnetic particle detectors. The circuit design has been successfully simulated using the simulation software Multisim. The details of PMT performance tests and simulations are described.

Extension of photomultiplier tube dynamic range for the LHAASO-KM2A electromagnetic particle detectors

International Nuclear Information System (INIS)

Lv, Hongkui; Sheng, Xiangdong; He, Huihai; Liu, Jia; Zhang, Zhongquan; Hou, Chao; Zhao, Jing

2015-01-01

In the Large High Altitude Air Shower Observatory (LHAASO), the 1 km 2 array (KM2A) requires linear measurement of optical intensity with a wide dynamic range. Over 5000 photomultiplier tubes (PMTs) are employed in this experiment and developed as “two outputs” device (anode and dynode) to meet the relevant requirements. In this study, the linearity of the anode and the eighth dynode (DY8), which is limited by space charge effects and mainly related to the relative dynode voltage ratios of the PMT divider, is examined. A voltage divider for the Hamamatsu R11102 PMT is designed and a dramatically enhanced linearity is demonstrated. Test results show that this design can cover a wide dynamic range from 20 to 2×10 5 photoelectrons and achieve a peak anode current of 380 mA at a PMT gain of 10 5 , which satisfies the requirements of KM2A electromagnetic particle detectors. The circuit design has been successfully simulated using the simulation software Multisim. The details of PMT performance tests and simulations are described

CT and MR imaging features in phosphaturic mesenchymal tumor-mixed connective tissue: A case report.

Science.gov (United States)

Shi, Zhenshan; Deng, Yiqiong; Li, Xiumei; Li, Yueming; Cao, Dairong; Coossa, Vikash Sahadeo

2018-04-01

Phosphaturic mesenchymal tumor-mixed connective tissue (PMT-MCT) is rare and usually benign and slow-growing. The majority of these tumors is associated with sporadic tumor-induced osteomalacia (TIO) or rickets, affect middle-aged individuals and are located in the extremities. Previous imaging studies often focused on seeking the causative tumors of TIO, not on the radiological features of these tumors, especially magnetic resonance imaging (MRI) features. PMT-MCT remains a largely misdiagnosed, ignored or unknown entity by most radiologists and clinicians. In the present case report, a review of the known literature of PMT-MCT was conducted and the CT and MRI findings from three patient cases were described for diagnosing the small subcutaneous tumor. Typical MRI appearances of PMT-MCT were isointense relative to the muscles on T1-weighted imaging, and markedly hyperintense on T2-weighted imaging containing variably flow voids, with markedly heterogeneous/homogenous enhancement on post contrast T1-weighted fat-suppression imaging. Short time inversion recovery was demonstrated to be the optimal sequence in localizing the tumor.

The CMS Beam Halo Monitor Detector System

CERN Document Server

CMS Collaboration

2015-01-01

A new Beam Halo Monitor (BHM) detector system has been installed in the CMS cavern to measure the machine-induced background (MIB) from the LHC. This background originates from interactions of the LHC beam halo with the final set of collimators before the CMS experiment and from beam gas interactions. The BHM detector uses the directional nature of Cherenkov radiation and event timing to select particles coming from the direction of the beam and to suppress those originating from the interaction point. It consists of 40 quartz rods, placed on each side of the CMS detector, coupled to UV sensitive PMTs. For each bunch crossing the PMT signal is digitized by a charge integrating ASIC and the arrival time of the signal is recorded. The data are processed in real time to yield a precise measurement of per-bunch-crossing background rate. This measurement is made available to CMS and the LHC, to provide real-time feedback on the beam quality and to improve the efficiency of data taking. In this talk we will describ...

Design and testing of a unique active Compton-suppressed LaBr3(Ce) detector system for improved sensitivity assays of TRU in remote-handled TRU wastes

Energy Technology Data Exchange (ETDEWEB)

J. K. Hartwell; M. E. McIlwain; J. A. Kulisek

2007-10-01

The US Department of Energy’s transuranic (TRU) waste inventory includes about 4,500 m3 of remote-handled TRU (RH-TRU) wastes composed of a variety of containerized waste forms having a contact surface dose rate that exceeds 2 mSv/hr (200 mrem/hr) containing waste materials with a total TRU concentration greater than 3700 Bq/g (100 nCi/g). As part of a research project to investigate the use of active Compton-suppressed room-temperature gamma-ray detectors for direct non-destructive quantification of the TRU content of these RH-TRU wastes, we have designed and purchased a unique detector system using a LaBr3(Ce) primary detector and a NaI(Tl) suppression mantle. The LaBr3(Ce) primary detector is a cylindrical unit ~25 mm in diameter by 76 mm long viewed by a 38 mm diameter photomultiplier. The NaI(Tl) suppression mantle (secondary detector) is 175 mm by 175 mm with a center well that accommodates the primary detector. An important feature of this arrangement is the lack of any “can” between the primary and secondary detectors. These primary and secondary detectors are optically isolated by a thin layer (.003") of aluminized kapton, but the hermetic seal and thus the aluminum can surrounds the outer boundary of the detector system envelope. The hermetic seal at the primary detector PMT is at the PMT wall. This arrangement virtually eliminates the “dead” material between the primary and secondary detectors, a feature that preliminary modeling indicated would substantially improve the Compton suppression capability of this device. This paper presents both the expected performance of this unit determined from modeling with MCNPX, and the performance measured in our laboratory with radioactive sources.

Managing iliofemoral deep venous thrombosis of pregnancy with a strategy of thrombus removal is safe and avoids post-thrombotic morbidity.

Science.gov (United States)

Herrera, Santiago; Comerota, Anthony J; Thakur, Subhash; Sunderji, Shiraz; DiSalle, Robert; Kazanjian, Sahira N; Assi, Zakaria

2014-02-01

Extensive deep venous thrombosis (DVT) during pregnancy is usually treated with anticoagulation alone, risking significant post-thrombotic syndrome (PTS) in young patients. Catheter-directed thrombolysis (CDT) and operative venous thrombectomy have been safely and effectively used in nonpregnant patients, demonstrating significant reduction in post-thrombotic morbidity. This report reviews short- and long-term outcomes of 13 patients with extensive DVT of pregnancy treated with a strategy of thrombus removal. From 1999 to 2013, 13 patients with iliofemoral DVT during pregnancy were offered CDT, pharmacomechanical thrombolysis (PMT), and/or venous thrombectomy. Gestational age ranged from 8 to 34 weeks. Fetal monitoring was performed throughout hospitalization. Radiation exposure was minimized with pelvic lead shields, focal fluoroscopy, and limited angiographic runs. Follow-up included objective vein evaluation using venous duplex and PTS assessment using the Villalta scale. CDT and/or PMT were used in 11 patients. Two patients underwent venous thrombectomy alone, and one patient had operative thrombectomy as an adjunct to CDT and PMT. Each patient had complete or near-complete thrombus resolution and rapid improvement in clinical symptoms. Eight of 11 having CDT or PMT underwent venoplasty and stenting of the involved iliac veins. Twelve of the 13 delivered healthy infants at term. One patient opted for termination of her pregnancy. Mean patient and gestational ages were 26 years and 26 weeks, respectively. Mean follow-up was 1.3 years, with only one recurrence. Duplex ultrasonography demonstrated patent veins in all but one patient and normal valve function in 10 patients. Eleven patients had Villalta scores thrombus removal, resulting in a patent venous system, normal valve function in many, prevention of PTS, and reduction in recurrence. Copyright © 2014. Published by Mosby, Inc.

Proximity focusing RICH with TOF capabilities

International Nuclear Information System (INIS)

Korpar, S.; Adachi, I.; Fujita, K.; Fukushima, T.; Gorisek, A.; Hayashi, D.; Iijima, T.; Ikado, T.; Ishikawa, T.; Kawai, H.; Kozakai, Y.; Krizan, P.; Kuratani, A.; Mazuka, Y.; Nakagawa, T.; Nishida, S.; Ogawa, S.; Pestotnik, R.; Seki, T.; Sumiyoshi, T.; Tabata, M.; Unno, Y.

2007-01-01

A proximity focusing RICH counter with a multi-channel micro-channel plate (MCP) PMT was tested as a time-of-flight counter. Cherenkov photons emitted in the radiator medium as well as in the entrance window of the PMT were used for the time-of-flight measurement, and an excellent performance of the counter could be demonstrated

The R&D of the 20 in. MCP–PMTs for JUNO

Energy Technology Data Exchange (ETDEWEB)

Chang, Yaping [Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); State Key Laboratory of Particle Detection and Electronics, Beijing 100049 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Huang, Guorui [North Night Vision Tech. Ltd., Nanjing 211106 (China); Heng, Yuekun [Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); State Key Laboratory of Particle Detection and Electronics, Beijing 100049 (China); Li, Dong [North Night Vision Tech. Ltd., Nanjing 211106 (China); Liu, Huilin [Xi’an Institute of Optics and Precision Mechanics, Chinese Academy of Sciences, Xi’an 710068 (China); Liu, Shulin [Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); State Key Laboratory of Particle Detection and Electronics, Beijing 100049 (China); Li, Weihua [Xi’an Institute of Optics and Precision Mechanics, Chinese Academy of Sciences, Xi’an 710068 (China); Ning, Zhe [Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); State Key Laboratory of Particle Detection and Electronics, Beijing 100049 (China); Qi, Ming [Department of Physics, Nanjing University, Nanjing 210093 (China); Qian, Sen, E-mail: qians@ihep.ac.cn [Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); State Key Laboratory of Particle Detection and Electronics, Beijing 100049 (China); Sun, Jianning; Si, Shuguang [North Night Vision Tech. Ltd., Nanjing 211106 (China); Tian, Jinshou [Xi’an Institute of Optics and Precision Mechanics, Chinese Academy of Sciences, Xi’an 710068 (China); Wang, Xingchao [North Night Vision Tech. Ltd., Nanjing 211106 (China); and others

2016-07-11

A new concept of large area photomultiplier based on MCPs was conceived for JUNO by the scientists in IHEP, and with the collaborative work of the MCP–PMT collaboration in China, 8 in. and 20 in. prototypes were produced. Test results show that this type of MCP–PMT can have good SPE performance as the traditional dynode type PMTs.

A Design of a PET Detector Using Micro-Channel Plate Photomultipliers with Transmission-Line Readout.

Science.gov (United States)

Kim, H; Frisch, H; Chen, C-T; Genat, J-F; Tang, F; Moses, W W; Choong, W S; Kao, C-M

2010-01-01

A computer simulation study has been conducted to investigate the feasibility of a positron emission tomography (PET) detector design by using micro-channel plate (MCP) photomultiplier tubes (PMT) with transmission-line (TL) read-out and waveform sampling. The detector unit consisted of a 24×24 array of pixelated LSO crystals, each of which was 4×4×25 mm(3) in size, and two 102×102 mm(2) MCP-PMTs coupled to both sides of the scintillator array. The crystal (and TL) pitch was 4.25 mm and reflective medium was inserted between the crystals. The transport of the optical photons inside the scintillator were simulated by using the Geant4 package. The output pulses of the MCP-PMT/TL unit were formed by applying the measured single photo-electron response of the MCP-PMT/TL unit to each individual photon that interacts with the photo-cathode of the MCP-PMT. The waveforms of the pulses at both ends of the TL strips were measured and analyzed to produce energy and timing information for the detected event. An experimental setup was developed by employing a Photonis Planacon MCP-PMT (XP85022) and a prototype TL board for measuring the single photo-electron response of the MCP-PMT/TL. The simulation was validated by comparing the predicted output pulses to measurements obtained with a single MCP-PMT/TL coupled to an LSO crystal exposed to 511 keV gamma rays. The validated simulation was then used to investigate the performance of the proposed new detector design. Our simulation result indicates an energy resolution of ~11% at 511 keV. When using a 400-600 keV energy window, we obtain a coincidence timing resolution of ~323 ps FWHM and a coincidence detection efficiency of ~40% for normally-incident 511keV photons. For the positioning accuracy, it is determined by the pitch of the TLs (and crystals) in the direction normal to the TLs and measured to be ~2.5 mm in the direction parallel to the TLs. The energy and timing obtained at the front- and back-end of the scintillator

Encapsulation pilot plant of radioactive wastes in thermosetting resins

International Nuclear Information System (INIS)

1982-01-01

The thermosetting resins (polyesters, epoxides) are used to encapsulate the low and intermediate - level radioactive wastes. The testing program concerning the drums produced by the pilot plant of the Chooz nuclear power plant is described. The installation operating is examined while thinking of the industrial application. The production costs are then evaluated

Improved 1500 MWe Arabelle begins operation

International Nuclear Information System (INIS)

Anon.

1995-01-01

Two of the first 1500 MWe steam turbine-generator sets, described as the largest in the world, are undergoing commissioning at the Chooz B PWR nuclear power station in France. A number of design improvements have been made over the previous generation of 1350 MWe turbines, a process which will continue. (Author)

Grass cell wall feruloylation: distribution of bound ferulate and candidate gene expression in Brachypodium distachyon

Directory of Open Access Journals (Sweden)

Hugo Bruno Correa Molinari

2013-03-01

Full Text Available The cell walls of grasses such as wheat, maize, rice and sugar cane, contain large amounts of ferulate that is ester-linked to the cell wall polysaccharide glucuronoarabinoxylan (GAX. This ferulate is considered to limit the digestibility of polysaccharide in grass biomass as it forms covalent linkages between polysaccharide and lignin components. Candidate genes within a grass-specific clade of the BAHD acyl-coA transferase superfamily have been identified as being responsible for the ester linkage of ferulate to GAX. Manipulation of these BAHD genes may therefore be a biotechnological target for increasing efficiency of conversion of grass biomass into biofuel. Here, we describe the expression of these candidate genes and amounts of bound ferulate from various tissues and developmental stages of the model grass Brachypodium distachyon. BAHD candidate transcripts and significant amounts of bound ferulate were present in every tissue and developmental stage. We hypothesise that BAHD candidate genes similar to the recently described rice OsPMT gene (PMT sub-clade are principally responsible for the bound coumaric acid (pCA, and that other BAHD candidates (non-PMT sub-clade are responsible for bound ferulic acid (FA. There were some similarities with between the ratio of expression non-PMT / PMT genes and the ratio of bound FA / pCA between tissue types, compatible with this hypothesis. However, much further work to modify BAHD genes in grasses and to characterise the heterologously expressed proteins is required to demonstrate their function.

Silicon surface barrier detector and study of energy spectrum of alpha particles from radioactive source

International Nuclear Information System (INIS)

Verma, S.D.; Sinha, Vijaya

1986-01-01

The principles of working of three commonly used radiation detectors, namely ionization chambers, scintillation counters with photomultiplier tube (PMT) systems and semiconductor detectors are briefly discussed. Out of the semiconductor detectors, the silicon surface barrier (SSB) detector has distinct advantages for detection of radiations, alpha particles in particular. The experimental setup to obtain the energy spectrum of alpha particles from 241 Am source using SSB fabricated in the Physics Department of Gujarat University, Ahmedabad is described. Its performance is compared with scintillation counter using PMT. SSB detector shows a sharp peak of #approx # 3 per cent energy resolution. The factors affecting the peak, namely, electronic noise, source dependent factors and detector-dependent factors are discussed. A method of calibrating SSB detectors based on energy loss mechanism of alpha particles in thin absorbers is described. Applications of such detectors are indicated. (M.G.B.)

The electronics readout and data acquisition system of the KM3NeT neutrino telescope node

Energy Technology Data Exchange (ETDEWEB)

Real, Diego [IFIC, Instituto de Física Corpuscular, CSIC-Universidad de Valencia, C/Catedrático José Beltrán, 2, 46980 Paterna (Spain); Collaboration: KM3NeT Collaboration

2014-11-18

The KM3NeT neutrino telescope will be composed by tens of thousands of glass spheres, called Digital Optical Module (DOM), each of them containing 31 PMTs of small photocathode area (3'). The readout and data acquisition system of KM3NeT have to collect, treat and send to shore, in an economic way, the enormous amount of data produced by the photomultipliers and at the same time to provide time synchronization between each DOM at the level of 1 ns. It is described in the present article the Central Logic Board, that integrates the Time to Digital Converters and the White Rabbit protocol used for the DOM synchronization in a transparent way, the Power Board used in the DOM, the PMT base to readout the photomultipliers and the respective collecting boards, the so called Octopus Board.

The electronics readout and data acquisition system of the KM3NeT neutrino telescope node

International Nuclear Information System (INIS)

Real, Diego

2014-01-01

The KM3NeT neutrino telescope will be composed by tens of thousands of glass spheres, called Digital Optical Module (DOM), each of them containing 31 PMTs of small photocathode area (3'). The readout and data acquisition system of KM3NeT have to collect, treat and send to shore, in an economic way, the enormous amount of data produced by the photomultipliers and at the same time to provide time synchronization between each DOM at the level of 1 ns. It is described in the present article the Central Logic Board, that integrates the Time to Digital Converters and the White Rabbit protocol used for the DOM synchronization in a transparent way, the Power Board used in the DOM, the PMT base to readout the photomultipliers and the respective collecting boards, the so called Octopus Board

Physics potential of the ICAL detector at the India-based Neutrino

Indian Academy of Sciences (India)

2017-04-26

Apr 26, 2017 ... (INO) is designed to study the atmospheric neutrinos and .... ing the momentum of the muon tracks in the case of .... Left panel shows the momentum resolution of muons produced in the region 0 ..... with Double CHOOZ [35] in France and culminating ... m above sea level near the city of Bengaluru in South.

Concentration of sup(99m)Tc-Sn-N-pyridoxyl-5-methyltryptophan, a biliary agent, in distant metastases of hepatomas

Energy Technology Data Exchange (ETDEWEB)

Hasegawa, Y; Nakano, S; Ibuka, K; Hashizume, T; Sasaki, Y; Imaoka, S; Ishiguro, S; Tanaka, S; Kasugai, H; Okano, Y

1985-03-01

During the last 2 years, eight patients with hepatocellular carcinoma who were suspected of having distant metastases have been studied to determine whether a new biliary agent, sup(99m)Tc-Sn-N-pyridoxyl-5-methyl-tryptophan (sup(99m)Tc-PMT), is taken up by extrahepatic tumors. In all eight patients, scintigrams showed a clearly increased uptake of sup(99m)Tc-PMT radioactivity by the extrahepatic tumors. In contrast, an increased uptake by the tumors of gallium citrate Ga 67 was only detected in four of the seven patients examined. The results obtained in this study suggest that sup(99m)Tc-PMT is useful both for characterizing the nature of extrahepatic tumors in patients with hepatoma and for detecting the metastases.

Preparation of Three-Dimensional Graphene Foams Using Powder Metallurgy Templates.

Science.gov (United States)

Sha, Junwei; Gao, Caitian; Lee, Seoung-Ki; Li, Yilun; Zhao, Naiqin; Tour, James M

2016-01-26

A simple and scalable method which combines traditional powder metallurgy and chemical vapor deposition is developed for the synthesis of mesoporous free-standing 3D graphene foams. The powder metallurgy templates for 3D graphene foams (PMT-GFs) consist of particle-like carbon shells which are connected by multilayered graphene that shows high specific surface area (1080 m(2) g(-1)), good crystallization, good electrical conductivity (13.8 S cm(-1)), and a mechanically robust structure. The PMT-GFs did not break under direct flushing with DI water, and they were able to recover after being compressed. These properties indicate promising applications of PMT-GFs for fields requiring 3D carbon frameworks such as in energy-based electrodes and mechanical dampening.

CCDiode: an optimal detector for laser confocal microscopes

Science.gov (United States)

Pawley, James B.; Blouke, Morley M.; Janesick, James R.

1996-04-01

The laser confocal microscope (LCM) is now an established research tool in biology and materials science. In biological applications, it is usually employed to detect the location of fluorescent market molecules and, under these conditions, signal levels from bright areas are often digitizer. To maintain the desired +/- 3 e noise level at the relatively high data rate of 1 MHz, our new device utilizes 64 separate readout amplifier/digitizer systems, operating in sequence. The resulting detector is more compact, efficient and reliable than the PMT it replaces but as its sensitive area is smaller than that of a PMT, it will require auxiliary optics when used with any LCM having a large (mm) pinhole. As the signal light is parallel, a simple lens mounted axially and with the CCDiode at its focus would suffice. Future versions may use 3 X 3 or 5 X 5 arrays of sensors to `track' the confocal spot as it is deflected by inhomogeneities of the specimen, change its effective size or shape or detect system misalignment.

Real-Time, Non-Intrusive Detection of Liquid Nitrogen in Liquid Oxygen at High Pressure and High Flow

Science.gov (United States)

Singh, Jagdish P.; Yueh, Fang-Yu; Kalluru, Rajamohan R.; Harrison, Louie

2012-01-01

An integrated fiber-optic Raman sensor has been designed for real-time, nonintrusive detection of liquid nitrogen in liquid oxygen (LOX) at high pressures and high flow rates in order to monitor the quality of LOX used during rocket engine ground testing. The integrated sensor employs a high-power (3-W) Melles Griot diode-pumped, solid-state (DPSS), frequency-doubled Nd:YAG 532- nm laser; a modified Raman probe that has built-in Raman signal filter optics; two high-resolution spectrometers; and photomultiplier tubes (PMTs) with selected bandpass filters to collect both N2 and O2 Raman signals. The PMT detection units are interfaced with National Instruments Lab- VIEW for fast data acquisition. Studies of sensor performance with different detection systems (i.e., spectrometer and PMT) were carried out. The concentration ratio of N2 and O2 can be inferred by comparing the intensities of the N2 and O2 Raman signals. The final system was fabricated to measure N2 and O2 gas mixtures as well as mixtures of liquid N2 and LOX

Flavour tagging with baryons and a study of two body $\\Lambda_b$ decays with the LHCb experiment

CERN Document Server

Storey, James William

2008-01-01

The LHCb experiment will perform precision measurements of CP-violation and search for rare B decays at the Large Hadron Collider (LHC), which is due to begin operation in 2008. The LHCb Ring Imaging Cherenkov (RICH) system provides the particle identification crucial for these studies. The Multi-Anode photomultiplier tube (MaPMT)is a candidate photon detector for the LHCb RICH system. Performance studies of the MaPMT in a charged particle beam at CERN demonstrate that the pulse shape of the BeetleMA readout ASIC does not return to zero after 125ns, which will lead to ghost pixel hits and the possible drift of the pedestal outside the dynamic range of the amplifier. Measurement of key CP asymmetries at LHCb requires that the flavour of the B-meson at creation is known. Flavour tagging using protons is shown to have potentially useful tagging performance, but the implementation is found to be challenging. A correlation between b-quark and Lambda flavour is observed for a Lambda produced in the same fragmentati...

Collection of scintillation light from small BGO crystals

International Nuclear Information System (INIS)

Cherry, S.R.; Shao, Y.; Tornai, M.P.; Siegel, S.; Ricci, A.R.; Phelps, M.E.

1995-01-01

The authors propose to develop a high resolution positron emission tomography (PET) detector designed for animal imaging. The detector consists of a 2-D array of small bismuth germanate (BGO) crystals coupled via optical fibers to a multi-channel photomultiplier tube (MC-PMT). Though this approach offers several advantages over the conventional BGO block design, it does require that a sufficient number of scintillation photons be transported from the crystal, down the fiber and into the PMT. In this study the authors use simulations and experimental data to determine how to maximize the signal reaching the PMT. This involves investigating factors such as crystal geometry, crystal surface treatment, the use of reflectors, choice of optical fiber, coupling of crystals to the optical fiber and optical fiber properties. Their results indicate that using 2 x 2 x 10 mm BGO crystals coupled to 30 cm of clad optical fiber, roughly 50 photoelectrons are produced at the PMT photocathode for a 511 keV interaction. This is sufficient to clearly visualize the photopeak and provide adequate timing resolution for PET. Based on these encouraging results, a prototype detector will now be constructed

Adolescents' protection motivation and smoking behaviour.

