WorldWideScience

Sample records for chooz pmt system

  1. Electromagnetic Compatibility (EMC) and Noise Background Testing for Double Chooz PMT System

    Energy Technology Data Exchange (ETDEWEB)

    Cepero, J. R.; Encabo Fernandez, F. J.; Pepe, I.; Verdugo, A.

    2009-05-21

    The Double Chooz PMT system is a HV/signal splitter. In this report is presented an electromagnetic compatibility and background noise testing for the Double Chooz PMT system. It was possible to proceed the EMC testing on different grounding configurations of PMT splitter due to its special PCB design, endowed of jumping points and a metal box ground electrode. (Author)

  2. Electromagnetic Compatibility (EMC) and Noise Background Testing for Double Chooz PMT System

    International Nuclear Information System (INIS)

    Cepero, J. R.; Encabo Fernandez, F. J.; Pepe, I.; Verdugo, A.

    2009-01-01

    The Double Chooz PMT system is a HV/signal splitter. In this report is presented an electromagnetic compatibility and background noise testing for the Double Chooz PMT system. It was possible to proceed the EMC testing on different grounding configurations of PMT splitter due to its special PCB design, endowed of jumping points and a metal box ground electrode. (Author)

  3. The double Chooz hardware trigger system

    Energy Technology Data Exchange (ETDEWEB)

    Cucoanes, Andi; Beissel, Franz; Reinhold, Bernd; Roth, Stefan; Stahl, Achim; Wiebusch, Christopher [RWTH Aachen (Germany)

    2008-07-01

    The double Chooz neutrino experiment aims to improve the present knowledge on {theta}{sub 13} mixing angle using two similar detectors placed at {proportional_to}280 m and respectively 1 km from the Chooz power plant reactor cores. The detectors measure the disappearance of reactor antineutrinos. The hardware trigger has to be very efficient for antineutrinos as well as for various types of background events. The triggering condition is based on discriminated PMT sum signals and the multiplicity of groups of PMTs. The talk gives an outlook to the double Chooz experiment and explains the requirements of the trigger system. The resulting concept and its performance is shown as well as first results from a prototype system.

  4. The DoubleChooz DAQ systems.

    CERN Multimedia

    CERN. Geneva

    2012-01-01

    The Double Chooz (DC) reactor anti-neutrino experiment consists of a neutrino detector and a large area Outer Veto detector. A custom data-acquisition (DAQ) system written in Ada language for all the sub-detector in the neutrino detector systems and a generic object oriented data acquisition system for the Outer Veto detector were developed. Generic object-oriented programming was also used to support several electronic systems to be readout providing a simple interface for any new electronics to be added given its dedicated driver. The core electronics of the experiment is based on FADC electronics (500MHz sampling rate), therefore a data-reduction scheme has been implemented to reduce the data volume per trigger. A dynamic data-format was created to allow dynamic reduction of each trigger before data is written to disk. The decision is based on low level information that determines the relevance of each trigger. The DAQ is structured internally into two types of processors: several read-out processors readi...

  5. Chooz B

    International Nuclear Information System (INIS)

    Barillot, Pascale; Baize, Jean-Marc

    1997-01-01

    This EDF press communique give information related to the exploitation of the Chooz B NPP. A calendar of the Chooz B1 and B2 NPPs exploitation is given as well as information about the local economic impact. The exploitation of the PWR reactors of the French nuclear sector corresponds to a accumulated experience of 600 year-reactor. Significant technological evolution has been recorded, namely in the test-control system, the turbo-alternator group 'Arabelle' and in the vapor generators. The reactor safety is based on the high professionalism of the exploitation personnel, on the computer-assisted behaviour allowing the choice of operators and on the conception based upon the experience accumulated by the French nuclear power plants, equivalent to 600 year-reactor operation. EDF operates a system of continual surveillance which allows the monitoring the environmental effects caused by the NPP exploitation. The following issues concerning the environment impact are reported in this document: - The effluent releases in the environment; - Health studies conducted in the NPPs' neighbourhood; - New authorizations for waste release; - Radioactive waste management. The report also mentions the French-Belgian partnership in the PWR construction, the socio-economic regional impact of the EDF activities related with the Chooz NPP operation, and the partnership with the associated service companies. Six appendices are attached to the report containing the following information: - A general layout of Chooz NPP; - Chooz B key figures; Chooz B key data; - Security and public information; - Evolution of PWR system in France; - World's nuclear systems

  6. 3D - Acquisition systems - test in Chooz B nuclear plant

    International Nuclear Information System (INIS)

    Brillault, B.; Thibault, G.

    1992-06-01

    EDF needs 3D-acquisition systems to get the precise geometry of critical nuclear spaces in order to prepare computer simulations of operations in these areas. The simulations must lead to an increase of the efficiency of the operation. The acquisition of the 3-D geometry can be done using 3D-acquisition systems. To answer the needs of the Construction Division, four different systems are compared by the Research Division in Chooz B nuclear plant in order to determine the right solution for each 3D-acquisition problem

  7. A novel PMT test system based on waveform sampling

    Science.gov (United States)

    Yin, S.; Ma, L.; Ning, Z.; Qian, S.; Wang, Y.; Jiang, X.; Wang, Z.; Yu, B.; Gao, F.; Zhu, Y.; Wang, Z.

    2018-01-01

    Comparing with the traditional test system based on a QDC and TDC and scaler, a test system based on waveform sampling is constructed for signal sampling of the 8"R5912 and the 20"R12860 Hamamatsu PMT in different energy states from single to multiple photoelectrons. In order to achieve high throughput and to reduce the dead time in data processing, the data acquisition software based on LabVIEW is developed and runs with a parallel mechanism. The analysis algorithm is realized in LabVIEW and the spectra of charge, amplitude, signal width and rising time are analyzed offline. The results from Charge-to-Digital Converter, Time-to-Digital Converter and waveform sampling are discussed in detailed comparison.

  8. Design studies for the Double Chooz trigger

    International Nuclear Information System (INIS)

    Cucoanes, Andi Sebastian

    2009-01-01

    The main characteristic of the neutrino mixing effect is assumed to be the coupling between the flavor and the mass eigenstates. Three mixing angles (θ 12 , θ 23 , θ 13 ) are describing the magnitude of this effect. Still unknown, θ 13 is considered very small, based on the measurement done by the CHOOZ experiment. A leading experiment will be Double Chooz, placed in the Ardennes region, on the same site as used by CHOOZ. The Double Chooz goal is the exploration of ∝80% from the currently allowed θ 13 region, by searching the disappearance of reactor antineutrinos. Double Chooz will use two similar detectors, located at different distances from the reactor cores: a near one at ∝150 m where no oscillations are expected and a far one at 1.05 km distance, close to the first minimum of the survival probability function. The measurement foresees a precise comparison of neutrino rates and spectra between both detectors. The detection mechanism is based on the inverse β-decay. The Double Chooz detectors have been designed to minimize the rate of random background. In a simplified view, two optically separated regions are considered. The target, filled with Gd-doped liquid scintillator, is the main antineutrino interaction volume. Surrounding the target, the inner veto region aims to tag the cosmogenic muon background which hits the detector. Both regions are viewed by photomultipliers. The Double Chooz trigger system has to be highly efficient for antineutrino events as well as for several types of background. The trigger analyzes discriminated signals from the central region and the inner veto photomultipliers. The trigger logic is fully programmable and can combine the input signals. The trigger conditions are based on the total energy released in event and on the PMT groups multiplicity. For redundancy, two independent trigger boards will be used for the central region, each of them receiving signals from half of the photomultipliers. A third trigger board

  9. Design studies for the Double Chooz trigger

    Energy Technology Data Exchange (ETDEWEB)

    Cucoanes, Andi Sebastian

    2009-07-24

    The main characteristic of the neutrino mixing effect is assumed to be the coupling between the flavor and the mass eigenstates. Three mixing angles ({theta}{sub 12}, {theta}{sub 23}, {theta}{sub 13}) are describing the magnitude of this effect. Still unknown, {theta}{sub 13} is considered very small, based on the measurement done by the CHOOZ experiment. A leading experiment will be Double Chooz, placed in the Ardennes region, on the same site as used by CHOOZ. The Double Chooz goal is the exploration of {proportional_to}80% from the currently allowed {theta}{sub 13} region, by searching the disappearance of reactor antineutrinos. Double Chooz will use two similar detectors, located at different distances from the reactor cores: a near one at {proportional_to}150 m where no oscillations are expected and a far one at 1.05 km distance, close to the first minimum of the survival probability function. The measurement foresees a precise comparison of neutrino rates and spectra between both detectors. The detection mechanism is based on the inverse {beta}-decay. The Double Chooz detectors have been designed to minimize the rate of random background. In a simplified view, two optically separated regions are considered. The target, filled with Gd-doped liquid scintillator, is the main antineutrino interaction volume. Surrounding the target, the inner veto region aims to tag the cosmogenic muon background which hits the detector. Both regions are viewed by photomultipliers. The Double Chooz trigger system has to be highly efficient for antineutrino events as well as for several types of background. The trigger analyzes discriminated signals from the central region and the inner veto photomultipliers. The trigger logic is fully programmable and can combine the input signals. The trigger conditions are based on the total energy released in event and on the PMT groups multiplicity. For redundancy, two independent trigger boards will be used for the central region, each of

  10. Development of a level-1 trigger and timing system for the Double Chooz neutrino experiment

    International Nuclear Information System (INIS)

    Reinhold, Bernd

    2009-01-01

    The measurement of the mixing angle θ 13 is the goal of several running and planned experiments. The experiments are either accelerator based (super)beam experiments (e.g. MINOS, T2K, Nova) or reactor anti-neutrino disappearance experiments (e.g. Daya Bay, RENO or Double Chooz). In order to measure or constrain θ 13 with the Double Chooz experiment the overall systematic errors have to be controlled at the one-percent or sub-percent level. The limitation of the systematic errors is achieved through various means and techniques. E.g. the experiment consists of two identical detectors at different baselines, which allow to make a differential anti-neutrino flux measurement, where basically only relative normalisation errors remain. The requirements on the systematic errors put also strong constraints on the quality of all components and materials used for both detectors, most prominently on the stability and radiopurity of the scintillator, the photomultiplier tubes, the vessels containing the detector liquids and the shielding against ambient radioactivity. The readout electronics, trigger and data acquisition system have to operate reliably as an integrated and highly efficient whole over several years. The trigger is provided by the Level-1 Trigger and Timing System, which is the subject of this thesis. It has to provide a highly efficient trigger (at the 0.1% level) for neutrino-induced events as well as for several types of background events. Its decision is realized in hardware and based on energy depositions in the muon veto and the target region. The Level-1 Trigger and Timing System furthermore provides a common System Clock and an absolute timestamp for each event. The Level-1 Trigger and Timing System consists of two types of VME modules, several Trigger Boards and a Trigger Master Board, which have been custom-designed and developed in the electronics workshop of our institute for this experiment and purpose, starting in 2005. In this thesis all

  11. Development of a level-1 trigger and timing system for the Double Chooz neutrino experiment

    Energy Technology Data Exchange (ETDEWEB)

    Reinhold, Bernd

    2009-02-25

    The measurement of the mixing angle {theta}{sub 13} is the goal of several running and planned experiments. The experiments are either accelerator based (super)beam experiments (e.g. MINOS, T2K, Nova) or reactor anti-neutrino disappearance experiments (e.g. Daya Bay, RENO or Double Chooz). In order to measure or constrain {theta}{sub 13} with the Double Chooz experiment the overall systematic errors have to be controlled at the one-percent or sub-percent level. The limitation of the systematic errors is achieved through various means and techniques. E.g. the experiment consists of two identical detectors at different baselines, which allow to make a differential anti-neutrino flux measurement, where basically only relative normalisation errors remain. The requirements on the systematic errors put also strong constraints on the quality of all components and materials used for both detectors, most prominently on the stability and radiopurity of the scintillator, the photomultiplier tubes, the vessels containing the detector liquids and the shielding against ambient radioactivity. The readout electronics, trigger and data acquisition system have to operate reliably as an integrated and highly efficient whole over several years. The trigger is provided by the Level-1 Trigger and Timing System, which is the subject of this thesis. It has to provide a highly efficient trigger (at the 0.1% level) for neutrino-induced events as well as for several types of background events. Its decision is realized in hardware and based on energy depositions in the muon veto and the target region. The Level-1 Trigger and Timing System furthermore provides a common System Clock and an absolute timestamp for each event. The Level-1 Trigger and Timing System consists of two types of VME modules, several Trigger Boards and a Trigger Master Board, which have been custom-designed and developed in the electronics workshop of our institute for this experiment and purpose, starting in 2005. In

  12. Double Chooz

    Energy Technology Data Exchange (ETDEWEB)

    Buck, Christian [Max-Planck-Institut fuer Kernphysik, Saupfercheckweg 1, D-69117 Heidelberg (Germany)

    2006-05-15

    The goal of the Double Chooz reactor neutrino experiment is to search for the neutrino mixing parameter {theta}{sub 13}. Double Chooz will use two identical detectors at 150 m and 1.05 km distance from the reactor cores. The near detector is used to monitor the reactor {nu}-bar {sub e} flux while the second is dedicated to the search for a deviation from the expected (1/distance){sup 2} behavior. This two detector concept will allow a relative normalization systematic error of ca. 0.6 %. The expected sensitivity for sin{sup 2}2{theta}{sub 13} is then in the range 0.02 - 0.03 after three years of data taking. The antineutrinos will be detected in a liquid scintillator through the capture on protons followed by a gamma cascade, produced by the neutron capture on Gd.

  13. PMT response drift of ATLAS Tile Laser II calibration system: an introduction of a new method

    CERN Document Server

    Di Gregorio, Giulia

    2016-01-01

    In this article I describe the performance of the monitoring diodes of the Laser II system, a new system for run II used to calibrate the gain variation of PMTs in between two cesium scan. I also show a new method to measure the PMT drift response that it is compared to the method used up to now (Clermont-Ferrant) corrected with the Pisa method. The agreement between the two method is within 0.2%.

  14. PMT Dark Noise Monitoring System for Neutrino Detector Borexino Based on the Devicenet Protocol and WEB-Access

    International Nuclear Information System (INIS)

    Chepurnov, A.S.; Orekhov, D.I.; Maimistov, D.A.; Sabelnikov, A.A.; Etenko, A.V.

    2006-01-01

    Monitoring of PMT dark noise in a neutrino detector BOREXINO is a procedure that indicates condition of the detector. Based on CAN industrial network, top level DeviceNet protocol and WEB visualization, the dark noise monitoring system having 256 channels for the internal detector and for the external muon veto was created. The system is composed as a set of controllers, converting the PMT signals to frequency and transmitting them over Can network. The software is the stack of the DeviceNet protocols, providing the data collecting and transporting. Server-side scripts build web pages of user interface and graphical visualization of data

  15. Double Chooz experiment

    International Nuclear Information System (INIS)

    Palomares, C.

    2009-01-01

    Double Chooz will use two identical detectors at different distances from the Chooz nuclear power station to search for a non-vanishing value of θ 13 , and, hopefully, to open the way to experiments aspiring to discover CP violation in the leptonic sector. The far detector is expected to be operative by the end of 2009. Installation of the near detector will occur in 2010. Double Chooz has the capacity to exclude sin 2 (2θ 13 ) 31 2 = 2.5 x 10 -3 eV 2 with three years of data running both near and far detectors. (author)

  16. Installation, commissioning and performance of the trigger system of the Double Chooz experiment and the analysis of hydrogen capture neutrino events

    Energy Technology Data Exchange (ETDEWEB)

    Lucht, Sebastian

    2013-11-18

    The Double Chooz experiment is a reactor antineutrino experiment located at Chooz, a small town in the Ardennes region in the north of France close to the Belgium border. The aim of the experiment is to measure the leptonic mixing angle θ{sub 13}. The antineutrino flux is measured by two identical detectors at different distances from the reactor cores used as neutrino source, in a so called ''disappearance'' experiment. Double Chooz is a precision experiment because previous experiments indicated a small value of θ{sub 13}. Therefore, the systematic uncertainties introduced by background events and detector related components have to be as small as possible. The detector and all electronic components have been designed accordingly. The first part of this thesis describes the trigger and timing system of the Double Chooz experiment. This system triggers the data acquisition of the detector. It continuously monitors the signals of the photomultiplier tubes (PMTs) of the detector. These signals are summed for groups of PMTs (group signal) and for all PMTs (sum signal). The group signals are the input signals to the trigger system. They are discriminated by one threshold resulting in a multiplicity condition on the number of active group signal discriminators. The sum signal is discriminated by four thresholds. The default trigger configuration for the Double Chooz experiment is based on a combination on the sum signal discriminators and the multiplicity condition. In addition, the trigger system provides a common clock signal for all data acquisition components and an online event classification to allow an online data reduction. The trigger system was installed and commissioned in 2011. In this thesis the commissioning of the trigger system and its performance is presented. Furthermore the development and tests of possible improvements for the trigger system are presented and discussed. The second part of this thesis introduces a complementary

  17. A PMT-Block test bench

    International Nuclear Information System (INIS)

    Adragna, P.; Antonaki, A.

    2006-01-01

    The front-end electronics of the ATLAS hadronic calorimeter (Tile Cal) is housed in a unit, called PMT-Block. The PMT-Block is a compact instrument comprising a light mixer, a PMT together with its divider and a 3-in-1 card, which provides shaping, amplification and integration for the signals. This instrument needs to be qualified before being assembled on the detector. A PMT-Block test bench has been developed for this purpose. This test bench is a system which allows fast, albeit accurate enough, measurements of the main properties of a complete PMT-Block. The system, both hardware and software, and the protocol used for the PMT-Blocks characterization are described in detail in this report. The results obtained in the test of about 10 000 PMT-Blocks needed for the instrumentation of the ATLAS (LHC-CERN) hadronic Tile Calorimeter are also reported

  18. A PMT-Block test bench

    Energy Technology Data Exchange (ETDEWEB)

    Adragna, P [Dipartimento di Fisica ' E.Fermi' , Universita di Pisa and Istituto Nazionale di Fisica Nucleare, Sezione di Pisa, Largo B. Pontecorvo 3, Pisa 56127 (Italy); Universita degli studi di Siena, via Roma 56, 53100 Siena (Italy); Antonaki, A [Institute of Accelerating Systems and Applications, P.O. Box 17214, Athens 10024 (Greece); National Capodistrian University of Athens, 30 Panepistimiou st., Athens 10679 (Greece)] (and others)

    2006-08-01

    The front-end electronics of the ATLAS hadronic calorimeter (Tile Cal) is housed in a unit, called PMT-Block. The PMT-Block is a compact instrument comprising a light mixer, a PMT together with its divider and a 3-in-1 card, which provides shaping, amplification and integration for the signals. This instrument needs to be qualified before being assembled on the detector. A PMT-Block test bench has been developed for this purpose. This test bench is a system which allows fast, albeit accurate enough, measurements of the main properties of a complete PMT-Block. The system, both hardware and software, and the protocol used for the PMT-Blocks characterization are described in detail in this report. The results obtained in the test of about 10 000 PMT-Blocks needed for the instrumentation of the ATLAS (LHC-CERN) hadronic Tile Calorimeter are also reported.

  19. R&D of a pioneering system for a high resolution photodetector: The VSiPMT

    Science.gov (United States)

    Barbato, F. C. T.; Barbarino, G.; Campajola, L.; Di Capua, F.; Mollo, C. M.; Valentini, A.; Vivolo, D.

    2017-12-01

    The VSiPMT (Vacuum Silicon PhotoMultiplier Tube) is an innovative design for a hybrid photodetector. The idea, born with the purpose to use a SiPM for large detection volumes, consists in replacing the classical dynode chain with a special SiPM. In this configuration, we match the large sensitive area of a photocathode with the performances of the SiPM technology, which therefore acts like an electron detector and so like a current amplifier. The excellent photon counting capability, fast response, low power consumption and the stability are among the most attractive features of the VSiPMT.We now present the progress on the realization of a 1-in. prototype and the preliminary tests we are performing on it.