Science.gov (United States)

Thrul, Johannes; Stemmler, Mark; Bühler, Anneke; Kuntsche, Emmanuel

2013-08-01

The protection motivation theory (PMT) is a well-known theory of behaviour change. This study tested the applicability of the sub-constructs of threat and coping appraisal in predicting adolescents' smoking-related behavioural intentions and smoking behaviour longitudinally. Adolescents (N = 494) aged 11-16 years and not currently smoking at baseline participated in the study. Predictive validity of PMT constructs was tested in a path analysis model. Self-efficacy significantly predicted behavioural intention at baseline, which significantly predicted behavioural intention at follow-up, which in turn predicted smoking behaviour at follow-up. The effect of self-efficacy on behavioural intention at follow-up was mediated by behavioural intention at baseline and the effect of self-efficacy on smoking behaviour was mediated by behavioural intention at baseline and follow-up. In conclusion, we found support for one part of the PMT, namely for the predictive validity of the coping appraisal construct self-efficacy in predicting adolescents' smoking-related behavioural intention and smoking behaviour. These results fail to support the appropriateness of the PMT's construct threat appraisal in longitudinally predicting adolescents' smoking as well as the applicability of communicating fear and negative information as preventive interventions for this target group.

Effect of compliance during periodontal maintenance therapy on levels of bacteria associated with periodontitis: A 6-year prospective study.

Science.gov (United States)

Costa, Fernando Oliveira; Vieira, Thaís Riberal; Cortelli, Sheila Cavalca; Cota, Luís Otávio Miranda; Costa, José Eustáquio; Aguiar, Maria Cássia Ferreira; Cortelli, José Roberto

2018-05-01

It is well established that regular compliance during periodontal maintenance therapy (PMT) maintains the stability of periodontal clinical parameters obtained after active periodontal therapy (APT). However, compliance during PMT has not yet been related to subgingival bacterial levels. Thus, this study followed individuals in PMT over 6 years and longitudinally evaluated the effects of compliance on periodontitis-associated bacterial levels and its relation to periodontal status. From a 6-year prospective cohort study with 212 individuals in PMT, 91 were determined to be eligible. From this total, 28 regular compliers (RC) were randomly selected and matched for age and sex with 28 irregular compliers (IC). Complete periodontal examination and microbiological samples were obtained 5 times: T1 (prior to APT), T2 (after APT), T3 (2 years), T4 (4 years), and T5 (6 years). Total bacteria counts and levels of Actinomyces naeslundii, Porphyromonas gingivalis, Tannerella forsythia, and Treponema denticola were evaluated through quantitative polymerase chain reaction. RC had less tooth loss and better clinical and microbiological conditions over time when compared with IC. IC had higher total bacterial counts and higher levels of T. denticola. Moreover, among IC, total bacterial counts were positively associated with plaque index and bleeding on probing, while levels of A. naeslundii, T. forsythia, and T. denticola were negatively associated with clinical attachment loss (4 to 5 mm) among RC. Compliance positively influenced subgingival microbiota and contributed to stability of periodontal clinical status. Regular visits during PMT sustained microbiological benefits provided by APT over a 6-year period. © 2018 American Academy of Periodontology.

Photon-counting-based diffraction phase microscopy combined with single-pixel imaging

Science.gov (United States)

Shibuya, Kyuki; Araki, Hiroyuki; Iwata, Tetsuo

2018-04-01

We propose a photon-counting (PC)-based quantitative-phase imaging (QPI) method for use in diffraction phase microscopy (DPM) that is combined with a single-pixel imaging (SPI) scheme (PC-SPI-DPM). This combination of DPM with the SPI scheme overcomes a low optical throughput problem that has occasionally prevented us from obtaining quantitative-phase images in DPM through use of a high-sensitivity single-channel photodetector such as a photomultiplier tube (PMT). The introduction of a PMT allowed us to perform PC with ease and thus solved a dynamic range problem that was inherent to SPI. As a proof-of-principle experiment, we performed a comparison study of analogue-based SPI-DPM and PC-SPI-DPM for a 125-nm-thick indium tin oxide (ITO) layer coated on a silica glass substrate. We discuss the basic performance of the method and potential future modifications of the proposed system.

The pipe model theory half a century on: a review.

Science.gov (United States)

Lehnebach, Romain; Beyer, Robert; Letort, Véronique; Heuret, Patrick

2018-01-23

More than a half century ago, Shinozaki et al. (Shinozaki K, Yoda K, Hozumi K, Kira T. 1964b. A quantitative analysis of plant form - the pipe model theory. II. Further evidence of the theory and its application in forest ecology. Japanese Journal of Ecology14: 133-139) proposed an elegant conceptual framework, the pipe model theory (PMT), to interpret the observed linear relationship between the amount of stem tissue and corresponding supported leaves. The PMT brought a satisfactory answer to two vividly debated problems that were unresolved at the moment of its publication: (1) What determines tree form and which rules drive biomass allocation to the foliar versus stem compartments in plants? (2) How can foliar area or mass in an individual plant, in a stand or at even larger scales be estimated? Since its initial formulation, the PMT has been reinterpreted and used in applications, and has undoubtedly become an important milestone in the mathematical interpretation of plant form and functioning. This article aims to review the PMT by going back to its initial formulation, stating its explicit and implicit properties and discussing them in the light of current biological knowledge and experimental evidence in order to identify the validity and range of applicability of the theory. We also discuss the use of the theory in tree biomechanics and hydraulics as well as in functional-structural plant modelling. Scrutinizing the PMT in the light of modern biological knowledge revealed that most of its properties are not valid as a general rule. The hydraulic framework derived from the PMT has attracted much more attention than its mechanical counterpart and implies that only the conductive portion of a stem cross-section should be proportional to the supported foliage amount rather than the whole of it. The facts that this conductive portion is experimentally difficult to measure and varies with environmental conditions and tree ontogeny might cause the commonly

Social media-based civic engagement solutions for dengue prevention in Sri Lanka: results of receptivity assessment.

Science.gov (United States)

Lwin, May O; Vijaykumar, Santosh; Foo, Schubert; Fernando, Owen Noel Newton; Lim, Gentatsu; Panchapakesan, Chitra; Wimalaratne, Prasad

2016-02-01

This article focuses on a novel social media-based system that addresses dengue prevention through an integration of three components: predictive surveillance, civic engagement and health education. The aim was to conduct a potential receptivity assessment of this system among smartphone users in the city of Colombo, the epicenter of the dengue epidemic in the island country of Sri Lanka. Grounded in Protection Motivation Theory (PMT) and using a convenience sampling approach, the cross-sectional survey assessed perceived severity (PSe), perceived susceptibility (PSu), perceived response efficacy (PRE), perceived self-efficacy (PSE) and intention-to-use (IU) among 513 individuals. The overall receptivity to the system was high with a score of >4.00 on a five-point scale. Participants belonging to younger, better educated and higher income groups reported significantly better perceptions of the efficaciousness of the system, were confident in their ability to use the system, and planned to use it in the future. PMT variables contributed significantly to regression models predicting IU. We concluded that a social media-based system for dengue prevention will be positively received among Colombo residents and a targeted, strategic health communication effort to raise dengue-related threat perceptions will be needed to encourage greater adoption and use of the system. © The Author 2015. Published by Oxford University Press. All rights reserved. For permissions, please email: journals.permissions@oup.com.

Characterization of photomultiplier tubes with a realistic model through GPU-boosted simulation

Science.gov (United States)

Anthony, M.; Aprile, E.; Grandi, L.; Lin, Q.; Saldanha, R.

2018-02-01

The accurate characterization of a photomultiplier tube (PMT) is crucial in a wide-variety of applications. However, current methods do not give fully accurate representations of the response of a PMT, especially at very low light levels. In this work, we present a new and more realistic model of the response of a PMT, called the cascade model, and use it to characterize two different PMTs at various voltages and light levels. The cascade model is shown to outperform the more common Gaussian model in almost all circumstances and to agree well with a newly introduced model independent approach. The technical and computational challenges of this model are also presented along with the employed solution of developing a robust GPU-based analysis framework for this and other non-analytical models.

Failure Investigation & Design Optimization of a Photo-Multiplier Tube Assembly Under Thermal Loading

Science.gov (United States)

Dahya, Kevin

2004-01-01

Analysis of GLAST ACD Photo-Multiplier Tube (PMT) assembly under thermal loading demonstrates that the glass tube experiences high stresses due to Coefficient of Thermal Expansion mismatch, as well as increased stress due to high stiffness and incompressibility of potting compound. Further investigation shows adverse loading effects due to the magnetic shield, a thin piece of steel wrapped around the PMT. This steel, Mu Metal, contained an overlap region that directly attributed to crack propagation in the outside surface of the tube. Sensitivities to different configurations were studied to reduce the stress and provide a more uniform loading throughout the PMT to ensure mission success. Studies indicate substituting a softer and more compressible potting compound and moving the Mu metal from the glass tube to the outside wall of the aluminum housing yields lower stress.

Anatomic and functional outcomes of pharmacomechanical and catheter-directed thrombolysis of iliofemoral deep venous thrombosis.

Science.gov (United States)

Hager, Eric; Yuo, Theodore; Avgerinos, Efthymios; Naddaf, Abdullah; Jeyabalan, Geetha; Marone, Luke; Chaer, Rabih

2014-07-01

Pharmacomechanical thrombolysis (PMT) and catheter-directed thrombolysis (CDT) are commonly used for the treatment of iliofemoral deep venous thrombosis (DVT). The purpose of this study was to examine the short- and long-term venous patency and venous valvular function as well as clinical outcomes of patients treated for iliofemoral DVT by PMT and CDT. A retrospective review of all patients with symptomatic DVT treated between 2006 and 2011 with PMT or CDT was performed. All patients were treated by local tissue plasminogen activator delivered with PMT or CDT. Patients were divided into two groups on the basis of initial treatment modality: patients treated by PMT alone (group 1), and those who underwent PMT and CDT or CDT alone (group 2). Group comorbidities, initial presenting symptoms, and Clinical, Etiologic, Anatomic, and Pathologic (CEAP) classification scores were compared. Postprocedural duplex ultrasound was used to assess valve function and treated vein patency rates. At all visits, Villalta and CEAP scores were recorded and compared. Group demographic and procedural results were analyzed by Fisher exact test for dichotomous variables and Kruskal-Wallis equality-of-populations rank test for the ordinal and continuous data. Kaplan-Meier survival estimates were used to assess preserved valve function as well as primary and secondary patency rates. There were 79 patients with 102 limbs treated for extensive iliofemoral DVT (median age, 51.5 years; range, 16.6-83.8 years). There were 18 patients in group 1 and 61 patients in group 2 (PMT + CDT [n = 54] or CDT alone [n = 7]). There were no differences in demographics or comorbidities between groups aside from malignant disease, which was more common in group 1 (35.3% vs 11.5%; P = .03). A total of 102 limbs were analyzed, 24 in group 1 and 78 in group 2. Patients in group 1 had a shorter symptom duration compared with group 2 (7 days vs 16 days; P = .011). The median number of procedures in group 1

Understanding of impurity behavior in SST-1 plasmas using visible spectroscopy

International Nuclear Information System (INIS)

Manchanda, Ranjana; Ramaiya, Nilam; Chowdhuri, Malay Bikas; Banerjee, Santanu; Ghosh, Joydeep

2015-01-01

Studies of impurity behavior in SST-1 plasma have been carried out using visible spectroscopic systems installed on the tokomak. This has been carried out using a low resolution and broadband survey spectrometer covering a 350-900 nm wavelength range, 0.5 m visible spectrometer having 600 and 1200 grooves/mm grating coupled with CCD camera and interference filter and photomultiplier (PMT) tube based systems. Temporal evolution of the hydrogen (H α , H β ) and impurities emissions like, C II, C III, O I, O II, O III, O V and a visible Continuum at 536.0 nm have been monitored using the PMT based system to understand impurity charge state evolution during plasma discharges. All systems are absolutely calibrated for impurity influx and plasma parameter estimations. Observed spectral lines in the visible range have been identified to recognize the presence of various impurities in the SST-1 plasmas. Comparison of impurities emission has been made for different plasma currents and toroidal magnetic fields. An analysis has been carried out to understand the impurities activities in plasmas of SST-1 tokomak in presence and absence of installed plasma facing components (PFC). Significantly higher carbon emissions have been observed indicating higher carbon content in the plasma with graphite PFCs installed. (author)

Summary of erosion-corrosion observations made in power stations on damp-steam circuits

International Nuclear Information System (INIS)

Lacaille, L.

1981-01-01

The development of the light-water system has profoundly modified the operating conditions of the turbines, in which expansion now takes place from the first saturated-steam stages. In addition to the traditional phenomena of mechanical erosion there are now problems of a chemical nature, linked to the temperatures of the liquid phase, which cause destruction in the HP stages of the turbines, the drier-feed heaters, and the linking piping. Systematic observations have been made in the PWR stations at Chooz, Doel, Tihange, Fessenheim, and Le Bugey, followed by trials of materials, improvements in the flow, chemical treatment of the secondary circuit, and reduction of the liquid phase in the steam emerging from the HP turbine [fr

Beer-Lambert-Law Parametric Model of Reflectance Spectra for Dyed Fabrics

Science.gov (United States)

2016-06-06

reflections from layered systems (i.e., scattering matrix formulations) [12,13,14], the Kubelka-Munk theory of diffuse reflectance (and formulations...mode. The Lambda 1050 incorporated a double beam, 150 mm integrating sphere housing a photomultiplier tube (PMT) detector for the UV-Vis (175 – 860 nm...of the combined system of dye and fabric. This relation follows from the Beer-Lambert law and formalism of the scattering- matrix [20]. In particular

Comparison of Low-Dose Catheter-Directed Thrombolysis with and without Pharmacomechanical Thrombectomy for Acute Lower Extremity Ischemia.

Science.gov (United States)

Gandhi, Sagar S; Ewing, Joseph A; Cooper, Emily; Chaves, Jose Mauro; Gray, Bruce H

2018-01-01

Catheter-directed thrombolysis (CDT) and/or pharmacomechanical thrombectomy (PMT) can dissolve/remove thrombus; PMT alone, however, may require the adjunctive use of CDT. The aim of this study was to compare the use of CDT with and without PMT for the treatment of acute lower extremity ischemia (ALI). We retrospectively reviewed all patients with ALI who underwent CDT with or without PMT between January 2008 and April 2014 (n = 99). Patients with incomplete medical charts were excluded (n = 16). Remaining patients were divided into 2 cohorts: group 1 included patients who underwent PMT + CDT (n = 54); group 2 included those who underwent CDT alone (n = 29). Lesions were further characterized by anatomic location: iliac disease (n = 14), femoropopliteal disease (n = 53), tibial disease (n = 2), and multilevel disease (n = 14). Data collection included patient and limb characteristics, duration of treatment, complications, clinical outcomes, adjunctive interventions, and follow-up. No significant differences were seen between treatment groups in terms of patient characteristics, occlusion length and location, Rutherford class, median duration of ischemia time (P = 0.22), or mean lysis time (P = 0.58). Treatment groups were also similar with regard to outcomes, including periprocedure complications, patency, reintervention, limb salvage, and amputation-free survival. There was no different between PMT + CDT and CDT alone in terms of periprocedural complications or outcomes. In the quest to resolve ALI, initial thrombus extraction with PMT may not reduce the need, duration, or efficacy of CDT. Copyright © 2017 Elsevier Inc. All rights reserved.

Related factors to workers' use of hearing protection device in knitting & ppinning factories of Yazd city based on Protection Motivation Theory

Directory of Open Access Journals (Sweden)

A. Barkhordi

2009-10-01

Full Text Available Background and aimsNoise-Induced Hearing Loss (NIHL is an important occupational disorder. High percentage of workers in occupational environments did not use the hearing protection device against harmful noise. This study was carried out to study factors related to workers' use of Hearing protection Device in Knitting & spinning factories of Yazd city based on protection motivation theory.MethodsIn this cross-sectional analytical study 280 workers of the knitting & spinning factories of Yazd City who exposed to harmful noise (over 85dB selected among the three factories by cluster sampling. The data gathered via exclusive interviews with selected workers  using the questionnaire designed based on protection motivation theory and were analyzedResults42/5 percent of workers permanently used hearing protection devices, and 20/7 percent of workers never use.There was a significant correlation between the age of workers and the mean score components of PMT; perceived severity, perceived vulnerability, perceived response efficacy and protection motivation. There was also a significant correlation between the work experience and the mean score of PMT factors; perceived severity, perceived response efficacy and perceived vulnerability. Also there was a significant correlation between workers' education level and the mean score of perceived response efficacy and there was a significant correlation between protection motivation and the mean score components of PMT; perceived vulnerability, perceived self-efficacy, perceived response efficacy, perceived costs and behaviorConclusionRegarding the significant correlations between the more constructs of PMT and protection motivation of workers for using hearing protective device, designing educational program based on PMT to increase hearing protection devices usage among workers is recommended.

Insights into Flood-Coping Appraisals of Protection Motivation Theory: Empirical Evidence from Germany and France.

Science.gov (United States)

Bubeck, Philip; Wouter Botzen, W J; Laudan, Jonas; Aerts, Jeroen C J H; Thieken, Annegret H

2017-11-17

Protection motivation theory (PMT) has become a popular theory to explain the risk-reducing behavior of residents against natural hazards. PMT captures the two main cognitive processes that individuals undergo when faced with a threat, namely, threat appraisal and coping appraisal. The latter describes the evaluation of possible response measures that may reduce or avert the perceived threat. Although the coping appraisal component of PMT was found to be a better predictor of protective intentions and behavior, little is known about the factors that influence individuals' coping appraisals of natural hazards. More insight into flood-coping appraisals of PMT, therefore, are needed to better understand the decision-making process of individuals and to develop effective risk communication strategies. This study presents the results of two surveys among more than 1,600 flood-prone households in Germany and France. Five hypotheses were tested using multivariate statistics regarding factors related to flood-coping appraisals, which were derived from the PMT framework, related literature, and the literature on social vulnerability. We found that socioeconomic characteristics alone are not sufficient to explain flood-coping appraisals. Particularly, observational learning from the social environment, such as friends and neighbors, is positively related to flood-coping appraisals. This suggests that social norms and networks play an important role in flood-preparedness decisions. Providing risk and coping information can also have a positive effect. Given the strong positive influence of the social environment on flood-coping appraisals, future research should investigate how risk communication can be enhanced by making use of the observed social norms and network effects. © 2017 Society for Risk Analysis.

Experience feedback of computerized controlled nuclear power plants

International Nuclear Information System (INIS)

Poizat, F.

2004-01-01

The N4 step of French PWR-type nuclear power plants is characterized by an instrumentation and control system entirely computerized (operation procedures including normal and accidental operation). Four power plants of this type (Chooz and Civaux sites) of 1450 MWe each were connected to the power grid between August 1996 and December 1999. The achievement of this program make it possible and necessary to carry out an experience feedback about the development, successes and difficulties encountered in order to draw out some lessons for future realizations. This is the aim of this article: 1 - usefulness and difficulties of such an experience feedback: evolution of instrumentation and control systems, necessary cautions; 2 - a successful computerized control: checking of systems operation, advantages, expectations; 3 - efficiency of computerized systems: demonstration of operation safety, profitability; 4 - conclusions and interrogations: system approach instead of 'micro-software' approach, commercial or 'made to measure' products, contract agreement with a supplier, when and how upgrading. (J.S.)

UV Observations of Atomic Oxygen in the Cusp Region

Science.gov (United States)

Fritz, B.; Lessard, M.; Dymond, K.; Kenward, D. R.; Lynch, K. A.; Clemmons, J. H.; Hecht, J. H.; Hysell, D. L.; Crowley, G.

2017-12-01

The Rocket Experiment for Neutral Upwelling (RENU) 2 launched into the dayside cusp on 13 December, 2015. The sounding rocket payload carried a comprehensive suite of particle, field, and remote sensing instruments to characterize the thermosphere in a region where pockets of enhanced neutral density have been detected [Lühr et al, 2004]. An ultraviolet photomultiplier tube (UV PMT) was oriented to look along the magnetic field line and remotely detect neutral atomic oxygen (OI) above the payload. The UV PMT measured a clear enhancement as the payload descended through a poleward moving auroral form, an indicator of structure in both altitude and latitude. Context for the UV PMT measurement is provided by the Special Sensor Ultraviolet Imager (SSULI) instrument on the Defense Meteorological Space Program (DMSP) satellite, which also measured OI as it passed through the cusp. UV tomography of SSULI observations produces a two-dimensional cross-section of volumetric emission rates in the high-latitude thermosphere prior to the RENU 2 flight. The volume emission rate may then be inverted to produce a profile of neutral density in the thermosphere. A similar technique is used to interpret the UV PMT measurement and determine structure in the thermosphere as RENU 2 descended through the cusp.

Characterization of O-mannosyltransferase family in Schizosaccharomyces pombe.

Science.gov (United States)

Tanaka, Naotaka; Fujita, Yasuko; Suzuki, Shotaro; Morishita, Masayo; Giga-Hama, Yuko; Shimoda, Chikashi; Takegawa, Kaoru

2005-05-13

Protein O-glycosylation is an essential protein modification in eukaryotic cells. In Saccharomyces cerevisiae, O-mannosylation is initiated in the lumen of the endoplasmic reticulum by O-mannosyltransferase gene products (Pmt1p-7p). A search of the Schizosaccharomyces pombe genome database revealed a total of three O-glycoside mannosyltransferase homologs (ogm1+, ogm2+, and ogm4+), closely related to Saccharomyces cerevisiae PMT1, PMT2, and PMT4. Although individual ogm genes were not found to be essential, ogm1Delta and ogm4Delta mutants exhibited aberrant morphology and failed to agglutinate during mating. The phenotypes of the ogm4Delta mutant were not complemented by overexpression of ogm1+ or ogm2+, suggesting that each of the Ogm proteins does not have overlapping functions. Heterologous expression of a chitinase from S. cerevisiae in the ogm mutants revealed that O-glycosylation of chitinase had decreased in ogm1Delta cells. A GFP-tagged Fus1p from S. cerevisiae was specifically not glycosylated and accumulated in the Golgi in ogm4Delta cells. These results indicate that O-glycosylation initiated by Ogm proteins plays crucial physiological roles and can serve as a sorting determinant for protein transport of membrane glycoproteins in S. pombe.

Botrytis cinerea protein O-mannosyltransferases play critical roles in morphogenesis, growth, and virulence.

Directory of Open Access Journals (Sweden)

Mario González

Full Text Available Protein O-glycosylation is crucial in determining the structure and function of numerous secreted and membrane-bound proteins. In fungi, this process begins with the addition of a mannose residue by protein O-mannosyltransferases (PMTs in the lumen side of the ER membrane. We have generated mutants of the three Botrytis cinerea pmt genes to study their role in the virulence of this wide-range plant pathogen. B. cinerea PMTs, especially PMT2, are critical for the stability of the cell wall and are necessary for sporulation and for the generation of the extracellular matrix. PMTs are also individually required for full virulence in a variety of hosts, with a special role in the penetration of intact plant leaves. The most significant case is that of grapevine leaves, whose penetration requires the three functional PMTs. Furthermore, PMT2 also contributes significantly to fungal adherence on grapevine and tobacco leaves. Analysis of extracellular and membrane proteins showed significant changes in the pattern of protein secretion and glycosylation by the pmt mutants, and allowed the identification of new protein substrates putatively glycosylated by specific PMTs. Since plants do no possess these enzymes, PMTs constitute a promising target in the development of novel control strategies against B. cinerea.

Energy resolution measurements of LaBr3:Ce scintillating crystals with an ultra-high quantum efficiency photomultiplier tube

International Nuclear Information System (INIS)

Pani, R.; Cinti, M.N.; Scafe, R.; Pellegrini, R.; Vittorini, F.; Bennati, P.; Ridolfi, S.; Lo Meo, S.; Mattioli, M.; Baldazzi, G.; Pisacane, F.; Navarria, F.; Moschini, G.; Boccaccio, P.; Orsolini Cencelli, V.; Sacco, D.

2009-01-01

The performance of the new prototype of high quantum efficiency PMT (43% at 380 nm), Hamamatsu R7600U-200, was studied coupled to a LaBr 3 :Ce crystal with the size of o12.5 mmx12.5 mm. The energy resolution results were compared with ones from two PMTs, Hamamatsu R7600U and R6231MOD, with 22% and 30% quantum efficiency (QE), respectively. Moreover, the photodetectors were equipped with tapered and un-tapered voltage dividers to study the non-linearity effects on pulse height distribution, due to very high peak currents induced in the PMT by the fast and intense light pulse of LaBr 3 :Ce. The results show an energy resolution improvement with UBA PMT of about 20%, in the energy range of 80-662 keV, with respect to the BA one.

Estimating the ROI on Implementation of RFID at the Ammunition Storage Warehouse and the 40th Supply Depot: KVA as a Methodology

Science.gov (United States)

2009-12-01

Balanced Scorecard CAPM Capital Asset Pricing Model DIS Defense Information System DoD Department of...Measurement Tool (PMT) is the Balanced Scorecard (BSC) based on critical success factors and key performance indicators. The MND has referred to Jung’s...authors can replicate the methodology for multiple projects to generate a portfolio of projects. Similar to the Capital Asset Pricing Model ( CAPM ) or

Adolescents' protection motivation and smoking behaviour

OpenAIRE

Thrul, Johannes; Stemmler, Mark; Bühler, Anneke; Kuntsche, Emmanuel

2017-01-01

The protection motivation theory (PMT) is a well-known theory of behaviour change. This study tested the applicability of the sub-constructs of threat and coping appraisal in predicting adolescents' smoking-related behavioural intentions and smoking behaviour longitudinally. Adolescents (N = 494) aged 11-16 years and not currently smoking at baseline participated in the study. Predictive validity of PMT constructs was tested in a path analysis model. Self-efficacy significantly predicted beha...

Upgrade of the ATLAS Hadronic Tile Calorimeter for the High Luminosity LHC

CERN Document Server

Hildebrand, Kevin; The ATLAS collaboration

2017-01-01

The Tile Calorimeter is the hadronic calorimeter covering the central region of the ATLAS detector at the Large Hadron Collider. It is a scintillator-steel sampling calorimeter read out via wavelength shifting fibers coupled to photomultiplier tubes (PMT). The PMT signals are digitized and stored on detector until a trigger is received. The Large Hadron Collider (LHC) has envisaged a series of upgrades towards a High Luminosity LHC (HL-LHC) delivering five times the LHC nominal instantaneous luminosity. The ATLAS Phase II upgrade (2024-2025) will accommodate the upgrade of the detector and data acquisition system for the HL-LHC. In particular, TileCal will undergo a major replacement of its on- and off-detector electronics. In the new architecture, all signals will be digitized and then transferred directly to the off-detector electronics, where the signals will be reconstructed, stored, and sent to the first level of trigger at the rate of 40 MHz. This will provide better precision of the calorimeter signals...

Analysis of time resolution in a dual head LSO+PSPMT PET system using low pass filter interpolation and digital constant fraction discriminator techniques

International Nuclear Information System (INIS)

Monzo, Jose M.; Lerche, Christoph W.; Martinez, Jorge D.; Esteve, Raul; Toledo, Jose; Gadea, Rafael; Colom, Ricardo J.; Herrero, Vicente; Ferrando, Nestor; Aliaga, Ramon J.; Mateo, Fernando; Sanchez, Filomeno; Mora, Francisco J.; Benlloch, Jose M.; Sebastia, Angel

2009-01-01

PET systems need good time resolution to improve the true event rate, random event rejection, and pile-up rejection. In this study we propose a digital procedure for this task using a low pass filter interpolation plus a Digital Constant Fraction Discriminator (DCFD). We analyzed the best way to implement this algorithm on our dual head PET system and how varying the quality of the acquired signal and electronic noise analytically affects timing resolution. Our detector uses two continuous LSO crystals with a position sensitive PMT. Six signals per detector are acquired using an analog electronics front-end and these signals are processed using an in-house digital acquisition board. The test bench developed simulates the electronics and digital algorithms using Matlab. Results show that electronic noise and other undesired effects have a significant effect on the timing resolution of the system. Interpolated DCFD gives better results than non-interpolated DCFD. In high noise environments, differences are reduced. An optimum delay selection, based on the environment noise, improves time resolution.

Analysis of time resolution in a dual head LSO+PSPMT PET system using low pass filter interpolation and digital constant fraction discriminator techniques

Energy Technology Data Exchange (ETDEWEB)

Monzo, Jose M. [Digital Systems Design (DSD) Group, ITACA Institute, Universidad Politecnica de Valencia, Camino de Vera s/n, 46022 Valencia (Spain)], E-mail: jmonfer@aaa.upv.es; Lerche, Christoph W.; Martinez, Jorge D.; Esteve, Raul; Toledo, Jose; Gadea, Rafael; Colom, Ricardo J.; Herrero, Vicente; Ferrando, Nestor; Aliaga, Ramon J.; Mateo, Fernando [Digital Systems Design (DSD) Group, ITACA Institute, Universidad Politecnica de Valencia, Camino de Vera s/n, 46022 Valencia (Spain); Sanchez, Filomeno [Nuclear Medical Physics Group, IFIC Institute, Consejo Superior de Investigaciones Cientificas (CSIC), 46980 Paterna (Spain); Mora, Francisco J. [Digital Systems Design (DSD) Group, ITACA Institute, Universidad Politecnica de Valencia, Camino de Vera s/n, 46022 Valencia (Spain); Benlloch, Jose M. [Nuclear Medical Physics Group, IFIC Institute, Consejo Superior de Investigaciones Cientificas (CSIC), 46980 Paterna (Spain); Sebastia, Angel [Digital Systems Design (DSD) Group, ITACA Institute, Universidad Politecnica de Valencia, Camino de Vera s/n, 46022 Valencia (Spain)

2009-06-01

PET systems need good time resolution to improve the true event rate, random event rejection, and pile-up rejection. In this study we propose a digital procedure for this task using a low pass filter interpolation plus a Digital Constant Fraction Discriminator (DCFD). We analyzed the best way to implement this algorithm on our dual head PET system and how varying the quality of the acquired signal and electronic noise analytically affects timing resolution. Our detector uses two continuous LSO crystals with a position sensitive PMT. Six signals per detector are acquired using an analog electronics front-end and these signals are processed using an in-house digital acquisition board. The test bench developed simulates the electronics and digital algorithms using Matlab. Results show that electronic noise and other undesired effects have a significant effect on the timing resolution of the system. Interpolated DCFD gives better results than non-interpolated DCFD. In high noise environments, differences are reduced. An optimum delay selection, based on the environment noise, improves time resolution.

Report on the current situation and the perspectives for nuclear equipment in France

International Nuclear Information System (INIS)

Vietti, A.; Hubert, G.; Frant, G.

1994-01-01

1993 was the year the 1300 MW series was completed as the twentieth GOLFECH 2 unit came on line. The 1400 MW-N4 series has progressed as planned: the first CHOOZ B unit is due to be connected to the grid in the Winter of 95/96. The fourth unit of the series, CIVAUX 2 was engaged in 1993. As for the FNR system, 1994 should be the year when the CREYS-MALVILLE power plant project, which will play a vital role in gathering industrial experience on this system, is restarted. In spite of the present weak development forecasts, nuclear power has strong prospects over the next fifty years. Therefore, EDF is working on several projects with the object of reinforcing safety and maintaining economic competitiveness, while, at the same time, taking into account the results of the research carried out into different systems and industrial criteria. (authors). 5 figs

French N4 Series Design and Manufacturing

International Nuclear Information System (INIS)

Lebreton, Gerard

1989-01-01

The construction contract for the first two N4 units. on the Chooz site close to the French-Belgian border (Chooz B1 and B2). was awarded by Electricite de France (EDF) to Fumarate in May 1984. At present, project construction is approximately 50% complete for unit B1. The main civil works are practically finished and the reactor vessel and the steam generator were delivered on site by mid-1988. The connection to the grid by 1991 appears quite feasible. Continuation of the French nuclear power programme in the 1990s, specifically on the CIVEX and Penly sites, is based on this model. The N4 thus follows the four-loop, 1,300 MW class series designated P.a. whose first unit is Cattenom 1, which will serve in the following as a reference to appreciate the design evolution of the N4 NSSS. The design evolutions selected to reach these objectives are in technical continuity with the previous series, integrate the vast experience gained within the French programme and abroad, and were supported by a large R and D programme and further by industrial qualification tests

Implications of the Super-K atmospheric, long baseline, and reactor data for the mixing angles θ13 and θ23

Science.gov (United States)

Escamilla-Roa, J.; Latimer, D. C.; Ernst, D. J.

2010-01-01

A three-neutrino analysis of oscillation data is performed using the recent, more finely binned Super-K oscillation data, together with the CHOOZ, K2K, and MINOS data. The solar parameters Δ21 and θ12 are fixed from a recent analysis and Δ32, θ13, and θ23 are varied. We utilize the full three-neutrino oscillation probability and an exact treatment of Earth’s Mikheyev-Smirnov-Wolfenstein (MSW) effect with a castle-wall density. By including terms linear in θ13 and ɛ:=θ23-π/4, we find asymmetric errors for these parameters θ13=-0.07-0.11+0.18 and ɛ=0.03-0.15+0.09. For θ13, we see that the lower bound is primarily set by the CHOOZ experiment while the upper bound is determined by the low energy e-like events in the Super-K atmospheric data. We find that the parameters θ13 and ɛ are correlated—the preferred negative value of θ13 permits the preferred value of θ23 to be in the second octant, and the true value of θ13 affects the allowed region for θ23.

MV-Switchgear Performance Evaluation of Electrical System at RSG-GAS after by Refunctioning

International Nuclear Information System (INIS)

T-Sulsistyo; T-Komarudin; Kiswanto; Y- Andriyanto

2005-01-01

Switchgear represents equipment link functioning to decide or connect source ration especial energy of PLN with building RSG-GAS distribution system burden. This system is provided with equipment circuit breaker (PMT) and disconnecting switch (PMS), which aim to the insulation, controlling, and protection electrical system RSG-GAS and equipment. Evaluation Method used by that is by perceiving nominal tension condition, nominal current, performance normal good switchgear in a condition, treatment and also trouble condition and also calculate change temperature effect of electric fire bow. Pursuant to calculation result, for the mean current 800 A, room; chamber temperature 24 o C, tension 24 kV, current disconnection time link to shorten 3 second, obtained temperature of equal to 90.5 o C (T1), and room temperature 40 o C obtained by temperature of equal to 108.5 o C (T2), so that of average temperature equal to 4.63 o C. While for the mean current 1250 A, room temperature 24 o C, tension 24 kV, current disconnection time link to shorten 3 second, obtained temperature equal to 282 o C (T1), and room temperature 40 o C obtained temperature equal to 298 o C (T2), so that average temperature equal to 4.0 o C. Result of evaluation job indicates that switchgear of electrical system RSG-GAS after re-functioning function goodness. (author)

Characterization of optical properties of the site of the ANTARES neutrino telescope

International Nuclear Information System (INIS)

Yepes-Ramírez, H.

2013-01-01

ANTARES is a neutrino detector based on a three-dimensional grid of photomultipliers tubes (PMT's) arranged in several detection lines anchored to the seabed at depth of 2.5 km in the Mediterranean Sea (40 km off the Toulon coast in France), its main physics goal is the reconstruction and identification of high energy neutrinos of extra-terrestrial origin. The PMT's register the Cherenkov light induced by relativistic charged leptons produced by the interaction of neutrinos with material in the detector surroundings. The propagation of Cherenkov light strongly depends on the optical properties of the sea water, the understanding of which is crucial in order to achieve the expected detector performance. To reach the ANTARES physics goals, good time and positioning calibration systems are required. The ANTARES optical beacon system consists of a set of pulsed light sources strategically located throughout the detector. The system is mainly used for time calibration but can also be used as a tool to study the water optical properties and their stability. In this contribution we will present the current status of our measurements of the group velocity and transmission length of light carried out between 2008 and 2011. A set of water models strategically defined will be discussed as well as some preliminary results concerning track reconstruction parameters

Evaluation of scintillator afterglow for use in a combined optical and PET imaging tomograph

Energy Technology Data Exchange (ETDEWEB)

Douraghy, Ali [Department of Molecular and Medical Pharmacology, Crump Institute for Molecular Imaging, UCLA School of Medicine, A136, 700 Westwood Plaza, Los Angeles, CA 90095-1770 (United States)]. E-mail: adouraghy@mednet.ucla.edu; Prout, David L. [Department of Molecular and Medical Pharmacology, Crump Institute for Molecular Imaging, UCLA School of Medicine, A136, 700 Westwood Plaza, Los Angeles, CA 90095-1770 (United States); Silverman, Robert W. [Department of Molecular and Medical Pharmacology, Crump Institute for Molecular Imaging, UCLA School of Medicine, A136, 700 Westwood Plaza, Los Angeles, CA 90095-1770 (United States); Chatziioannou, Arion F. [Department of Molecular and Medical Pharmacology, Crump Institute for Molecular Imaging, UCLA School of Medicine, A136, 700 Westwood Plaza, Los Angeles, CA 90095-1770 (United States)

2006-12-20

The design of a dual modality imaging system for small animal optical and positron emission tomography imaging (OPET) is underway. Its detector must be capable of imaging high energy {gamma}-rays from PET while also resolving optical wavelength photons from bioluminescence. GSO, high purity GSO, BGO, LSO, LYSO, and LaBr scintillators were investigated for their use in the OPET detector. Of specific interest were scintillators with low afterglow, since afterglow photons in the decay of the larger {gamma}-ray events are indistinguishable from the photons generated by bioluminescence. Samples from these crystals were coupled to a photomultiplier tube (PMT) and produced scintillation light from {gamma}-ray events originating from a positron source. The PMT output was directed to a special signal processing circuit that allowed measurement of single photons at different times in the decay of the scintillation. GSO and BGO exhibited optimal performance for use in the OPET system due to their low afterglow. LSO, LYSO, and LaBr were determined unsuitable for use with the current OPET design due to their significant afterglow components. The effect of the afterglow of GSO on the detection of the bioluminescence signal-to-noise ratio (SNR) was evaluated for the OPET system.

Expanding protection motivation theory: investigating an application to animal owners and emergency responders in bushfire emergencies.

Science.gov (United States)

Westcott, Rachel; Ronan, Kevin; Bambrick, Hilary; Taylor, Melanie

2017-04-26

Protection Motivation Theory (PMT) was developed by Rogers in 1975, to describe how individuals are motivated to react in a self-protective way towards a perceived health threat. Rogers expected the use of PMT to diversify over time, which has proved true over four decades. The purpose of this paper is to explore how PMT can be used and expanded to inform and improve public safety strategies in natural hazards. As global climate change impacts on the Australian environment, natural hazards seem to be increasing in scale and frequency, and Emergency Services' public education campaigns have necessarily escalated to keep pace with perceived public threat. Of concern, is that the awareness-preparedness gap in residents' survival plans is narrowing disproportionately slowly compared to the magnitude of resources applied to rectify this trend. Practical applications of adaptable social theory could be used to help resolve this dilemma. PMT has been used to describe human behaviour in individuals, families, and the parent-child unit. It has been applied to floods in Europe and wildfire and earthquake in the United States. This paper seeks to determine if an application of PMT can be useful for achieving other-directed human protection across a novel demographic spectrum in natural hazards, specifically, animal owners and emergency responders in bushfire emergencies. These groups could benefit from such an approach: owners to build and fortify their response- and self-efficacy, and to help translate knowledge into safer behaviour, and responders to gain a better understanding of a diverse demographic with animal ownership as its common denominator, and with whom they will be likely to engage in contemporary natural hazard management. Mutual collaboration between these groups could lead to a synergy of reciprocated response efficacy, and safer, less traumatic outcomes. Emergency services' community education programs have made significant progress over the last decade, but

Lifetime of MCP-PMTs and other performance features

Science.gov (United States)

Lehmann, A.; Böhm, M.; Eyrich, W.; Miehling, D.; Pfaffinger, M.; Stelter, S.; Uhlig, F.; Ali, A.; Belias, A.; Dzhygadlo, R.; Gerhardt, A.; Götzen, K.; Kalicy, G.; Krebs, M.; Lehmann, D.; Nerling, F.; Patsyuk, M.; Peters, K.; Schepers, G.; Schmitt, L.; Schwarz, C.; Schwiening, J.; Traxler, M.; Düren, M.; Etzelmüller, E.; Föhl, K.; Hayrapetyan, A.; Kreutzfeld, K.; Merle, O.; Rieke, J.; Schmidt, M.; Wasem, T.; Achenbach, P.; Cardinali, M.; Hoek, M.; Lauth, W.; Schlimme, S.; Sfienti, C.; Thiel, M.

2018-02-01

The bar PANDA experiment at FAIR will use DIRC detectors for the separation of hadrons. The compactness of the bar PANDA detector requires the image planes of these detectors to be placed inside the magnetic field of the solenoid. Due to this and other boundary conditions MCP-PMTs were identified as the only suitable photon sensors. Until recently the major obstacle for an application of MCP-PMTs in high rate experiments like bar PANDA were serious aging problems which led to damage at the photo-cathode and a fast declining quantum efficiency as the integrated anode charge (IAC) increased. With new countermeasures against the aging, in particular due to the application of an atomic layer deposition (ALD) technique to coat the MCP pores, the lifetime of MCP-PMTs has meanwhile increased by a factor >50 which is fully sufficient for bar PANDA. The recent results of our long-term lifetime measurements are discussed. New 2-inch MCP-PMT prototypes from Hamamatsu show an encouraging behavior. However, the currently best performing MCP-PMT is a 2-inch PHOTONIS tube with two ALD-layers which reaches an IAC of >16 C/cm2 without any visible sign of aging. In the second part of these proceedings a new data acquisition system of the PADIWA/TRB type is presented which allows a quasi-parallel measurement of many MCP-PMT performance parameters. Especially unwanted effects like dark-count rate, crosstalk, ion after-pulsing, and recoil electrons can be studied in more detail than ever before. Exemplary results for these parameters are shown. The discussed DAQ system will be used for the comprehensive data quality checks of the MCP-PMTs being built into the DIRCs.

Determinants of Preventive Intentions for Endocrine Disrupters : An Application of the Protection Motivation Theory

OpenAIRE

Tozuka, Tadashi; Hayakawa, Masanori; Fukada, Hiromi

2001-01-01

Protection motivation theory (PMT) suggested by Rogers (1983) is one of the theories concerning threat appeal. The purpose of this study was to explore the determinants of preventive intentions for endocrine disrupters (estrogen mimics), by using the PMT framework. Independent variables were (1) threat (high or low), (2) response efficacy (high or low), (3) response cost (high or low), and (4) gender (men or women). Four hundred university students (200 men and 200 women) were assigned to one...

Field tests of the mobile robot Sherpa

Energy Technology Data Exchange (ETDEWEB)

Beaucourt, P. de; Garrec, P.; Morganti, P. [CEA Centre d`Etudes de Saclay, 91 - Gif-sur-Yvette (France). Dept. des Procedes et Systemes Avances; Trouville, B. [Electricite de France (EDF), 78 - Chatou (France); Lucibello, P.; Nobile, M. [ENEA, Rome (Italy). Direzione Studi

1995-12-31

This paper summarizes recent demonstrations of the transport capabilities, inside nuclear buildings, of the six egged robot SHERPA, developed by the CEA (Atomic Energy Commission) robotic team. Results of the tests carried out at Chooz-B and Trino Vercellesse Nuclear Power Plants, respectively in June 1993 and in January 1994, in the framework of the European Community TELEMAN Programme, are presented. (authors). 10 refs., 13 figs.

Field tests of the mobile robot Sherpa

International Nuclear Information System (INIS)

Beaucourt, P. de; Garrec, P.; Morganti, P.; Lucibello, P.; Nobile, M.

1995-01-01

This paper summarizes recent demonstrations of the transport capabilities, inside nuclear buildings, of the six egged robot SHERPA, developed by the CEA (Atomic Energy Commission) robotic team. Results of the tests carried out at Chooz-B and Trino Vercellesse Nuclear Power Plants, respectively in June 1993 and in January 1994, in the framework of the European Community TELEMAN Programme, are presented. (authors). 10 refs., 13 figs

Reducing skin cancer risk: an intervention based on protection motivation theory.

Science.gov (United States)

McClendon, B T; Prentice-Dunn, S

2001-05-01

Caucasian college students who intentionally tanned participated in a brief skin cancer intervention based on protection motivation theory (PMT). This intervention targeted skin appearance and consisted of brief lectures, a comprehensive essay, video clips about a young man who died of melanoma, and short discussions. Compared to a waitlist control group, the intervention group showed increases on PMT variables and intentions at post-test. The waitlist group later received the intervention and showed similar increases. Additionally, all but one PMT variable maintained post-test levels at a one-month follow-up. Photographs taken at post-test and at the one-month follow-up were judged by raters blind to the hypothesis. Seventy-two percent of participants were judged to have lighter skin whereas only 16 percent had darker skin. These results provide additional support for theory-based methods for changing maladaptive attitudes and behaviors associated with skin cancer risk.

Protection motivation theory and adolescent drug trafficking: relationship between health motivation and longitudinal risk involvement.

Science.gov (United States)

Wu, Ying; Stanton, Bonita F; Li, Xiaoming; Galbraith, Jennifer; Cole, Matthew L

2005-03-01

To assess health protection motivation as explained by the constructs of protection motivation theory (PMT) and its association with drug trafficking over 2 years. The sample included 817 African American youth (13-16 years old) participating in an adolescent risk-reduction program. We developed an instrument measuring the level of health protection motivation (LHPM) using factor analysis. Changes in LHPM over time were examined among drug traffickers, abstainers, initiators, and nonrisk youths. In sum, 151 participants reported selling and/or delivering drugs during the study period. The significant inverse correlation between drug-trafficking intention and health protection motivation was consistent with PMT. Changes in LHPM were strongly associated with the dynamics of behavior over 2 years. Adolescent drug trafficking can be predicted by an overall level of health protection motivation. PMT and related theories should be considered in the design of drug-trafficking prevention intervention.

A superconducting supercollider calorimeter photomultiplier tube preamplifier circuit

Energy Technology Data Exchange (ETDEWEB)

Panescu, D; Lackey, J; Robl, P; Smith, W H [Wisconsin Univ., Madison, WI (United States). Physics Dept.

1992-07-15

This study presents the design of the front end amplifier for a scintillator calorimeter with photomultiplier tube (PMT) readout. The design is based on analytical computations and SPICE simulations, and is checked against tests performed on a prototyped circuit. We were looking to achieve (1) a very low droop within the 4 ns after the integration of the photomultiplier tube (PMT) signal was completed, (2) a very low noise figure for the whole amplifier in a 100 MHz bandwidth, (3) an input impedance optimized for the PMT which is actually used, (4) baseline restoration as quick as possible at the output of the clip amps, (5) no loss of information due to the saturation at intermediary stages (e.g. integrator), and (6) an output driving 100 {Omega} twisted pair cables, or 50 {Omega} coaxial cables, in order to transmit the signal to switched capacitor arrays for analog storage. (orig.).

Identification of Pectin Degrading Enzymes Secreted by Xanthomonas oryzae pv. oryzae and Determination of Their Role in Virulence on Rice.

Directory of Open Access Journals (Sweden)

Lavanya Tayi

Full Text Available Xanthomonas oryzae pv.oryzae (Xoo causes the serious bacterial blight disease of rice. Xoo secretes a repertoire of plant cell wall degrading enzymes (CWDEs like cellulases, xylanases, esterases etc., which act on various components of the rice cell wall. The major cellulases and xylanases secreted by Xoo have been identified and their role in virulence has been determined. In this study, we have identified some of the pectin degrading enzymes of Xoo and assessed their role in virulence. Bioinformatics analysis indicated the presence of four pectin homogalacturonan (HG degrading genes in the genome of Xoo. The four HG degrading genes include one polygalacturonase (pglA, one pectin methyl esterase (pmt and two pectate lyases (pel and pelL. There was no difference in the expression of pglA, pmt and pel genes by laboratory wild type Xoo strain (BXO43 grown in either nutrient rich PS medium or in plant mimic XOM2 medium whereas the expression of pelL gene was induced in XOM2 medium as indicated by qRT-PCR experiments. Gene disruption mutations were generated in each of these four genes. The polygalacturonase mutant pglA- was completely deficient in degrading the substrate Na-polygalacturonicacid (PGA. Strains carrying mutations in the pmt, pel and pelL genes were as efficient as wild type Xoo (BXO43 in cleaving PGA. These observations clearly indicate that PglA is the major pectin degrading enzyme produced by Xoo. The pectin methyl esterase, Pmt, is the pectin de-esterifying enzyme secreted by Xoo as evident from the enzymatic activity assay performed using pectin as the substrate. Mutations in the pglA, pmt, pel and pelL genes have minimal effects on virulence. This suggests that, as compared to cellulases and xylanases, the HG degrading enzymes may not have a major role in the pathogenicity of Xoo.