  20. From double Chooz to triple Chooz - neutrino physics at the Chooz reactor complex

    International Nuclear Information System (INIS)

    Huber, Patrick; Kopp, Joachim; Lindner, Manfred; Rolinec, Mark; Winter, Walter

    2006-01-01

    We discuss the potential of the proposed Double Chooz reactor experiment to measure the neutrino mixing angle sin 2 2θ 13 . We especially consider systematical uncertainties and their partial cancellation in a near and far detector operation, and we discuss implications of a delayed near detector startup. Furthermore, we introduce Triple Chooz, which is a possible upgrade scenario assuming a second, larger far detector, which could start data taking in an existing cavern five years after the first far detector. We review the role of the Chooz reactor experiments in the global context of future neutrino beam experiments. We find that both Double Chooz and Triple Chooz can play a leading role in the search for a finite value of sin 2 2θ 13 . Double Chooz could achieve a sensitivity limit of ∼ 2.10 -2 at the 90% confidence level after 5 years while the Triple Chooz setup could give a sensitivity below 10 -2

  1. Estimation of the systematic uncertainties of the measurement of the neutrino mixing angle θ{sub 13} related to the trigger system of the Double Chooz experiment

    Energy Technology Data Exchange (ETDEWEB)

    Stueken, David Anselm

    2013-10-14

    The Double Chooz experiment, located in the Ardennes region next to the CHOOZ-B nuclear power plant, is a reactor antineutrino experiment to measure neutrino oscillations. It has been designed as precision experiment to measure the neutrino mixing angel θ{sub 13} with highest possible accuracy due to its small value close to zero. The electron antineutrino flux emitted by the reactor cores is measured by two identical neutrino detectors located at different distances from the reactor cores. Each detector consist of a 10.3 m{sup 3} target volume filled with liquid scintillator and surrounded by 390 photomultiplier tubes. The far detector is located 1.05 km away from the reactor cores to be most sensitive to oscillation effects. The unoscillated neutrino flux is measured by the near detector located 400 m away from the reactor cores. In order to reduce background events and other sources resulting in systematic uncertainties, special requirements have been demanded for all detector components and electronic systems. In this context, a most efficiently operating data acquisition system is essential. The subsystem responsible to start data storage for events of interest is the so called ''trigger system''. The design concept of the Double Chooz trigger system introduces two redundancy concepts in order to trigger the data acquisition in the most robust and efficient way: The trigger decision is based on a combination of an energy threshold and the number of active photomultiplier tubes (multiplicity condition). Secondly, the system is divided into two identical but independently operating subsystems for most robust operations of the full system. Additionally, the two subsystem provide the possibility to measure the efficiency of the system. Apart from generating the trigger signal for the data acquisition, the system provides an online event classification in order to adjust the amount of stored data for each event type. After one and a half year

  2. Making PMT halftone prints

    Energy Technology Data Exchange (ETDEWEB)

    Corey, J.D.

    1977-05-01

    In the printing process for technical reports presently used at Bendix Kansas City Division, photographs are reproduced by pasting up PMT halftone prints on the artwork originals. These originals are used to make positive-working plastic plates for offset lithography. Instructions for making good-quality halftone prints using Eastman Kodak's PMT materials and processes are given in this report. 14 figures.

  3. Proof-of-principle study of a small animal PET/field-cycled MRI combined system using conventional PMT technology

    International Nuclear Information System (INIS)

    Peng Hao; Handler, William B.; Scholl, Timothy J.; Simpson, P.J.; Chronik, Blaine A.

    2010-01-01

    There are currently several approaches to the development of combined PET/MRI systems, all of which need to address adverse interactions between the two systems. Of particular relevance to the majority of proposed PET/MRI systems is the effect that static and dynamic magnetic fields have on the performance of PET detection systems based on photomultiplier tubes (PMTs). In the work reported in this paper, performance of two conventional PMTs has been systematically investigated and characterized as a function of magnetic field exposure conditions. Detector gain, energy resolution, time resolution, and efficiency were measured for static field exposures between 0 and 6.3 mT. Additionally, the short-term recovery and long-term stability of gain and energy resolution were measured in the presence of repeatedly applied dynamic magnetic fields changing at 4 T/s. It was found that the detectors recovered normal operation within several milliseconds following the end of large pulsed magnetic fields. In addition, the repeated applications of large pulsed magnetic fields did not significantly affect detector stability. Based on these results, we implemented a proof-of-principle PET/field-cycled MRI (FCMRI) system for small animal imaging using commercial PMT-based PET detectors. The first PET images acquired within the PET/FCMRI system are presented. The image quality, in terms of spatial resolution, was compared between standalone PET and the PET/FCMRI system. Finally, the relevance of these results to various aspects of PET/MRI system design is discussed.

  4. The system of high-voltage power PMT for experiments at the JINR Nuclotron

    International Nuclear Information System (INIS)

    Piyadin, S.M.; Ladygin, V.P.; Pilyar, A.V.; Reznikov, S.G.; Janek, M.

    2015-01-01

    An 8-channel high-voltage power system based on the use of the module «Wenzel Elektronik N1130» is described. Specifications of control modules 8DAC-12 and 8ADC-14 designed for the high-voltage systems in CAMAC standard are presented. This system is designed to provide the power for the detectors used in physics experiments at the JINR Nuclotron.

  5. Computer-assisted command and control for Chooz B

    International Nuclear Information System (INIS)

    Anon.

    1995-01-01

    A new type of command and control system has been installed at the Chooz B nuclear power plant. A key feature of the system is a man/machine interface designed to provide operators with on-screen assistance more quickly than ever. (Author)

  6. Double Chooz: Results and Perspectives

    Energy Technology Data Exchange (ETDEWEB)

    Franke, A.J., E-mail: ajfranke@nevis.columbia.edu [Columbia University, New York, New York 10027 (United States)

    2013-04-15

    The Double Chooz experiment has been observing ν{sup ¯}{sub e} from two reactor cores at the Chooz nuclear power station in Ardennes, France, with a single 10.3 m{sup 3} fiducial volume Gd-doped liquid scintillator detector at a flux-weighted average baseline of ∼1050 m. This article reviews results achieved with a detector live time of 227.93 days and exposure of 33.71 GW-ton-years. A total of 8,249 candidate ν{sup ¯}{sub e} events have been observed, compared to an expected 8,937 events in the null-oscillation case: this deficit is interpreted as evidence for ν{sup ¯}{sub e} disappearance. A fit to the observed neutrino rate and spectral shape gives a best-fit value of sin{sup 2}(2θ{sub 13})=0.109±0.030(stat.)±0.025(syst.) at a mass-squared splitting of Δm{sub 31}{sup 2}=2.32×10{sup −3} eV{sup 2}. The null-oscillation hypothesis is excluded by the data at 99.8% CL (2.9σ). The Double Chooz Near Detector is under construction, and analysis efforts to measure neutrino directionality, test Lorentz violation, and measure backgrounds in situ are underway.

  7. Double Chooz: Results and Perspectives

    Science.gov (United States)

    Franke, A. J.

    2013-04-01

    The Double Chooz experiment has been observing ν from two reactor cores at the Chooz nuclear power station in Ardennes, France, with a single 10.3 m fiducial volume Gd-doped liquid scintillator detector at a flux-weighted average baseline of ˜1050 m. This article reviews results achieved with a detector live time of 227.93 days and exposure of 33.71 GW-ton-years. A total of 8,249 candidate ν events have been observed, compared to an expected 8,937 events in the null-oscillation case: this deficit is interpreted as evidence for ν disappearance. A fit to the observed neutrino rate and spectral shape gives a best-fit value of sin2(2θ13)=0.109±0.030 (stat.)±0.025 (syst.) at a mass-squared splitting of Δm312=2.32×10-3 eV. The null-oscillation hypothesis is excluded by the data at 99.8% CL (2.9σ). The Double Chooz Near Detector is under construction, and analysis efforts to measure neutrino directionality, test Lorentz violation, and measure backgrounds in situ are underway.

  8. Study of the Light Emission Process from the Double Chooz Photomultipliers

    Energy Technology Data Exchange (ETDEWEB)

    Calvo, E.; Cerrada, M.; Crespo, J. I.; Gil-Botella, I.; Jimenez, S.; Lopez, M.; Novella, P.; Palomares, C.; Santorelli, R.; Verdugo, A.

    2012-09-13

    In this document we present a study of the light emitted by the base of a Hamamatsu R7081MOD-ASSY photomultiplier (PMT) of the same type used in the Double Chooz experiment. Several characteristic features of the light signal have been found in terms of amplitude, length and pulse shape. Additional investigations on the properties of the epoxy used to cover the photomultiplier base have been carried out. A possible explanation of the light emission process is discussed at the end of the study. (Author) 1 ref.

  9. Characterization of Magnetic Field Immersed Photomultipliers from Double Chooz Experiment. Design and Construction of their Magnetic Shields; Caracterizacion de los fotomultiplicadores del experimento Double Chooz bajo campo magnetico y diseno y construccion de sus blindajes magneticos

    Energy Technology Data Exchange (ETDEWEB)

    Valdivia Valero, F. J.

    2007-12-28

    Flavour oscillations of neutrinos are a quantum-mechanical effect widely demonstrated. It is explained through interferences of their mass eigenstates, therefore, belonging to the physical area beyond the Standard Model. This work deals with the CIEMAT collaboration in the neutrino experiment Double Chooz. Such an experiment aims to measure the mixture angle {theta}{sub 1}3, one of the PMNS leptonic mixture matrix, with a un reached-before sensibility by decrease of systematic errors. For this, two identical scintillator detectors, equipped with PMT's, will be sited at different distances from two reactors located in the nuclear power plant CHOOZ B (France). The electronic neutrino flux from these reactors will be compared, explaining its deficit by flavour oscillations of these particles. The identity of both detectors will be diminished by the magnetic field effects on the PMT's response. Therefore, this study serves as for quantifying such an effects as for fitting the magnetic shields design that minimize them. Shielding measurements and final design of magnetic shields as much as the effect these ones cause in the PMT's response immersed in a monitored magnetic field are presented. (Author) 85 refs.

  10. Characterization of Magnetic Field Immersed Photomultipliers from Double Chooz Experiment. Design and Construction of their Magnetic Shields; Caracterizacion de los fotomultiplicadores del experimento Double Chooz bajo campo magnetico y diseno y construccion de sus blindajes magneticos

    Energy Technology Data Exchange (ETDEWEB)

    Valdivia Valero, F J

    2007-12-28

    Flavour oscillations of neutrinos are a quantum-mechanical effect widely demonstrated. It is explained through interferences of their mass eigenstates, therefore, belonging to the physical area beyond the Standard Model. This work deals with the CIEMAT collaboration in the neutrino experiment Double Chooz. Such an experiment aims to measure the mixture angle {theta}{sub 1}3, one of the PMNS leptonic mixture matrix, with a un reached-before sensibility by decrease of systematic errors. For this, two identical scintillator detectors, equipped with PMT's, will be sited at different distances from two reactors located in the nuclear power plant CHOOZ B (France). The electronic neutrino flux from these reactors will be compared, explaining its deficit by flavour oscillations of these particles. The identity of both detectors will be diminished by the magnetic field effects on the PMT's response. Therefore, this study serves as for quantifying such an effects as for fitting the magnetic shields design that minimize them. Shielding measurements and final design of magnetic shields as much as the effect these ones cause in the PMT's response immersed in a monitored magnetic field are presented. (Author) 85 refs.

  11. Characterization of Magnetic Field Immersed Photomultipliers from Double Chooz Experiment. Design and Construction of their Magnetic Shields

    International Nuclear Information System (INIS)

    Valdivia Valero, F. J.

    2007-01-01

    Flavour oscillations of neutrinos are a quantum-mechanical effect widely demonstrated. It is explained through interferences of their mass eigenstates, therefore, belonging to the physical area beyond the Standard Model. This work deals with the CIEMAT collaboration in the neutrino experiment Double Chooz. Such an experiment aims to measure the mixture angle θ 1 3, one of the PMNS leptonic mixture matrix, with a un reached-before sensibility by decrease of systematic errors. For this, two identical scintillator detectors, equipped with PMT's, will be sited at different distances from two reactors located in the nuclear power plant CHOOZ B (France). The electronic neutrino flux from these reactors will be compared, explaining its deficit by flavour oscillations of these particles. The identity of both detectors will be diminished by the magnetic field effects on the PMT's response. Therefore, this study serves as for quantifying such an effects as for fitting the magnetic shields design that minimize them. Shielding measurements and final design of magnetic shields as much as the effect these ones cause in the PMT's response immersed in a monitored magnetic field are presented. (Author) 85 refs

  12. Dimensionless parameterization of lidar for laser remote sensing of the atmosphere and its application to systems with SiPM and PMT detectors.

    Science.gov (United States)

    Agishev, Ravil; Comerón, Adolfo; Rodriguez, Alejandro; Sicard, Michaël

    2014-05-20

    In this paper, we show a renewed approach to the generalized methodology for atmospheric lidar assessment, which uses the dimensionless parameterization as a core component. It is based on a series of our previous works where the problem of universal parameterization over many lidar technologies were described and analyzed from different points of view. The modernized dimensionless parameterization concept applied to relatively new silicon photomultiplier detectors (SiPMs) and traditional photomultiplier (PMT) detectors for remote-sensing instruments allowed predicting the lidar receiver performance with sky background available. The renewed approach can be widely used to evaluate a broad range of lidar system capabilities for a variety of lidar remote-sensing applications as well as to serve as a basis for selection of appropriate lidar system parameters for a specific application. Such a modernized methodology provides a generalized, uniform, and objective approach for evaluation of a broad range of lidar types and systems (aerosol, Raman, DIAL) operating on different targets (backscatter or topographic) and under intense sky background conditions. It can be used within the lidar community to compare different lidar instruments.

  13. Status of the Double Chooz experiment

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez, L.F.G. [Universidade Estadual de Campinas (IFGW/UNICAMP), SP (Brazil). Inst. de Fisica Gleb Wataghin. Dept. de Raios Cosmicos e Cronologia; Universite Oaris Diderot (France); Kemp, E. [Universidade Estadual de Campinas (IFGW/UNICAMP), SP (Brazil). Inst. de Fisica Gleb Wataghin. Dept. de Raios Cosmicos e Cronologia; Anjos, J.C. dos; Barbosa, A.F.; Lima Junior, H.P.; Gama, R.; Abrahao, T.; Pepe, I.M. [Centro Brasileiro de Pesquisas Fisicas (CBPF), Rio de Janeiro, RJ (Brazil); Chimenti, P. [Universidade Federal do ABC (UFABC), SP (Brazil)

    2011-07-01

    Full text: The neutrino oscillation experiment Double Chooz, located at the nuclear power plant of Chooz (Ardennes, France), has as purpose to measure the mixing angle {theta}{sub 13} with greater precision than the measurement of its predecessor, the Chooz experiment. In four years of data acquisition, we expect to decrease the current limit of sin{sup 2}(2{theta}{sub 13}) from 0.2 to 0.03, contributing for the determination of this parameter that is still open in the neutrino mixing matrix. For this, the Double Chooz experiment will use antineutrinos generated in both Chooz plant reactors and will make high accuracy measurements of the flux in two different distances with identical detectors. The first detector (the 'far detector') is already in operation since January 2011 and the construction of the second one (the'{sup n}ear detector') should be completed on the beginning of 2012. Thus, in this work we present the main aspects of this neutrino oscillation experiment and preliminary results of the detector performance. (author)

  14. Status of the double Chooz experiment

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez, L.F.G.; Kemp, E. [Universidade Estadual de Campinas (IFGW/UNICAMP), SP (Brazil). Inst. de Fisica Gleb Wataghin. Dept. de Raios Cosmicos e Cronologia; Anjos, J.C. dos; Lima Junior, H.P.; Gama, R.; Abrahao, T.; Pepe, I.M. [Centro Brasileiro de Pesquisas Fisicas (MCT/CBPF), Rio de Janeiro, RJ (Brazil)

    2012-07-01

    Full text: The neutrino oscillation experiment Double Chooz, located at the nuclear power plant of Chooz (Ardennes, France), has as purpose to measure the mixing angle {theta}{sub 13} with greater precision than the measurement of its predecessor, the Chooz experiment. For this, the Double Chooz experiment will use antineutrinos generated in both Chooz plant reactors and will make high accuracy measurements of the flux in two different baselines with identical gadolinium-doped-scintillator detectors, that uses the inverse-beta-decay positron and neutron detection as an antineutrino signature. This signature is given by a prompt signal from the positron and a delayed neutron signal, which allow to decrease significantly the uncorrelated background. Other forms of background, in particular the cosmic correlated one, are managed using different technic. The use of two equal detectors at different baselines will allow to better control our systematic errors, in particular the ones associated with the reactor and with the reactor anomaly effect. The first detector (known as the 'far detector', 1050m from the reactors) is already in operation since April 2011 and the second one (known as the 'near detector', 400m from the reactor) is under construction. Thus, in this work we present the main aspects of this neutrino oscillation experiment and results update. (author)

  15. Double Chooz Improved Multi-Detector Measurements

    CERN Multimedia

    CERN. Geneva

    2016-01-01

    The Double Chooz experiment (DC) is a reactor neutrino oscillation experiment running at Chooz nuclear power plant (2 reactors) in France. In 2011, DC first reported indication of non-zero θ13 with the far detector (FD) located at the maximum of oscillation effects (i.e. disappearance), thus challenging the CHOOZ non-observation limit. A robust observation of θ13 followed in 2012 by the Daya Bay experiments with multiple detector configurations. Since 2015 DC runs in a multi-detector configuration making thus the impact of several otherwise dominating systematics reduce strongly. DC’s unique almost "iso-flux" site, allows the near detector (ND) to become a direct accurate non-oscillation reference to the FD. Our first multi-detector results at MORIOND-2016 showed an intriguing deviation of θ13 with respect to the world average. We will address this issue in this seminar. The combined "reactor-θ13" measurement is expected to ...

  16. The Upgraded Calibration System for the Scintillator-PMT Tile Hadronic Calorimeter of the ATLAS experiment at CERN/LHC

    CERN Document Server

    Chakraborty, Dhiman; The ATLAS collaboration

    2017-01-01

    The ATLAS Tile Calorimeter (TileCal) is the central section of the hadronic calorimeter of the ATLAS experiment and provides important information for reconstruction of hadrons, jets, hadronic decays of tau leptons and missing transverse energy in highest energy proton-proton and heavy-ion collisions at CERN’s Large Hadron Collider. This sampling calorimeter uses steel plates as absorber and scintillating tiles as active medium. The light produced by the passage of charged particles is transmitted by wavelength shifting fibres to photomultiplier tubes (PMTs) located on the outside of the calorimeter. The readout is segmented into about 5000 cells (longitudinally and transversally), each read out by two PMTs in parallel. A multi-component calibration system is employed to calibrate and monitor the stability and performance of each part of the readout chain during data taking. The TileCal calibration system comprises Cesium radioactive sources, laser and charge injection elements and it allows to monitor and ...

  17. The upgraded calibration system for the scintillator-PMT Tile Hadronic Calorimeter of the ATLAS experiment at CERN/LHC

    CERN Document Server

    Chakraborty, Dhiman; The ATLAS collaboration

    2017-01-01

    The ATLAS Tile Calorimeter (TileCal) is the central section of the hadronic calorimeter of the ATLAS experiment and provides important information for reconstruction of hadrons, jets, hadronic decays of tau leptons and missing transverse energy in highest energy proton-proton and heavy-ion collisions at CERN’s Large Hadron Collider. This sampling calorimeter uses steel plates as absorber and scintillating tiles as active medium. The light produced by the passage of charged particles is transmitted by wavelength shifting fibres to photomultiplier tubes (PMTs) located on the outside of the calorimeter. The readout is segmented into about 5000 cells (longitudinally and transversally), each read out by two PMTs in parallel. A multi-component calibration system is employed to calibrate and monitor the stability and performance of each part of the readout chain during data taking. The TileCal calibration system comprises Cesium radioactive sources, laser and charge injection elements and it allows to monitor and ...

  18. Chooz B1 start-up marked by total computer control

    International Nuclear Information System (INIS)

    Anon.