Prevalence and predictors of complementary and alternative medicine use among people with coronary heart disease or at risk for this in the sixth Tromsø study: a comparative analysis using protection motivation theory.

Science.gov (United States)

Kristoffersen, Agnete E; Sirois, Fuschia M; Stub, Trine; Hansen, Anne Helen

2017-06-19

Engagement in healthy lifestyle behaviors, such as healthy diet and regular physical activity, are known to reduce the risk of developing coronary heart disease (CHD). Complementary and alternative medicine (CAM) is known to be associated with having a healthy lifestyle. The primary aim of this study was to examine the prevalence and predictors of CAM use in CHD patients, and in those without CHD but at risk for developing CHD, using Protection Motivation Theory (PMT) as a guiding conceptual framework. Questionnaire data were collected from 12,981 adult participants in the cross-sectional sixth Tromsø Study (2007-8). Eligible for analyses were 11,103 participants who reported whether they had used CAM or not. Of those, 830 participants reported to have or have had CHD (CHD group), 4830 reported to have parents, children or siblings with CHD (no CHD but family risk), while 5443 reported no CHD nor family risk of CHD. We first compared the patterns of CAM use in each group, and then examined the PMT predictors of CAM use. Health vulnerability from the threat appraisal process of PMT was assessed by self-rated health and expectations for future health. Response efficacy from the coping appraisal process of PMT was assessed as preventive health beliefs and health behavior frequency. Use of CAM was most commonly seen in people with no CHD themselves, but family risk of developing CHD (35.8%), compared to people already diagnosed with CHD (30.2%) and people with no CHD nor family risk (32.1%). All four of the PMT factors; self-rated health, expectations for future health, preventive health beliefs, and the health behavior index - were predictors for CAM use in the no CHD but family risk group. These findings suggest that people use CAM in response to a perceived risk of developing CHD, and to prevent disease and to maintain health.

Identification of Pectin Degrading Enzymes Secreted by Xanthomonas oryzae pv. oryzae and Determination of Their Role in Virulence on Rice.

Science.gov (United States)

Tayi, Lavanya; Maku, Roshan V; Patel, Hitendra Kumar; Sonti, Ramesh V

2016-01-01

Xanthomonas oryzae pv.oryzae (Xoo) causes the serious bacterial blight disease of rice. Xoo secretes a repertoire of plant cell wall degrading enzymes (CWDEs) like cellulases, xylanases, esterases etc., which act on various components of the rice cell wall. The major cellulases and xylanases secreted by Xoo have been identified and their role in virulence has been determined. In this study, we have identified some of the pectin degrading enzymes of Xoo and assessed their role in virulence. Bioinformatics analysis indicated the presence of four pectin homogalacturonan (HG) degrading genes in the genome of Xoo. The four HG degrading genes include one polygalacturonase (pglA), one pectin methyl esterase (pmt) and two pectate lyases (pel and pelL). There was no difference in the expression of pglA, pmt and pel genes by laboratory wild type Xoo strain (BXO43) grown in either nutrient rich PS medium or in plant mimic XOM2 medium whereas the expression of pelL gene was induced in XOM2 medium as indicated by qRT-PCR experiments. Gene disruption mutations were generated in each of these four genes. The polygalacturonase mutant pglA- was completely deficient in degrading the substrate Na-polygalacturonicacid (PGA). Strains carrying mutations in the pmt, pel and pelL genes were as efficient as wild type Xoo (BXO43) in cleaving PGA. These observations clearly indicate that PglA is the major pectin degrading enzyme produced by Xoo. The pectin methyl esterase, Pmt, is the pectin de-esterifying enzyme secreted by Xoo as evident from the enzymatic activity assay performed using pectin as the substrate. Mutations in the pglA, pmt, pel and pelL genes have minimal effects on virulence. This suggests that, as compared to cellulases and xylanases, the HG degrading enzymes may not have a major role in the pathogenicity of Xoo.

Effect of an Educational Intervention Based on Protection Motivation Theory on Preventing Cervical Cancer among

Science.gov (United States)

Malmir, Shabnam; Barati, Majid; Khani Jeihooni, Ali; Bashirian, Saeed; Hazavehei, Seyed Mohammad Mehdi

2018-03-27

Objective: This study aimed to determine the effectiveness of an educational intervention to prevent cervical cancer among marginalized Iranianwomen based on the Protection Motivation Theory (PMT) as a theoretical framework. Methods: This quasi-experimental study was carried out on 143 women of Kermanshah City in western Iran during 2017. Participants were recruited through cluster and simple random sampling and randomly divided into experimental (n=72) and control groups (n=71). All completed a self-administered questionnaire including PMT constructs and demographic variables. An intervention over six sessions was then applied to the experimental group. Reassessment was conducted three months after the intervention, with data was analyzed with SPSS-16 using chi-square, McNemar, paired T- and independent T-tests. Results: The mean scores for the constructs of PMT, and cervical cancer screening behavior showed no significant differences between the two groups before the intervention (P>0.05). The educational manipulation had significant effects on the experimental groups’ average response for perceived vulnerability, perceived severity, perceived reward, self-efficacy, response efficacy, response cost and protection motivation (all p health centers were significantly increased after 3 months in the experimental (P=0.048), but notthe control group (P>0.05). Conclusions: The results show that applying an educational intervention based on PMT might help prevent cervical cancer and improve regular Pap smear testing. Creative Commons Attribution License

High spatial resolution gamma imaging detector based on a 5 inch diameter R3292 Hamamatsu PSPMT

International Nuclear Information System (INIS)

Wojcik, R.; Majewski, S.; Kross, B.; Weisenberger, A.G.; Steinbach, D.

1998-01-01

High resolution imaging gamma-ray detectors were developed using Hamamatsu's 5 inch diameter R3292 position sensitive PMT (PSPMT) and a variety of crystal scintillator arrays. Special readout techniques were used to maximize the active imaging area while reducing the number of readout channels. Spatial resolutions approaching 1 mm were obtained in a broad energy range from 20 to 511 keV. Results are also presented of coupling the scintillator arrays to the PMT via imaging light guides consisting of acrylic optical fibers

Recent measurements on the Hamamatsu 13 in., R8055, PhotoMultiplier Tubes

International Nuclear Information System (INIS)

Tsagli, S.; Aggouras, G.; Anassontzis, E.G.; Ball, A.E.; Chinowsky, W.; Fahrun, E.; Grammatikakis, G.; Green, C.; Grieder, P.; Katrivanos, P.; Koske, P.; Ludvig, J.; Markopoulos, E.; Minkowsky, P.; Nygren, D.; Papageorgiou, K.; Przybylski, G.; Resvanis, L.K.; Siotis, I.; Sopher, J.; Staveris, T.; Tsagli, V.; Zhukov, V.A.

2006-01-01

The key component of NESTOR, the deep-sea Cherenkov neutrino telescope, built in the Mediterranean, NW of Greece, is the optical module. The NESTOR Optical Module employs a PhotoMultiplier Tube (PMT) in a transparent glass pressure housing. The Hamamatsu PMT R8055-01, 13 in. photomultiplier was selected for NESTOR to replace the old 15'' Hamamatsu PMTs (R2018-03). Extensive tests have been made on the sensitivity, uniformity, time resolution and noise rates of 162 R8055-01 13 in. PMTs

A LSO scintillator array for a PET detector module with depth of interaction measurement

International Nuclear Information System (INIS)

Huber, J.S.; Moses, W.W.; Andreaco, M.S.; Petterson, O.

2000-01-01

We present construction methods and performance results for a production scintillator array of 64 optically isolated, 3 mm x 3 mm x 30 mm sized LSO crystals. This scintillator array has been developed for a PET detector module consisting of the 8x8 LSO array coupled on one end to a single photomultiplier tube (PMT) and on the opposite end to a 64 pixel array of silicon photodiodes (PD). The PMT provides an accurate timing pulse and initial energy discrimination, the PD identifies the crystal of interaction, the sum provides a total energy signal, and the PD/(PD+PMT) ratio determines the depth of interaction (DOI). Unlike the previous LSO array prototypes, we now glue Lumirror reflector material directly onto 4 sides of each crystal to obtain an easily manufactured, mechanically rugged array with our desired depth dependence. With 511 keV excitation, we obtain a total energy signal of 3600 electrons, pulse-height resolution of 25% fwhm, and 6-15 mm fwhm DOI resolution

Laser Calibration of the ATLAS Tile Calorimeter

CERN Document Server

Di Gregorio, Giulia; The ATLAS collaboration

2017-01-01

High performance stability of the ATLAS Tile Calorimeter is achieved with a set of calibration procedures. One step of the calibration procedure is based on measurements of the response stability to laser excitation of the PMTs that are used to readout the calorimeter cells. A facility to study in lab the PMT stability response is operating in the PISA-INFN laboratories since 2015. Goals of the tests in lab are to study the time evolution of the PMT response to reproduce and to understand the origin of the response drifts seen with the PMT mounted on the Tile calorimeter in its normal operating during LHC run I and run II. A new statistical approach was developed to measure drift of the absolute gain. This approach was applied to both the ATLAS laser calibration data and to data collected in the Pisa local laboratory. The preliminary results from these two studies are shown.

Laser calibration of the ATLAS Tile Calorimeter

CERN Document Server

Di Gregorio, Giulia; The ATLAS collaboration

2017-01-01

High performance stability of the ATLAS Tile calorimeter is achieved with a set of calibration procedures. One step of the calibrtion procedure is based on measurements of the response stability to laser excitation of the photomultipliers (PMTs) that are used to readout the calorimeter cells. A facility to study in lab the PMT stability response is operating in the PISA-INFN laboratories since 2015. Goals of the test in lab are to study the time evolution of the PMT response to reproduce and to understand the origin of the resonse drifts seen with the PMT mounted on the Tile calorimeter in its normal operation during LHC run I and run II. A new statistical approach was developed to measure the drift of the absolute gain. This approach was applied to both the ATLAS laser calibration data and to the data collected in the Pisa local laboratory. The preliminary results from these two studies are shown.

CBM RICH geometry optimization

Energy Technology Data Exchange (ETDEWEB)

Mahmoud, Tariq; Hoehne, Claudia [II. Physikalisches Institut, Giessen Univ. (Germany); Collaboration: CBM-Collaboration

2016-07-01

The Compressed Baryonic Matter (CBM) experiment at the future FAIR complex will investigate the phase diagram of strongly interacting matter at high baryon density and moderate temperatures in A+A collisions from 2-11 AGeV (SIS100) beam energy. The main electron identification detector in the CBM experiment will be a RICH detector with a CO{sub 2} gaseous-radiator, focusing spherical glass mirrors, and MAPMT photo-detectors being placed on a PMT-plane. The RICH detector is located directly behind the CBM dipole magnet. As the final magnet geometry is now available, some changes in the RICH geometry become necessary. In order to guarantee a magnetic field of 1 mT at maximum in the PMT plane for effective operation of the MAPMTs, two measures have to be taken: The PMT plane is moved outwards of the stray field by tilting the mirrors by 10 degrees and shielding boxes have been designed. In this contribution the results of the geometry optimization procedure are presented.

Neutrinos oscillations researches near a nuclear reactor

International Nuclear Information System (INIS)

Laiman, M.

1999-01-01

This thesis deals with the research of neutrinos oscillations near the Chooz B nuclear power plant in the Ardennes. The first part presents the framework of the researches and the chosen detector. The second part details the antineutrinos flux calculus from the reactors and the calculus of the expected events. The analysis procedure is detailed in the last part from the calibration to the events selection. (A.L.B.)

New trends in shielding designs for PWRs in France

International Nuclear Information System (INIS)

Champion, G.; Forestier, J.; Arbelot, E.

1985-01-01

Various engineering solutions to confinement of the stray neutron fields will be incorporated into the design of the 1450 MWe Chooz B-1 (Ardennes B-1) PWR, the first unit of the new N4 program in France. The reactor is in the early stages of construction. These engineering solutions are the results of many shielding configuration studies performed prior to actual design. The solutions and the calculation methodologies are discussed

EDF's dismantling experience

International Nuclear Information System (INIS)

Mira, J.J.

1993-01-01

The dismantling policy at EDF, taking into account technical, economical and socio-political factors, is presented. The various current realizations are reviewed and their dismantling solution discussed: Chinon A2, Chinon A1, Marcoule G1, G2, G3, Brennilis (EL4). Several dismantling projects are also described (Chinon A3, St-Laurent A1-A2, Chooz A). The various dismantling operations are presented and scheduled

Measurement of Photomultipier Plateau Curves and Single MIP response in the AD detector at ALICE

CERN Document Server

Sanchez Falero, Sebastian De Jesus

2015-01-01

The Alice Diffractive (AD) detector is a forward detector in the ALICE experiment at CERN. It is aimed to the triggering on diffractive events and extends the pseudorapidity coverage to about 4.9 < /n/ < 6.3. In this work, a PMT's efficiency plateau and single MIP response are measured using a replica of the detector's scintillator modules, electronic and data acquisition system and cosmic rays as particle source.

Implementation of ALARA at the design stage of Nuclear Power Plants

Energy Technology Data Exchange (ETDEWEB)

Brissaud, A.; Ridoux, P. [Electricite de France, Villeurbanne (France)

1995-03-01

In the 1970s, Electricite de France (EdF) had limited knowledge and experience of pressurized water reactors (PWRs). Electricity generation by nuclear units was oriented towards gas-graphite reactors, even though EdF had a share in the PWR unit of CHOOZ A-1 (250 MWe, later upgraded to 320 MWe). Some facts about the origin of doses in that king of reactor were known to the research and development (R&D) support staff of EdF, which mainly comprises the French Atomic Commission (CEA), but only a few of EdF`s engineers were aware of these facts. One has to bear in mind that CHOOZ A-1 only went critical in April 1967 and was officially connected to the grid in May 1970 after some important problems had been solved. Meanwhile, the nuclear program was launched at full speed, beginning with the order for FESSENHEIM 1 in 1970, FESSENHEIM 2 and BUGEY 2 and 3 in 1971. TIHANGE 1, in which EdF had a share, went on-line in September 1975. Also, supposing that EdF had had such knowledge and experience, it is quite evident that it would have been very difficult to modify the lay-out inside the reactor building.

Granzyme A Produces Bioactive IL-1β through a Nonapoptotic Inflammasome-Independent Pathway

Directory of Open Access Journals (Sweden)

Dagmar Hildebrand

2014-11-01

Full Text Available Bacterial components are recognized by the immune system through activation of the inflammasome, eventually causing processing of the proinflammatory cytokine interleukin-1β (IL-1β, a pleiotropic cytokine and one of the most important mediators of inflammation, through the protease caspase-1. Synthesis of the precursor protein and processing into its bioactive form are tightly regulated, given that disturbed control of IL-1β release can cause severe autoinflammatory diseases or contribute to cancer development. We show that the bacterial Pasteurella multocida toxin (PMT triggers Il1b gene transcription in macrophages independently of Toll-like receptor signaling through RhoA/Rho-kinase-mediated NF-κΒ activation. Furthermore, PMT mediates signal transducer and activator of transcription (STAT protein-controlled granzyme A (a serine protease expression in macrophages. The exocytosed granzyme A enters target cells and mediates IL-1β maturation independently of caspase-1 and without inducing cytotoxicity. These findings show that macrophages can induce an IL-1β-initiated immune response independently of inflammasome activity.

Muon Lifetime Measurement and Introduction to the use of FPGAs in Experimental Physics

International Nuclear Information System (INIS)

Villasenor, L.

2008-01-01

During the laboratory sessions at the Workshop, the students used a simple experimental setup to measure the muon lifetime with a 10% statistical error. The muon detector consisted of a sealed container, filled with liquid scintillator, coupled to a 2.5'' photomultiplier (PMT). A personal computer (PC) was used to control a digital oscilloscope which directly measured the time interval between two consecutive PMT pulses in a time window of 20 μs. The students were also introduced to the use of root to analyze the muon data and to measure the muon lifetime. They were also presented with a basic introduction to the application of field-programmable gate arrays (FPGAs) in data acquisition (DAQ) systems by means of examples. We started with a brief introduction to the VHDL language and the software package used to program FPGAs and PROMs on a commercial FPGA development board. They learned to program FPGAs for handling data transfers using the RS-232 port of a PC. They were also introduced to the concepts of circular RAMs (Random Access Memory) and FIFO (First-In First-Out) memories in the context of fast and efficient DAQ systems. We emphasized the way in which inexpensive FPGA-based electronics replaces the use of traditionally used electronics modules, such as NIM, CAMAC, FASTBUS, VME, etc., to construct fast and powerful DAQ systems

The ionoluminescence apparatus at the LABEC external microbeam facility

International Nuclear Information System (INIS)

Calusi, S.; Colombo, E.; Giuntini, L.; Giudice, A. Lo; Manfredotti, C.; Massi, M.; Pratesi, G.; Vittone, E.

2008-01-01

In this paper, we describe the main features of the ionoluminescence (IL) apparatus recently installed at the external scanning microbeam facility of the 3 MV Tandetron accelerator of the INFN LABEC Laboratory in Firenze. The peculiarity of this IL set-up resides in the fact that the light produced by the ion irradiation of the specimen is collected by a bifurcated optical fiber, so that photons are shunted both to a CCD spectrometer, working in the 200-900 nm wavelength range, and to a photomultiplier (PMT). The accurate focusing of the optical system allows high photon collection efficiency and this results in rapid acquisition of luminescence spectra with low ion currents on luminescent materials; simultaneously, luminescence maps with a spatial resolution of 10 μm can be acquired through the synchronization of PMT photon detection with the position of the scanning focused ion beam. An optical filter with a narrow passband facing the photomultiplier allows chromatic selectivity of the luminescence centres. The IL apparatus is synergistically integrated into the existing set-up for ion beam analyses (IBA). The upgraded system permits simultaneous IL and PIXE/PIGE/BS measurements. With our integrated system, we have been studying raw lapis lazuli samples of different known origins and precious lapis lazuli artworks of the Collezione Medicea of Museum of Natural History, University of Firenze, aiming at characterising their composition and provenance

The ionoluminescence apparatus at the LABEC external microbeam facility

Energy Technology Data Exchange (ETDEWEB)

Calusi, S.; Colombo, E. [INFN Sezione di Torino, Via P.Giuria 1, 10125 Torino (Italy); Dipartimento di Fisica Sperimentale and NIS Excellence Centre, Universita di Torino, Via P. Giuria 1, 10125 Torino (Italy); Giuntini, L. [Dipartimento di Fisica, Universita and INFN Sezione di Firenze, Via Sansone 1, 50019, Sesto Fiorentino, Firenze (Italy)], E-mail: giuntini@fi.infn.it; Giudice, A. Lo [Dipartimento di Fisica Sperimentale and NIS Excellence Centre, Universita di Torino, Via P. Giuria 1, 10125 Torino (Italy); Manfredotti, C. [INFN Sezione di Torino, Via P.Giuria 1, 10125 Torino (Italy); Dipartimento di Fisica Sperimentale and NIS Excellence Centre, Universita di Torino, Via P. Giuria 1, 10125 Torino (Italy); Massi, M. [Dipartimento di Fisica, Universita and INFN Sezione di Firenze, Via Sansone 1, 50019, Sesto Fiorentino, Firenze (Italy); Pratesi, G. [Dipartimento di Scienze della Terra and Museo di Storia Naturale, Universita di Firenze, Via G. La Pira 4, 50121 Firenze (Italy); Vittone, E. [INFN Sezione di Torino, Via P.Giuria 1, 10125 Torino (Italy); Dipartimento di Fisica Sperimentale and NIS Excellence Centre, Universita di Torino, Via P. Giuria 1, 10125 Torino (Italy)

2008-05-15

In this paper, we describe the main features of the ionoluminescence (IL) apparatus recently installed at the external scanning microbeam facility of the 3 MV Tandetron accelerator of the INFN LABEC Laboratory in Firenze. The peculiarity of this IL set-up resides in the fact that the light produced by the ion irradiation of the specimen is collected by a bifurcated optical fiber, so that photons are shunted both to a CCD spectrometer, working in the 200-900 nm wavelength range, and to a photomultiplier (PMT). The accurate focusing of the optical system allows high photon collection efficiency and this results in rapid acquisition of luminescence spectra with low ion currents on luminescent materials; simultaneously, luminescence maps with a spatial resolution of 10 {mu}m can be acquired through the synchronization of PMT photon detection with the position of the scanning focused ion beam. An optical filter with a narrow passband facing the photomultiplier allows chromatic selectivity of the luminescence centres. The IL apparatus is synergistically integrated into the existing set-up for ion beam analyses (IBA). The upgraded system permits simultaneous IL and PIXE/PIGE/BS measurements. With our integrated system, we have been studying raw lapis lazuli samples of different known origins and precious lapis lazuli artworks of the Collezione Medicea of Museum of Natural History, University of Firenze, aiming at characterising their composition and provenance.

Characterization of the Hamamatsu R11265-103-M64 multi-anode photomultiplier tube for the LHCb RICH Upgrade

CERN Document Server

Matteuzzi, C; Carniti, P; Cassina, L; Giachero, A; Gotti, C; Khanji, B; Maino, M; Pessina, G

2014-01-01

The Hamamatsu R11265-103-M64 MaPMT is the baseline photon sensor to be used for the LHCb RICH Upgrade detector. This choice has been supported by a large number of tests of this device. This note summarizes the measurements performed by the INFN Milano Bicocca group to characterize the photon detector. A description is provided of the unpublished outcomes and particularly of the more recent developments about the aging of the R11265-103-M64 MaPMT and the test of a whole photon detector RICH Elementary Cell.

Scintillating optical fibers for fine-grained hodoscopes

International Nuclear Information System (INIS)

Borenstein, S.R.; Strand, R.C.

1981-01-01

Fast detectors with fine spatial resolution will be needed to exploit high event rates at ISABELLE. Scintillating optical fibers for fine grained hodoscopes have been developed by the authors. A commercial manufacturer of optical fibers has drawn and clad PVT scintillator. Detection efficiencies greater than 99% have been achieved for a 1 mm fiber with a PMT over lengths up to 60 cm. Small diameter PMT's and avalanche photodiodes have been tested with the fibers. Further improvements are sought for the fiber and for the APD's sensitivity and coupling efficiency with the fiber

Robustness studies of the photomultipliers reading out TileCal, the central hadron calorimeter of the ATLAS experiment

CERN Document Server

Di Gregorio, Giulia; The ATLAS collaboration

2018-01-01

TileCal, the hadron calorimeter of the ATLAS experiment in LHC, is a 10000 channel detector readout by photomultipliers (PMTs). A challenging goal is to understand whether the full sample of PMTs installed at the beginning of the ATLAS detector operation can be used until completion of the High-Luminosity Large Hadron Collider (HL-LHC) program or not. For this reason, a reliable study of the PMT robustness against ageing is required. Detailed studies modelling the PMT response variation as a function of the integrated anode charge were done.

Protein (Cyanobacteria): 78779802 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available 1196 ... hypothetical protein PMT9312_1418 Prochlorococcus marinus str. MIT 9312 MKFLTTLFLKLLLLSNFVIAETIPTKSNILKQSSECIKDSQNQICRELVSKLEKLQYVVFDQNRFKCQSSLLGLQSELIEAYFLKSLSKKRISFMIPYVIKNC

The factors affecting cervical cancer screening among addicted women of Hamedan in 2015: On the basis of Protection Motivation Theory model

Directory of Open Access Journals (Sweden)

2017-01-01

Full Text Available Background and Objectives:  Cervical cancer is one of the most common types of genital cancer among women in developing countries. Addicted women are among the high-risk group of patients who suffer from cervical cancer. Health Protection Motivation Theory (PMT is one of the theories that emphasizes on fear effects of health risks (such as diseases on attitudes and health behaviors. Thus, this study was performed to determine the factors associated with cervical cancer screening behavior using PMT on addicted women referring to addiction treatment center of Hamedan in 2015. Methods: The current study was conducted on 56 addicted women referring to Hannah's Methadone Therapy Counseling Center in June 2015. A researcher-made questionnaire which comprised of three sections (demographics, knowledge and assessment of the PMT constructs was used to collect data. The validity of questionnaire was evaluated using content validity method and test-retest test was used to measure reliability. Data were analyzed statistically by SPSS version 16 and using T-test, Chi-Square and ANOVA tests. Results: The mean age of all participants was 46.48±10.82 years. The average duration of addiction was 8.11±7.22 years. Of all samples, 53.6% had never done any Pap smear test. There was not a  significant relevance between test performance (screening method and the marital status, income or the last pregnancy method. However, there was a significant relationship between test performance and education (P=0.041, awareness level (P<0.001, structures of motivation (P<0.001, perceived costs (P=0.031, perceived rewards (P=0.001, self-efficacy (P<0.001 and efficient response (P<0.001. Conclusion: We showed that there was a significant relevance between test performance and the level of awareness and various domains of PMT. Thus, it is recommended that PMT could be used during educational interventions and counseling procedures.

Investigation of the Role of Training Health Volunteers in Promoting Pap Smear Test Use among Iranian Women Based on the Protection Motivation Theory.

Science.gov (United States)

Ghahremani, Leila; Harami, Zahra Khiyali; Kaveh, Mohammad Hossein; Keshavarzi, Sareh

2016-01-01

Cervical cancer is known as one of the most prevalent types of cancers and a major public health problem in developing countries which can be detected by Pap test, prevented, and treated. Despite the effective role of Pap test in decreasing the incidence and mortality due to cervical cancer, it is still one the most common causes of cancer-related deaths among women, especially in developing countries. Thus, this study aimed to examine the effect of educational interventions implemented by health volunteers based on protection motivation theory (PMT) on promoting Pap test use among women. This quasi-experimental study was conducted on 60 health volunteers and 420 women. The study participants were divided into an intervention and a control group. Data were collected using a valid self-reported questionnaire including demographic variables and PMT constructs which was completed by both groups before and 2 months after the intervention. Then, the data were entered into the SPSS statistical software, version 19 and were analyzed using Chi-square test, independent T-test, and descriptive statistical methods. P<0.05 was considered as statistically significant. The findings of this study showed that the mean scores of PMT constructs (i.e. perceived vulnerability, perceived severity, fear, response-costs, self-efficacy, and intention) increased in the intervention group after the intervention (P<0.001). However, no significant difference was found between the two groups regarding response efficacy after the intervention (P=0.06). The rate of Pap test use also increased by about 62.9% among the study women. This study showed a significant positive relationship between PMT-based training and Pap test use. The results also revealed the successful contribution of health volunteers to training cervical cancer screening. Thus, training interventions based on PMT are suggested to be designed and implemented and health volunteers are recommended to be employed for educational

Nuclear energy. The innovations of the N4 reactor

International Nuclear Information System (INIS)

Anon.

1998-01-01

The coupling to the electric network of the two first units of N4 type reactors, on the site of Chooz in the Ardennes, marks the third great step of the French nuclear programme of PWR type reactors, after the realization of 34 units of 900 MWe and 20 units of 1300 M We. The nuclear boiler N4, realizes a new evolution in power, in performances and in reliability. (N.C.)

The Monitoring and Calibration Web Systems for the ATLAS Tile Calorimeter Data Quality Analysis

International Nuclear Information System (INIS)

Sivolella, A; Maidantchik, C; Ferreira, F

2012-01-01

The Tile Calorimeter (TileCal) is one of the ATLAS sub-detectors. The read-out is performed by about 10,000 PhotoMultiplier Tubes (PMTs). The signal of each PMT is digitized by an electronic channel. The Monitoring and Calibration Web System (MCWS) supports the data quality analysis of the electronic channels. This application was developed to assess the detector status and verify its performance. It can provide to the user the list of TileCal known problematic channels, that is stored in the ATLAS condition database (COOL DB). The bad channels list guides the data quality validator in identifying new problematic channels and is used in data reconstruction and the system allows to update the channels list directly in the COOL database. MCWS can generate summary results, such as eta-phi plots and comparative tables of the masked channels percentage. Regularly, during the LHC (Large Hadron Collider) shutdown a maintenance of the detector equipments is performed. When a channel is repaired, its calibration constants stored in the COOL database have to be updated. Additionally MCWS system manages the update of these calibration constants values in the COOL database. The MCWS has been used by the Tile community since 2008, during the commissioning phase, and was upgraded to comply with ATLAS operation specifications. Among its future developments, it is foreseen an integration of MCWS with the TileCal control Web system (DCS) in order to identify high voltage problems automatically.

Detecting and Characterizing Nighttime Lighting Using Multispectral and Hyperspectral Imaging

Science.gov (United States)

2012-12-01

are a wide variety of statistically based methods for analysis of MSI data, but they can also be analyzed to some degree using MSI spectral signatures...the received signal for the detection of clouds at night using moonlight . The implementation of the PMT system allowed for an unintentional ability...been known since the 1970s, the early night-time mapping products were derived from analog data ( film ). Elvidge et al. (1997) presented the first

Robustness studies of the photomultipliers reading out TileCal, the central hadron calorimeter of the ATLAS experiment

CERN Document Server

Di Gregorio, Giulia; The ATLAS collaboration

2018-01-01

The ATLAS Tile Calorimeter (TileCal) is the central section of the hadronic calorimeter of the ATLAS experiment. This sampling calorimeter uses steel plates as absorber and scintillating tiles as active medium. The light produced by the passage of charged particles is transmitted by wavelength shifting fibres to photo-multiplier tubes (PMTs), located in the outer part of the calorimeter. The readout is segmented into about 5000 cells, each one being read out by two PMTs in parallel. The detector readout geometry will not be changed for the Phase II of the High Luminosity Large Hadron Collider (HL-LHC) operation. A challenging goal is to understand whether the full sample of PMTs installed at the beginning of the ATLAS detector operation can be used until completion of the HL-LHC program or not. For this reason, a reliable study of the PMT robustness against ageing is required. Detailed studies modelling the PMT response variation as a function of the integrated anode charge were done. The PMT response evoluti...

A Peer Mentor Tutor Program in Physics

Science.gov (United States)

Nossal, S. M.; Jacob, A. T.; Buehlman, J. D.; Middlecamp, C. H.

2001-05-01

The Peer Mentor Tutor (PMT) program in the University of Wisconsin-Madison's Physics Department matches upper level undergraduate physics majors in small groups with students potentially at-risk for having academic trouble with their gateway introductory non-calculus physics course or for feeling isolated at the University. The program enhances students'learning and confidence by providing an emphasis on problem solving, a supportive environment for asking questions, and opportunities for acquiring missing math skills. The students assisted include, among others, returning adults, students of color,students with English as a second language, and students who have never taken physics in high school. The tutors acquire teaching and leadership experience with ongoing training throughout the year. The Physics PMT program is run in collaboration with a similar program in Chemistry. The peer model is also being applied to other science courses at the University of Wisconsin. We will describe the structure of the Physics PMT program and our current efforts to expand the program into a broader Physics Learning Center that may serve multiple purposes and courses.

The effects of Earth's magnetic field on 3-inch diameter photomultipliers used in KM3NeT neutrino telescope

Directory of Open Access Journals (Sweden)

Giordano V.

2016-01-01

Full Text Available The KM3NeT neutrino telescope will be the largest underwater neutrino telescope and will be located in the abyss of the Mediterranean Sea. In neutrino telescopes the key element of the detector is the optical module and for KM3NeT it consists of 31 PMTs stored inside a transparent pressure-resistant glass sphere of 17-inch that serves as mechanical protection while ensuring good light transmission. Since the PMTs installed into an underwater neutrino telescope can change their orientation because of movements of the detector structure due to sea currents, the influence of Earth's magnetic field has been investigated. Magnetic shielding by means of a mu-metal cage is used to reduce magnetic effects and to make the response of the PMT sufficiently orientation independent. In order to quantify the effect on magnetic field, we compared measurements on variation of gain, transit time spread and detection efficiency for a 3-inch PMT in shielded and unshielded condition at 3 PMT inclinations. Data shows that variations are sufficiently low especially for timing properties.

Locally aggressive and multifocal phosphaturic mesenchymal tumors: two unusual cases of tumor-induced osteomalacia.

Science.gov (United States)

Higley, Meghan; Beckett, Brooke; Schmahmann, Sandra; Dacey, Elizabeth; Foss, Erik

2015-12-01

Tumor-induced osteomalacia (TIO) has long been recognized as a clinical paraneoplastic syndrome. The identification of a unique histopathologic entity, the phosphaturic mesenchymal tumor (PMT), as a distinct etiology for TIO has been a more recent discovery. The majority of published cases describe a solitary, non-aggressive appearing soft tissue or osseous lesions in patients with osteomalacia; aggressive appearing or multifocal lesions appear to be exceedingly rare. These tumors characteristically secrete fibroblast growth factor 23 (FGF23). Elevated serum levels of FGF23 result in phosphate wasting and osteomalacia. In the majority of cases, laboratory abnormalities and clinical signs and symptoms of osteomalacia precede identification of the causative lesion by years. Following diagnosis, complete resection with wide margins to prevent local recurrence is most often curative. Imaging characteristics of PMT are diverse and remain incompletely defined, as the majority of previous publications are outside of the radiologic literature. We present multiple imaging modalities in two cases of patients with debilitating osteomalacia and unusual appearing PMTs: one with a locally aggressive lesion leading to pathologic fracture, the second presenting with exceedingly rare multifocal PMT.

Balloonborne lidar experiment

Science.gov (United States)

Shepherd, O.; Aurilio, G.; Bucknam, R. D.; Brooke, R. W.; Hurd, A. G.

1980-12-01

The object of this contract was to design a balloonborne lidar experiment capable of performing nightime atmospheric density measurements in the 10 to 40 km altitude domain with a resolution of 100 meters. The payload includes a frequency-tripled Nd:YAG laser with outputs at 353 and 1064 nm, a telescoped receiver with PMT detectors, a command-controlled optical pointing system, and support systems, including thermal control, telemetry, command, and power. Density measurements would be made using the back-scattered 353 nm radiation data with aerosol corrections obtained from 1064 nm radiation scatterings.

The research of data acquisition system for Raman spectrometer

Science.gov (United States)

Cui, Xiao; Guo, Pan; Zhang, Yinchao; Chen, Siying; Chen, He; Chen, Wenbo

2011-11-01

Raman spectrometer has been widely used as an identification tool for analyzing material structure and composition in many fields. However, Raman scattering echo signal is very weak, about dozens of photons at most in one laser plus signal. Therefore, it is a great challenge to design a Raman spectrum data acquisition system which could accurately receive the weak echo signal. The system designed in this paper receives optical signals with the principle of photon counter and could detect single photon. The whole system consists of a photoelectric conversion module H7421-40 and a photo counting card including a field programmable gate array (FPGA) chip and a PCI9054 chip. The module H7421-40 including a PMT, an amplifier and a discriminator has high sensitivity on wavelength from 300nm to 720nm. The Center Wavelength is 580nm which is close to the excitation wavelength (532nm), QE 40% at peak wavelength, Count Sensitivity is 7.8*105(S-1PW-1) and Count Linearity is 1.5MHZ. In FPGA chip, the functions are divided into three parts: parameter setting module, controlling module, data collection and storage module. All the commands, parameters and data are transmitted between FPGA and computer by PCI9054 chip through the PCI interface. The result of experiment shows that the Raman spectrum data acquisition system is reasonable and efficient. There are three primary advantages of the data acquisition system: the first one is the high sensitivity with single photon detection capability; the second one is the high integrated level which means all the operation could be done by the photo counting card; and the last one is the high expansion ability because of the smart reconfigurability of FPGA chip.

Wistar-Kyoto Female Rats Are More Susceptible to Develop Sugar Binging: A Comparison with Wistar Rats

Directory of Open Access Journals (Sweden)

Helena Papacostas-Quintanilla

2017-05-01

Full Text Available The hedonic component of the feeding behavior involves the mesolimbic reward system and resembles addictions. Nowadays, the excessive consumption of sucrose is considered addictive. The Wistar-Kyoto (WKY rat strain is prone to develop anxiety and addiction-like behavior; nevertheless, a lack of information regarding their vulnerability to develop sugar binging-like behavior (SBLB and how it affects the reward system persist. Therefore, the first aim of the present study was to compare the different predisposition of two rat strains, Wistar (W and WKY to develop the SBLB in female and male rats. Also, we studied if the SBLB-inducing protocol produces changes in anxiety-like behavior using the plus-maze test (PMT and, analyzed serotonin (5-HT and noradrenaline (NA concentrations in brain areas related to anxiety and ingestive behavior (brain stem, hypothalamus, nucleus accumbens, and amygdala. Finally, we evaluated whether fluoxetine, a drug that has been effective in reducing the binge-eating frequency, body weight, and severity of binge eating disorder, could also block this behavior. Briefly, WKY and W female rats were exposed to 30% sucrose solution (2 h, 3 days/week for 4 weeks, and fed up ad libitum. PMT was performed between the last two test periods. Immediately after the last test where sucrose access was available, rats were decapitated and brain areas extracted for high-performance liquid chromatography analysis. The results showed that both W and WKY female and male rats developed the SBLB. WKY rats consumed more calories and ingested a bigger amount of sucrose solution than their W counterpart. This behavior was reversed by using fluoxetine, rats exposed to the SBLB-inducing protocol presented a rebound effect during the washout period. On female rats, the SBLB-inducing protocol induced changes in NA concentrations on WKY, but not on W rats. No changes were found in 5-HT levels. Finally, animals that developed SBLB showed increased

Ferroelectric properties of bismuth-doped PMT-PT ceramics

International Nuclear Information System (INIS)

Hyun, June Won; Kim, Yeon Jung; Kim, Gang Bae

2010-01-01

This study examined the ferroelectric properties of Bi-doped 0.66(Pb (1-3x/2) Bi x )(Mg 1/3 Ta 2/3 )O 3 - 0.34PbTiO 3 ceramics for use as a piezoelectric transformer. The optimum conditions for obtaining samples with high density and improved electrical properties were a sintering temperature of 1200 .deg. C/4 h and the addition of 3 mol% Bi. The temperature dependent dielectric constant of the ceramics was examined at frequencies ranging from 1 kHz to 100 kHz. The broad dielectric constant anomaly coupled with a shift in the dielectric maximum towards higher temperature with increasing frequency indicates a relaxor-type behavior in the ceramics. The piezoelectric coefficient (d 33 ) and the planar coupling factor (K p ) increase with the addition of 3 mol% Bi, and then decrease with further addition of Bi. The dielectric constant and the dissipation factor at room temperature could be improved by the addition of 3 mol% Bi.

Studies of column supported towers

International Nuclear Information System (INIS)

Chauvel, D.; Costaz, J.-L.

1991-01-01

As a result of a research and development programme into the civil engineering of cooling towers launched in 1978 by Electricite de France, very high cooling towers were built at Golfech and Chooz, in France, using column supports. This paper discusses the evolution of this new type of support from classical diagonal supports, presents some of the results of design calculations and survey measurements taken during construction of the shell and analyses the behaviour of the structure. (author)

Actively-stabilized photomultiplier tube base for vacuum operation

International Nuclear Information System (INIS)

Bryan, M.A; Morris, C.L.; Idzorek, G.C.

1992-01-01

An actively stabilized photomultiplier tube (PMT) base design for an Amperex XP-2262B PMT is described. Positive-negative-positive transistors are used as low-impedance current sources to maintain constant voltages on the last three dynodes. This technique results in a highly stable, low-power tube base ideal for use with low-duty-factor beams, such as those found at the Clinton P. Anderson Meson Physics Facility. Furthermore, because of the low power usage of this large design, these bases can be sealed in a heat-conductive, electrically insulating material and used in a vacuum

Protection motivation theory and stages of change in sun protective behavior.

Science.gov (United States)

Prentice-Dunn, Steven; McMath, Ben F; Cramer, Robert J

2009-03-01

This study examined the usefulness of the stage of change model and protection motivation theory (PMT) in creating brief persuasive appeals to promote healthy sun-behavior. College women (N = 254) read one of four essays that manipulated the level of threat and coping appraisal. The transition from the precontemplation to contemplation stage was promoted by threat appraisal information, but transition from contemplation to the preparation stage occurred only when individuals were provided with both high threat and high coping information. Thus, brief communications based on PMT may create attitudes leading to behavior change when later, more intensive, interventions are introduced.

A simple method to improve the spatial uniformity of venetian-blind photomultiplier tubes

International Nuclear Information System (INIS)

Santos, J.M.F. dos; Veloso, J.F.C.A.; Morgado, R.E.

1996-01-01

An improvement in the uniformity of venetian-blind photomultiplier tubes has been achieved by reducing the voltage difference between the first and second dynodes. The method has been applied to a gas proportional scintillation counter (GPSC) instrumented with a venetian-blind photomultiplier (PMT). When exposed to a 20-mm collimated 5.9-keV x-ray beam, an overall improvement in energy resolution for the GPSC/PMT combination from 20% to 11.5% was achieved. An alternative method that reduces the photocathode-to-first-dynode voltage was less effective and resulted in a severe degradation of detector energy resolution

Concept and design of an alignment monitoring system for the CBM RICH mirrors

Energy Technology Data Exchange (ETDEWEB)

Bendarouach, Jordan [Justus Liebig University (Germany); Collaboration: CBM-Collaboration

2016-07-01

The Compressed Baryonic Matter (CBM) experiment at the future FAIR (Facility for Antiproton and Ion Research) complex will investigate the phase diagram of strongly interacting matter at high baryon density and moderate temperatures in A+A collisions from 2-11 AGeV (SIS100) beam energy. One of the key detector components required for this CBM physics program is the RICH (Ring Imaging CHerenkov) detector, developed for efficient and clean electron identification and pion suppression. The detector consists of about 80 spherical glass mirror tiles, distributed over two sphere parts. An important aspect to guarantee a stable operation of the RICH detector is the alignment of the mirrors. A method originally developed and inspired by the HERA-B experiment uses recorded data to assess mirror alignment of the RICH mirror system. Measurements of Cherenkov distances and angles on the PMT plane may reveal potential misalignments of the considered tile. If mirror misalignment is revealed, it can be subsequently included and rectified by correction routines, which should mostly increase ring reconstruction as well as ring-track matching efficiencies. Results of this alignment method based on simulated events, reproducing potential mirror misalignments, its limits and first correction routines are presented.

Study of influence with fourier transform on long cable in measurement of fall time of DPF neutron profile

International Nuclear Information System (INIS)

Guo Hongsheng; Li Rurong; Tang Dengpan; Yang Gaozhao; Hu Qingyuan; Si Fenni; Zhang Jianhua; Peng Taiping

2011-01-01

The influence of the Fourier Transform on long cable in the measurement of fall time of DPF neutron profile is discussed by mathematical methods. The application of anti-convolution function with the Fourier Transform on long cable is analysed. The time interval between the peak time and the time that the height falls 3 orders of magnitude after peak is measured with gated-detector array system which consists of PMT (photomultiplier tube) and organic scintillation crystal. (authors)

Constraints on θ13 from a three-flavor oscillation analysis of reactor antineutrinos at KamLAND

International Nuclear Information System (INIS)

Gando, A.; Gando, Y.; Ichimura, K.; Ikeda, H.; Kibe, Y.; Kishimoto, Y.; Minekawa, Y.; Mitsui, T.; Morikawa, T.; Nagai, N.; Nakajima, K.; Narita, K.; Shimizu, I.; Shimizu, Y.; Shirai, J.; Suekane, F.; Suzuki, A.; Takahashi, H.; Takahashi, N.; Takemoto, Y.

2011-01-01

We present new constraints on the neutrino oscillation parameters Δm 21 2 , θ 12 , and θ 13 from a three-flavor analysis of solar and KamLAND data. The KamLAND data set includes data acquired following a radiopurity upgrade and amounts to a total exposure of 3.49x10 32 target-proton-year. Under the assumption of CPT invariance, a two-flavor analysis (θ 13 =0) of the KamLAND and solar data yields the best-fit values tan 2 θ 12 =0.444 -0.030 +0.036 and Δm 21 2 =7.50 -0.20 +0.19 x10 -5 eV 2 ; a three-flavor analysis with θ 13 as a free parameter yields the best-fit values tan 2 θ 12 =0.452 -0.033 +0.035 , Δm 21 2 =7.50 -0.20 +0.19 x10 -5 eV 2 , and sin 2 θ 13 =0.020 -0.016 +0.016 . This θ 13 interval is consistent with other recent work combining the CHOOZ, atmospheric and long-baseline accelerator experiments. We also present a new global θ 13 analysis, incorporating the CHOOZ, atmospheric, and accelerator data, which indicates sin 2 θ 13 =0.009 -0.007 +0.013 . A nonzero value is suggested, but only at the 79% C.L.

Control rod cluster drop time anomaly Guandong nuclear power station (Daya bay) and Electricite de France nuclear power stations (1450 MWe N4 Series)

International Nuclear Information System (INIS)

Olivera, J.J.; Naury, S.; Tricot, N.; Tran Dai, P.; Gama, J.M.

1996-01-01

The anomaly of control rod cluster drop time revealed at Guandong Nuclear Power Station in Daya Bay and in the Chooz B1 pilot unit for the N4 series, led to the replacement of the M1 type control rod cluster guide tubes with 1300 MWe PWR type guide tubes, adapted to the geometry of the Guandong reactors and the 1450 MWe reactors of the N4 series. The comparison of the drop times obtained with the 1300 MWe type control rod cluster guide 1300 MWe type control rod cluster guide tubes gave satisfactory results. These met the safety criterion for N4 series control rod cluster drop times (2.15 under hot shutdown conditions). The drop time tests which will be carried out in middle of and at the end of cycle 1 of Chooz B1 should make it possible to finally validate the solution already successfully implemented at Guandong. However, this anomaly has revealed the limits of representativeness of the experimental test loops with regard to the real reactor configuration. In view of this, it has been deemed necessary to ask Electricite de France to pursue its analysis both on the understanding of the phenomena which led to this anomaly and on the limits of the representativeness of the experimental test loops. (authors)

Performance of waveform digitizers as a compact data acquisition system for the ISMRAN experiment

International Nuclear Information System (INIS)

Mitra, A.; Netrakanti, P.K.; Kashyap, V.K.S.; Behera, S.P.; Jha, V.; Mishra, D.K.; Pant, L.M.

2016-01-01

The Indian Scintillator Matrix for Reactor Anti-Neutrino (ISMRAN) detector is proposed at the Dhruva reactor, BARC, to measure the anti-neutrinos (υ-bar ) for the purpose of reactor monitoring and sterile neutrino search. A one ton detector, consisting of 100 plastic scintillator bars (10cm x 10cm x 100cm), wrapped with the Gadolinium (Gd) coated mylar foils and coupled with photomultiplier tubes (PMT) at both ends, is planned for this purpose. One of the key components for such an experiment is the development of a dedicated and economical data acquisition system (DAQ) for the detector setup. The FPGA based waveform digitizers are suitable for this purpose, where data from a large number of detectors need to be read out simultaneously. This effectively reduces the burden of the intermediate conventional pulse processing electronics between the detectors and the DAQ. We have procured the CAEN made 16 channel, model V1730, 14bit, 500 MS/s VME based waveform digitizers for this purpose. A series of measurements have been carried out to evaluate the performance of the digitizers. We are also working on the related auxiliary software and data format to be used extensively for ISMRAN DAQ

A Full Slice Test Version of a Tentative Upgraded Readout System for TileCal

CERN Document Server

Muschter, S; The ATLAS collaboration; Bohm, C; Eriksson, D; Kavianipour, H; Oreglia, M; Tang, F

2011-01-01

The upgrade plans on the ATLAS hadronic calorimeter (TileCal) include the full readout of all data to the counting room. In order to study functional requirements of the future upgraded TileCal readout system we have assembled a minimal TDAQ slice. The aim is to implement a tentative readout chain for TileCal, starting with a newly developed 3-in-1 FE-board from University of Chicago and ending with the storage of triggered data on a PC. Later we will use PMT pulses, amplified and shaped by the 3-in-1 board, as a data source. However, for simplicity we start by using well defined calibration pulses also generated by the 3-in-1 board. The pulses are sampled by a 12 bit ADC, which is connected to an ML605 evaluation board from XILINX. These boards emulate the new on-detector electronics. The ML605 communicates via two 5Gb/s optical links with a Virtex-6 FPGA development board from HighTech Global which emulates the off-detector electronics. The off-detector board is situated in a PC and uses PCIe for readout an...