    1995-01-01

    The start-up of Chooz B1, the first of EdF's latest generation 1450 MWe N4 reactors, marks the first use in a nuclear power plant of a fully computerised control room. Working in partnership with EdF, Sema Group designed and supplied the advanced command and control system for this plant. (Author)

  19. Correlated background and impact on the measurement of θ13 with the Double Chooz detector

    International Nuclear Information System (INIS)

    Remoto, Alberto

    2012-01-01

    The Double Chooz experiment uses antineutrinos emitted from the Chooz nuclear power plant (France) to measure the oscillation mixing parameter θ 13 . By using two detectors at different baselines, a precise measurement of antineutrinos disappearance is anticipated. The Far detector has been taking physics data since April 2011, while the Near detector is under construction. Data from April 13, 2011 to March 30, 2012 taken with the Far detector only have been analyzed and an indication for antineutrino disappearance, consistent with the current neutrino oscillation hypothesis, has been found. The best fit value for the neutrino mixing parameter sin 2 (2θ 13 ) is 0.109 ± 0.030(stat.) ± 0.025(syst.). This thesis present an accurate description of the Double Chooz experiment, with particular emphasis on the Far detector and its acquisition system. The main focus of the thesis is the accurate study of the correlated background affecting the Double Chooz antineutrinos sample and its impact on the measurement of the mixing parameter θ 13 . A general overview of the current experimental scenario which aim to the characterization of the neutrino oscillation is also provided, focusing on the recent results obtained in this field. (author) [fr

  20. Results from the Double Chooz experiment

    Directory of Open Access Journals (Sweden)

    Kaneda Michiru

    2016-01-01

    Full Text Available Recent results from the Double Chooz experiment on the neutrino mixing angle θ13 are presented. Two detectors are located at distances of 400m and 1050m from the reactor cores of the Chooz nuclear power plant, to measure the original neutrino flux from the reactor cores and the disappearance of neutrinos, respectively. The Far Detector has taken data since 2011 while the Near Detector started the data taking in 2014. The latest far detector only result with gadolinium capture events is sin2 2θ13=0.090+0.032.-0.029. Studies using hydrogen capture events also have been improved and the combined result of gadolinium and hydrogen capture events is obtained as sin2 2θ13 = 0.088 ± 0.033.

  1. Neutrino oscillations - the Double Chooz experiment

    Energy Technology Data Exchange (ETDEWEB)

    Lasserre, Th. [CEA Saclay, Dept. d' Astrophysique, de Physique des Particules de Physique Nucleaire et de l' Instrumentation Associee (DSM/DAPNIA/SPP/APC), 91- Gif sur Yvette (France)

    2007-07-01

    {theta}{sub 13} is the mixing angle that couples the field of the neutrino number 3 (the heaviest) to the electron field. The Double Chooz experiment will use 2 identical detectors, near the Chooz nuclear reactor cores to measure the last undetermined mixing angle {theta}{sub 13}. The basic principle of the multi-detector concept is the cancellation of the reactor-induced systematic errors. The first detector will be installed in the existing underground laboratory (1050 meters away from the plant station) that was used in the first Chooz experiment in the nineties. The second detector will be constructed from 2009 in a new neutrino laboratory, located down a 45 m well that will be excavated 300 m away from the reactors. An average visible neutrino rate of 55 (550) events per day is expected to be detected inside the far (near) detector, taking into account the various inefficiencies, if no oscillations. The near detector will perform a measurement of the anti-neutrino flux and its energy spectrum with an unprecedented accuracy and for a long period (3 years). These huge statistics will also be exploited to monitor changes in the relative amounts of U{sup 235} and Pu{sup 239} in the core, paving the way to use neutrino detection for safeguards applications. (A.C.)

  2. The double chooz reactor neutrino experiment

    Energy Technology Data Exchange (ETDEWEB)

    Botella, I Gil [CIEMAT, Basic Research Department, Avenida Complutense, 22, 28040 Madrid (Spain)], E-mail: ines.gil@ciemat.es

    2008-05-15

    The Double Chooz reactor neutrino experiment will be the next detector to search for a non vanishing {theta}{sub 13} mixing angle with unprecedented sensitivity, which might open the way to unveiling CP violation in the leptonic sector. The measurement of this angle will be based in a precise comparison of the antineutrino spectrum at two identical detectors located at different distances from the Chooz nuclear reactor cores in France. Double Chooz is particularly attractive because of its capability to measure sin{sup 2} (2{theta}{sub 13}) to 3{sigma} if sin{sup 2}(2{theta}{sub 13}) > 0.05 or to exclude sin{sup 2}(2{theta}{sub 13}) down to 0.03 at 90% C.L. for {delta}m{sup 2} = 2.5 x 10{sup -3} eV{sup 2} in three years of data taking with both detectors. The construction of the far detector starts in 2008 and the first neutrino results are expected in 2009. The current status of the experiment, its physics potential and design and expected performance of the detector are reviewed.

  3. Chasing theta-13 with the Double Chooz experiment

    Energy Technology Data Exchange (ETDEWEB)

    Lasserre, Thierry [CEA/DSM/IRFU/SPP, Gif-sur-Yvette (France)

    2009-07-01

    Neutrino oscillation physics is entering a precision measurement area. The smallness of the theta-13 neutrino mixing angle is still enigmatic and should be resolved. Double Chooz will use two identical detectors near the Chooz nuclear power station to search for a non vanishing theta-13, and hopefully open the way to experiments aspiring to discover CP violation in the leptonic sector.

  4. Sterile Neutrino Search with the Double Chooz Experiment

    Science.gov (United States)

    Hellwig, D.; Matsubara, T.; Double Chooz Collaboration

    2017-09-01

    Double Chooz is a reactor antineutrino disappearance experiment located in Chooz, France. A far detector at a distance of about 1 km from reactor cores is operating since 2011; a near detector of identical design at a distance of about 400 m is operating since begin 2015. Beyond the precise measurement of θ 13, Double Chooz has a strong sensitivity to so called light sterile neutrinos. Sterile neutrinos are neutrino mass states not taking part in weak interactions, but may mix with known neutrino states. In this paper, we present an analysis method to search for sterile neutrinos and the expected sensitivity with the baselines of our detectors.

  5. The U238 antineutrino spectrum in the Double Chooz experiment

    Energy Technology Data Exchange (ETDEWEB)

    Haag, Nils; Oberauer, Lothar; Potzel, Walter; Schreckenbach, Klaus [Technische Universitaet, Muenchen (Germany); Lachenmaier, Tobias [Eberhard Karls Universitaet, Tuebingen (Germany)

    2011-07-01

    The DoubleChooz experiment aims at the determination of the unknown neutrino mixing parameter {Theta}{sub 13}. Two liquid scintillator detectors will measure an electron antineutrino disappearance at the Chooz site in the French ardennes. In order to improve the sensitivity, the antineutrino spectrum emitted by the Chooz reactor cores has to be determined with high accuracy. This talk focusses on the U238 spectrum, which is the only contributing spectrum, that was not measured until now. The final U238 beta spectrum is presented, and its implementation into the analysis framework is shown.

  6. Latest results from the Double Chooz experiment

    Energy Technology Data Exchange (ETDEWEB)

    Goeger-Neff, Marianne [Physik Department E15, Technische Universitaet Muenchen (Germany); Collaboration: Double Chooz-Collaboration

    2016-07-01

    Double Chooz aims at a precise measurement of the neutrino mixing angle θ{sub 13} through the disappearance of reactor electron antineutrinos. The experiment relies on the measurement of neutrino flux and spectrum with two identical detectors at 400 m and 1000 m from the reactor cores of two nuclear power reactors. anti ν{sub e} are detected by inverse beta decay on free protons in 8.3 tons of Gd-loaded liquid scintillator, providing a unique delayed coincidence signature. Double Chooz has been running since 2011 with the far detector only, providing the first indication for non-zero θ{sub 13} with reactor antineutrinos. With a rate+shape analysis of 467.90 live days from 2011-2013 we obtain a value of sin {sup 2} 2 θ{sub 13}=0.090{sup +0.032}{sub -0.029}. Data taking with the near detector has started beginning of 2015, allowing a significant reduction of both reactor and detector related systematic uncertainties. The talk reviews the most recent results obtained with the far detector only and discuss first data from the near detector.

  7. CHOOZ-A expert assessment program

    International Nuclear Information System (INIS)

    Bouat, M.; Godin, R.

    1993-01-01

    CHOOZ-A Nuclear Power Plant, the first French-Belgian PWR unit (300 MWe) was definitively shut down at the end of October 1991, after 24 years in operation. Since summer 1991, the steering committee of the French (EDF) Lifetime Project has initiated a large inquiry to the different technical specialists of EDF and external organizations, trying to define a wide expert assessment program on this plant. The aim is to improve the knowledge of aging mechanisms such as those observed on the 52 PWR French nuclear power plants (900 and 1,300 MWe), and contribute to the validation of non-destructive in-service testing methods. This paper presents the retained CHOOZ-A expert assessment program and technical lines followed during its set up. First major project stages are described, then technical choices are explained, and at last the final program is presented with the specific content of each expert assessment. The definitive program is scheduled for a three year period starting at the moment of final shutdown license acquisition, with a provisional total budget of more than US $10 million

  8. The neutrino experiment Double Chooz and data analysis with the near detector

    Energy Technology Data Exchange (ETDEWEB)

    Franke, Michael Werner

    2016-03-07

    During the last years there has been a huge progress in the field of neutrino physics. Neutrino oscillations are well established and almost all parameters, except a possible CP-violating phase, are determined to high precision. One experiment providing a precise measurement of the neutrino mixing angle θ{sub 13} is the Double Chooz reactor antineutrino experiment. The reactor antineutrinos are detected via the inverse beta decay in two identical liquid scintillator based detectors. A few years ago, the value of θ{sub 13} was unknown and only an upper limit existed. Double Chooz was the first reactor antineutrino experiment presenting a result for a nonzero value of θ{sub 13}. The value for sin{sup 2}2θ{sub 13} from the latest Double Chooz publication is 0.090{sup +0.032}{sub -0.029}. As part of this thesis, an infrastructure for filling the Double Chooz near detector was established and 190 m{sup 3} of detector liquids were prepared successfully. The filling process was optimized to allow an efficient filling of the near detector. The total operation time was reduced to only 22 days. Compared to the far detector filling time of 2 months, this is a great improvement. The development of a completely new level measurement system was as well part of this thesis. Due to the excellent performance of the level measurement system, the hard restrictions for the safety of the Double Chooz detector were met during the entire filling process. Several power glitches and network failures did not harm the system and did not result in any loss of data. These irregularities and the simple maintenance and repair possibilities certify the success of the design concept for the new level measurement system. For this thesis, data from the Double Chooz near detector with a total live time of 110.4 days was used. The mass concentrations of uranium and thorium in the near detector were determined using BiPo coincidences. These events originate from the β-decay of {sup 214}Bi and {sup

  9. Double-Chooz: a search for {theta}{sub 13}

    Energy Technology Data Exchange (ETDEWEB)

    Lasserre, Th. [DSM/DAPNIA/SPP, CEA/Saclay, 91191 Gif-sur-Yvette (France)

    2005-12-15

    The Double-Chooz experiment goal is to search for a non-vanishing value of the {theta}{sub 13} neutrino mixing angle. This is the last step to accomplish prior moving towards a new era of precision measurements in the lepton sector. The current best constraint on the third mixing angle comes from the CHOOZ reactor neutrino experiment sin{sup 2}(2{theta}{sub 13})<0.2 (90% C.L., {delta}m{sub atm}{sup 2}=2.0eV{sup 2}). Double-Chooz will explore the range of sin{sup 2}(2{theta}{sub 13}) from 0.2 to 0.03-0.02, within three years of data taking. The improvement of the CHOOZ result requires an increase in the statistics, a reduction of the systematic error below one percent, and a careful control of the backgrounds. Therefore, Double-Chooz will use two identical detectors, one at 150 m and another at 1.05 km distance from the Chooz nuclear cores. In addition, we will use the near detector as a ''state of the art'' prototype to investigate the potential of neutrinos for monitoring the civil nuclear power plants. The plan is to start operation with two detectors in 2008, and to reach a sensitivity sin{sup 2}(2{theta}{sub 13}) of 0.05 in 2009, and 0.03-0.02 in 2011.

  10. Chooz nuclear facilities. 2009 annual report

    International Nuclear Information System (INIS)

    2010-01-01

    This annual report is established on account of article 21 of the 2006-686 French law from June 13, 2006, relative to the transparency and safety in the nuclear domain. It describes, first, the nuclear facilities of Chooz, and then the measures taken to ensure their safety (personnel radioprotection, actions implemented for nuclear safety improvement, organisation in crisis situation, external and internal controls, technical assessment of the facilities, administrative procedures carried out in 2009), incidents and accidents registered in 2009, radioactive and chemical effluents released by the facilities in the environment, other pollutions, management of radioactive wastes, and, finally, the actions carried out in the domain of transparency and public information. A glossary and the viewpoint of the Committee of Hygiene, safety and working conditions about the content of the document conclude the report. (J.S.)

  11. Chooz-A Steam Generators Characterization

    International Nuclear Information System (INIS)

    Aitammar, Laurie

    2016-01-01

    EDF nuclear waste management requires a deep understanding of characterization, classification and waste sorting operations. In fact, French nuclear waste management defines several classes with specific management, treatment and storage facilities. Based on particular criteria, the more the radiological risk of the nuclear waste is important, the more its management will be complex and expensive. During the dismantling of the first French pressurized reactor Chooz-A, decontamination of the primary water circuits (not including the reactor vessel), the steam generators and the pressurizer have been carried out in order to reduce their activity levels. Thanks to these decontamination operations, and a specific characterization methodology, EDF was able to Re-classify the 4 steam generators and store them in one piece at the ANDRA Very Low Level Activity disposal facilities instead of the Low and Intermediate Level activity one. This re-classification allowed EDF to avoid important cutting and packaging processes. To characterize and declare Chooz-A SG activity, EDF-CIDEN used a methodology defined by the French institute of atomic energy, CEA. The method is based on external gamma spectrometry measurements performed with NaI collimated detectors, associated with MERCURAD simulations providing the transfer functions for the detectors and activity sources. Internal measurements are carried out with a CZT (CdZnTe) probe inside the SG tubes to refine the 3D model. In fact, the primary side represents the main source of activity, and understanding its contamination distribution is important to reduce the model and calculation uncertainties. Measurements eventually provided SG 60 Co global activity, from which the activities of other radionuclides of the spectrum were determined using scaling factors. The final activity declaration takes into account the standard deviation of the measurements in order to cover the uncertainties of the methodology. Thereby, the declaration

  12. Sterile neutrino search with the Double Chooz experiment

    Energy Technology Data Exchange (ETDEWEB)

    Hellwig, Denise; Bekman, Ilja; Kampmann, Philipp; Schoppmann, Stefan; Soiron, Michael; Stahl, Achim; Wiebusch, Christopher [III. Physikalisches Institut B, RWTH Aachen (Germany)

    2016-07-01

    The Double Chooz experiment is a reactor neutrino disappearance experiment located at the Chooz nuclear power plant, France. It measures the electron-antineutrino flux of the two nuclear reactors with two detectors of identical design. A far detector at a distance of about 1 km is operating since 2011; a near detector at a distance of about 400 m is operating since the end of 2014. The combination of the two detectors offers sensitivity to sterile neutrino mixing parameters. Sterile neutrinos are neutrino mass states not taking part in weak interactions, but may mix with known neutrino states. This induces additional mixing angles and mass differences. This talk describes the search for sterile neutrinos and the sensitivity of Double Chooz to the mixing angle θ{sub 14}.

  13. Double-Chooz: a search for {theta}{sub 13}

    Energy Technology Data Exchange (ETDEWEB)

    Mention, G. [APC/PCC, College de France, 75005 Paris (France)

    2005-08-15

    The Double-Chooz experiment goal is to search for a non-vanishing value of the {theta}{sub 13} neutrino mixing angle. This is the last step to accomplish prior moving towards a new era of precision measurements in the lepton sector. The current best constraint on the third mixing angle comes from the CHOOZ reactor neutrino experiment sin{sup 2}(2{theta}{sub 13}) < 0.2-0.14 (90% C.L., {delta}m{sub atm}{sup 2}=2.0-2.410{sup -3} eV{sup 2}). Double-Chooz will explore the range of sin{sup 2}(2{theta}{sub 13}) from 0.2 to 0.03-0.02, within three years of data taking. The improvement of the CHOOZ result requires an increase in the statistics, a reduction of the systematic error below one percent, and a careful control of the backgrounds. Therefore, Double-Chooz will use two identical detectors, one at 150 m and another at 1.05 km distance from the Chooz nuclear cores. In addition, we will use the near detector as a 'state of the art' prototype to investigate the potential of neutrinos for monitoring the civil nuclear power plants. The plan is to start operation with two detectors in 2008, and to reach a sin{sup 2}(2{theta}{sub 13}) sensitivity of 0.05 in 2009, and 0.03-0.02 in 2011.

  14. The double chooz experiment: simulation of reactor antineutrino spectra

    International Nuclear Information System (INIS)

    Mueller, T.

    2010-01-01

    The Double Chooz experiment aims to study the oscillations of electron antineutrinos produced by the Chooz nuclear power station, located in France, in the Ardennes region. It will lead to an unprecedented accuracy on the value of the mixing angle θ 13 . Improving the current knowledge on this parameter, given by the Chooz experiment, requires a reduction of both statistical and systematic errors, that is to say not only observing a large data sample, but also controlling the experimental uncertainties involved in the production and detection of electron antineutrinos. The use of two identical detectors will cancel most of the experimental systematic uncertainties limiting the sensitivity to the value of the mixing angle. We present in this thesis, simulations of reactor antineutrino spectra that were carried out in order to control the sources of systematic uncertainty related to the production of these particles by the plant. We also discuss our work on controlling the normalization error of the experiment through the precise determination of the number of target protons by a weighing measurement and through the study of the fiducial volume of the detectors which requires an accurate modeling of neutron physics. After three years of data taking with two detectors, Double Chooz will be able to disentangle an oscillation signal for sin 2 2θ 13 ≥ 0.05 (at 3σ) or, if no oscillations are observed, to put a limit of sin 2 2θ 13 ≤ 0.03 at 90% C.L. (author) [fr

  15. Optical Module Front-End for a Neutrino Underwater Telescope PMT interface

    CERN Document Server

    Lo Presti, D; Caponetto, L

    2007-01-01

    A proposal for a new system to capture signals in the Optical Module (OM) of an Underwater Neutrino Telescope is described. It concentrates on the problem of power consumption in relation to precision. In particular, a solution for the interface between the photomultiplier (PMT) and the front-end electronics is presented.

  16. Re-examining reactor vessel embrittlement at Chooz A

    International Nuclear Information System (INIS)

    Guilleret, J.-C.

    1988-01-01

    The Chooz A PWR experienced an extended shutdown in 1987/88 following indications that the reactor vessel was embrittling more rapidly than expected. Discrepancies between the expected rate and estimates of the actual rate were not easily explained. The huge body of work done since then to establish safety margins and support restart of the plant should provide a model for the owners of other older PWRs grappling with the embrittlement issue. (author)

  17. The chooz a expert survey program and its main conclusions for plant life management

    International Nuclear Information System (INIS)

    Barthelet, B.; Heuze, A.; Hennart, J.C.; Havard, P.

    2001-01-01

    Because of the importance of PWR components life management represents for Electricity Companies, significant R and D programs are dedicated to identifying and analysing mechanisms and damage rates of the different degradation modes of these components, systems and structures. To assess R and D assumptions and to validate non destructive test results through reviews, expert survey programs on in-situ equipment may enhance the knowledge about most of the various phenomena involved. In this regard, an extensive program was launched after the Chooz A NPP was decommissioned in 1991, after 24 years in operation. This program gathered EDF, IPSN, FRAMATOME, ELECTRABEL and TRACTEBEL into partnership. The expert survey program was performed in various laboratories between 1995 and 1999 and includes: - on-site non destructive testing before sampling, - and metallurgical and mechanical tests performed on samples taken from the nuclear and non nuclear part of the unit. The expert survey program performed by Utilities in various laboratories involved the following equipment: - reactor vessel and internal equipment, - reactor coolant system (dissimilar metal welds, SS welds, cast austenitic ferritic steels), - feedwater plant piping (erosion-corrosion), - electric cables susceptible of temperature and irradiation induced ageing, - anchoring in civil engineering structures, - main primary circuit concerning activation measurement. In conclusion, the extensive Chooz A expert survey program yields numerous significant results. The main outcomes will contribute to validate non destructive tests and enhance our knowledge of some degradation mechanisms of often quite similar components present in units in operation. It is worthy to note that this program is of prime importance for operation feedback; the cost of the whole study amounts to approximately 10 Million Euros. (author)

  18. Synthetic Pulse Dilation - PMT Model for high bandwidth gamma measurements

    Science.gov (United States)

    Geppert-Kleinrath, H.; Herrmann, H. W.; Kim, Y. H.; Zylstra, A. B.; Meaney, K. D.; Lopez, F. E.; Khater, H.; Horsfield, C. J.; Gales, S.; Leatherland, A.; Hilsabeck, T.; Kilkenny, J. D.; Hares, J. D.; Dymoke-Bradshaw, T.; Milnes, J.

    2017-10-01

    The Cherenkov mechanism used in Gas Cherenkov Detectors (GCD) is exceptionally fast. However, the temporal resolution of GCDs, such as the Gamma Reaction History diagnostic (GRH), is limited by the current state-of-the-art photomultiplier tube (PMT) to 100 ps. The new pulse dilation - PMT (PD-PMT) for NIF allows for a temporal resolution comparable to that of the gas cell, or of 10ps. Enhanced resolution will contribute to the quest for ignition in a crucial way through precision measurement of reaction history and areal density (ρ R) history, leading to better constrained models. Features such as onset of alpha heating, shock reverberations and burn truncation due to dynamically evolving failure modes will become visible for the first time. PD-PMT will be deployed on GCD-3 at NIF in 2018. Our synthetic PD-PMT model evaluates the capabilities of these future measurements, as well as minimum yield requirements for measurements performed in a well at 3.9 m from target chamber center (TCC), and within a diagnostic inserter at 0.2m from TCC.

  19. Double Chooz and non Asian efforts towards {theta}{sub 13}

    Energy Technology Data Exchange (ETDEWEB)

    Lasserre, Thierry [CEA/Saclay and Laboratoire Astroparticle and Cosmologie Institut de Recherche des Lois Fondamentales de l' Univers Service de Physique des Particules 91191 Gif-s-Yvette (France)], E-mail: thierry.lasserre@cea.fr

    2008-11-01

    Neutrino oscillation physics is entering a precision measurement area. The smallness of the {theta}{sub 13} neutrino mixing angle is still enigmatic and should be resolved. Double Chooz will use two identical detectors near the Chooz nuclear power station to search for a non vanishing {theta}{sub 13}, and hopefully open the way to experiments aspiring to discover CP violation in the leptonic sector. The Angra project aims to prevail over the Double Chooz experiment if the third neutrino oscillation channel is not discovered in the forthcoming years.

  20. Background-independent measurement of θ13 in Double Chooz

    International Nuclear Information System (INIS)

    Abe, Y.; Anjos, J.C. dos; Barriere, J.C.; Baussan, E.; Bekman, I.; Bergevin, M.; Bezerra, T.J.C.; Bezrukov, L.; Blucher, E.; Buck, C.; Busenitz, J.; Cabrera, A.; Caden, E.; Camilleri, L.; Carr, R.; Cerrada, M.; Chang, P.-J.; Chauveau, E.

    2014-01-01

    The oscillation results published by the Double Chooz Collaboration in 2011 and 2012 rely on background models substantiated by reactor-on data. In this analysis, we present a background-model-independent measurement of the mixing angle θ 13 by including 7.53 days of reactor-off data. A global fit of the observed antineutrino rates for different reactor power conditions is performed, yielding a measurement of both θ 13 and the total background rate. The results on the mixing angle are improved significantly by including the reactor-off data in the fit, as it provides a direct measurement of the total background rate. This reactor rate modulation analysis considers antineutrino candidates with neutron captures on both Gd and H, whose combination yields sin 2 (2θ 13 )=0.102±0.028(stat.)±0.033(syst.). The results presented in this study are fully consistent with the ones already published by Double Chooz, achieving a competitive precision. They provide, for the first time, a determination of θ 13 that does not depend on a background model

  1. An application specific integrated circuit for multi-anode PMT

    Energy Technology Data Exchange (ETDEWEB)

    Gaglione, Renaud [Laboratoire de Physique Corpusculaire, 24 avenue des Landais, 63177 Aubiere (France)]. E-mail: gaglione@clermont.in2p3.fr; Bohner, Gerard [Laboratoire de Physique Corpusculaire, 24 avenue des Landais, 63177 Aubiere (France); Lecoq, Jacques [Laboratoire de Physique Corpusculaire, 24 avenue des Landais, 63177 Aubiere (France); Montarou, Gerard [Laboratoire de Physique Corpusculaire, 24 avenue des Landais, 63177 Aubiere (France); Royer, Laurent [Laboratoire de Physique Corpusculaire, 24 avenue des Landais, 63177 Aubiere (France)

    2006-11-01

    The main purpose of this development is to design an 'intelligent sensor', composed of one multi-anode PMT (Hamamatsu H8500), four custom front-end analog chips with embedded analog-to-digital converter and a pre-processing logical unit. The idea of this design is to improve as far as possible the treatment speed of signals of the PMT. This design must be compact to fit the PMT dimensions, in order to combine them together to form an assembly which will be used in medical imaging research, especially for gamma-ray camera at 141keV (Tc99m) with NaI(Tl) crystal.

  2. Magnetic shield of PMT used in DAMPE electromagnetic calorimeter

    CERN Document Server

    Wang, Peilong; Wang, Xiaolian; Xu, Zizong

    2014-01-01

    The magnetic characteristics of photomultiplier tube R5610A-01 are studied in this paper. The experimental data shows that the gain of R5610A-01 loses about 53% when the magnetic field is 3G along its +X axis. A cylinder of one-layer permalloy strip is able to reduce the effect of 3G magnetic field on the PMT's gain to less than 1%. A cylinder of two-layer permalloy is finally used to shield the PMT from the outside field.

  3. Optimization design of a 20-in. elliptical MCP-PMT

    International Nuclear Information System (INIS)

    Chen, Ping; Tian, Jinshou; Wei, Yonglin; Liu, Hulin; Sai, Xiaofeng; He, Jianping; Chen, Lin; Wang, Xing; Lu, Yu

    2017-01-01

    This paper describes the simulation work for optimizing the newly developed 20-in. elliptical MCP-PMT by enlarging the outside diameters of the two focusing electrodes and the open area of the glass bulb. Effects of biasing voltages applied to the two focusing electrodes and the MCP input facet are studied. With the new design of the 20 in. MCP-PMT, the transit time spread of the prototype can be less than 3 ns and the collection efficiency is as much as the present prototype.

  4. Evaluation of flat panel PMT for gamma ray imaging

    International Nuclear Information System (INIS)

    Pani, R.; Cinti, M.N.; Pellegrini, R.; Trotta, C.; Trotta, G.; Montani, L.; Ridolfi, S.; Garibaldi, F.; Scafe, R.; Belcari, N.; Del Guerra, A.

    2003-01-01

    The first position sensitive PMT, Hamamatsu R2486, developed in 1985, represented a strong technological advance for gamma-ray imaging. Hamamatsu H8500 Flat Panel PMT is the last generation position sensitive PMT: extremely compact with 2 in. active area. Its main features are: minimum peripheral dead zone (1 mm) and height of 12 mm. It was designed to be assembled in array to cover large detection area. It can represent a technical revolution for many applications in the field of gamma-ray imaging as for example nuclear medicine. This tube is based on metal channel dynode for charge multiplication and 8x8 anodes for charge collection and position calculation. In this paper we present a preliminary evaluation of the imaging performances addressed to nuclear medicine application. To this aim we have taken into account two different electronic readouts: resistive chain with Anger Camera principle and multianode readout. Flat panel PMT was coupled to CsI(Tl) and NaI(Tl) scintillation arrays. The results were also compared with the first generation PSPMT

  5. Light Production in the Double Chooz Photomultiplier Tubes

    Energy Technology Data Exchange (ETDEWEB)

    Calvo, E.; Cerrada, M.; Crespo, J. I.; Gil-Botella, I.; Jimenez, S.; Lopez, M.; Novella, P.; Palomares, C.; Santorelli, R.; Verdugo, A.

    2012-09-13

    In this document we present a study of the phenomenon of light emission (called glowing) in the bases of the Hamamatsu R7081MOD-ASSY photomultiplier tubes (PMTs) used in the Double Chooz experiment. The tests have been carried out at the CIEMAT laboratories over a photomultiplier tube of the same model. We have studied the phenomenon making first a characterization of it, and then focusing on the dependence of the rate and the amount of emitted light versus voltage and temperature. In addition, we have looked for the possible existence of an ultraviolet component in the light which would be harmful for the experiment because it could be able to excite the scintillator liquid. Finally, we propose and test a method to reduce the light emission using a cover on the base of the photomultiplier tube.. (Author)

  6. Safety margins of PWR irradiated vessels - The Chooz A issue

    Energy Technology Data Exchange (ETDEWEB)

    Hedin, F; Barthelet, B [Electricite de France (EDF), 75 - Paris (France); Guilleret, J C

    1988-12-31

    In 1986, some irradiated specimen of CHOOZ A (SENA) vessel showed a significant excess of {delta} RTNDT to former previsions. The lack of data on one of the two irradiated shells, and discrepancies between dosimeters results and available previous fluence calculations whose accuracy was questionable, cause the safety authorities to require an important complementary work program before putting again the plant on the grid after 1987 fuel reloading. These works are presented and discussed. They lead to a state that a conservative to day value of the vessel RTNDT is 64 degrees Celsius and that there is no underclad defect in the vessel wall and welds. Then the plant was allowed to restart with certitude that vessel irradiation will not impair its lifetime. (author). 4 refs.

  7. The Chooz power station: ten years of operation

    International Nuclear Information System (INIS)

    Teste du Bailler, Andre

    1977-01-01

    The switching into actual service of the Chooz plant, the first pressurized water reactor ever built in France, occurred on 3rd april 1967. Ten years later, one can establish a highly positive balance schedule of plant's operation whose availability is satisfactory, except the mechanical failure which occurred during the startup. The behavior of the equipment, in particular of the components of the primary loop, was satisfactory in its whole since it allowed the gradual increase in capacity by 15% with respect to the initial design. It allowed also the achievment of noticeable progress in the design of equipment intended for the new power stations. Interesting results have also been obtained in radioprotection, working conditions of the staff and environment protection fields. Finally, the training of the operating teams has been closely followed, whether it concerned the operators directly affected by plant operation or the trainees gathered in a school specially organized for this purpose and transferred since to a training Center [fr

  8. PMT signal increase using a wavelength shifting paint

    Energy Technology Data Exchange (ETDEWEB)

    Allada, K. [Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Hurlbut, Ch. [Eljen Technology, Sweetwater, TX 79556 (United States); Ou, L.; Schmookler, B. [Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Shahinyan, A. [Yerevan Physics Institute, Yerevan (Armenia); Wojtsekhowski, B., E-mail: bogdanw@jlab.org [Thomas Jefferson National Accelerator Facility, Newport News, VA 23606 (United States)

    2015-05-11

    We report a 1.65 times increase of the PMT signal and a simple procedure of application of a new wavelength shifting (WLS) paint for PMTs with non-UV-transparent windows. Samples of four different WLS paints, made from hydrocarbon polymers and organic fluors, were tested on a 5-in. PMT (ET 9390KB) using Cherenkov radiation produced in fused silica disks by {sup 106}Ru electrons on a ‘table-top’ setup. The best performing paint was employed on two different types of 5-in. PMTs (ET 9390KB and XP4572B), installed in atmospheric pressure CO{sub 2} gas Cherenkov detectors, and tested using GeV electrons.

  9. Chooz A: a model for the dismantling of water-cooled reactors

    International Nuclear Information System (INIS)

    Anon.

    2017-01-01

    The specificity of Chooz-A, the first French pressurized water reactor (PWR), is that the reactor and its major components (pumps, exchangers and cooling circuits) are installed in 2 caves dug out in a hill slope. Chooz-A was operating from 1967 to 1991, in 1993 the fuel was removed and in 2007 EDF received the authorization to dismantle the reactor. In 2012, EDF completed the dismantling of the cave containing the elements of the cooling circuit, a cornerstone was the removing of the four 14 m high steam generators. The dismantling of the pressure vessel began in march 2017, it is the same tools and the same processes that were used for the dismantling of the pressure vessel of the Zorita plant (Spain) in 2016. The end of the Chooz-A dismantling is expected in 2022. The feedback experience will help to standardize practices for the French fleet of PWRs. (A.C.)

  10. International Cooperation for the Dismantling of Chooz A Reactor Pressure Vessel

    International Nuclear Information System (INIS)

    Grenouillet, J.J.; Posivak, E.

    2009-01-01

    Chooz A is the first PWR that is being decommissioned in France. The main issue that is conditioning the success of the project is the Reactor Pressure Vessel (RPV) and Reactor Vessel Internals (RVI) segmentation. Whereas Chooz A is the first and unique RPV and RVI being dismantled in France, there are many similar experiences available in the world. Thus the project team was eager to cooperate with other teams facing or being faced with the same issue. A cooperation programme was established in two separate ways: - Benefiting from experience feedback from completed RPV and RVI dismantling projects, - Looking for synergy with future RPV dismantling projects for activities such as segmentation tools design, qualification and manufacturing for example. This paper describes the implementation of this programme and how the outcome of the cooperation was used for the implementation of Chooz-A RPV and RVI segmentation project. It shows also the limits of such a cooperation. (authors)

  11. Evaluation of RI images of hepatic blood flow using Tc-99m PMT

    Energy Technology Data Exchange (ETDEWEB)

    Fujiwara, Hiromichi; Iwasaki, Naoya; Ichikawa, Kesato

    1988-03-01

    To evaluate the clinical significance of RI images of hepatic blood flow using Tc-99m-PMT, analysis of the RI images and estimation of hepatic blood flow were carried out in patients with various liver diseases (37 cases). After intravenous injection of Tc-99m-PMT, hepatic accumulation curve of ROI positioned at whole liver area and time activity curve of ROI positioned at celiac artery were obtained through scintillation camera images with the computer-analysed system. Hepatic blood flow coefficient (K) was calculated from the hepatic accumulation curve. Based on the differential curve calculated from the time activity curve, chronological images of arterial, portal, parenchymal and saturated parenchymal phases were obtained. Results ; 1) K was 0.50 + 0.04, 0.35 + 0.02 and 0.26 + 0.04/min in normal type, CH type and LC type respectively. These coefficients well correlated with clinical severity of hepatic diseases. 2) Perfusional phase images of the liver became poorer in accordance with progression of liver disease, while images of spleen, portal venous system and collateral channels were more clearly obtained in liver cirrhosis. This method was shown to have a potential to understanding of severity of liver disease and hepatic blood flow dynamics.

  12. Equalisation of the PMT response to charge particles for the LUCID detector of the ATLAS experiment

    CERN Document Server

    Vittori, Camilla

    2014-01-01

    With a view to the Run II of LHC, 44 Hamamatsu R760 PMTs have been calibrated with a 207Bi source. The working point of each PMT has been xed in order to equalise the PMT gain at a value smaller than $10^{5}$. Studies on the reproducibility and the stability in time of such calibration permitted to reach a 5% accuracy on PMT gain. In addition, an evaluation of the relative gain of 10 modied PMTs has been performed.

  13. Muon background studies for shallow depth Double - Chooz near detector

    Energy Technology Data Exchange (ETDEWEB)

    Gómez, H. [Laboratoire Astroparticule et Cosmologie (APC) - Université Paris 7. Paris (France)

    2015-08-17

    Muon events are one of the main concerns regarding background in neutrino experiments. The placement of experimental set-ups in deep underground facilities reduce considerably their impact on the research of the expected signals. But in the cases where the detector is installed on surface or at shallow depth, muon flux remains high, being necessary their precise identification for further rejection. Total flux, mean energy or angular distributions are some of the parameters that can help to characterize the muons. Empirically, the muon rate can be measured in an experiment by a number of methods. Nevertheless, the capability to determine the muons angular distribution strongly depends on the detector features, while the measurement of the muon energy is quite difficult. Also considering that on-site measurements can not be extrapolated to other sites due to the difference on the overburden and its profile, it is necessary to find an adequate solution to perform the muon characterization. The method described in this work to obtain the main features of the muons reaching the experimental set-up, is based on the muon transport simulation by the MUSIC software, combined with a dedicated sampling algorithm for shallow depth installations based on a modified Gaisser parametrization. This method provides all the required information about the muons for any shallow depth installation if the corresponding overburden profile is implemented. In this work, the method has been applied for the recently commissioned Double - Chooz near detector, which will allow the cross-check between the simulation and the experimental data, as it has been done for the far detector.

  14. Muon background studies for shallow depth Double - Chooz near detector

    International Nuclear Information System (INIS)

    Gómez, H.

    2015-01-01

    Muon events are one of the main concerns regarding background in neutrino experiments. The placement of experimental set-ups in deep underground facilities reduce considerably their impact on the research of the expected signals. But in the cases where the detector is installed on surface or at shallow depth, muon flux remains high, being necessary their precise identification for further rejection. Total flux, mean energy or angular distributions are some of the parameters that can help to characterize the muons. Empirically, the muon rate can be measured in an experiment by a number of methods. Nevertheless, the capability to determine the muons angular distribution strongly depends on the detector features, while the measurement of the muon energy is quite difficult. Also considering that on-site measurements can not be extrapolated to other sites due to the difference on the overburden and its profile, it is necessary to find an adequate solution to perform the muon characterization. The method described in this work to obtain the main features of the muons reaching the experimental set-up, is based on the muon transport simulation by the MUSIC software, combined with a dedicated sampling algorithm for shallow depth installations based on a modified Gaisser parametrization. This method provides all the required information about the muons for any shallow depth installation if the corresponding overburden profile is implemented. In this work, the method has been applied for the recently commissioned Double - Chooz near detector, which will allow the cross-check between the simulation and the experimental data, as it has been done for the far detector

  15. Flat Panel PMT: advances in position sensitive photodetection

    International Nuclear Information System (INIS)

    Pani, R.; Pellegrini, R.; Trotta, C.; Cinti, M.N.; Bennati, P.; Trotta, G.; Iurlaro, G.; Montani, L.; Ridolfi, S.; Cusanno, F.; Garibaldi, F.

    2003-01-01

    Over the last ten years there was being a strong advancement in photodetection. Different application fields are involved in their use in particular high energy physics, astrophysics and nuclear medicine. They usually work by coupling a scintillation crystal and more recent scintillation arrays with pixel size as small as 0.5 mm. PSPMT represents today the most ready technology for photodetection with large detection areas and very high spatial resolution. Flat panel PMT represents the last technological advancement. Its dimension is 50x50 mm 2 with a narrow peripheral dead zone (0.5 mm final goal). Its compactness allow to assemble different modules closely packed, achieving large detection areas with an effective active area of 97%. In this paper we analyze the imaging performances of PSPMT by coupling two scintillation arrays and by light spot scanning of photocathode to evaluate the linearity position response, spatial resolution and uniformity gain response as a function of light distribution spread and the number of photoelectrons generated on photocathode. The results point out a very narrow PMT intrinsic charge spread and low cross-talk between anodes. Energy resolution and spatial resolution show a good linearity with DRF variation. An unexpected intra-anode gain variation is carried out. In this paper we present the results obtained with this PSPMT regarding imaging performances principally addressed to nuclear medicine application

  16. Nuclear safety and radiation protection report of the Chooz nuclear facilities - 2010; Rapport sur la surete nucleaire et la radioprotection des installations nucleaires de Chooz - 2010

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2011-06-15

    This safety report was established under the article 21 of the French law no. 2006-686 of June 13, 2006 relative to nuclear safety and information transparency. It presents, first, the facilities of the Chooz nuclear power plant (Ardennes (FR)): 2 PWR reactors in operation (Chooz B, INB 139 and 144) and one partially dismantled PWR reactor (Chooz A, INB 163). Then, the nuclear safety and radiation protection measures taken regarding the facilities are reviewed: nuclear safety definition, radiation protection of intervening parties, safety and radiation protection improvement paths, crisis management, external and internal controls, technical situation of facilities, administrative procedures in progress. The incidents and accidents which occurred in 2010, are reported as well as the radioactive and non-radioactive (chemical, thermal) effluents discharge in the environment. Finally, The radioactive materials and wastes generated by the facilities are presented and sorted by type of waste, quantities and type of conditioning. Other environmental impacts (noise, microbial proliferation in cooling towers) are presented with their mitigation measures. Actions in favour of transparency and public information are presented as well. The document concludes with a glossary and a list of recommendations from the Committees for health, safety and working conditions. (J.S.)

  17. Realization of the low background neutrino detector Double Chooz. From the development of a high-purity liquid and gas handling concept to first neutrino data

    Energy Technology Data Exchange (ETDEWEB)

    Pfahler, Patrick

    2012-12-17

    produced and, together with all other ingredients of muon veto and buffer, delivered to the experiment, where they were mixed and tuned in due consideration of the individual requirements of the different liquids. For the filling and handling of the DC-far detector, the underground laboratory was equipped with a comprehensive liquid-handling, gas-handling and monitoring-system, which provides all necessary functions to flush, fill, operate and empty the detector safely. Using these systems, the DC-far detector was flushed and filled in accordance with an especially developed sequence, which considered critical filling points and avoided unnecessary stress on the different detector vessels. By the means of this, the far detector of Double Chooz could be filled without damaging the detector vessels. In addition, it could be demonstrated that the quality and cleanliness of the detector liquids were maintained during filling. As a result of this, Double Chooz was able to acquire first neutrino data and to publish its first result of {Theta}{sub 13} with sin{sup 2}(2{Theta}{sub 13})=0.109 {+-} 0.030(stat.) {+-} 0.025(syst.).