X-ray and gamma ray detector readout system

Science.gov (United States)

Tumer, Tumay O; Clajus, Martin; Visser, Gerard

2010-10-19

A readout electronics scheme is under development for high resolution, compact PET (positron emission tomography) imagers based on LSO (lutetium ortho-oxysilicate, Lu.sub.2SiO.sub.5) scintillator and avalanche photodiode (APD) arrays. The key is to obtain sufficient timing and energy resolution at a low power level, less than about 30 mW per channel, including all required functions. To this end, a simple leading edge level crossing discriminator is used, in combination with a transimpedance preamplifier. The APD used has a gain of order 1,000, and an output noise current of several pA/ Hz, allowing bipolar technology to be used instead of CMOS, for increased speed and power efficiency. A prototype of the preamplifier and discriminator has been constructed, achieving timing resolution of 1.5 ns FWHM, 2.7 ns full width at one tenth maximum, relative to an LSO/PMT detector, and an energy resolution of 13.6% FWHM at 511 keV, while operating at a power level of 22 mW per channel. Work is in progress towards integration of this preamplifier and discriminator with appropriate coincidence logic and amplitude measurement circuits in an ASIC suitable for a high resolution compact PET instrument. The detector system and/or ASIC can also be used for many other applications for medical to industrial imaging.

Effect of Motivational Interviewing on a Weight Loss Program Based on the Protection Motivation Theory.

Science.gov (United States)

Mirkarimi, Kamal; Mostafavi, Firoozeh; Eshghinia, Samira; Vakili, Mohammad Ali; Ozouni-Davaji, Rahman Berdi; Aryaie, Mohammad

2015-06-01

The prevalence of overweight and obesity is on the increase the world over, which imposes an ever-increasing burden on societies and health care systems. This study sought to investigate the effect of motivational interviewing (MI) on a weight-loss program based on the protection motivation theory (PMT). This randomized clinical trial study, comprising pretest-posttest with a control group, was conducted on 150 overweight and obese women attending a private nutrition clinic for the first time. Samples were randomly selected using the clinic's records and then allocated to three groups (50 women in each group) receiving: 1) a standard weight-control program; 2) motivational interviewing; and 3) MI plus intention intervention. Data were collected using a researcher-made questionnaire through in-person interviews and were analyzed using SPSS (version 11) and statistical tests, including the Kruskal-Wallis test, one-way analysis of variance, paired t-test, and linear regression model. In the two intervention groups, the PMT construct scores, namely susceptibility (P = 0.001), severity (P = 0.001), rewards (P =0.004), self-efficacy (P = 0.001), response efficacy (P = 0.001), and costs (P = 0.014), were significantly increased compared to those in the control group. The anthropometric status was statistically significant in the MI group (P = 0.001) and the MI plus intention-intervention group (P = 0.001) at 2 months' follow-up, while in the control group, weight was meaningfully different after the intervention (P = 0.027). Weight was different between the groups after the intervention, with the Tukey test demonstrating that the differences were statistically significant between the control group and the MI group. Our results demonstrated that MI, combined with the implementation of intention intervention, increased weight loss and PMT construct scores in our study population.

Instrumentation and calibration methods for the multichannel measurement of phase and amplitude in optical tomography

International Nuclear Information System (INIS)

Nissilae, Ilkka; Noponen, Tommi; Kotilahti, Kalle; Katila, Toivo; Lipiaeinen, Lauri; Tarvainen, Tanja; Schweiger, Martin; Arridge, Simon

2005-01-01

In this article, we describe the multichannel implementation of an intensity modulated optical tomography system developed at Helsinki University of Technology. The system has two time-multiplexed wavelengths, 16 time-multiplexed source fibers and 16 parallel detection channels. The gain of the photomultiplier tubes (PMTs) is individually adjusted during the measurement sequence to increase the dynamic range of the system by 10 4 . The PMT used has a high quantum efficiency in the near infrared (8% at 800 nm), a fast settling time, and low hysteresis. The gain of the PMT is set so that the dc anode current is below 80 nA, which allows the measurement of phase independently of the intensity. The system allows measurements of amplitude at detected intensities down to 1 fW, which is sufficient for transmittance measurements of the female breast, the forearm, and the brain of early pre-term infants. The mean repeatability of phase and the logarithm of amplitude (ln A) at 100 MHz were found to be 0.08 deg. and 0.004, respectively, in a measurement of a 7 cm phantom with an imaging time of 5 s per source and source optical power of 8 mW. We describe a three-step method of calibrating the phase and amplitude measurements so that the absolute absorption and scatter in tissue may be measured. A phantom with two small cylindrical targets and a second phantom with three rods are measured and reconstructions made from the calibrated data are shown and compared with reconstructions from simulated data

Protection motivation theory and cigarette smoking among vocational high school students in China: a cusp catastrophe modeling analysis.

Science.gov (United States)

Xu, Yunan; Chen, Xinguang

2016-01-01

Tobacco use is one of the greatest public health problems worldwide and the hazards of cigarette smoking to public health call for better recognition of cigarette smoking behaviors to guide evidence-based policy. Protection motivation theory (PMT) provides a conceptual framework to investigate tobacco use. Evidence from diverse sources implies that the dynamics of smoking behavior may be quantum in nature, consisting of an intuition and an analytical process, challenging the traditional linear continuous analytical approach. In this study, we used cusp catastrophe, a nonlinear analytical approach to test the dual-process hypothesis of cigarette smoking. Data were collected from a random sample of vocational high school students in China ( n = 528). The multivariate stochastic cusp modeling was used and executed with the Cusp Package in R. The PMT-based Threat Appraisal and Coping Appraisal were used as the two control variables and the frequency of cigarette smoking (daily, weekly, occasional, and never) in the past month was used as the outcome variable. Consistent with PMT, the Threat Appraisal (asymmetry, α 1 = 0.1987, p < 0.001) and Coping Appraisal (bifurcation, β 2 = 0.1760, p < 0.05) significantly predicted the smoking behavior after controlling for covariates. Furthermore, the cusp model performed better than the alternative linear and logistic regression models with regard to higher R 2 (0.82 for cusp, but 0.21 for linear and 0.25 for logistic) and smaller AIC and BIC. Study findings support the conclusion that cigarette smoking in adolescents is a quantum process and PMT is relevant to guide studies to understand smoking behavior for smoking prevention and cessation.

New regulations regarding Postgraduate Medical Training in Spain: perception of the tutor's role in the Murcia Region

Directory of Open Access Journals (Sweden)

Saura-Llamas José

2010-06-01

Full Text Available Abstract Background Recently introduced regulatory changes have expanded the Tutor role to include their primary responsibility for Postgraduate Medical Training (PMT. However, accreditation and recognition of that role has been devolved to the autonomic regions. The opinions of the RT may be relevant to future decisions; Methods A comprehensive questionnaire, including demographic characteristics, academic and research achievement and personal views about their role, was sent to 201 RTs in the Murcia Region of Spain. The responses are described using median and interquartile ranges (IQR; Results There were 147 replies (response rate 73%, 69% male, mean age 45 ± 7 yrs. RTs perception of the residents' initial knowledge and commitment throughout the program was 5 (IQR 4-6 and 7 (IQR 5-8, respectively. As regards their impact on the PMT program, RTs considered that their own contribution was similar to that of senior residents. RTs perception of how their role was recognised was 5 (IQR 3-6. Only 16% did not encounter difficulties in accessing specific RT training programs. Regarding the RTs view of their various duties, supervision of patient care was accorded the greatest importance (64% while the satisfactory completion of the PMT program and supervision of day-to-day activities were also considered important (61% and 59% respectively. The main RT requirements were: a greater professional recognition (97%, protected time (95%, specific RT training programs (95% and financial recognition (86%; Conclusions This comprehensive study, reflecting the feelings of our RTs, provides a useful insight into the reality of their work and the findings ought to be taken into consideration in the imminent definitive regulatory document on PMT.

PARTICIPATION IN HIGH ENERGY PHYSICS

Energy Technology Data Exchange (ETDEWEB)

White, Christopher

2012-12-20

This grant funded experimental and theoretical activities in elementary particles physics at the Illinois Institute of Technology (IIT). The experiments in which IIT faculty collaborated included the Daya Bay Reactor Neutrino Experiment, the MINOS experiment, the Double Chooz experiment, and FNAL E871 - HyperCP experiment. Funds were used to support summer salary for faculty, salary for postdocs, and general support for graduate and undergraduate students. Funds were also used for travel expenses related to these projects and general supplies.

Photocopia-A Unibody Mono-material Compact and Scalable Photomultiplier

Energy Technology Data Exchange (ETDEWEB)

Mulhollan, Gregory [Saxet Surface Science

2014-12-01

The Photocopia photomultiplier tube (PMT) takes advantage of two of the many unique properties of the hydrogenated amorphous silicon-germanium (a-SiGe) photoemitter material: its mechanical flexibility and mostly substrate-independent properties. The a-SiGe photoemitter has high secondary electron (SE) yield. It can be used both as the photocathode and as the gain medium. The active material can be grown on a flat, thin unibody substrate, formed and then “rolled up” ex situ. The completed structure would then be activated and sealed within a tube. The Ge component can be increased to enhance red-sensitivity. Compact sizes are possible, minimizing magnetic field effects. The Photocopia PMT will be a low cost alternative to MCPs for TOF detectors and provide better timing discrimination for Cherenkov detectors. Retention of the ability to activate to a normal photoyield state upon flexing (bending) the substrate of the a-SiGe material after growth, but prior to activation has been shown. The SE coefficient of the activated material has been characterized over the voltage range suitable for utilization as the gain material. The time response of the material is suited to PMT use.

High-speed charge-to-time converter ASIC for the Super-Kamiokande detector

Energy Technology Data Exchange (ETDEWEB)

Nishino, H., E-mail: nishino@post.kek.j [Institute for Cosmic Ray Research, University of Tokyo, Chiba 277-8582 (Japan); Awai, K.; Hayato, Y.; Nakayama, S.; Okumura, K.; Shiozawa, M.; Takeda, A. [Institute for Cosmic Ray Research, University of Tokyo, Chiba 277-8582 (Japan); Ishikawa, K.; Minegishi, A. [Iwatsu Test Instruments Corporation, Tokyo 168-8511 (Japan); Arai, Y. [The Institute of Particle and Nuclear Studies, KEK, Ibaraki 305-0801 (Japan)

2009-11-11

A new application-specific integrated circuit (ASIC), the high-speed charge-to-time converter (QTC) IWATSU CLC101, provides three channels, each consisting of preamplifier, discriminator, low-pass filter, and charge integration circuitry, optimized for the waveform of a photomultiplier tube (PMT). This ASIC detects PMT signals using individual built-in discriminators and drives output timing signals whose width represents the integrated charge of the PMT signal. Combined with external input circuits composed of passive elements, the QTC provides full analog signal processing for the detector's PMTs, ready for further processing by time-to-digital converters (TDCs). High-rate (>1MHz) signal processing is achieved by short-charge-conversion-time and baseline-restoration circuits. Wide-range charge measurements are enabled by offering three gain ranges while maintaining a short cycle time. QTC chip test results show good analog performance, with efficient detection for a single photoelectron signal, four orders of magnitude dynamic range (0.3mVapprox3V; 0.2approx2500pC), 1% charge linearity, 0.2 pC charge resolution, and 0.1 ns timing resolution. Test results on ambient temperature dependence, channel isolation, and rate dependence also meet specifications.

Combining motivational and volitional interventions to promote exercise participation: protection motivation theory and implementation intentions.

Science.gov (United States)

Milne, Sarah; Orbell, Sheina; Sheeran, Paschal

2002-05-01

This study compared a motivational intervention based on protection motivation theory (PMT, Rogers, 1975, 1983) with the same motivational intervention augmented by a volitional intervention based on implementation intentions (Gollwitzer, 1993). The study had a longitudinal design, involving three waves of data collection over a 2-week period, incorporating an experimental manipulation of PMT variables at Time 1 and a volitional, implementation intention intervention at Time 2. Participants (N=248) were randomly allocated to a control group or one of two intervention groups. Cognitions and exercise behaviour were measured at three time-points over a 2-week period. The motivational intervention significantly increased threat and coping appraisal and intentions to engage in exercise but did not bring about a significant increase in subsequent exercise behaviour. In contrast, the combined protection motivation theory/implementation intention intervention had a dramatic effect on subsequent exercise behaviour. This volitional intervention did not influence behavioural intention or any other motivational variables. It is concluded that supplementing PMT with implementation intentions strengthens the ability of the model to explain behaviour. This has implications for health education programmes, which should aim to increase both participants' motivation and their volition.

Antimalarial agents against both sexual and asexual parasites stages: structure-activity relationships and biological studies of the Malaria Box compound 1-[5-(4-bromo-2-chlorophenyl)furan-2-yl]-N-[(piperidin-4-yl)methyl]methanamine (MMV019918) and analogues.

Science.gov (United States)

Vallone, Alessandra; D'Alessandro, Sarah; Brogi, Simone; Brindisi, Margherita; Chemi, Giulia; Alfano, Gloria; Lamponi, Stefania; Lee, Soon Goo; Jez, Joseph M; Koolen, Karin J M; Dechering, Koen J; Saponara, Simona; Fusi, Fabio; Gorelli, Beatrice; Taramelli, Donatella; Parapini, Silvia; Caldelari, Reto; Campiani, Giuseppe; Gemma, Sandra; Butini, Stefania

2018-04-25

Therapies addressing multiple stages of Plasmodium falciparum life cycle are highly desirable for implementing malaria elimination strategies. MMV019918 (1, 1-[5-(4-bromo-2-chlorophenyl)furan-2-yl]-N-[(piperidin-4-yl)methyl]methanamine) was selected from the MMV Malaria Box for its dual activity against both asexual stages and gametocytes. In-depth structure-activity relationship studies and cytotoxicity evaluation led to the selection of 25 for further biological investigation. The potential transmission blocking activity of 25 versus P. falciparum was confirmed through the standard membrane-feeding assay. Both 1 and 25 significantly prolonged atrioventricular conduction time in Langendorff-isolated rat hearts, and showed inhibitory activity of Ba 2+ current through Ca v 1.2 channels. An in silico target-fishing study suggested the enzyme phosphoethanolamine methyltransferase (PfPMT) as a potential target. However, compound activity against PfPMT did not track with the antiplasmodial activity, suggesting the latter activity relies on a different molecular target. Nevertheless, 25 showed interesting activity against PfPMT, which could be an important starting point for the identification of more potent inhibitors active against both sexual and asexual stages of the parasite. Copyright © 2018 Elsevier Masson SAS. All rights reserved.

High-speed charge-to-time converter ASIC for the Super-Kamiokande detector

International Nuclear Information System (INIS)

Nishino, H.; Awai, K.; Hayato, Y.; Nakayama, S.; Okumura, K.; Shiozawa, M.; Takeda, A.; Ishikawa, K.; Minegishi, A.; Arai, Y.

2009-01-01

A new application-specific integrated circuit (ASIC), the high-speed charge-to-time converter (QTC) IWATSU CLC101, provides three channels, each consisting of preamplifier, discriminator, low-pass filter, and charge integration circuitry, optimized for the waveform of a photomultiplier tube (PMT). This ASIC detects PMT signals using individual built-in discriminators and drives output timing signals whose width represents the integrated charge of the PMT signal. Combined with external input circuits composed of passive elements, the QTC provides full analog signal processing for the detector's PMTs, ready for further processing by time-to-digital converters (TDCs). High-rate (>1MHz) signal processing is achieved by short-charge-conversion-time and baseline-restoration circuits. Wide-range charge measurements are enabled by offering three gain ranges while maintaining a short cycle time. QTC chip test results show good analog performance, with efficient detection for a single photoelectron signal, four orders of magnitude dynamic range (0.3mV∼3V; 0.2∼2500pC), 1% charge linearity, 0.2 pC charge resolution, and 0.1 ns timing resolution. Test results on ambient temperature dependence, channel isolation, and rate dependence also meet specifications.

Women's preferences for contralateral prophylactic mastectomy: An investigation using protection motivation theory.

Science.gov (United States)

Tesson, Stephanie; Richards, Imogen; Porter, David; Phillips, Kelly-Anne; Rankin, Nicole; Musiello, Toni; Marven, Michelle; Butow, Phyllis

2016-05-01

Most women diagnosed with unilateral breast cancer without BRCA1 or BRCA2 mutations are at low risk of contralateral breast cancer. Contralateral Prophylactic Mastectomy (CPM) decreases the relative risk of contralateral breast cancer, but may not increase life expectancy; yet international uptake is increasing. This study applied protection motivation theory (PMT) to determine factors associated with women's intentions to undergo CPM. Three hundred eighty-eight women previously diagnosed with unilateral breast cancer and of negative or unknown BRCA1 or BRCA2 status were recruited from an advocacy group's research database. Participants completed measures of PMT constructs based on a common hypothetical CPM decision-making scenario. PMT constructs explained 16% of variance in intentions to undergo CPM. Response efficacy (CPM's advantages) and response costs (CPM's disadvantages) were unique individual predictors of intentions. Decision-making appears driven by considerations of the psychological, cosmetic and emotional advantages and disadvantages of CPM. Overestimations of threat to life from contralateral breast cancer and survival benefit from CPM also appear influential factors. Patients require balanced and medically accurate information regarding the pros and cons of CPM, survival rates, and recurrence risks to ensure realistic and informed decision-making.

Innovative power management, attitude determination and control tile for CubeSat standard NanoSatellites

Science.gov (United States)

Ali, Anwar; Mughal, M. Rizwan; Ali, Haider; Reyneri, Leonardo

2014-03-01

Electric power supply (EPS) and attitude determination and control subsystem (ADCS) are the most essential elements of any aerospace mission. Efficient EPS and precise ADCS are the core of any spacecraft mission. So keeping in mind their importance, they have been integrated and developed on a single tile called CubePMT module. Modular power management tiles (PMTs) are already available in the market but they are less efficient, heavier in weight, consume more power and contain less number of subsystems. Commercial of the shelf (COTS) components have been used for CubePMT implementation which are low cost and easily available from the market. CubePMT is developed on the design approach of AraMiS architecture: a project developed at Politecnico di Torino that provides low cost and higher performance space missions with dimensions larger than CubeSats. The feature of AraMiS design approach is its modularity. These modules can be reused for multiple missions which helps in significant reduction of the overall budget, development and testing time. One has just to reassemble the required subsystems to achieve the targeted specific mission.

Software Tools Streamline Project Management

Science.gov (United States)

2009-01-01

Three innovative software inventions from Ames Research Center (NETMARK, Program Management Tool, and Query-Based Document Management) are finding their way into NASA missions as well as industry applications. The first, NETMARK, is a program that enables integrated searching of data stored in a variety of databases and documents, meaning that users no longer have to look in several places for related information. NETMARK allows users to search and query information across all of these sources in one step. This cross-cutting capability in information analysis has exponentially reduced the amount of time needed to mine data from days or weeks to mere seconds. NETMARK has been used widely throughout NASA, enabling this automatic integration of information across many documents and databases. NASA projects that use NETMARK include the internal reporting system and project performance dashboard, Erasmus, NASA s enterprise management tool, which enhances organizational collaboration and information sharing through document routing and review; the Integrated Financial Management Program; International Space Station Knowledge Management; Mishap and Anomaly Information Reporting System; and management of the Mars Exploration Rovers. Approximately $1 billion worth of NASA s projects are currently managed using Program Management Tool (PMT), which is based on NETMARK. PMT is a comprehensive, Web-enabled application tool used to assist program and project managers within NASA enterprises in monitoring, disseminating, and tracking the progress of program and project milestones and other relevant resources. The PMT consists of an integrated knowledge repository built upon advanced enterprise-wide database integration techniques and the latest Web-enabled technologies. The current system is in a pilot operational mode allowing users to automatically manage, track, define, update, and view customizable milestone objectives and goals. The third software invention, Query

Performance of the hybrid photomultiplier tube (HPMT)

Energy Technology Data Exchange (ETDEWEB)

Schomaker, R.J. [B.V. Delft Electronische Producten, Roden (Netherlands)

1995-12-31

The HPMT, which may be an alternative for PhotoMultiplier Tubes (PMT`s) in many applications, is a vacuum tube in which the latest technologies of photocathodes and photodiodes are combined. Photo-electrons are accelerated and bombarding a reversely biased PIN diode, where they create many electron-hole-pairs. The resulting charge pulse can be amplified and further processed. The HPMT shows many superior characteristics compared to regular PMT`s, because it does not suffer the statistical fluctuations common for electron multiplication processes. An energy resolution of up to 14 photo-electrons will be presented, together with striking figures for dynamic range and timing behavior.

Commissioning of CMS Forward Hadron Calorimeters with Upgraded Multi-anode PMTs and uTCA Readout

CERN Document Server

Tiras, Emrah; Onel, Yasar

2016-01-01

The high flux of charged particles interacting with the CMS Forward Hadron Calorimeter PMT windows introduced a significant background for the trigger and offline data analysis. During Long Shutdown 1, all of the original PMTs were replaced with multi-anode, thin window photomultiplier tubes. At the same time, the back-end electronic readout system was upgraded to uTCA readout. The experience with commissioning and calibration of the Forward Hadron Calorimeter is described as well as the uTCA system. The upgrade was successful and provided quality data for Run 2 data-analysis at 13 TeV.

Proposta de bioremediació de l'estany Olla del Rei de Castelldefels

OpenAIRE

Vidiella Martin, Maria

2017-01-01

The UPC campus and the Mediterranean Technology Park (PMT) is an educational and research site that includes a naturalized area that sets it apart: the lake called "Olla del Rei", included in the inventory of wetlands in Catalonia. The evolution of the system and the effects caused by the network of drainage channels connected to the lagoon, have generated huge problems that threaten the existence of the lake as a natural area: eutrophication and loss of quality of the water, the exponential ...

LabVIEW DAQ for NE213 Neutron Detector

International Nuclear Information System (INIS)

Al-Adeeb, Mohammed

2003-01-01

A neutron spectroscopy system, based on a NE213 liquid scintillation detector, to be placed at the Stanford Linear Accelerator Center to measure neutron spectra from a few MeV up to 800 MeV, beyond shielding. The NE213 scintillator, coupled with a Photomultiplier Tube (PMT), detects and converts radiation into current for signal processing. Signals are processed through Nuclear Instrument Modules (NIM) and Computer Automated Measurement and Control (CAMAC) modules. CAMAC is a computer automated data acquisition and handling system. Pulses are properly prepared and fed into an analog to digital converter (ADC), a standard CAMAC module. The ADC classifies the incoming analog pulses into 1 of 2048 digital channels. Data acquisition (DAQ) software based on LabVIEW, version 7.0, acquires and organizes data from the CAMAC ADC. The DAQ system presents a spectrum showing a relationship between pulse events and respective charge (digital channel number). Various photon sources, such as Co-60, Y-88, and AmBe-241, are used to calibrate the NE213 detector. For each source, a Compton edge and reference energy [units of MeVee] is obtained. A complete calibration curve results (at a given applied voltage to the PMT and pre-amplification gain) when the Compton edge and reference energy for each source is plotted. This project is focused to development of a DAQ system and control setup to collect and process information from a NE213 liquid scintillation detector. A manual is created to document the process of the development and interpretation of the LabVIEW-based DAQ system. Future high-energy neutron measurements can be referenced and normalized according to this calibration curve

Inspection of Chooz power plant after ten years operation

International Nuclear Information System (INIS)

Saglio, Robert.

1978-01-01

This report is intended to discuss the results from the complete technical audit of the vessel effected in 1976 at the Ardennes reactor (CNA 305 MWe). This audit had a special character as far as this power plant has never been inspected before: the start-up had taken place in 1967 and was then prior to the development of French regulations (and even to the first version of the ASME code, Section XI). In that time, no inspection was expected; it has yet been possible to have a complete audit in ten days. The automatic start-up of focused ultrasonic testing so appeared to have reached the required reliability and a good sensitivity [fr

The social and economic impact created by construction of a nuclear power station: the part played by local companies

International Nuclear Information System (INIS)

Rongere, H.

1983-01-01

The president of the Sedan Chamber of Commerce and Industry and managing director of a public works company indicates how local and regional firms involved in the construction of the Chooz B power plant in the Ardennes organized themselves to cater for the requirements of the EDF. The measures taken by these firms to adapt themselves to the demanding and complex nuclear power market are indicated and further the repercussions of the on site work on employment levels and business activity are indicated [fr

Combined potential of future long-baseline and reactor experiments

International Nuclear Information System (INIS)

Huber, P.; Lindner, M.; Rolinec, M.; Schwetz, T.; Winter, W.