  18. Realization of the low background neutrino detector Double Chooz. From the development of a high-purity liquid and gas handling concept to first neutrino data

    International Nuclear Information System (INIS)

    Pfahler, Patrick

    2012-01-01

    , together with all other ingredients of muon veto and buffer, delivered to the experiment, where they were mixed and tuned in due consideration of the individual requirements of the different liquids. For the filling and handling of the DC-far detector, the underground laboratory was equipped with a comprehensive liquid-handling, gas-handling and monitoring-system, which provides all necessary functions to flush, fill, operate and empty the detector safely. Using these systems, the DC-far detector was flushed and filled in accordance with an especially developed sequence, which considered critical filling points and avoided unnecessary stress on the different detector vessels. By the means of this, the far detector of Double Chooz could be filled without damaging the detector vessels. In addition, it could be demonstrated that the quality and cleanliness of the detector liquids were maintained during filling. As a result of this, Double Chooz was able to acquire first neutrino data and to publish its first result of Θ 13 with sin 2 (2Θ 13 )=0.109 ± 0.030(stat.) ± 0.025(syst.).

  19. In-service - pressure test of the primary circuit of the Chooz nuclear power plant

    International Nuclear Information System (INIS)

    Barthelemy, F.L.; Lespiaucq, P.G.

    1977-01-01

    A brief summary is given of the regulations governing inspection pratices of operating nuclear power plants, in France. As an example, such an inspection performed in 1976 on the Westinghouse 320 MWe PWR built in Chooz (Ardennes) is described. Emphasis is put on the administrative organization, the technical solutions, the specific problems and the difficulties encountered. (author)

  20. Double Chooz sensitivity and backgrounds studies to search for θ13 leptonic mixing angle

    International Nuclear Information System (INIS)

    Mention, G.

    2005-06-01

    The Double Chooz experiment will study the oscillations of electron antineutrinos produced by the Chooz nuclear power station to measure θ 13 mixing angle. The current knowledge on this parameter, provided ny the Chooz experiment, can be improved by reducing statistical and systematic errors. A large data sample will be collected to improve the former one. Two identical detectors will be built to cancel most of experimental systematic uncertainties involved in production and detection processes. Special care will be dedicated to backgrounds generated by natural radioactivity and cosmic ray interactions. In the hereby thesis, we describe our simulation studies to compute θ 13 sensitivity and assess the discovery potential of the experiment. We concentrated particularly on quantifying the detector related systematic errors that would limit the θ 13 sensitivity. Background related systematic errors such as the accidental events produced by the radioactivity of the photomultiplier tubes, correlated events from neutrons as well as a hypothetical background (mimicking the oscillation pattern) were taken into account. After 3 years, Double Chooz will be able to disentangle an oscillation signal for sin 2 (2*θ 13 ) > 0.05 (at 3*σ) or, if no oscillations were observed, to put a limit of sin 2 (2θ 13 ) < 0.03 at 90% C.L. (author)

  1. Investigation of the Chooz-A nuclear power plant bolts

    International Nuclear Information System (INIS)

    Monnet, I.; Decroix, G.M.; Dubuisson, P.; Reuchet, J.; Morlent, O.

    2002-01-01

    In Pressurised Water Reactor, some baffle-former bolts in austenitic stainless steel, are submitted to an important Intergranular cracking. This cracking may be attributed to the irradiation hardening during in pile service. As part of its concern of safety related to the ageing of the plant and, in particular, to the behaviour of the internals, IRSN wished to take part in the expertise Program on CHOOZ A power nuclear plant, within the framework of a convention with EDF, which provided the baffle-bolts. Examinations of these bolts, after 140 000 of in pile service, were carried out by the laboratories of the CEA. Hardness profiles were carried out on four bolts, which were irradiated at different doses, ranging from 0 to 22 dpa. The bolt of the core barrel, considered as unirradiated, shows a constant value of hardness, equal to the value of unirradiated material, all along the bolt and a slight increase in the head of the screw. The axial profile of hardness carried out on an irradiated bolt shows that there is a gradient of hardness between the most irradiated part (400 Hv) and the least irradiated part (270 Hv). The hardness of this bolt starts to evolve at 2.5 dpa and the maximum of hardening is reached for the most irradiated part (3.6 dpa). The hardness profile on the most irradiated bolt (between 10 and 22 dpa) indicate that hardness is homogeneous all along the bolt, 400 Hv. It confirms the existence of a threshold dose beyond which hardness does not vary any more, this threshold is estimated to be between 3.6 dpa and 10 dl Microstructural examinations of these bolts led us to conclude that hardening is correlated to dislocation microstructure. Indeed, the examination of the bolt of the core barrel confirms that this bolt is hardly unirradiated since the initial network of dislocations was not modified and that only some rare dislocation loops were observed. This is in agreement with hardness results showing no hardening of this bolt. On the two more

  2. A PMT mass testing facility for the JUNO experiment

    Energy Technology Data Exchange (ETDEWEB)

    Tietzsch, Alexander; Alsheimer, Isabell; Blum, David; Lachenmaier, Tobias; Sterr, Tobias [Physikalisches Institut, Universitaet Tuebingen (Germany); Bein, Bosse; Bick, Daniel; Ebert, Joachim; Hagner, Caren; Rebber, Henning; Steppat, Lisa; Wonsak, Bjoern [Institut fuer Experimentalphysik, Universitaet Hamburg (Germany)

    2016-07-01

    The JUNO (Jiangmen Underground Neutrino Observatory) experiment will be one of the big neutrino oscillation experiments starting in the next years. The main goal of JUNO is the determination of the neutrino mass hierarchy. To detect the sub-dominant effects in the oscillation pattern which depend on the mass hierarchy, the JUNO detector is planned with almost 20 kt fiducial volume, high light yield and energy resolution of better than 3%. In order to reach this, roughly 17000 newly developed high QE PMTs for the central detector, and additionally 2000 for the veto will be used. Each PMT has to be tested and characterized before it will be mounted in the experiment. This talk gives an overview on our plans and strategy for the mass test of all PMTs, and on the current status of the experimental test setup and next steps. The testing facility is developed in a cooperation between the Physical Institutes in Tuebingen and Hamburg within the JUNO collaboration.

  3. Hepatobiliary scintigraphy and function test with sup(99m)Tc-N-pyridoxyl-5-methyltryptophan (sup(99m)Tc-PMT)

    International Nuclear Information System (INIS)

    Sugimura, Kazuro; Nishiyama, Shoji; Narabayashi, Isamu

    1985-01-01

    The authors studied the effectiveness of sup(99m)Tc-N-pyridoxyl-5-methyltryptophan (sup(99m)Tc-PMT) for dynamic imaging and function on 40 patients with various hepatobiliary diseases and on healthy individuals. In healthy subjects, sup(99m)Tc-PMT is rapidly removed from the blood by the parenchymal cells of the liver and is excreted through the biliary system. The imaging of the liver, bile ducts, gallbladder and intestines with sup(99m)Tc-PMT was satisfactory. There was no renal visualization. In the case of serial images of healthy individuals, the gallbladder, intrahepatic bile duct and small intestine were visualized after 18.8 +- 7.2, 8.8 +- 1.4, and 16.7 +- 6.3 min, respectively; the mean peak time on the hepatogram was 8.0 +- 5.3 min. The bile ducts of patients with liver disorders were visualized later than those of healthy individuals. Particularly in the case of severe liver parenchymal diseases, the appearance time for the bile duct was significantly delayed. However, the delays in appearance time did not correlate well with low scores on the liver function test. At 70 min after the intravenous administration of sup(99m)Tc-PMT, 2.5 +- 1.5 % of the injected dose was excreted into the urine of the healthy individuals. The urinary excretion of sup(99m)Tc-PMT by the patients with hepatobiliary diseases showed no increase, and it was not entirely related to the results of the serum function tests. However, a larger amount of sup(99m)Tc-PMT was retained in the blood of the patients with hepatobiliary diseases. The blood retention values at 20 min after injection into those with liver cirrhosis and hepatoma were significantly delayed. (author)

  4. A simple method to increase effective PMT gain by amplifier circuit powered from voltage divider

    International Nuclear Information System (INIS)

    Popov, V.; Majewski, S.; Wojtsekhowski, B.; Guerin, D

    2001-01-01

    A novel concept is introduced of additional effective signal amplification by employing a dedicated circuit to process anode or dynode signals prior to sending them through a standard 50 /spl Omega/ line/cable. The circuit is entirely powered by the current flowing through the base voltage divider. Additional gain factors of 2-10 were easily achieved with preserved operation speed and rate capability up to several MHz. This additional signal boost can be used in many applications where higher gain and/or lower PMT operational voltages are desirable. For example, in the case of a PMT employed in a low input light signal (such as a Cherenkov counter), this technique will permit operation at a lower voltage and, therefore, will result in better operational PMT stability and longer PMT lifetime. At present, two experimental set-ups at Jefferson Lab are using PMT bases using this concept

  5. IAEA Concludes Safety Review at Chooz Nuclear Power Plant in France

    International Nuclear Information System (INIS)

    2013-01-01

    management of corrective maintenance and leak repair to minimize backlogs and maintain plant safety; The plant should enhance the chemistry control program to cover all chemistry aspects of plant systems; The plant should enhance the process of root cause analysis of safety significant events to improve the depth of analysis of such events; and The plant should consider improving systems to allow clear identification of deficiencies in the field once they have been recognized. Chooz management expressed a determination to address all the areas identified for improvement and requested the IAEA to schedule a follow-up mission in approximately 18 months. The team delivered a draft of its recommendations, suggestions and good practices to the plant management in the form of Technical Notes for factual comments. The technical notes and comments from the plant and the French Safety Authority will be reviewed at IAEA headquarters. The final report will be submitted to the Government of France within three months. This was the 175th mission of the OSART programme, which began in 1982, and the 25th mission in France. The next OSART mission in France is scheduled at Flamanville Units 1 and 2 in 2014. Background: General information about OSART missions can be found on the IAEA Website. An OSART mission is designed as a review of programmes and activities essential to operational safety. It is not a regulatory inspection, nor is it a design review or a substitute for an exhaustive assessment of the plant's overall safety status. Experts participating in the IAEA's June 2010 International Conference on Operational Safety of Nuclear Power Plants (NPP) reviewed the experience of the OSART programme and concluded: In OSART missions NPPs are assessed against IAEA Safety Standards which reflect the current international consensus on what constitutes a high level of safety; and OSART recommendations and suggestions are of utmost importance for operational safety improvement of NPPs. The IAEA

  6. ATLAS TileCal Sub-Module Production at UIUC - Photos of Prototype PMT Test Setup

    CERN Multimedia

    Errede, Steve

    2001-01-01

    Photo 1 - Entrance to the lab. Photo 2 - A shot of the center of the lab. Photo 3 - The back of the lab. The Dark Box: Photo 4 - A view of the outside of the Dark Box along with its dry nitrogen system. Photo 5 - A view of the inside of the Dark Box. Photo 6 - The LED holder, beam splitter (removed in this shot), and a pulsing circuit. Photo 7 - The PMT holder. Photo 8 - A possible design for a Stepper Motor controlled filter wheel. Photo 9 - Polishing area for the optical fibers. R&D Work on Stepper Motor/Motion Control: Photo 10 - The complete prototype of the Stepper Motor setup. Photo 11 - The prototype of the Main Stepper Motor Driver Board. Photo 12 - The prototype of the Stepper Motor Power Amplifer. Photo 13 - The prototype of the Stepper Motor LabPC + Interface Board.

  7. Electron optics design of an 8-in. spherical MCP-PMT

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Ping, E-mail: chenping@opt.cn [Key Laboratory of Ultra-fast photoelectric Diagnostics Technology, Xi’an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences, Xi’an 710119 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Collaborative Innovation Center of Extreme Optics, Shanxi University, Taiyuan 030006, Shanxi (China); Tian, Jinshou [Key Laboratory of Ultra-fast photoelectric Diagnostics Technology, Xi’an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences, Xi’an 710119 (China); Collaborative Innovation Center of Extreme Optics, Shanxi University, Taiyuan 030006, Shanxi (China); Qian, Sen; Zhao, Tianchi [Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); Liu, Hulin; Wei, Yonglin; Sai, Xiaofeng; He, Jianping; Wang, Xing; Lu, Yu [Key Laboratory of Ultra-fast photoelectric Diagnostics Technology, Xi’an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences, Xi’an 710119 (China); Chen, Lin; Guo, Lehui; Pei, Chengquan; Hui, Dandan [Key Laboratory of Ultra-fast photoelectric Diagnostics Technology, Xi’an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences, Xi’an 710119 (China); University of Chinese Academy of Sciences, Beijing 100049 (China)

    2017-03-11

    This paper discusses the electron optical system of an 8-in. spherical MCP-PMT. The MCP assembly, the supporting pole and the supply voltages are carefully designed to optimize the photoelectron collection efficiency and the transit time spread. Coating the MCP nickel-chromium electrode with an additional high secondary emission material is employed to make a breakthrough on the collection efficiency. With the simulation software CST, the Finite Integration method and the Monte Carlo method are combined to evaluate the collection efficiency, the time properties and the Earth's magnetic field effects. Simulation results show that the photocathode active solid angle is over 3.5 πsr, the average collection efficiency can exceed 95% with the coated MCP and the mean transit time spread is 2.2 ns for a typical electric potential of 500 V applied between the photocathode and the MCP input facet. The prototype and the measured single photoelectron spectrum are also presented.

  8. Studying the muon background component in the Double Chooz experiment

    Energy Technology Data Exchange (ETDEWEB)

    Dietrich, Dennis

    2013-03-28

    The reactor anti-neutrino experiment Double Chooz (DC) will measure the third neutrino mixing angle θ{sub 13} with very high precision. This mixing angle is connected to fundamental questions in particle physics beyond the current Standard Model. In DC neutrinos are detected via the Inverse Beta Decay reaction, which provides a clean signal distinguishable from most backgrounds. However, as neutrino interactions in the detector are very rare and an interfering muon background is present, a proper understanding and reduction of this background is mandatory. This is crucial because muons create fast neutrons and βn-emitters which lead to background capable of mimicking the neutrino interaction in the detector. This thesis covers different analysis topics related to the cosmic ray muon background at the DC far site. The thesis covers the identification of muons, the applied rejection technique and the determination of the muon rate at DC far site. Utilizing the muon rejection cuts of the neutrino analysis a muon rate of 13 s{sup -1} in the Inner Detector (ID) and of 46 s{sup -1} in the Inner Muon Veto (IV) was found. The efficiency of the IV to identify and reject cosmic ray muons was measured and a value greater than 99.97% has been found. The stability of the determined muon rates was examined and a seasonal modulation was found, compatible with a variation of the temperature profile of the atmosphere over the year. The parameter describing the strength between the relationship of temperature and muon rate change, the effective temperature coefficient was obtained: αT=0.39±0.01(stat.)±0.02(syst.). This gave the opportunity to measure the atmospheric kaon to pion ratio with the DC far detector which was found to be r(K/π)=0.14±0.06. Additional variations of muon rate with surface pressure were found and the barometric coefficient describing this effect was measured as βp=-0.59±0.20(stat.)±0.10(syst.) permille /mbar. Another central theme of this work was

  9. Studying the muon background component in the Double Chooz experiment

    International Nuclear Information System (INIS)

    Dietrich, Dennis

    2013-01-01

    The reactor anti-neutrino experiment Double Chooz (DC) will measure the third neutrino mixing angle θ 13 with very high precision. This mixing angle is connected to fundamental questions in particle physics beyond the current Standard Model. In DC neutrinos are detected via the Inverse Beta Decay reaction, which provides a clean signal distinguishable from most backgrounds. However, as neutrino interactions in the detector are very rare and an interfering muon background is present, a proper understanding and reduction of this background is mandatory. This is crucial because muons create fast neutrons and βn-emitters which lead to background capable of mimicking the neutrino interaction in the detector. This thesis covers different analysis topics related to the cosmic ray muon background at the DC far site. The thesis covers the identification of muons, the applied rejection technique and the determination of the muon rate at DC far site. Utilizing the muon rejection cuts of the neutrino analysis a muon rate of 13 s -1 in the Inner Detector (ID) and of 46 s -1 in the Inner Muon Veto (IV) was found. The efficiency of the IV to identify and reject cosmic ray muons was measured and a value greater than 99.97% has been found. The stability of the determined muon rates was examined and a seasonal modulation was found, compatible with a variation of the temperature profile of the atmosphere over the year. The parameter describing the strength between the relationship of temperature and muon rate change, the effective temperature coefficient was obtained: αT=0.39±0.01(stat.)±0.02(syst.). This gave the opportunity to measure the atmospheric kaon to pion ratio with the DC far detector which was found to be r(K/π)=0.14±0.06. Additional variations of muon rate with surface pressure were found and the barometric coefficient describing this effect was measured as βp=-0.59±0.20(stat.)±0.10(syst.) permille /mbar. Another central theme of this work was the extrapolation

  10. Chooz A, First Pressurized Water Reactor to be Dismantled in France - 13445

    Energy Technology Data Exchange (ETDEWEB)

    Boucau, Joseph [Westinghouse Electric Company, 43 rue de l' Industrie, Nivelles (Belgium); Mirabella, C. [Westinghouse Electric France, Orsay (France); Nilsson, Lennart [Westinghouse Electric Sweden, Vaesteraas (Sweden); Kreitman, Paul J. [Westinghouse Electric Company, Lake Bluff, IL 60048 (United States); Obert, Estelle [EDF - DPI - CIDEN, Lyon (France)

    2013-07-01

    Nine commercial nuclear power plants have been permanently shut down in France to date, of which the Chooz A plant underwent an extensive decommissioning and dismantling program. Chooz Nuclear Power Station is located in the municipality of Chooz, Ardennes region, in the northeast part of France. Chooz B1 and B2 are 1,500 megawatt electric (MWe) pressurized water reactors (PWRs) currently in operation. Chooz A, a 305 MWe PWR implanted in two caves within a hill, began operations in 1967 and closed in 1991, and will now become the first PWR in France to be fully dismantled. EDF CIDEN (Engineering Center for Dismantling and Environment) has awarded Westinghouse a contract for the dismantling of its Chooz A reactor vessel (RV). The project began in January 2010. Westinghouse is leading the project in a consortium with Nuvia France. The project scope includes overall project management, conditioning of the reactor vessel (RV) head, RV and RV internals segmentation, reactor nozzle cutting for lifting the RV out of the pit and seal it afterwards, dismantling of the RV thermal insulation, ALARA (As Low As Reasonably Achievable) forecast to ensure acceptable doses for the personnel, complementary vacuum cleaner to catch the chips during the segmentation work, needs and facilities, waste characterization and packaging, civil work modifications, licensing documentation. The RV and RV internals will be segmented based on the mechanical cutting technology that Westinghouse applied successfully for more than 13 years. The segmentation activities cover the cutting and packaging plan, tooling design and qualification, personnel training and site implementation. Since Chooz A is located inside two caves, the project will involve waste transportation from the reactor cave through long galleries to the waste buffer area. The project will end after the entire dismantling work is completed, and the waste storage is outside the caves and ready to be shipped either to the ANDRA (French

  11. Measurement of the neutrino mixing angle θ13 with the Double Chooz experiment

    Science.gov (United States)

    Ostrovskiy, Igor

    2009-10-01

    The neutrino mixing angle θ13 is last one which value is still unknown. Measuring the θ13 is important for completing our understanding of three flavor neutrino oscillations. Moreover, leptonic CP violation could only be measured in case the value of θ13 is not zero. The current best limit (^2(2θ13)Ardennes. Described in this talk, is another experiment, Double Chooz, that is being prepared at the same site. The Double Chooz experiment offers several fundamental improvements and is aiming to surpass the current limit by an order of magnitude (^2(2θ13) < 0.03). Details of the detector design, overview of systematic errors and expected sensitivity, as well as current status of the experiment are presented.

  12. The O-methyltransferase PMT2 mediates methylation of pinosylvin in Scots pine.

    Science.gov (United States)

    Paasela, Tanja; Lim, Kean-Jin; Pietiäinen, Milla; Teeri, Teemu H

    2017-06-01

    Heartwood extractives are important determinants of the natural durability of pine heartwood. The most important phenolic compounds affecting durability are the stilbenes pinosylvin and its monomethylether, which in addition have important functions as phytoalexins in active defense. A substantial portion of the synthesized pinosylvin is 3-methoxylated but the O-methyltransferase responsible for this modification has not been correctly identified. We studied the expression of the stilbene pathway during heartwood development as well as in response to wounding of xylem and UV-C treatment of needles. We isolated and enzymatically characterized a novel O-methyltransferase, PMT2. The methylated product was verified as pinosylvin monomethylether using ultra performance liquid chromatography-tandem mass spectrometry and high performance liquid chromatography analyses. The PMT2 enzyme was highly specific for stilbenes as substrate, in contrast to caffeoyl-CoA O-methyltransferase (CCoAOMT) and PMT1 that were multifunctional. Expression profile and multifunctional activity of CCoAOMT suggest that it might have additional roles outside lignin biosynthesis. PMT1 is not involved in the stilbene pathway and its biological function remains an open question. We isolated a new specific O-methyltransferase responsible for 3-methoxylation of pinosylvin. Expression of PMT2 closely follows stilbene biosynthesis during developmental and stress induction. We propose that PMT2 is responsible for pinosylvin methylation in Scots pine (Pinus sylvestris), instead of the previously characterized methyltransferase, PMT1. © 2017 The Authors. New Phytologist © 2017 New Phytologist Trust.

  13. Measurement of the leptonic mixing parameter θ13 at the reactor antineutrino experiment Double Chooz

    International Nuclear Information System (INIS)

    Durand, V.

    2014-01-01

    The Double Chooz experiment aims at measuring the neutrino mixing parameter θ 13 by studying the oscillations of ν-bar e produced by the Chooz nuclear reactors located in France. The experimental concept consists in comparing the signal of 2 identical 10.3 m 3 detectors, allowing the cancellation of most of the experimental systematic uncertainties. The near detector, whose goal is the flux normalization and a measurement without oscillation, is expected to be delivered in 2013. The farthest detector from the source is taking data since april 2011 and is sensitive to θ 13 , which is expected to affect both the rate and the shape of measured ν-bar e . In 102 days with far detector only, 4121 ν-bar e candidates have been observed, while the expectation in case of no-oscillation is 4344 ± 165 events. This deficit is interpreted as evidence for ν-bar e disappearance. From a rate and shape analysis, it is found that sin 2 (θ 13 ) = [0.086±0.041(stat.)±0.030(syst)] with Δm 31 2 =2.4*10 -3 eV 2 , while the no-oscillation hypothesis is even excluded at 94.6%. We present in this document the concept and detection method of the Double Chooz experiment, along with its analysis strategy and first results on θ 13 . (author)

  14. Nuclear safety and radiation protection report of the Chooz nuclear facilities - 2011

    International Nuclear Information System (INIS)

    2012-01-01

    This safety report was established under the article 21 of the French law no. 2006-686 of June 13, 2006 relative to nuclear safety and information transparency. It presents, first, the facilities of the Chooz nuclear power plant (Ardennes (FR)): 2 PWR reactors in operation (Chooz B, INB 139 and 144) and one partially dismantled PWR reactor (Chooz A, INB 163). Then, the nuclear safety and radiation protection measures taken regarding the facilities are reviewed: nuclear safety definition, radiation protection of intervening parties, safety and radiation protection improvement paths, crisis management, external and internal controls, technical situation of facilities, administrative procedures in progress. The incidents and accidents which occurred in 2011, are reported as well as the radioactive and non-radioactive (chemical, thermal) effluents discharge in the environment. Finally, The radioactive materials and wastes generated by the facilities are presented and sorted by type of waste, quantities and type of conditioning. Other environmental impacts (noise, microbial proliferation in cooling towers) are presented with their mitigation measures. Actions in favour of transparency and public information are presented as well. The document concludes with a glossary followed by the viewpoint of the Committees for health, safety and working conditions. (J.S.)

  15. Nuclear safety and radiation protection report of the Chooz nuclear facilities - 2010

    International Nuclear Information System (INIS)

    2011-06-01

    This safety report was established under the article 21 of the French law no. 2006-686 of June 13, 2006 relative to nuclear safety and information transparency. It presents, first, the facilities of the Chooz nuclear power plant (Ardennes (FR)): 2 PWR reactors in operation (Chooz B, INB 139 and 144) and one partially dismantled PWR reactor (Chooz A, INB 163). Then, the nuclear safety and radiation protection measures taken regarding the facilities are reviewed: nuclear safety definition, radiation protection of intervening parties, safety and radiation protection improvement paths, crisis management, external and internal controls, technical situation of facilities, administrative procedures in progress. The incidents and accidents which occurred in 2010, are reported as well as the radioactive and non-radioactive (chemical, thermal) effluents discharge in the environment. Finally, The radioactive materials and wastes generated by the facilities are presented and sorted by type of waste, quantities and type of conditioning. Other environmental impacts (noise, microbial proliferation in cooling towers) are presented with their mitigation measures. Actions in favour of transparency and public information are presented as well. The document concludes with a glossary and a list of recommendations from the Committees for health, safety and working conditions. (J.S.)

  16. Background estimation of cosmic-ray induced neutrons in Chooz site water veto tank for possible future Ricochet Deployment

    Science.gov (United States)

    Silva, James

    2017-09-01

    The Ricochet experiment seeks to measure Coherent (neutral-current) Elastic Neutrino-Nucleus Scattering (CE νNS) using metallic superconducting and germanium semi-conducting detectors with sub-keV thresholds placed near a neutrino source such as the Chooz Nuclear Reactor Complex. In this poster, we present an estimate of the flux of cosmic-ray induced neutrons, which represent an important background in any (CE νNS) search, based on reconstructed cosmic ray data from the Chooz Site. We have simulated a possible Ricochet deployment at the Chooz site in GEANT4 focusing on the spallation neutrons generated when cosmic rays interact with the water tank veto that would surround our detector. We further simulate and discuss the effectiveness of various shielding configurations for optimizing the background levels for a future Ricochet deployment.

  17. Auranofin Inhibits the Enzyme Activity of Pasteurella multocida Toxin PMT in Human Cells and Protects Cells from Intoxication

    Directory of Open Access Journals (Sweden)

    Stefan Carle

    2017-01-01

    Full Text Available The AB-type protein toxin from Pasteurella multocida (PMT contains a functionally important disulfide bond within its catalytic domain, which must be cleaved in the host cell cytosol to render the catalytic domain of PMT into its active conformation. Here, we found that the reductive potential of the cytosol of target cells, and more specifically, the activity of the thioredoxin reductase (TrxR is crucial for this process. This was demonstrated by the strong inhibitory effect of the pharmacological TrxR inhibitor auranofin, which inhibited the intoxication of target cells with PMT, as determined by analyzing the PMT-catalyzed deamidation of GTP-binding proteins (G-proteins in the cytosol of cells. The amount of endogenous substrate levels modified by PMT in cells pretreated with auranofin was reduced compared to cells treated with PMT alone. Auranofin had no inhibitory effect on the activity of the catalytic domain of constitutively active PMT in vitro, demonstrating that auranofin did not directly inhibit PMT activity, but interferes with the mode of action of PMT in cells. In conclusion, the results show that TrxR is crucial for the mode of action of PMT in mammalian cells, and that the drug auranofin can serve as an efficient inhibitor, which might be a starting point for novel therapeutic options against toxin-associated diseases.

  18. Liquid scintillators and liquefied rare gases for particle detectors. Background-determination in Double Chooz and scintillation properties of liquid argon

    International Nuclear Information System (INIS)

    Hofmann, Martin Alexander

    2012-01-01

    Evidence for physics beyond the well-established standard model of particle physics is found in the sector of neutrino physics, in particular in neutrino oscillations, and in experimental hints requiring the presence of Dark Matter. Neutrino oscillations demand the neutrinos to be massive and at least four additional parameters, three mixing angles and one phase, are introduced. A non-vanishing value for the third mixing angle, θ 13 , has only recently been found, amongst others by the reactor antineutrino disappearance experiment Double Chooz. This experiment detects anti ν e 's by means of the Inverse Beta Decay (IBD), which has a clear signature that can very effectively be discriminated from most of the background. However, some background still survives the selection cuts applied to the data, partly induced by radioactivity. In order to determine the amount of radioimpurities in the detector, germanium spectroscopy measurements and neutron activation analyses have been carried out for various parts of the Double Chooz far detector. A dedicated Monte-Carlo simulation was performed to obtain the singles event rate induced by the identified radioimpurities in the fiducial volume of Double Chooz. In the present thesis, parts from the outer detector systems, as well as components of the inner detector liquids were measured. In sum, a singles rate of less than 0.35 Hz above the antineutrino detection threshold of 0.7 MeV has been found. This is by far below the design goal of Double Chooz of ∝ 20 Hz. The analysis of bismuth-polonium (BiPo) coincidences in the first Double Chooz data allows to directly determine the number of decays from the U- and the Th-decay chain in the active detector parts. Assuming radioactive equilibrium, concentrations of (1.71±0.08).10 -14 (g)/(g) for uranium and (8.16±0.49).10 -14 (g)/(g) for thorium have been found, which are also well below the design goal of Double Chooz (2.10 -13 (g)/(g)). Both gamma spectroscopy measurements and

  19. Liquid scintillators and liquefied rare gases for particle detectors. Background-determination in Double Chooz and scintillation properties of liquid argon

    Energy Technology Data Exchange (ETDEWEB)

    Hofmann, Martin Alexander

    2012-11-27

    Evidence for physics beyond the well-established standard model of particle physics is found in the sector of neutrino physics, in particular in neutrino oscillations, and in experimental hints requiring the presence of Dark Matter. Neutrino oscillations demand the neutrinos to be massive and at least four additional parameters, three mixing angles and one phase, are introduced. A non-vanishing value for the third mixing angle, {theta}{sub 13}, has only recently been found, amongst others by the reactor antineutrino disappearance experiment Double Chooz. This experiment detects anti {nu}{sub e}'s by means of the Inverse Beta Decay (IBD), which has a clear signature that can very effectively be discriminated from most of the background. However, some background still survives the selection cuts applied to the data, partly induced by radioactivity. In order to determine the amount of radioimpurities in the detector, germanium spectroscopy measurements and neutron activation analyses have been carried out for various parts of the Double Chooz far detector. A dedicated Monte-Carlo simulation was performed to obtain the singles event rate induced by the identified radioimpurities in the fiducial volume of Double Chooz. In the present thesis, parts from the outer detector systems, as well as components of the inner detector liquids were measured. In sum, a singles rate of less than 0.35 Hz above the antineutrino detection threshold of 0.7 MeV has been found. This is by far below the design goal of Double Chooz of {proportional_to} 20 Hz. The analysis of bismuth-polonium (BiPo) coincidences in the first Double Chooz data allows to directly determine the number of decays from the U- and the Th-decay chain in the active detector parts. Assuming radioactive equilibrium, concentrations of (1.71{+-}0.08).10{sup -14}(g)/(g) for uranium and (8.16{+-}0.49).10{sup -14}(g)/(g) for thorium have been found, which are also well below the design goal of Double Chooz (2.10{sup -13

  20. A Study of Personal Health Record User's Behavioral Model Based on the PMT and UTAUT Integrative Perspective.

    Science.gov (United States)

    Hsieh, Hui-Lung; Kuo, Yu-Ming; Wang, Shiang-Ru; Chuang, Bi-Kun; Tsai, Chung-Hung

    2016-12-23

    The personal health record (PHR) is a system that enables borderless medical care services by combining technological innovation and human consideration. This study explored factors affecting the adoption of PHR from technical, medical, and social perspectives according to the Protection Motivation Theory (PMT) and Unified Theory of Acceptance and Use of Technology (UTAUT) model. A survey using a structured questionnaire was subsequently conducted, which produced the following results: (1) The PMT and UTAUT were effective at predicting PHR usage behaviors; (2) Perceived ease-of-use was the most decisive factor influencing the use of PHR, followed by self-efficacy and perceived usefulness; and (3) Behavioral intention for PHR was significantly and positively correlated with usage behavior. From the obtained results, this study recommends that health authorities and medical institutions promote self-efficacy in the use of PHR to improve the levels of behavioral intention and usage behavior among the people. Additionally, medical care institutions are recommended to promote health management and preventive healthcare concepts to help improve public acceptance of the PHR system as a means to self-manage their health. Finally, community centers, medical institutions, and health authorities are urged to work together to enhance public medical knowledge and pool resources for the PHR system, both of which are essential for improving the popularity of the PHR, public quality of life, and the effectiveness of health management.

  1. A Study of Personal Health Record User’s Behavioral Model Based on the PMT and UTAUT Integrative Perspective

    Directory of Open Access Journals (Sweden)

    Hui-Lung Hsieh

    2016-12-01

    Full Text Available The personal health record (PHR is a system that enables borderless medical care services by combining technological innovation and human consideration. This study explored factors affecting the adoption of PHR from technical, medical, and social perspectives according to the Protection Motivation Theory (PMT and Unified Theory of Acceptance and Use of Technology (UTAUT model. A survey using a structured questionnaire was subsequently conducted, which produced the following results: (1 The PMT and UTAUT were effective at predicting PHR usage behaviors; (2 Perceived ease-of-use was the most decisive factor influencing the use of PHR, followed by self-efficacy and perceived usefulness; and (3 Behavioral intention for PHR was significantly and positively correlated with usage behavior. From the obtained results, this study recommends that health authorities and medical institutions promote self-efficacy in the use of PHR to improve the levels of behavioral intention and usage behavior among the people. Additionally, medical care institutions are recommended to promote health management and preventive healthcare concepts to help improve public acceptance of the PHR system as a means to self-manage their health. Finally, community centers, medical institutions, and health authorities are urged to work together to enhance public medical knowledge and pool resources for the PHR system, both of which are essential for improving the popularity of the PHR, public quality of life, and the effectiveness of health management.

  2. A Study of Personal Health Record User’s Behavioral Model Based on the PMT and UTAUT Integrative Perspective

    Science.gov (United States)

    Hsieh, Hui-Lung; Kuo, Yu-Ming; Wang, Shiang-Ru; Chuang, Bi-Kun; Tsai, Chung-Hung

    2016-01-01

    The personal health record (PHR) is a system that enables borderless medical care services by combining technological innovation and human consideration. This study explored factors affecting the adoption of PHR from technical, medical, and social perspectives according to the Protection Motivation Theory (PMT) and Unified Theory of Acceptance and Use of Technology (UTAUT) model. A survey using a structured questionnaire was subsequently conducted, which produced the following results: (1) The PMT and UTAUT were effective at predicting PHR usage behaviors; (2) Perceived ease-of-use was the most decisive factor influencing the use of PHR, followed by self-efficacy and perceived usefulness; and (3) Behavioral intention for PHR was significantly and positively correlated with usage behavior. From the obtained results, this study recommends that health authorities and medical institutions promote self-efficacy in the use of PHR to improve the levels of behavioral intention and usage behavior among the people. Additionally, medical care institutions are recommended to promote health management and preventive healthcare concepts to help improve public acceptance of the PHR system as a means to self-manage their health. Finally, community centers, medical institutions, and health authorities are urged to work together to enhance public medical knowledge and pool resources for the PHR system, both of which are essential for improving the popularity of the PHR, public quality of life, and the effectiveness of health management. PMID:28025557

  3. Characterization, modelization and optimization of the Double Chooz acrylic vessels: physics impact

    International Nuclear Information System (INIS)

    Queval, R.

    2010-01-01

    Double Chooz is one of the new generation experiments designed to measure the last unknown leptonic mixing angle, θ 13 . Il studies the oscillations of electronic antineutrinos produced by the Chooz nuclear power plant. Our knowledge on θ 13 can be improved by reducing both statistical errors (increasing both the detector size and run time) and systematic errors (using identical near and far detectors). Also, special care is dedicated to analyze backgrounds generated by natural radioactivity and cosmic ray interactions. The work presented here mostly focuses on Target and Gamma Catcher acrylic vessels, in the core of the detector. A new material designed for the experiment was developed since no pre-existing material met the required conditions. This material was characterized optically, to maximize light transmission and reduce the induced dead zone. With this in mind, a physics study of the Target vessel design was performed to identify any spectral distortion or count rate modification it could induce. As far as backgrounds are concerned, the material is radio-pure enough so that the singles rate coming from acrylic is negligible compared to the one from the photomultiplier tubes. An unknown single source is coming from the external contamination in the detector, such as dust. This is why we defined cleanliness goals for the detector fabrication and integration. These goals were met, thanks to well-defined protocols and careful team work. After three years of data taking, Double Chooz could disentangle an oscillation signal at 3α for sin 2 2θ 13 ≥ 0.05 - 0.06. If no oscillations were observed, the experiment could give an upper limit on sin 2 2θ 13 of 0.02 - 0.03 at 90 % C.L. (author) [fr

  4. A high resolution animal PET scanner using compact PS-PMT detectors

    International Nuclear Information System (INIS)

    Watanabe, M.; Okada, H.; Shimizu, K.; Omura, T.

    1996-01-01

    A new high resolution PET scanner dedicated to animal studies has been designed, built and tested. The system utilizes 240 block detectors, each of which consists of a new compact position-sensitive photomultiplier tube (PS-PMT) and an 8 x 4 BGO array. A total number of 7,680 crystals (480 per ring) are positioned to form a 508 mm diameter of 16 detector rings with 7.2 mm pitch and 114 mm axial field of view (FOV). The system is designed to perform activation studies using a monkey in a sitting position. The data can be acquired in either 2D or 3D mode, where the slice collimators are retracted in 3D mode. The transaxial resolution is 2.6 mm FWHM at the center of the FOV, and the average axial resolution on the axis of the ring is 3.3 mm FWHM in the direct slice and 3.2 mm FWHM in the cross slice. The scatter fraction, sensitivity and count rate performance were evaluated for a 10 cm diameter cylindrical phantom. The total system sensitivity is 2.3 kcps/kBq/ml in 2D mode and 22.8 kcps/kBq/ml in 3D mode. The noise equivalent count rate with 3D mode is equivalent to that with 2D mode at five times higher radioactivity level. The applicable imaging capabilities of the scanner was demonstrated by animal studies with a monkey

  5. Coherent neutrino scattering with low temperature bolometers at Chooz reactor complex

    International Nuclear Information System (INIS)

    Billard, J; Gascon, J; Jesus, M De; Carr, R; Formaggio, J A; Heine, S T; Johnston, J; Leder, A; Sibille, V; Winslow, L; Dawson, J; Lasserre, T; Figueroa-Feliciano, E; Palladino, K J; Vivier, M

    2017-01-01

    We present the potential sensitivity of a future recoil detector for a first detection of the process of coherent elastic neutrino nucleus scattering (CE ν NS). We use the Chooz reactor complex in France as our luminous source of reactor neutrinos. Leveraging the ability to cleanly separate the rate correlated with the reactor thermal power against (uncorrelated) backgrounds, we show that a 10 kg cryogenic bolometric array with 100 eV threshold should be able to extract a CE ν NS signal within one year of running. (paper)

  6. The treatment of low level effluents by flocculation and settling at the Chooz nuclear power plant

    International Nuclear Information System (INIS)

    Petteau, J.L.; Roofthooft, R.

    1989-01-01

    At the Chooz plant, radioactive effluents were formerly treated by evaporation, but because throughput was low, another method was studied. After laboratory tests, a 500 L/h flocculation and settling pilot plant was constructed, followed later by a 5 m 3 /h installation. The main isotopes eliminated are caesium-134 and caesium-137. Flocculation with copper ferrocyanide reduces the total activity to less than 500 Bq/L. The installation described in the paper was commissioned in 1984 and has been in industrial operation since 1985, processing all types of effluent. The evaporator can be set aside for boric acid recovery. (author). 3 figs, 1 tab

  7. Measurement of the mixing leptonic parameter θ13 at the Double Chooz reactor antineutrino experiment

    International Nuclear Information System (INIS)

    Durand, V.