2005-01-01

We investigate the determination of neutrino oscillation parameters by experiments within the next ten years. The potential of conventional beam experiments (MINOS, ICARUS, OPERA), superbeam experiments (T2K, NOνA), and reactor experiments (D-CHOOZ) to improve the precision on the 'atmospheric' parameters Δm 31 2 , θ 23 , as well as the sensitivity to θ 13 are discussed. Further, we comment on the possibility to determine the leptonic CP-phase and the neutrino mass hierarchy if θ 13 turns out to be large

Echoes of the world; Echos du Monde

Energy Technology Data Exchange (ETDEWEB)

Anon

2007-09-15

EDF is authorized to dismantle Chooz A. The cooling towers of Calder Hall on the site of Sellafield were destroyed, within the framework of the demolition of the site.Belarus hopes to begin the building of a nuclear power plant in order to produce it own energy. Bangladesh is ready to build its first nuclear reactor. Germany cannot hold its commitment of CO{sub 2} reduction if it does not maintain the nuclear power production. Japan launches the next generation of light water advanced reactors. (N.C.)

Protection motivation theory in predicting intention to engage in protective behaviors against schistosomiasis among middle school students in rural China.

Science.gov (United States)

Xiao, Han; Li, Shiyue; Chen, Xinguang; Yu, Bin; Gao, Mengting; Yan, Hong; Okafor, Chukwuemeka N

2014-10-01

Among millions of people who suffer from schistosomiasis in China, adolescents are at increased risk to be infected. However, there is a lack of theory-guided behavioral prevention intervention programs to protect these adolescents. This study attempted to apply the Protection Motivation Theory (PMT) in predicting intentions to engage in protective behaviors against schistosomiasis infection. The participants were selected using the stratified cluster sampling method. Survey data were collected using anonymous self-reported questionnaire. The advanced structural equation modeling (SEM) method was utilized to assess the complex relationship among schistosomiasis knowledge, previous risk exposure and protective measures in predicting intentions to engage in protective behavior through the PMT constructs. Approximately 70% of participants reported they were always aware of schistosomiasis before exposure to water with endemic schistosomiasis, 6% of the participants reported frequency of weekly or monthly prior exposure to snail-conditioned water. 74% of participants reported having always engaged in protective behaviors in the past three months. Approximately 7% were unlikely or very unlikely to avoid contact with snail-conditioned water, and to use protective behaviors before exposure. Results from SEM analysis indicated that both schistosomiasis knowledge and prior exposure to schistosomiasis were indirectly related to behavior intentions through intrinsic rewards and self-efficacy; prior protective behaviors were indirectly related to behavior intentions through severity, intrinsic rewards and self-efficacy, while awareness had an indirect relationship with behavior intentions through self-efficacy. Among the seven PMT constructs, severity, intrinsic rewards and self-efficacy were significantly associated with behavior intentions. The PMT can be used to predict the intention to engage in protective behaviors against schistosomiasis. Schistosomiasis intervention

Protection Motivation Theory in Predicting Intention to Engage in Protective Behaviors against Schistosomiasis among Middle School Students in Rural China

Science.gov (United States)

Chen, Xinguang; Yu, Bin; Gao, Mengting; Yan, Hong; Okafor, Chukwuemeka N.

2014-01-01

Background Among millions of people who suffer from schistosomiasis in China, adolescents are at increased risk to be infected. However, there is a lack of theory-guided behavioral prevention intervention programs to protect these adolescents. This study attempted to apply the Protection Motivation Theory (PMT) in predicting intentions to engage in protective behaviors against schistosomiasis infection. Methods The participants were selected using the stratified cluster sampling method. Survey data were collected using anonymous self-reported questionnaire. The advanced structural equation modeling (SEM) method was utilized to assess the complex relationship among schistosomiasis knowledge, previous risk exposure and protective measures in predicting intentions to engage in protective behavior through the PMT constructs. Principal Findings Approximately 70% of participants reported they were always aware of schistosomiasis before exposure to water with endemic schistosomiasis, 6% of the participants reported frequency of weekly or monthly prior exposure to snail-conditioned water. 74% of participants reported having always engaged in protective behaviors in the past three months. Approximately 7% were unlikely or very unlikely to avoid contact with snail-conditioned water, and to use protective behaviors before exposure. Results from SEM analysis indicated that both schistosomiasis knowledge and prior exposure to schistosomiasis were indirectly related to behavior intentions through intrinsic rewards and self-efficacy; prior protective behaviors were indirectly related to behavior intentions through severity, intrinsic rewards and self-efficacy, while awareness had an indirect relationship with behavior intentions through self-efficacy. Among the seven PMT constructs, severity, intrinsic rewards and self-efficacy were significantly associated with behavior intentions. Conclusions The PMT can be used to predict the intention to engage in protective behaviors against

A novel compensation method for the anode gain non-uniformity of multi-anode photomultiplier tubes.

Science.gov (United States)

Lee, Chan Mi; Il Kwon, Sun; Ko, Guen Bae; Ito, Mikiko; Yoon, Hyun Suk; Lee, Dong Soo; Hong, Seong Jong; Lee, Jae Sung

2012-01-07

The position-sensitive multi-anode photomultiplier tube (MA-PMT) is widely used in high-resolution scintillation detectors. However, the anode gain nonuniformity of this device is a limiting factor that degrades the intrinsic performance of the detector module. The aim of this work was to develop a gain compensation method for the MA-PMT and evaluate the resulting enhancement in the performance of the detector. The method employs a circuit that is composed only of resistors and is placed between the MA-PMT and a resistive charge division network (RCN) used for position encoding. The goal of the circuit is to divide the output current from each anode, so the same current flows into the RCN regardless of the anode gain. The current division is controlled by the combination of a fixed-value series resistor with an output impedance that is much larger than the input impedance of the RCN, and a parallel resistor, which detours part of the current to ground. PSpice simulations of the compensation circuit and the RCN were performed to determine optimal values for the compensation resistors when used with Hamamatsu H8500 MAPMTs. The intrinsic characteristics of a detector module consisting of this MA-PMT and a lutetium-gadolinium-oxyorthosilicate (LGSO) crystal array were tested with and without the gain compensation method. In simulation, the average coefficient of variation and max/min ratio decreased from 15.7% to 2.7% and 2.0 to 1.2, respectively. In the flood map of the LGSO-H8500 detector, the uniformity of the photopeak position for individual crystals and the energy resolution were much improved. The feasibility of the method was shown by applying it to an octagonal prototype positron emission tomography scanner.

Protection motivation theory in predicting intention to engage in protective behaviors against schistosomiasis among middle school students in rural China.

Directory of Open Access Journals (Sweden)

Han Xiao

2014-10-01

Full Text Available Among millions of people who suffer from schistosomiasis in China, adolescents are at increased risk to be infected. However, there is a lack of theory-guided behavioral prevention intervention programs to protect these adolescents. This study attempted to apply the Protection Motivation Theory (PMT in predicting intentions to engage in protective behaviors against schistosomiasis infection.The participants were selected using the stratified cluster sampling method. Survey data were collected using anonymous self-reported questionnaire. The advanced structural equation modeling (SEM method was utilized to assess the complex relationship among schistosomiasis knowledge, previous risk exposure and protective measures in predicting intentions to engage in protective behavior through the PMT constructs.Approximately 70% of participants reported they were always aware of schistosomiasis before exposure to water with endemic schistosomiasis, 6% of the participants reported frequency of weekly or monthly prior exposure to snail-conditioned water. 74% of participants reported having always engaged in protective behaviors in the past three months. Approximately 7% were unlikely or very unlikely to avoid contact with snail-conditioned water, and to use protective behaviors before exposure. Results from SEM analysis indicated that both schistosomiasis knowledge and prior exposure to schistosomiasis were indirectly related to behavior intentions through intrinsic rewards and self-efficacy; prior protective behaviors were indirectly related to behavior intentions through severity, intrinsic rewards and self-efficacy, while awareness had an indirect relationship with behavior intentions through self-efficacy. Among the seven PMT constructs, severity, intrinsic rewards and self-efficacy were significantly associated with behavior intentions.The PMT can be used to predict the intention to engage in protective behaviors against schistosomiasis. Schistosomiasis

Measurement of the dynamic response of low-gain solid-state photodetector under weak pulse illumination

CERN Document Server

Clément, D; Morel, Christian

2000-01-01

This paper presents the development of a Tunable Light Pulse Generator built to measure the quantum efficiency of photodetectors under continuous or pulsed (20 ns FWHM) illumination as a function of wavelength in the Visible-UV region. For this purpose, a miniature Hamamatsu R5600U-04 PMT with low cathode resistivity can be used as reference detector. Dedicated electronics was developed in order to measure simultaneously the cathode and anode currents. This should allow to determine precisely the gain as a function of the high voltage applied to the PMT. Preliminary measurements using the TLPG do not demonstrate significant differences between the dynamic (approx 10 000 photons) and DC responses of PIN photodiodes down to 300 nm.

A high speed digitizing photomultiplier tube base for the KTeV CsI calorimeter

International Nuclear Information System (INIS)

Whitmore, J.

1994-11-01

A circuit has been designed to digitize PMT signals over an 18-bit dynamic range with 8-bits of resolution. The crucial element of the circuit is the custom charge integrating and encoding (QIE) ASIC. This chip is designed to operate at rates up to 53 MHz, and, in conjunction with an 8-bit FADC, generates 12-bit floating point output. Bench tests of a 17-bit version of the digital base demonstrated excellent noise performance, linearity and pedestal and gain stability. Twenty-five channels of digitizing PMT bases have been built and used for readout of a CsI array in a test beam at CERN. Performance of these devices in a beam environment is discussed

Performance of an electromagnetic calorimeter with lead-tungstate crystals

International Nuclear Information System (INIS)

Kohara, R.; Sugitate, T.; Sugita, N.; Tsuchimoto, Y.; Toyoda, D.; Homma, K.; Yamazaki, H.

2003-01-01

The performance of an electromagnetic calorimeter with lead-tungstate (PWO) crystals was tested by using 1 GeV photons. The calorimeter consisted of nine crystals of 20 x 20 x 200 mm in size arranged in a 3 x 3 array. The energy resolution was obtained to be σ E /E = (2.50 ± 0.75%) / √E + (1.25 ± 0.34%) with a photomultiplier tube (PMT) reading all signals. Another setup, reading the central cell with an avalanche photo diode (APD) and the surrounding 8 cells with the PMT, was also studied, however, its energy resolution was not scaled with the stochastic function and we found the resolution of about 10% around 1 GeV. (author)

Skin cancer preventive behaviors among rural farmers: An intervention based on protection motivation theory.

Science.gov (United States)

Babazadeh, Towhid; Kamran, Aziz; Dargahi, Abdollah; Moradi, Fatemeh; Shariat, Fariba; Rezakhani Moghaddam, Hamed

2016-01-01

Background: Skin cancer is a serious public health problem in the world. Its prevalence in many countries has been increased in recent years. This study aimed to assess the effects of a theory-based educational intervention to promote skin cancer preventive behaviors (SCPBs) among rural farmers in Chalderan County, Iran. Methods: This was a quasi-randomized controlled field trial study conducted on 238 rural farmers. The data were collected by a questionnaire containing the constructs of the Protection Motivation Theory (PMT) as well as the items of SCPBs. The differences between the groups before and 3 months after the intervention were determined by independent t-test, paired t-test, and chi-square applying SPSS software. Results: Before the intervention, no significant difference was found in the scores of the PMT constructs between the two groups (p>0.05). However, significant differences were found between the scores of all the variables, as well as SCPBs, in the two groups after the intervention (p<0.05). Conclusion: The PMT was found to be an appropriate framework for designing educational interventions aiming at promoting SCPBs among rural farmers. It was concluded that designing an educational program with a focus on promoting perceived susceptibility increased the level of performing SCPBs among the rural farmers.

Imaging technique of whole-body scintigram in the event of breakdown of the photomultiplier tube

International Nuclear Information System (INIS)

Inagaki, Syoichi; Tonami, Syuichi; Yasui, Masakazu; Sugishita, Kouki; Nakamura, Mamoru; Kuranishi, Makoto

1997-01-01

When the PMT and preamplifier are out of order, it is impossible to make a correct diagnosis because of defects on the scintigram. However, repair of the equipment may take a long time. In order to perform emergent whole-body scintigrams in the event of such breakdowns, we have developed a new approach named the lead-shield method. The major principles of this method involve placing a lead shield on the gamma camera such that it corresponds to the area of the abnormal PMT and making use of the normal area of the detector. The lead shield, 2 mm thick and 1.5 times as wide as the defect on a planar image, was situated perpendicular to the scan plane of the whole-body scintigram. The results showed that whole-body scintigrams obtained by the lead-shield method had the same quality as those obtained by the conventional method, and the spatial resolution and uniformity showed nearly no change despite some disadvantages such as lower sensitivity and shorter scan length. The lead-shield method can be a useful tool for the performance of whole-body scintigrams in cases of emergency when the PMT and preamplifier are out of order. (author)

Determinants of Cancer Early Detection Behaviors:Application of Protection Motivation Theory.

Science.gov (United States)

Rahaei, Zohreh; Ghofranipour, Fazlollah; Morowatisharifabad, Mohammad Ali; Mohammadi, Eesa

2015-01-01

Cancer is account for 13% of all deaths around the world and is the third cause of mortality in Iran. More than one third of these cases are pre-ventable and about 33% are curable with early detection. The aim of this study was to determine the predictors of cancer early detection (CED) behaviors applying Protection Motivation Theory (PMT). In this cross-sectional study, cluster sampling method was employed to recruit 260 individuals of above 20 years old in Yazd, Iran and a researcher designed questionnaire was completed through interviews for each of the respondents. PMT theoretical variables and CED behaviors were the basis of data collection procedure. Participants acquired 64.47% of the protection motivation, 30.97% of the passive and 45.64% of the active behaviors‟ possible scores. Theory constructs predicted 19.8%, 15.6% and 9.6% of the variations for protection motivation, passive and active behavior respectively. Protection motivation was responsible for 3.6% of passive and 8% of active behaviors‟ variations. Considering the scarceness of CED behaviors and the applicability of PMT in predicting these behaviors, utilization of the PMT‟s constructs in any interventional programs to accelerate CED behaviors could be an alternate methodological choice in the cancer control initiatives.

Women's preferences for selective estrogen reuptake modulators: an investigation using protection motivation theory.

Science.gov (United States)

Ralph, Angelique F; Ager, Brittany; Bell, Melanie L; Collins, Ian M; Andrews, Lesley; Tucker, Kathy; Phillips, Kelly-Anne; Butow, Phyllis

2014-07-01

Selective estrogen receptor modulators (SERMs) reduce breast cancer risk by 38%. However, uptake is low and the reasons are not well understood. This study applied protection motivation theory (PMT) to determine factors associated with intention to take SERMs. Women at increased risk of breast cancer (N=107), recruited from two familial cancer clinics in Australia, completed a questionnaire containing measures of PMT constructs. Hierarchical multiple linear regression analysis was used to analyze the data. Forty-five percent of women said they would be likely or very likely to take SERMs in the future. PMT components accounted for 40% of variance in intention to take SERMs. Perceived vulnerability, severity and response efficacy appeared the most influential in women's decisions to take or not take SERMs. Many women are interested in SERMs as a risk management option. Accurate risk estimation and an understanding of the benefits of SERMs are critical to women's decision making. Health professionals need to explore women's perceptions of their risk and its consequences, as well as providing clear evidence-based information about the efficacy of SERMs. Exploring the source and strength of beliefs about SERMs may allow more effective, tailored counseling. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

Imaging technique of whole-body scintigram in the event of breakdown of the photomultiplier tube

Energy Technology Data Exchange (ETDEWEB)

Inagaki, Syoichi; Tonami, Syuichi; Yasui, Masakazu; Sugishita, Kouki; Nakamura, Mamoru; Kuranishi, Makoto [Toyama Medical and Pharmaceutical Univ. (Japan). Hospital

1997-10-01

When the PMT and preamplifier are out of order, it is impossible to make a correct diagnosis because of defects on the scintigram. However, repair of the equipment may take a long time. In order to perform emergent whole-body scintigrams in the event of such breakdowns, we have developed a new approach named the lead-shield method. The major principles of this method involve placing a lead shield on the gamma camera such that it corresponds to the area of the abnormal PMT and making use of the normal area of the detector. The lead shield, 2 mm thick and 1.5 times as wide as the defect on a planar image, was situated perpendicular to the scan plane of the whole-body scintigram. The results showed that whole-body scintigrams obtained by the lead-shield method had the same quality as those obtained by the conventional method, and the spatial resolution and uniformity showed nearly no change despite some disadvantages such as lower sensitivity and shorter scan length. The lead-shield method can be a useful tool for the performance of whole-body scintigrams in cases of emergency when the PMT and preamplifier are out of order. (author)

A fiber-optic sorbitol biosensor based on NADH fluorescence detection toward rapid diagnosis of diabetic complications.

Science.gov (United States)

Gessei, Tomoko; Arakawa, Takahiro; Kudo, Hiroyuki; Mitsubayashi, Kohji

2015-09-21

Accumulation of sorbitol in the tissue is known to cause microvascular diabetic complications. In this paper, a fiber-optic biosensor for sorbitol which is used as a biomarker of diabetic complications was developed and tested. The biosensor used a sorbitol dehydrogenase from microorganisms of the genus Flavimonas with high substrate specificity and detected the fluorescence of reduced nicotinamide adenine dinucleotide (NADH) by the enzymatic reaction. An ultraviolet light emitting diode (UV-LED) was used as the excitation light source of NADH. The fluorescence of NADH was detected using a spectrometer or a photomultiplier tube (PMT). The UV-LED and the photodetector were coupled using a Y-shaped optical fiber. In the experiment, an optical fiber probe with a sorbitol dehydrogenase immobilized membrane was placed in a cuvette filled with a phosphate buffer containing the oxidized form of nicotinamide adenine dinucleotide (NAD(+)). The changes in NADH fluorescence intensity were measured after adding a standard sorbitol solution. According to the experimental assessment, the calibration range of the sorbitol biosensor systems using a spectrometer and a PMT was 5.0-1000 μmol L(-1) and 1.0-1000 μmol L(-1), respectively. The sorbitol biosensor system using the sorbitol dehydrogenase from microorganisms of the genus Flavimonas has high selectivity and sensitivity compared with that from sheep liver. The sorbitol biosensor allows for point-of-care testing applications or daily health care tests for diabetes patients.

Expanding of FOV of NaI(Tl) gamma camera detectors-Is it possible?

International Nuclear Information System (INIS)

Gayshan, Vadim L.; Gektin, A.V.; Boyarintsev, A.; Pedash, V.

2006-01-01

Every gamma camera detector used for medical imaging of conventional design faces the problem of distorted or no information readout at the areas closer to the edge of detectors. Obtaining position and energy information becomes almost impossible at distance 0-12 of PMT size from the edge. Therefore, in some designs were proposed losing of edge energy resolution while improving in spatial uniformity when it comes to imaging at the edges. This work is dedicated to understanding of the problem, mathematical simulations, practical tests and recommendations to build detectors with larger usable FOV without increasing in dimensions. To study the problem we built the test jig with linear motion source and readout electronics to simulate gamma cameras of PMTs. Based on simulation results the idea of modifying of crystal shape combined with specific light redirection system of baffles was tested and allowed to expand usable FOV. The results are presented and showed that for traditional NaI(Tl) scintillators using 2'' PMT may be possible to obtain relatively good spatial resolution starting from 4-5mm from the edge of a detector. The question of economical efficiency of proposed method is being investigated and a special detector manufacturing technology must be developed to accommodate this. While we believe that achieved results are very important for small size detectors (<20cm) they could be beneficial even for larger detectors used in whole body imaging systems

Passive magnetic cylindrical shielding at gauss-range static fields

International Nuclear Information System (INIS)

Calvo, E.; Cerrada, M.; Gil-Botella, I.; Palomares, C.; Rodriguez, I.; Toral, F.; Verdugo, A.

2009-01-01

A study has been performed in order to find the optimal solution for the magnetic shielding of the 10 in. photomultipliers which will be used in the Double Chooz neutrino experiment under a very low magnetic field (less than 2 G). The results obtained with analytical and numerical calculations are compared with measurements made using test prototypes of several magnetic materials, with different dimensions and from different manufacturers. An exhaustive analysis of the magnetic materials was needed to understand the observed disagreement between calculations and test results obtained at low field values.

Contribution to the build-up of a core calculation frame: comparison between ''diffusion'' and ''SPn'' operators on various configurations of the first N4 core

International Nuclear Information System (INIS)

Magat, Ph.

1997-04-01

The aim of this study is to compare two calculation methods implemented in the neutronic code CRONOS 2: the diffusion approximation and the SP n method. The APOLLO 2 code is used to build the multiparameter cross section libraries.The comparison is based on the first core of N4 type Chooz reactor. The rod worth and the power map have been calculated. Some recommendations about the SP n development order of flux are made and the results show that the diffusion calculations over-estimate the black rod efficiency up to 10%. (A.C.)

Ocean Color Underwater Low Light Advanced Radiometer—Ocean Color at Night

Data.gov (United States)

National Aeronautics and Space Administration — The OCULLAR activity pairs a miniature and ruggedized photomultiplier tube (PMT) with an existing commercial-off-the-shelf (COTS) silicon photodetector (SiP)...

Long-duration conservation of a nuclear power plant unit under construction

International Nuclear Information System (INIS)

Brun, C.; Long, A.; Saurin, P.; Liquette, A.

1994-01-01

The experience described is that of the Chooz B1 NPP unit, which had to be put into a state of conservation for one and one-half years with the reactor coolant system and auxiliary systems having been completely erected and internally cleaned. Erection of the secondary systems had been 80% completed. The dry conservation technique was adopted for all of the fluid systems and components, except for the injection and leakoff lines of the four reactor coolant pump no. 1 seals, for which wet conservation was employed. For the buildings themselves, Electricite de France (EdF) took measures to facilitate conservation, including ventilation and heating, limiting the entry of atmospheric air, and evacuating the dehumidifier regeneration air to the atmosphere via a collector and a fan. This conservation required the installation of 20 dry air generators, which enabled continuously circulating dry air through the systems and components. Monthly or bimonthly relative humidity checks, depending on the systems, were carried out. The results of these checks showed that the relative humidity remained below 50% throughout the NPP unit conservation period. For the steam generators, in addition to dry air circulation, humidity detectors as well as corrosion test coupons were installed on the tube sheet. (authors). 5 figs

Monte Carlo calculations of the optical coupling between bismuth germanate crystals and photomultiplier tubes

International Nuclear Information System (INIS)

Derenzo, S.E.; Riles, J.K.

1981-10-01

The high density and atomic number of bismuth germanate (Bi 4 Ge 3 O 12 or BGO) make it a very useful detector for positron emission tomography. Modern tomograph designs use large numbers of small, closely-packed crystals for high spatial resolution and high sensitivity. However, the low light output, the high refractive index (n=2.15), and the need for accurate timing make it important to optimize the transfer of light to the photomultiplier tube (PMT). We describe the results of a Monte Carlo computer program developed to study the effect of crystal shape, reflector type, and the refractive index of the PMT window on coupling efficiency. The program simulates total internal, external, and Fresnel reflection as well as internal absorption and scattering by bubbles

Hostility and hearing protection behavior: the mediating role of personal beliefs and low frustration tolerance.

Science.gov (United States)

Rabinowitz, S; Melamed, S; Feiner, M; Weisberg, E; Ribak, J

1996-10-01

The authors examined whether hostility would negatively be associated with occupational health behavior, namely, the use of hearing protection devices (HPDs). Also examined as possible mediators were the protection motivation theory (PMT) components and low frustration tolerance (LFT). Participants were 226 male industrial workers, all exposed to potentially hearing-damaging noise. Hostility was negatively related to HPD use. It moderately correlated with the PMT components: negatively with perceived susceptibility, severity, effectiveness, and self-efficacy and positively with perceived barriers. Hostility correlated highly with LFT. Regression analyses confirmed the mediating role of perceived barriers, low self-efficacy, and LFT in the negative relationship between hostility and the use of HPDs. Thus, intrapsychic characteristics of hostile people may be significant for hearing protection behavior.

Development of gaseous photomultiplier

International Nuclear Information System (INIS)

Tokanai, F.; Sumiyoshi, T.; Sugiyama, H.; Okada, T.