    2012-01-01

    The Double Chooz experiment aims at measuring the neutrino mixing parameter θ13 by studying the oscillations of de ν-bar e produced by the Chooz nuclear reactors located in France. The experimental concept consists in comparing the signal of two identical 10.3 m 3 detectors, allowing to cancel most of the experimental systematic uncertainties. The near detector, whose goal is the flux normalization and a measurement without oscillation, is expected to be delivered in 2013. The farthest detector from the source is taking data since April 2011 and is sensitive to θ 13 , which is expected to affect both the rate and the shape of the measured de ν-bar e . In this thesis, are first presented the Double Chooz experiment, with its ν-bar e source, its detection method, and the expected signal and backgrounds. In order to perform a selection, important quantities have to be reconstructed, calibrated, and saved in data files. The channel time offsets determination, the energy and vertex reconstruction algorithm CocoReco, the reconstruction packages of the Common Trunk, and the light trees maker Cheetah are especially presented. Concerning the data analysis, all the selection cuts and results for signal and backgrounds are discussed, particularly the multiplicity cut, the multiple off time window method, the lithium veto cut, and the cosmogenic 9 Li background studies. The Double Chooz experiment observed 8,249 de ν-bar e candidates in 227.93 days in its far detector only. The reactor antineutrino flux prediction used the Bugey 4 flux measurement after correction for differences in core composition. The expectation in case of no-oscillation is 8,937 events and this deficit is interpreted as evidence for ν-bar e disappearance. From a rate and shape analysis, is found sin 2 2θ = 0,109± 0,030 (stat) ± 0,025 (syst), with Δm 2 31 = 2,32 x 10 -3 eV 2 , while the no-oscillation hypothesis is even excluded at 2.9 σ. (author) [fr

  8. Building a nuclear power plant from A to Z: Chooz B as an example

    International Nuclear Information System (INIS)

    Anon.

    1994-01-01

    From the design studies to the tests and reactor divergence, building a nuclear power plant involves strictly planned operations. This issue deals with the operations carried out first in the design offices and then on the site, in order to achieve such a vast and sophisticated industrial project: organizing, designing, engineering, assembling, testing, manufacturing and transporting heavy components. These various phases are shown through the example of Chooz B, a nuclear power plant with two 1.450 MW units, which is being built in the Ardennes, and whose first reactor will diverge in 1995. (author)

  9. Investigation about decoupling capacitors of PMT voltage divider effects on neutron-gamma discrimination

    International Nuclear Information System (INIS)

    Divani, Nazila; Firoozabadi, Mohammad M.; Bayat, Esmail

    2014-01-01

    Scintillators are almost used in any nuclear laboratory. These detectors combine of scintillation materials, PMT and a voltage divider. Voltage dividers are different in resistive ladder design. But the effect of decoupling capacitors and damping resistors haven’t discussed yet. In this paper at first a good equilibrium circuit designed for PMT, and it was used for investigating about capacitors and resistors in much manner. Results show that decoupling capacitors have great effect on PMT output pulses. In this research, it was tried to investigate the effect of Capacitor’s value and places on PMT voltage divider in Neutron-Gamma discrimination capability. Therefore, the voltage divider circuit for R329-02 Hamamatsu PMT was made and Zero Cross method used for neutron-gamma discrimination. The neutron source was a 20Ci Am-Be. Anode and Dynode pulses and discrimination spectrum were saved. The results showed that the pulse height and discrimination quality change with the value and setting of capacitors

  10. A front end ASIC for the readout of the PMT in the KM3NeT detector

    International Nuclear Information System (INIS)

    Gajanana, D; Gromov, V; Timmer, P; Heine, E; Kluit, R

    2010-01-01

    In this work, we describe the front end ASIC to readout the Photo-Multiplier-Tube of the KM3NeT detector, in detail. Stringent power budgeting, area constraints and lowering cost motivate us to design a custom front-end ASIC for reading the PMT. The ASIC amplifies the PMT signal and discriminates it against a threshold level and delivers the information via low voltage differential signals (LVDS). These LVDS signals carry highly accurate timing information of the photons . The length of the LVDS signals or Time over Threshold (ToT) gives information on the number of detected photons. A one-time programmable read-only memory (PROM) block provides unique identification to the chip. The chip communicates with the data acquisition electronics via an I 2 C bus. The data is transmitted to shore via fiber optics, where processing is done. The ASIC was fabricated in 0.35u CMOS process from AustriaMicroSystems (AMS).

  11. Progress in RPV-examination of the Chooz-A vessel (and the French procedures, its new developments (MIS5))

    Energy Technology Data Exchange (ETDEWEB)

    Samman, J; Martin, E; Lacroix, R [Electricite de France (EDF), 93 - Saint-Denis (France). Groupe des Labs.

    1988-12-31

    This document deals with the French Chooz-A reactor. It describes the method used for in-service inspection of Reactor Pressure Vessels (RPV). The ultrasonic testing procedure is described, showing its advantages and limitations. The supplementary ultrasonic examination is also described, as well as the validation of underclad cracks detection and sizing. Historical data is also provided. (TEC).

  12. Flash-ADCs test, optimization of the detector design and development of a new concept of spatial reconstruction in the double chooz neutrino oscillation experiment

    International Nuclear Information System (INIS)

    Akiri, T.

    2010-09-01

    Double Chooz (DC) is a reactor neutrino oscillation experiment whose purpose is the measurement of the last unknown mixing angle θ 13 . It inherits from the past Chooz experiment which was limited by the statistical and systematic errors at the same extent of about 2.8%. To lower the statistical error, the DC detector target mass has been increased and a longer exposure is foreseen while the lowering of the systematic error is ensured by the use of two identical detectors. One will be located in the vicinity of the reactor cores to monitor the flux and spectrum of the ν-bar e emitted whereas the other one will be located where the effect of the oscillation is expected to be maximal. They are respectively so-called 'near' and 'far' detectors. The expected errors are 0.5% (stat.) and 0.6% (syst.) for a measurement down to sin 2 (2*θ 13 ) = 0.05 (θ 13 6.5 degrees) at three standard deviations after three years of data taking. The far detector is expected for November 2010 while the near detector will be operational in mid-2012. This thesis presents first a hardware work consisting in testing the Flash-ADCs that are the core of the main acquisition system of the experiment. Subsequently, it presents analyses performed on Monte Carlo simulations towards the optimization of the detector design. This work was composed of analyses to choose some detector components with the appropriate natural radioactivity contamination, analyses for the best achievable energy resolution and the most stable and robust way of triggering. The work on the optimization of the detector together with the acquired knowledge on the Flash-ADCs led us to envisage the possibility of a new spatial reconstruction based on the time of flight. All these contributions to the experiment are described in details throughout this manuscript. (author)

  13. Development of 10×10 Matrix-anode MCP-PMT

    Science.gov (United States)

    Yang, Jie; Li, Yongbin; Xu, Pengxiao; Zhao, Wenjin

    2018-02-01

    10×10 matrix-anode is developed by high-temperature co-fired ceramics (HTCC) technology. Based on the new matrix-anode, a new kind of photon counting imaging detector - 10×10 matrix-anode MCP-PMT is developed, and its performance parameters are tested. HTCC technology is suitable for the MCP-PMT's air impermeability and its baking process. Its response uniformity is better than the metal-ceramic or metal-glass sealing anode, and it is also a promising method to realize a higher density matrix-anode.

  14. A 30 ps Timing Resolution for Single Photons with Multi-pixel Burle MCP-PMT

    Energy Technology Data Exchange (ETDEWEB)

    Va' vra, J.; Benitez, J.; Coleman, J.; Leith, D.W.G.S.; Mazaheri, G.; Ratcliff, B.; Schwiening, J.; /SLAC

    2006-07-05

    We have achieved {approx}30 psec single-photoelectron and {approx}12ps for multi-photoelectron timing resolution with a new 64 pixel Burle MCP-PMT with 10 micron microchannel holes. We have also demonstrated that this detector works in a magnetic field of 15kG, and achieved a single-photoelectron timing resolution of better than 60 psec. The study is relevant for a new focusing DIRC RICH detector for particle identification at future Colliders such as the super B-factory or ILC, and for future TOF techniques. This study shows that a highly pixilated MCP-PMT can deliver excellent timing resolution.

  15. Measuring the θ13 mixing angle with the two Double Chooz detectors

    International Nuclear Information System (INIS)

    Sibille, Valerian

    2016-01-01

    The Double Chooz experiment aims at accurately measuring the value of the θ 13 leptonic mixing angle. To this intent, the experiment makes the most of two identical detectors - filled with gadolinium-loaded liquid scintillator - observing ν e -bar's released by the two 4.25 GWth nuclear reactors of the French Chooz power plant. The so-called 'far detector' - located at an average distance of 1050 m from the two nuclear cores - has been taking data since April 2011. The 'near detector' - at an average distance of 400 m from the cores - has monitored the reactor since December 2014. The θ 13 mixing parameter leads to an energy dependent disappearance of ν e -bar's as they propagate from the nuclear cores to the detection sites, which allows for a fit of the sin 2 2θ 13 value. By reason of correlations between the detectors and an iso-flux layout, the detection systematics and the ν e -bar flux uncertainty impairing the θ 13 measurement are dramatically suppressed. In consequence, the precision of the θ 13 measurement is dominated by the uncertainty on the backgrounds and the relative normalisation of the ν e -bar-rates. The main background originates from the decay of β n -emitters - generated by μ-spallation - within the detector itself. The energy spectra of these cosmogenic isotopes have been simulated and complemented by a diligent error treatment. These predictions have been successfully compared to the corresponding data spectra, extracted by means of an active veto, whose performance has been studied at both sites. The rate of cosmogenic background remaining within the ν e -bar candidates has also been assessed. Additionally, the normalisation of the ν e -bar rates, bound to the number of target protons within each detector, has been evaluated. All this work was part of the first Double Chooz multi-detector results, yielding sin 2 2θ 13 =0.111 ± 0.018. (author) [fr

  16. Determination of the direction to a source of antineutrinos via inverse beta decay in Double Chooz

    Science.gov (United States)

    Nikitenko, Ya.

    2016-11-01

    To determine the direction to a source of neutrinos (and antineutrinos) is an important problem for the physics of supernovae and of the Earth. The direction to a source of antineutrinos can be estimated through the reaction of inverse beta decay. We show that the reactor neutrino experiment Double Chooz has unique capabilities to study antineutrino signal from point-like sources. Contemporary experimental data on antineutrino directionality is given. A rigorous mathematical approach for neutrino direction studies has been developed. Exact expressions for the precision of the simple mean estimator of neutrinos' direction for normal and exponential distributions for a finite sample and for the limiting case of many events have been obtained.

  17. SCOTT: A time and amplitude digitizer ASIC for PMT signal processing

    Science.gov (United States)

    Ferry, S.; Guilloux, F.; Anvar, S.; Chateau, F.; Delagnes, E.; Gautard, V.; Louis, F.; Monmarthe, E.; Le Provost, H.; Russo, S.; Schuller, J.-P.; Stolarczyk, Th.; Vallage, B.; Zonca, E.; KM3NeT Consortium

    2013-10-01

    SCOTT is an ASIC designed for the readout electronics of photomultiplier tubes developed for KM3NeT, the cubic-kilometer scale neutrino telescope in Mediterranean Sea. To digitize the PMT signals, the multi-time-over-threshold technique is used with up to 16 adjustable thresholds. Digital outputs of discriminators feed a circular sampling memory and a “first in first out” digital memory. A specific study has shown that five specifically chosen thresholds are suited to reach the required timing accuracy. A dedicated method based on the duration of the signal over a given threshold allows an equivalent timing precision at any charge. To verify that the KM3NeT requirements are fulfilled, this method is applied on PMT signals digitized by SCOTT.

  18. The mDOM. A multi-PMT optical module for IceCube-Gen2

    Energy Technology Data Exchange (ETDEWEB)

    Classen, Lew; Kappes, Alexander [Institut fur Kernphysik, Westfaelische Wilhelms-Universitaet Muenster (Germany); Karg, Timo; Kretzschmann, Axel [DESY, Zeuthen (Germany); Koelpin, Alexander; Lindner, Stefan; Roeber, Juergen [LTE, Friedrich-Alexander-Universitaet Erlangen-Nuernberg (Germany)

    2016-07-01

    Following the discovery of an astrophysical neutrino flux by IceCube in 2013, planning is under way for the next generation neutrino telescope at the South Pole, IceCube-Gen2, which will significantly enhance and expand IceCube's sensitivity both towards high neutrino energies as well as in the low-energy regime. In the scope of these efforts, a novel multi-PMT optical sensor is being developed which, following the KM3NeT design, consists of an array of several small PMTs inside a transparent pressure vessel. This design provides some significant advantages compared to the conventional single-PMT module design, such as an increased effective area, homogeneous coverage of the full solid angle, and intrinsic angular sensitivity. The talk presents an overview of the project and its current status, featuring hardware development, testing, and simulation efforts.

  19. Correlates of Protective Motivation Theory (PMT) to adolescents' drug use intention.

    Science.gov (United States)

    Wu, Cynthia Sau Ting; Wong, Ho Ting; Chou, Lai Yan; To, Bobby Pak Wai; Lee, Wai Lok; Loke, Alice Yuen

    2014-01-03

    Early onset and increasing proliferation of illicit adolescent drug-use poses a global health concern. This study aimed to examine the correlation between Protective Motivation Theory (PMT) measures and the intention to use drugs among adolescents. An exploratory quantitative correlation design and convenience sampling were adopted. A total of 318 students completed a self-reported questionnaire that solicited information related to their demographics and activities, measures of threat appraisal and coping appraisal, and the intention to use drugs. Logistic regression analysis showed that intrinsic and extrinsic rewards were significant predictors of intention. The odds ratios were equal to 2.90 (p < 0.05) and 8.04 (p < 0.001), respectively. The logistic regression model analysis resulted in a high Nagelkerke R2 of 0.49, which suggests that PMT related measures could be used in predicting drug use intention among adolescents. Further research should be conducted with non-school adolescents to confirm the application.

  20. Asking the Right Questions: Action Learning and PMT 401

    Science.gov (United States)

    2016-08-01

    program aimed at improving leadership, critical thinking , problem solving and decision­making skills. Participants in this rigorous, in­residence...problem • Skill Development • Urgent and complex problems requiring unique systems thinking • Groups charged with implementing the solution as...most pressing organi­ zational issues: problem solving, organizational learning, team building, leadership development, and professional growth and

  1. Programmable integrated front-end for SiPM/PMT PET detectors with continuous scintillating crystal

    OpenAIRE

    Herrero Bosch, Vicente; Monzó Ferrer, José María; Ros García, Ana; Aliaga Varea, Ramón José; González Martínez, Antonio Javier; Montoliu, C.; Colom Palero, Ricardo José; Benlloch Baviera, Jose María

    2012-01-01

    AMIC architecture has been introduced in previous works in order to provide a generic and expandable solution for implementing large number of outputs SiPM array/PMT detectors. The underlying idea in AMIC architecture is to calculate the moments of the detected light distribution in an analog fashion. These moments provide information about energy, x/y position, etc. of the light distribution of the detected event. Moreover this means that a small set of signals contains most of the informati...

  2. Significance of delayed /sup 99m/Tc-PMT scintigraphy in diagnosis of hepatocellular carcinoma. Comparison between /sup 99m/Tc-PMT and /sup 67/Ga-citrate scintigraphy

    Energy Technology Data Exchange (ETDEWEB)

    Hasegawa, Yoshihisa; Nakano, Shunichi; Hashizume, Terumi and others

    1985-03-01

    The usefulness of delayed hepatobiliary imaging with /sup 99m/Tc-PMT in diagnosis of hepatocellular carcinoma was studied in 30 patients with histologically verified hepatocellular carcinoma. Of 30 patients, delayed /sup 99m/Tc-PMT images showed 13 patients (43 %) of increased radioactivity and 4 (13 %) of equilibrated radioactivity in carcinoma as compared with that in the surrounding normal liver tissues. Furthermore, 3 of 6 patients who showed no filling defects in /sup 99m/Tc-Sn colloid liver images, showed increased uptake of radioactivity in carcinoma in delayed /sup 99m/Tc-PMT images. These results suggest that the complementary use of delayed /sup 99m/Tc-PMT imaging to /sup 99m/Tc-Sn colloid liver imaging is useful for detecting hepatoma lesions. The hepatic lesions were positively visualized on /sup 99m/Tc-PMT and/or /sup 67/Ga-citrate images in 21 (70 %) of 30 patients. These results indicate that use of delayed /sup 99m/Tc-PMT and /sup 67/Ga-citrate imaging in combination is useful for positive visualization of hepatocellular carcinoma.

  3. Cross-talk of a multi-anode PMT and attainment of a σ∼10ps TOF counter

    International Nuclear Information System (INIS)

    Enari, Y.; Hayasaka, K.; Hokuue, T.; Inami, K.; Ohshima, T.; Sato, N.; Akatsu, M.; Kawakami, S.; Miyabayashi, Y.; Tokuda, H.; Yanase, H.; Shimoi, H.; Fujimori, T.

    2005-01-01

    We extensively studied a cross-talk phenomenon that seriously deteriorates the high time-resolution of a multi-anode 16-channel linear array photo-multiplier tube (PMT); the dynode structures were modified to eliminate the cross-talk effect and to recover a time resolution of σ=70-80ps for single photons. The use of 16 anode signals of the modified PMT enabled us to attain σ=12ps for a small TOF counter of Cherenkov radiation

  4. Cosmic-muon characterization and annual modulation measurement with Double Chooz detectors

    Energy Technology Data Exchange (ETDEWEB)

    Abrahão, T.; Anjos, J.C. dos [Centro Brasileiro de Pesquisas Físicas, Rio de Janeiro, RJ, 22290-180 (Brazil); Almazan, H.; Buck, C. [Max-Planck-Institut für Kernphysik, 69117 Heidelberg (Germany); Appel, S. [Physik Department, Technische Universität München, 85748 Garching (Germany); Baussan, E.; Brugière, T. [IPHC, Université de Strasbourg, CNRS/IN2P3, 67037 Strasbourg (France); Bekman, I. [III. Physikalisches Institut, RWTH Aachen University, 52056 Aachen (Germany); Bezerra, T.J.C. [SUBATECH, CNRS/IN2P3, Université de Nantes, Ecole des Mines de Nantes, 44307 Nantes (France); Bezrukov, L. [Institute of Nuclear Research of the Russian Academy of Sciences, Moscow 117312 (Russian Federation); Blucher, E. [The Enrico Fermi Institute, The University of Chicago, Chicago, Illinois 60637 (United States); Busenitz, J. [Department of Physics and Astronomy, University of Alabama, Tuscaloosa, Alabama 35487 (United States); Cabrera, A. [AstroParticule et Cosmologie, Université Paris Diderot, CNRS/IN2P3, CEA/IRFU, Observatoire de Paris, Sorbonne Paris Cité, 75205 Paris Cedex 13 (France); Camilleri, L.; Carr, R. [Columbia University, New York, New York 10027 (United States); Cerrada, M. [Centro de Investigaciones Energéticas, Medioambientales y Tecnológicas, CIEMAT, 28040, Madrid (Spain); Chauveau, E. [Research Center for Neutrino Science, Tohoku University, Sendai 980-8578 (Japan); Chimenti, P., E-mail: hgomez@apc.univ-paris7.fr [Universidade Federal do ABC, UFABC, Santo André, SP, 09210-580 (Brazil); and others

    2017-02-01

    A study on cosmic muons has been performed for the two identical near and far neutrino detectors of the Double Chooz experiment, placed at ∼120 and ∼300 m.w.e. underground respectively, including the corresponding simulations using the MUSIC simulation package. This characterization has allowed us to measure the muon flux reaching both detectors to be (3.64 ± 0.04) × 10{sup −4} cm{sup −2}s{sup −1} for the near detector and (7.00 ± 0.05) × 10{sup −5} cm{sup −2}s{sup −1} for the far one. The seasonal modulation of the signal has also been studied observing a positive correlation with the atmospheric temperature, leading to an effective temperature coefficient of α {sub T} = 0.212 ± 0.024 and 0.355 ± 0.019 for the near and far detectors respectively. These measurements, in good agreement with expectations based on theoretical models, represent one of the first measurements of this coefficient in shallow depth installations.