2014-01-01

We have been developing gaseous photomultiplier tubes (PMTs) with alkali photocathode combined with micropattern gas detectors (MPGDs). The potential advantage of the gaseous PMT is that it can achieve a very large effective area with adequate position and timing resolutions. In addition, it will be easily operated under a very high magnetic field, compared with the conventional vacuum-based PMT. To evaluate the gaseous PMTs filled with Ne and Ar based gas mixture, we have developed gaseous PMTs with an alkali photocathode combined with MPGDs such as a glass capillary plate, GEM, and Micromegas detector. We describe the recent development of the gaseous PMTs, particularly the production of the photocathode, gas gain, ion and photon feedbacks, quantum efficiency, and the characteristics in the magnetic field environment. (author)

A study of muon neutrino to electron neutrino oscillations in the MINOS experiment

Energy Technology Data Exchange (ETDEWEB)

Yang, Tingjun [Stanford Univ., CA (United States)

2009-03-01

distinguish the electron neutrino signal from background. The most important part of this measurement is the background estimation, which is done through extrapolation. The number of background events is measured at the Near Detector, then extrapolated to the Far Detector. Since different background sources extrapolate differently, some knowledge about the relative contribution from different background sources is necessary. We developed a method that can be used to obtain relative contributions of various background sources from comparison of background rates in the horn-on and horn-off configurations. We also described our effort to improve two aspects of the Monte Carlo simulation which are very important for the v_e appearance analysis: one is the hadronization model in the neutrino-nucleon interactions, the other is the modeling of PMT crosstalk. We performed a blind analysis and examined several sidebands before looking at the signal region. After we opened the box, we observed a 1.4 σ excess of v_e-like events in the Far Detector compared with the number of predicted background events. The excess is well within the statistical fluctuation of the background events. If we interpret the excess as a v_e signal from v_μ → v_e oscillation, the best fit sin² 2θ₁₃ value is consistent with the CHOOZ limit. However we want to emphasize that our result is consistent with θ₁₃ = 0 at 90% C.L..

Neutrino GDR meeting

International Nuclear Information System (INIS)

Aguilar-Saavedra, J.A.; Camilleri, L.; Mention, G.; VanElewyck, V.; Verderi, M.; Blondel, A.; Augier, C.; Bellefon, A. de; Coc, A.; Duchesneau, D.; Favier, J.; Lesgourgues, J.; Payet, J.

2006-01-01

The purpose of the neutrino GDR (research program coordination) is to federate the activities of French research teams devoted to studying the neutrino. The presentations have been organized on 2 days. A review of the present status of the theoretical and experimental knowledge on neutrinos on a worldwide basis has been made on the first day while the second day has been dedicated to reporting the activities of the 5 following working groups: 1) determination of neutrino parameters, 2) physics beyond the standard model, 3) neutrinos in the universe, 4) neutrino detection, and 5) common tools. During the first day the American neutrino research program has been presented through the description of the 2 neutrino detection systems: Nova and Minor. The following neutrino experiments involving nuclear reactors: Chooz (France), Daya-bay (China), Reno (Korea) and Angra (Brazil) have also been reviewed. This document is made up of the slides of the presentations

Characterization of porcine eyes based on autofluorescence lifetime imaging

Science.gov (United States)

Batista, Ana; Breunig, Hans Georg; Uchugonova, Aisada; Morgado, António Miguel; König, Karsten

2015-03-01

Multiphoton microscopy is a non-invasive imaging technique with ideal characteristics for biological applications. In this study, we propose to characterize three major structures of the porcine eye, the cornea, crystalline lens, and retina using two-photon excitation fluorescence lifetime imaging microscopy (2PE-FLIM). Samples were imaged using a laser-scanning microscope, consisting of a broadband sub-15 femtosecond (fs) near-infrared laser. Signal detection was performed using a 16-channel photomultiplier tube (PMT) detector (PML-16PMT). Therefore, spectral analysis of the fluorescence lifetime data was possible. To ensure a correct spectral analysis of the autofluorescence lifetime data, the spectra of the individual endogenous fluorophores were acquired with the 16-channel PMT and with a spectrometer. All experiments were performed within 12h of the porcine eye enucleation. We were able to image the cornea, crystalline lens, and retina at multiple depths. Discrimination of each structure based on their autofluorescence intensity and lifetimes was possible. Furthermore, discrimination between different layers of the same structure was also possible. To the best of our knowledge, this was the first time that 2PE-FLIM was used for porcine lens imaging and layer discrimination. With this study we further demonstrated the feasibility of 2PE-FLIM to image and differentiate three of the main components of the eye and its potential as an ophthalmologic technique.

Use of protection motivation theory, affect, and barriers to understand and predict adherence to outpatient rehabilitation.

Science.gov (United States)

Grindley, Emma J; Zizzi, Samuel J; Nasypany, Alan M

2008-12-01

Protection motivation theory (PMT) has been used in more than 20 different health-related fields to study intentions and behavior, albeit primarily outside the area of injury rehabilitation. In order to examine and predict patient adherence behavior, this study was carried out to explore the use of PMT as a screening tool in a general sample of people with orthopedic conditions. New patients who were more than 18 years old and who were prescribed 4 to 8 weeks of physical therapy treatment (n=229) were administered a screening tool (Sports Injury Rehabilitation Beliefs Scale, Positive and Negative Affect Schedule, and a barriers checklist) prior to treatment. Participants' adherence was assessed with several attendance measures and an in-clinic assessment of behavior. Statistical analyses included correlation, chi-square, multiple regression, and discriminant function analyses. A variety of relationships among affect, barriers, and PMT components were evident. In-clinic behavior and attendance were influenced by affect, whereas dropout status was predicted by affect, severity, self-efficacy, and age. The screening tool used in this study may assist in identifying patients who are at risk for poor adherence and provide valuable information to enhance provider-patient relationships and foster patient adherence. However, it is recommended that more research be conducted to further understand the impact of variables on patient adherence and that the screening tool be enhanced to increase its predictive ability.

Influence of Piezosurgery on Bone Healing around Titanium Implants: A Histological Study in Rats.

Science.gov (United States)

Sirolli, Marcelo; Mafra, Carlos Eduardo Secco; Santos, Rodrigo Albuquerque Basílio Dos; Saraiva, Luciana; Holzhausen, Marinella; César, João Batista

2016-01-01

The aim of this study was to evaluate histomorphometrically the influence of two techniques of dental implant site preparation on bone healing around titanium implants. Fifteen male Wistar rats (±300 g) were used in the study. Each tibia was randomly assigned to receive the implant site preparation either with a conventional drilling technique (control - DRILL group) or with a piezoelectric device (PIEZO group). The animals were sacrificed after 30 days and then the following histomorphometric parameters were evaluated (percentage) separately for cortical and cancellous regions: proportion of mineralized tissue (PMT) adjacent to implant threads (500 μm adjacent); bone area within the threads (BA) and bone-implant contact (BIC). The results demonstrated that there were no statistically significant differences between both groups for cancellous BIC (p>0.05) and cortical PMT (p>0.05). On the other hand, a higher percentage of BA was observed in the PIEZO group in the cortical (71.50±6.91 and 78.28±4.38 for DRILL and PIEZO groups, respectively; ppiezosurgery also showed higher PMT values in the cancellous zone (9.35±5.54 and 18.72±13.21 for DRILL and PIEZO groups, respectively; ppiezosurgery was beneficial to bone healing rates in the cancellous bone region, while the drill technique produced better results in the cortical bone.

Evaluation of light Collection in Radiation Portal Monitor with Multi PMTs using Monte Carlo simulation

International Nuclear Information System (INIS)

Lim, Chang Hwy; Park, Jong Won; Lee, Junghee; Moon, Myung Kook; Kim, Jongyul; Lee, Suhyun

2015-01-01

A plastic scintillator in the RPM is suited for the γ-ray detection of various-range energy and is the cost effective radiation detection material. In order to well inspect emitted radiation from the container cargo, the radiation detection area of a plastic scintillator should be larger than other general purpose radiation detector. However, the large size plastic scintillator affects the light collection efficiency at the photo-sensitive sensor due to the long light transport distance and light collisions in a plastic scintillator. Therefore, the improvement of light collection efficiency in a RPM is one of the major issues for the high performance RPM development. We calculated the change of the number of collected light according to changing of the attachment position and number of PMT. To calculate the number of collected light, the DETECT2000 and MCNP6 Monte Carlo simulation software tool was used. Response signal performance of RPM system is affected by the position of the incident radiation. If the distance between the radiation source and a PMT is long, the number of loss signal is larger. Generally, PMTs for signal detection in RPM system has been attached on one side of plastic scintillator. In contrast, RPM model in the study have 2 PMTs, which attached at the two side of plastic scintillator. We estimated difference between results using the old method and our method. According to results, uniformity of response signal was better than method using one side. If additive simulation and experiment is performed, it will be possible to develop the improved RPM system. In the future, we will perform additive simulation about many difference RPM model

Evaluation of light Collection in Radiation Portal Monitor with Multi PMTs using Monte Carlo simulation

Energy Technology Data Exchange (ETDEWEB)

Lim, Chang Hwy; Park, Jong Won; Lee, Junghee [Korea Research Institute of Ships and Ocean Engineering, Daejeon (Korea, Republic of); Moon, Myung Kook; Kim, Jongyul; Lee, Suhyun [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

2015-10-15

A plastic scintillator in the RPM is suited for the γ-ray detection of various-range energy and is the cost effective radiation detection material. In order to well inspect emitted radiation from the container cargo, the radiation detection area of a plastic scintillator should be larger than other general purpose radiation detector. However, the large size plastic scintillator affects the light collection efficiency at the photo-sensitive sensor due to the long light transport distance and light collisions in a plastic scintillator. Therefore, the improvement of light collection efficiency in a RPM is one of the major issues for the high performance RPM development. We calculated the change of the number of collected light according to changing of the attachment position and number of PMT. To calculate the number of collected light, the DETECT2000 and MCNP6 Monte Carlo simulation software tool was used. Response signal performance of RPM system is affected by the position of the incident radiation. If the distance between the radiation source and a PMT is long, the number of loss signal is larger. Generally, PMTs for signal detection in RPM system has been attached on one side of plastic scintillator. In contrast, RPM model in the study have 2 PMTs, which attached at the two side of plastic scintillator. We estimated difference between results using the old method and our method. According to results, uniformity of response signal was better than method using one side. If additive simulation and experiment is performed, it will be possible to develop the improved RPM system. In the future, we will perform additive simulation about many difference RPM model.

Delayed gamma-ray spectroscopy with lanthanum bromide detector for non-destructive assay of nuclear material

Science.gov (United States)

Favalli, Andrea; Iliev, Metodi; Ianakiev, Kiril; Hunt, Alan W.; Ludewigt, Bernhard

2018-01-01

High-energy delayed γ-ray spectroscopy is a potential technique for directly assaying spent fuel assemblies and achieving the safeguards goal of quantifying nuclear material inventories for spent fuel handling, interim storage, reprocessing facilities, repository sites, and final disposal. Requirements for the γ-ray detection system, up to ∼6 MeV, can be summarized as follows: high efficiency at high γ-ray energies, high energy resolution, good linearity between γ-ray energy and output signal amplitude, ability to operate at very high count rates, and ease of use in industrial environments such as nuclear facilities. High Purity Germanium Detectors (HPGe) are the state of the art and provide excellent energy resolution but are limited in their count rate capability. Lanthanum Bromide (LaBr3) scintillation detectors offer significantly higher count rate capabilities at lower energy resolution. Thus, LaBr3 detectors may be an effective alternative for nuclear spent-fuel applications, where count-rate capability is a requirement. This paper documents the measured performance of a 2" (length) × 2" (diameter) of LaBr3 scintillation detector system, coupled to a negatively biased PMT and a tapered active high voltage divider, with count-rates up to ∼3 Mcps. An experimental methodology was developed that uses the average current from the PMT's anode and a dual source method to characterize the detector system at specific very high count rate values. Delayed γ-ray spectra were acquired with the LaBr3 detector system at the Idaho Accelerator Center, Idaho State University, where samples of ∼3g of 235U were irradiated with moderated neutrons from a photo-neutron source. Results of the spectroscopy characterization and analysis of the delayed γ-ray spectra acquired indicate the possible use of LaBr3 scintillation detectors when high count rate capability may outweigh the lower energy resolution.

Genomic organization of plant aminopropyl transferases.

Science.gov (United States)

Rodríguez-Kessler, Margarita; Delgado-Sánchez, Pablo; Rodríguez-Kessler, Gabriela Theresia; Moriguchi, Takaya; Jiménez-Bremont, Juan Francisco

2010-07-01

Aminopropyl transferases like spermidine synthase (SPDS; EC 2.5.1.16), spermine synthase and thermospermine synthase (SPMS, tSPMS; EC 2.5.1.22) belong to a class of widely distributed enzymes that use decarboxylated S-adenosylmethionine as an aminopropyl donor and putrescine or spermidine as an amino acceptor to form in that order spermidine, spermine or thermospermine. We describe the analysis of plant genomic sequences encoding SPDS, SPMS, tSPMS and PMT (putrescine N-methyltransferase; EC 2.1.1.53). Genome organization (including exon size, gain and loss, as well as intron number, size, loss, retention, placement and phase, and the presence of transposons) of plant aminopropyl transferase genes were compared between the genomic sequences of SPDS, SPMS and tSPMS from Zea mays, Oryza sativa, Malus x domestica, Populus trichocarpa, Arabidopsis thaliana and Physcomitrella patens. In addition, the genomic organization of plant PMT genes, proposed to be derived from SPDS during the evolution of alkaloid metabolism, is illustrated. Herein, a particular conservation and arrangement of exon and intron sequences between plant SPDS, SPMS and PMT genes that clearly differs with that of ACL5 genes, is shown. The possible acquisition of the plant SPMS exon II and, in particular exon XI in the monocot SPMS genes, is a remarkable feature that allows their differentiation from SPDS genes. In accordance with our in silico analysis, functional complementation experiments of the maize ZmSPMS1 enzyme (previously considered to be SPDS) in yeast demonstrated its spermine synthase activity. Another significant aspect is the conservation of intron sequences among SPDS and PMT paralogs. In addition the existence of microsynteny among some SPDS paralogs, especially in P. trichocarpa and A. thaliana, supports duplication events of plant SPDS genes. Based in our analysis, we hypothesize that SPMS genes appeared with the divergence of vascular plants by a processes of gene duplication and the

EDF decommissioning programme a global commitment to safety, environment and cost efficiency of nuclear energy

International Nuclear Information System (INIS)

Grenouillet, J.-J.

2002-01-01

EDF has 9 NPPs permanently shutdown and under decommissioning. EDF considers that if the nuclear option is to remain open, it is necessary to deal with increasing public concerns for environmental and waste management issues. Therefore EDF has decided to achieve total dismantling of all shutdown reactor in the next 25 years. The Decommissioning Program has been developed including 2 stages of activities. The first stage consists of: 1) Final dismantling of Brennilis in 2015; 2) A dismantling demonstration of a PWR reactor building (Chooz A) before starting replacing the population of PWRs currently in operation; 3) Final dismantling of reactor containment of a GCR (Bugey 1) as a first of its kind. The second stage includes: 1)Dismantling of following 5 GCR (Saint Laurent A1 and A2, Chinon A1, A2 and A3); 2) Final dismantling of Chooz A and Bugey 1 in 2025. The successful implementation relies on the simplification of the regulatory process; availability of treatment, conditioning and disposal facilities and effective nuclear industry. The main issue is availability of time and waste solutions such as opening of a Very Low Waste disposal in 2003 (130 000 tons); opening of a new disposal for graphite and radiferous wastes (17 000 tons) in 2010 and opening in 2007-2008 of a centralized interim storage (BANEDA) facility for long-lived Medium Level Wastes (500 tons including filters, control rods etc)Three investigations are to be carried out for high level radioactive waste before 2006

High spatial resolution measurement of depth-of-interaction of a PET LSO crystal

International Nuclear Information System (INIS)

Simon, A.; Kalinka, G.; Novak, D.; Sipos, A.; Vegh, J.; Molnar, J.

2004-01-01

Complete text of publication follows. A new type of experimental technique to investigate the depth-of-interaction (DOI) dependence in small scintillator elements designed for high-resolution animal PET [1] has been introduced at our institute, recently. A lutetium oxyorthosilicate (LSO) crystal (2x2x10 mm 3 ) was irradiated with a highly focused 2 MeV He + beam at the ATOMKI nuclear microprobe laboratory. Pulse height spectra from a photomultiplier (PMT) attached to one end of the LSO crystal were collected in list mode. Sequential scans of 1000x1000 μm 2 areas along the 10 mm long crystal were made to get high lateral resolution images of pulse height spectra at different distances from the window of the PMT. A mean pulse height algorithm was applied to each pixel to generate two dimensional intensity images and the corresponding spectra of 100 μmx1 mm areas. Representative pulse height spectra are shown in Fig. 1 for different distances between the position of irradiation and the PMT. The mean value of the pulse height spectrum describing the position of the full energy peak is a way to measure DOI effects. It is seen that the closer the DOI to the PMT-end of the crystal the higher the energy of the peak. The centre of the detected peak varies about 30 % along the lateral side of the crystal. This effect is due to the increasing number of reflections with associated loss of light when the distance between the DOI position and the light collecting PMT grows. Further these results, no difference in the light intensity was found depending on which position across (perpendicular to the length of) the crystal was irradiated with the microbeam. The obtained results of the overall DOI dependence confirm previous measurements on LSO crystals with similar geometry and wrapping but based on collimated gamma-ray irradiation. Since the present experimental setup allows obtaining data with several orders of magnitude better spatial resolution (from μm up to mm) than with

Channel control ASIC for the CMS hadron calorimeter front end readout module

International Nuclear Information System (INIS)

Ray Yarema et al.

2002-01-01

The Channel Control ASIC (CCA) is used along with a custom Charge Integrator and Encoder (QIE) ASIC to digitize signals from the hybrid photo diodes (HPDs) and photomultiplier tubes (PMTs) in the CMS hadron calorimeter. The CCA sits between the QIE and the data acquisition system. All digital signals to and from the QIE pass through the CCA chip. One CCA chip interfaces with two QIE channels. The CCA provides individually delayed clocks to each of the QIE chips in addition to various control signals. The QIE sends digitized PMT or HPD signals and time slice information to the CCA, which sends the data to the data acquisition system through an optical link

Quality Assurance on Undoped CsI Crystals for the Mu2e Experiment

Science.gov (United States)

Atanov, N.; Baranov, V.; Budagov, J.; Davydov, Yu. I.; Glagolev, V.; Tereshchenko, V.; Usubov, Z.; Cervelli, F.; Di Falco, S.; Donati, S.; Morescalchi, L.; Pedreschi, E.; Pezzullo, G.; Raffaelli, F.; Spinella, F.; Colao, F.; Cordelli, M.; Corradi, G.; Diociaiuti, E.; Donghia, R.; Giovannella, S.; Happacher, F.; Martini, M.; Miscetti, S.; Ricci, M.; Saputi, A.; Sarra, I.; Echenard, B.; Hitlin, D. G.; Hu, C.; Miyashita, T.; Porter, F.; Zhang, L.; Zhu, R.-Y.; Grancagnolo, F.; Tassielli, G.; Murat, P.

2018-02-01

The Mu2e experiment is constructing a calorimeter consisting of 1,348 undoped CsI crystals in two disks. Each crystal has a dimension of 34 x 34 x 200 mm, and is readout by a large area silicon PMT array. A series of technical specifications was defined according to physics requirements. Preproduction CsI crystals were procured from three firms: Amcrys, Saint-Gobain and Shanghai Institute of Ceramics. We report the quality assurance on crystal's scintillation properties and their radiation hardness against ionization dose and neutrons. With a fast decay time of 30 ns and a light output of more than 100 p.e./MeV measured with a bi-alkali PMT, undoped CsI crystals provide a cost-effective solution for the Mu2e experiment.

The performance of a prototype array of water Cherenkov detectors for the LHAASO project

Science.gov (United States)

An, Q.; Bai, Y. X.; Bi, X. J.; Cao, Z.; Chang, J. F.; Chen, G.; Chen, M. J.; Chen, S. M.; Chen, S. Z.; Chen, T. L.; Chen, X.; Chen, Y. T.; Cui, S. W.; Dai, B. Z.; Du, Q.; Danzengluobu; Feng, C. F.; Feng, S. H.; Gao, B.; Gao, S. Q.; Ge, M. M.; Gu, M. H.; Hao, X. J.; He, H. H.; Hou, C.; Hu, H. B.; Hu, X. B.; Huang, J.; Huang, W. P.; Jia, H. Y.; Jiang, K.; Liu, J.; Liu, J. L.; Liu, J. S.; Liu, S. B.; Liu, Y.; Liu, Y. N.; Li, Q. J.; Li, C.; Li, F.; Li, H. C.; Li, X. R.; Lu, H.; Lv, H. K.; Mao, Y. J.; Ma, L. L.; Ma, X. H.; Shao, J.; Shao, M.; Sheng, X. D.; Sun, G. X.; Sun, Z. B.; Tang, Z. B.; Wu, C. Y.; Wu, H. R.; Wu, Q.; Xiao, G.; Xu, Y.; Yang, Q. Y.; Yang, R.; Yao, Z. G.; You, X. H.; Yuan, A. F.; Zhang, B. K.; Zhang, H. M.; Zhang, S. R.; Zhang, S. S.; Zhang, X. Y.; Zhang, Y.; Zhang, L.; Zhai, L. M.; Zhao, J.; Zhao, L.; Zhao, Z. G.; Zha, M.; Zhou, B.; Zhu, F. R.; Zhu, K. J.; Zhuang, J.; Zuo, X.

2013-10-01

A large high-altitude air-shower observatory (LHAASO) is to be built at Shangri-La, Yunnan Province, China. This observatory is intended to conduct sub-TeV gamma astronomy, and as an important component of the LHAASO project, a water Cherenkov detector array (WCDA) is proposed. To investigate engineering issues and fully understand the water Cherenkov technique for detecting air showers, a prototype array at 1% scale of the LHAASO-WCDA has been built at Yang-Ba-Jing, Tibet, China. This paper introduces the prototype array setup and studies its performance by counting rate of each photomultiplier tube (PMT), trigger rates at different PMT multiplicities, and responses to air showers. Finally, the reconstructed shower directions and angular resolutions of the detected showers for the prototype array are given.

Spectroscopic measurement of ion temperature and ion velocity distributions in the flux-coil generated FRC

International Nuclear Information System (INIS)

Gupta, D.; Gota, H.; Hayashi, R.; Kiyashko, V.; Morehouse, M.; Primavera, S.; Bolte, N.; Marsili, P.; Roche, T.; Wessel, F.

2010-01-01

One aim of the flux-coil generated field reversed configuration at Tri Alpha Energy (TAE) is to establish the plasma where the ion rotational energy is greater than the ion thermal energy. To verify this, an optical diagnostic was developed to simultaneously measure the Doppler velocity-shift and line-broadening using a 0.75 m, 1800 groves/mm, spectrometer. The output spectrum is magnified and imaged onto a 16-channel photomultiplier tube (PMT) array. The individual PMT outputs are coupled to high-gain, high-frequency, transimpedance amplifiers, providing fast-time response. The Doppler spectroscopy measurements, along with a survey spectrometer and photodiode-light detector, form a suite of diagnostics that provide insights into the time evolution of the plasma-ion distribution and current when accelerated by an azimuthal-electric field.

A single photon sensor employing wavelength-shifting and light-guiding technology

Energy Technology Data Exchange (ETDEWEB)

Schulte, Lukas; Voge, Markus; Boeser, Sebastian; Kowalski, Marek [Physikalisches Institut, Universitaet Bonn (Germany)

2013-07-01

In this work we describe a feasibility study of a novel type of single photon sensor that employs organic wavelength shifting materials (WLS) to capture photons and guide them to a PMT readout. Two different WLS materials, Saint Gobain BC-480 and BC-482A, have been tested as candidates for use in such a sensor. We address the photon detection efficiency, noise properties, time and spatial resolution, PMT readout, as well as some practical aspects relevant for the development and construction of a prototype sensor. Calculating the overall photon detection efficiency, we show that the effective photosensitive area of a prototype built with existing technology could easily exceed that of modules currently used e. g. in IceCube while having a dark noise rate up to two orders of magnitude smaller.