  5. Cosmic-muon characterization and annual modulation measurement with Double Chooz detectors

    Science.gov (United States)

    Abrahão, T.; Almazan, H.; dos Anjos, J. C.; Appel, S.; Baussan, E.; Bekman, I.; Bezerra, T. J. C.; Bezrukov, L.; Blucher, E.; Brugière, T.; Buck, C.; Busenitz, J.; Cabrera, A.; Camilleri, L.; Carr, R.; Cerrada, M.; Chauveau, E.; Chimenti, P.; Corpace, O.; Crespo-Anadón, J. I.; Dawson, J. V.; Dhooghe, J.; Djurcic, Z.; Dracos, M.; Etenko, A.; Fallot, M.; Franco, D.; Franke, M.; Furuta, H.; Gil-Botella, I.; Giot, L.; Givaudan, A.; Gögger-Neff, M.; Gómez, H.; Gonzalez, L. F. G.; Goodman, M.; Hara, T.; Haser, J.; Hellwig, D.; Hourlier, A.; Ishitsuka, M.; Jochum, J.; Jollet, C.; Kale, K.; Kampmann, P.; Kaneda, M.; Kaplan, D. M.; Kawasaki, T.; Kemp, E.; de Kerret, H.; Kryn, D.; Kuze, M.; Lachenmaier, T.; Lane, C.; Laserre, T.; Lastoria, C.; Lhuillier, D.; Lima, H.; Lindner, M.; López-Castaño, J. M.; LoSecco, J. M.; Lubsandorzhiev, B.; Maeda, J.; Mariani, C.; Maricic, J.; Matsubara, T.; Mention, G.; Meregaglia, A.; Miletic, T.; Minotti, A.; Nagasaka, Y.; Navas-Nicolás, D.; Novella, P.; Oberauer, L.; Obolensky, M.; Onillon, A.; Oralbaev, A.; Palomares, C.; Pepe, I.; Pronost, G.; Reinhold, B.; Rybolt, B.; Sakamoto, Y.; Santorelli, R.; Schönert, S.; Schoppmann, S.; Sharankova, R.; Sibille, V.; Sinev, V.; Skorokhvatov, M.; Soiron, M.; Soldin, P.; Stahl, A.; Stancu, I.; Stokes, L. F. F.; Strait, M.; Suekane, F.; Sukhotin, S.; Sumiyoshi, T.; Sun, Y.; Svoboda, B.; Tonazzo, A.; Veyssiere, C.; Vivier, M.; Wagner, S.; Wiebusch, C.; Wurm, M.; Yang, G.; Yermia, F.; Zimmer, V.

    2017-02-01

    A study on cosmic muons has been performed for the two identical near and far neutrino detectors of the Double Chooz experiment, placed at ~120 and ~300 m.w.e. underground respectively, including the corresponding simulations using the MUSIC simulation package. This characterization has allowed us to measure the muon flux reaching both detectors to be (3.64 ± 0.04) × 10-4 cm-2s-1 for the near detector and (7.00 ± 0.05) × 10-5 cm-2s-1 for the far one. The seasonal modulation of the signal has also been studied observing a positive correlation with the atmospheric temperature, leading to an effective temperature coefficient of αT = 0.212 ± 0.024 and 0.355 ± 0.019 for the near and far detectors respectively. These measurements, in good agreement with expectations based on theoretical models, represent one of the first measurements of this coefficient in shallow depth installations.

  6. Cosmic-muon characterization and annual modulation measurement with Double Chooz detectors

    International Nuclear Information System (INIS)

    Abrahão, T.; Anjos, J.C. dos; Almazan, H.; Buck, C.; Appel, S.; Baussan, E.; Brugière, T.; Bekman, I.; Bezerra, T.J.C.; Bezrukov, L.; Blucher, E.; Busenitz, J.; Cabrera, A.; Camilleri, L.; Carr, R.; Cerrada, M.; Chauveau, E.; Chimenti, P.

    2017-01-01

    A study on cosmic muons has been performed for the two identical near and far neutrino detectors of the Double Chooz experiment, placed at ∼120 and ∼300 m.w.e. underground respectively, including the corresponding simulations using the MUSIC simulation package. This characterization has allowed us to measure the muon flux reaching both detectors to be (3.64 ± 0.04) × 10 −4 cm −2 s −1 for the near detector and (7.00 ± 0.05) × 10 −5 cm −2 s −1 for the far one. The seasonal modulation of the signal has also been studied observing a positive correlation with the atmospheric temperature, leading to an effective temperature coefficient of α T = 0.212 ± 0.024 and 0.355 ± 0.019 for the near and far detectors respectively. These measurements, in good agreement with expectations based on theoretical models, represent one of the first measurements of this coefficient in shallow depth installations.

  7. Utilization of FADC for reconstruction and analysis of the background data in the Chooz neutrino experiment

    International Nuclear Information System (INIS)

    Veron, Didier

    1997-01-01

    This thesis describes a particular contribution to the Chooz experiment. The latter looks for the oscillations, over a distance of 1 km, of antineutrons emitted by two nuclear reactors. The electron-type antineutrinos are detected through their inverse beta interaction with a target's proton. The neutron is detected through its capture by a gadolinium nucleus revealed by an 8 MeV gamma emission. In the first part we describe the reconstruction of events as simulated by the GIANT software. We show that the positron's and neutron's stopping point can actually be reconstructed with an accuracy of 10 and 20 cm respectively. In the second part, we proceed to the analysis of the calibration's data as recorded with Fast Wave Form Digitizers. This confirms the reliability of the Monte-Carlo results and allows measurement of both the neutrons' capture probability and time by the target gadolinium. The last part deals with the background (reactor turned off) data analysis and the pin-pointing of its various sources. In order to reduce their contribution, we define spatial cuts. These cuts' reliability is validated by analysis of data obtained not only with a neutron source, but also with neutrons issued from cosmic rays. We end up with a background contribution of two to three events per day, about ten times less than the expected neutrino rate at full reactor power. (author)

  8. Correlates of Protective Motivation Theory (PMT to Adolescents’ Drug Use Intention

    Directory of Open Access Journals (Sweden)

    Cynthia Sau Ting Wu

    2014-01-01

    Full Text Available Early onset and increasing proliferation of illicit adolescent drug-use poses a global health concern. This study aimed to examine the correlation between Protective Motivation Theory (PMT measures and the intention to use drugs among adolescents. An exploratory quantitative correlation design and convenience sampling were adopted. A total of 318 students completed a self-reported questionnaire that solicited information related to their demographics and activities, measures of threat appraisal and coping appraisal, and the intention to use drugs. Logistic regression analysis showed that intrinsic and extrinsic rewards were significant predictors of intention. The odds ratios were equal to 2.90 (p < 0.05 and 8.04 (p < 0.001, respectively. The logistic regression model analysis resulted in a high Nagelkerke R2 of 0.49, which suggests that PMT related measures could be used in predicting drug use intention among adolescents. Further research should be conducted with non-school adolescents to confirm the application.

  9. Dual parameter analysis of CsI:Tl/PMT with a digital oscilloscope

    CERN Document Server

    Devol, T A; Fjeld, R A

    1999-01-01

    Scintillation pulses from alpha-particle and gamma-ray excited CsI:Tl were recorded with a photomultiplier tube and digital oscilloscope card in single parameter (pulse shape or pulse height) and dual parameter (simultaneous pulse shape and pulse height) modes. A 2.8x1.3x1.3 cm sup 3 CsI:Tl crystal was coupled to a Burle 8850 photomultiplier tube (PMT) and excited with sup 1 sup 4 sup 8 Gd (E subalpha=3.18 MeV) and sup 1 sup 3 sup 7 Cs (E subgamma=0.662 MeV). The timing pulses (50 OMEGA terminated dynode signal) from the PMT base were directly input to a GaGe CompuScope 8012A/PCI sup T sup M (12-bit, 50 MHz dual channel digital oscilloscope card) that resided in a P6-300 MHz personal computer. Individual digitized pulses were processed via a LabVIEW sup T sup M V 4.1 interface to the oscilloscope. The ratio of the charge collected over a short time interval to the total charge collected was used for the single parameter pulse shape spectrum while the total charge collected was used for the single parameter pu...

  10. Experimental modal analysis of the steam inlet pipe to the Chooz B1 high pressure turbine

    International Nuclear Information System (INIS)

    Guihot, O.; Anne, J.P.; Chartain, G.; Le Pironnec, D.

    1993-05-01

    This report presents the results of the modal analysis carried out on one of the steam inlet pipe of the high pressure turbine of the Chooz B1 power plant. This experimental analysis is made within the frame of the research and development project ''dynamical, acoustical and aerodynamical behaviour of the turbogenerator N4''. This research program provides amongst others, numerical studies with the software CIRCUS and ASTER, in order to verify the dynamical behaviour of the designed inlet pipe. The numerical models will be updated from results of the experimental modal analysis to improve the numerical representation of this pipe. All the identified modes in the frequency band [5.2000] Hz are presented in the report. The modal characteristics of the main modes are detailed. Further analysis have been made, in order ease the updating of the numerical models. They consisted in an analysis of the evolution of the dynamical behaviour due to a change of the boundary conditions of the inlet valve frame on one hand and resulting from the presence of an additional mass on the pipe, at the level of the middle flange, on the other hand. The analysis made in low frequency range shows that the pipe is thoroughly embedded in the frame of the high pressure turbine. On the other hand, the boundary conditions on the inlet valve frame are more difficult to determine, because the dynamical behaviour of the valve frame and the upper pipe can not be uncoupled from the considered pipe. The main shell modes of ranks 2, 3 and 4 have been very accurately identified. The most relevant modes to update the numerical models are given. (authors). 48 figs., 18 tabs., 4 refs

  11. From the measurement of the θ13 mixing angle to the search for geo-neutrinos: studying νe-bare with Double Chooz and Borexino

    International Nuclear Information System (INIS)

    Roncin, Romain

    2014-01-01

    Double Chooz is a reactor neutrino oscillation experiment which aims at measuring the θ 13 mixing angle thanks to two identical detectors located at different distances from the two reactors of the Chooz nuclear power plant, in the French Ardennes. While the near detector will start taking data in fall 2014 to normalize the flux of the neutrinos emitted by the nuclear reactors, the far detector is running since April 2011 and allows to observe the neutrinos disappearance through the neutrino oscillation phenomenon. This thesis is also dedicated to the Borexino experiment which was designed to observe solar neutrinos. Due to its low background level as well as its position in a nuclear free country, Italy, Borexino is also sensitive to geo-neutrinos. This thesis presents both the Double Chooz and Borexino experiments, from the description of the detectors to the main results, with a special attention to the background and its rejection. Studies on the neutrino directionality with these two experiments are also detailed. In the case of Double Chooz, since the neutrinos are coming from the two nuclear reactors, the precision of the analysis method can be assessed. This thesis presents also for the first time the possibility to retrieve the initial direction of the neutrinos when the neutrons created in the inverse beta decay reactions are captured on hydrogen. In the case of Borexino, neutrino directionality information could facilitate the discrimination between geo-neutrinos and neutrinos from nuclear reactors. (author) [fr

  12. Characterization of large-area photomultipliers under low magnetic fields: Design and performance of the magnetic shielding for the Double Chooz neutrino experiment

    International Nuclear Information System (INIS)

    Calvo, E.; Cerrada, M.; Fernandez-Bedoya, C.; Gil-Botella, I.; Palomares, C.; Rodriguez, I.; Toral, F.; Verdugo, A.

    2010-01-01

    A precise quantitative measurement of the effect of low magnetic fields in Hamamatsu R7081 photomultipliers has been performed. These large-area photomultipliers will be used in the Double Chooz neutrino experiment. A magnetic shielding has been developed for these photomultipliers. Its design and performance is also reported in this paper.

  13. Investigation of a Multi-Anode Microchannel Plate PMT for Time-of-Flight PET

    Science.gov (United States)

    Choong, Woon-Seng

    2010-10-01

    We report on an investigation of a mulit-anode microchannel plate PMT for time-of-flight PET detector modules. The primary advantages of an MCP lie in its excellent timing properties (fast rise time and low transit time spread), compact size, and reasonably large active area, thus making it a good candidate for TOF applications. In addition, the anode can be segmented into an array of collection electrodes with fine pitch to attain good position sensitivity. In this paper, we investigate using the Photonis Planacon MCP-PMT with a pore size of 10 μm to construct a PET detector module, specifically for time-of-flight applications. We measure the single electron response by exciting the Planacon with pulsed laser diode. We also measure the performance of the Planacon as a PET detector by coupling a 4 mm×4 mm×10 mm LSO crystal to individual pixel to study its gain uniformity, energy resolution, and timing resolution. The rise time of the Planacon is 440 ps with pulse duration of about 1 ns. A transit time spread of 120 ps FWHM is achieved. The gain is fairly uniform across the central region of the Planacon, but drops off by as much as a factor of 2.5 around the edges. The energy resolution is fairly uniform across the Planacon with an average value of 18.6 ± 0.7% FWHM. While the average timing resolution of 252 ± 7 ps FWHM is achieved in the central region of the Planacon, it degrades to 280 ± 9 ps FWHM for edge pixels and 316 ± 15 ps FWHM for corner pixels. We compare the results with measurements performed with a fast timing conventional PMT (Hamamatsu R-9800). We find that the R9800, which has significantly higher PDE, has a better timing resolution than the Planacon. Furthermore, we perform detector simulations to calculate the improvement that can be achieved with a higher PDE Planacon. The calculation shows that the Planacon can achieve significantly better timing resolution if it can attain the same PDE as the R-9800, while only a 30% improvement is

  14. Protecting children from myopia: a PMT perspective for improving health marketing communications.

    Science.gov (United States)

    Lwin, May O; Saw, Seang-Mei

    2007-01-01

    This research examined the predictive utility of the protection motivation theory (PMT) model for myopia prevention amongst children. An integrative model for myopia prevention behavior of parents was first developed in the context of theory and survey instruments then refined using information gathered from two focus groups. Empirical data then was collected from parents of primary school children in Singapore, a country with one of the highest rates of myopia in the world, and analyzed using structural equation modeling (SEM). Our findings revealed that coping appraisal variables were more significantly associated with protection motivation, relative to threat appraisal variables. In particular, perceived self-efficacy was the strongest predictor of parental intention to enforce good visual health behaviors, while perceived severity was relatively weak. Health marketing communications and public policy implications are discussed.

  15. Pengaruh pemberian makanan tambahan (PMT pada ibu hamil terhadap berat lahir bayi

    Directory of Open Access Journals (Sweden)

    Hana Shafiyyah Zulaidah

    2014-10-01

    Full Text Available Background: Anemia causes fetal growth disorders that affect birth weight. Antenatal care (ANC coverage and provision of high Fe if not followed by a decrease in the incidence of anemia can result indirectly in the risk of low birth weight. Supplementary feeding is expected to resolve the issue. Objective: To assess the effect of supplementary feeding on the third trimester of pregnancy on birth weight. Method: This was a quantitative study with a study design of quasi-experiment and non-equivalent control group. The given intervention was fish-processed feeding for 30 days. The study population was pregnant women in the third trimester in all health centers in the City of Yogyakarta and the samples were 104 pregnant women in some health centers with convenience sampling technique. The subjects were divided into two, namely the treatment group (PMT and the comparison group (non-PMT. Birth weight was weighed immediately after the baby was born. Statistical analysis used t-test and logistic regression. Results: The mean birth weight of infants in the treatment group and the comparison group was 3248 g and 2974 g, respectively, so that the difference in the mean birth weight of both groups was 274 g (p=0.0002; 95%C:131-416. Thus, supplementary feeding was shown significantly affect the birth weight. The extraneous variables that significantly influenced birth weight were pregnancy interval. Other extraneous variables were age, mid-upper-arm circumference (MUAC, education, occupation, economic status, parity, protein intake, compliance of Fe tablet intake, antenatal care, gestational age at delivery and anemia status were not proven statistically significant to affect birth weight. Conclusion: Supplementary feeding effect on birth weight.

  16. The C-terminal MIR-containing region in the Pmt1 O-mannosyltransferase restrains sporulation and is dispensable for virulence in Beauveria bassiana.

    Science.gov (United States)

    He, Zhangjiang; Luo, Linli; Keyhani, Nemat O; Yu, Xiaodong; Ying, Shenghua; Zhang, Yongjun

    2017-02-01

    Protein O-mannosyltransferases (Pmts) belong to a highly conserved protein family responsible for the initiation of O-glycosylation of many proteins. Pmts contain one dolichyl-phosphate-mannose-protein mannosyltransferases (PMT) domain and three MIR motifs (mannosyltransferase, inositol triphosphate, and ryanodine receptor) that are essential for activity in yeast. We report that in the insect fungal pathogen, Beauveria bassiana, deletion of the C-terminal Pmt1 MIR-containing region (Pmt1∆ 311-902 ) does not alter O-mannosyltransferase activity, but does increase total cell wall protein O-mannosylation levels and results in phenotypic changes in fungal development and cell wall stability. B. bassiana mutants harboring the Pmt1 ∆ 311-902 mutation displayed a significant increase in conidiation with up-regulation of conidiation-associated genes and an increase in biomass accumulation as compared to the wild-type parent. However, decreased vegetative growth and blastospore production was noted, and Pmt1 ∆ 311-902 mutants were altered in cell wall composition and cell surface features. Insect bioassays revealed little effect on virulence for the Pmt1 ∆ 311-902 strain via cuticle infection or intrahemocoel injection assays, although differences in hyphal body differentiation in the host hemolymph and up-regulation of virulence-associated genes were noted. These data suggest novel roles for Pmt1 in negatively regulating conidiation and demonstrate that the C-terminal Pmt1 MIR-containing region is dispensable for enzymatic activity and organismal virulence.

  17. PEMANFAATAN TEPUNG SUKUN (Artocarpus altilis sp. PADA PEMBUATAN ANEKA KUDAPAN SEBAGAI ALTERNATIF MAKANAN BERGIZI UNTUK PMT-AS

    Directory of Open Access Journals (Sweden)

    Dewanti Putri Pratiwi

    2013-11-01

    Full Text Available ABSTRACTBreadfruit is valuable fruit and has a good of nutrient content, but its usage is limited by poor storage properties of fresh fruit. Processing into flour, can increase its utilization. The aim of this research was to utilize breadfruit flour in production of nutritious snack foods for School Supplementary Feeding Programme (PMT-AS. There were three products developed in this study; brownies, pia, and croquette. The research was conducted using experimental design. The proportions of breadfruit flour and wheat flour were different for each product, which brownies was formulated using 70:30, 80:20, 90:10, and 100:0; whereas pia and croquette was formulated by 50:50, 60:40, 70:30, and 80:20. Proximate analysis showed that 100 g brownies contained 409 kcal energy and 7.5 g protein, 100 g pia had 383 kcal energy and 6.7 g protein and croquette had the highest energy and protein content is 455 kcal and 9.9 g protein. In conclusion, all products were suitable as alternative snacks for PMT-AS. The products have met 300 kcal energy and 5 g protein per serving size. Considered also the cost of production, these products have fulfilled criteria to be used in PMT-AS.Keywords: breadfruit, PMT-AS, snacksABSTRAKSukun merupakan buah yang bernilai dan memiliki kandungan gizi yang baik, tetapi penggunaannya terbatas oleh penyimpanan ketika berbentuk buah segar. Sukun yang diubah ke dalam bentuk tepung dapat meningkatkan pemanfaatannya. Tujuan dari penelitian ini adalah memanfaatkan tepung sukun dalam pembuatan kudapan sebagai alternatif makanan bergizi untuk PMT-AS. Terdapat tiga produk dalam penelitian ini, yaitu brownies, pia, dan kroket. Penelitian ini menggunakan desain eksperimental. Perbandingan tepung sukun dan tepung terigu berbeda untuk masing-masing produk. Formulasi brownies adalah 70:39, 80:20, 90:10, dan 100:0, sedangkan formulasi pia dan kroket adalah 50:50, 60:40, 70:30, dan 80:20. Berdasarkan uji organoleptik diketahui bahwa produk

  18. Clinical evaluation of the scoring of optical findings with technetium-99m-N-pyridoxyl-5-methyl-tryptophan (PMT) hepatobiliary scintigraphy for fulminant hepatitis

    International Nuclear Information System (INIS)

    Uchiyama, Katsuhiro; Kuniyasu, Yoshio; Niio, Yasuo

    1998-01-01

    Fulminant hepatitis is one of the most life-threatening diseases for which adequate medical therapy does not exist. Then, we evaluated the usefulness of technetium-99m-N-pyridoxyl-5-methyl-tryptophan (PMT) hepatobiliary scintigraphy to estimate the diagnosis and prognosis of fulminant hepatitis. In total 60 patients, 23 with fulminant hepatitis (FH), 25 with severe acute hepatitis (SAH) and 12 with acute hepatitis (AH), computer data acquisition by gamma-camera system started just after the injection of 185 MBq 99m Tc-PMT. The optical finding score which included cardiac blood pool remaining time (0-3), distribution of radioactivity in the liver (0-3), extrahepatic bile duct (EHBD) and intestine appearance time (0-3) were studied. The cardiac blood pool remaining time score was 2.8±0.5 in FH, 2.2±0.8 in SAH, 0.9±1.1 in AH. The intrahepatic distribution score was 2.1±0.8 in FH, 0.3±0.6 in SAH, 0.1±0.3 in AH. The EHBD and intestine appearance time score was 1.9±1.1 in FH, 1.5±1.2 in SAH, 0.3±0.6 in AH. The total score was 6.7±1.4 in FH, 4.0±1.6 in SAH, 1.3±1.3 in AH. There were significantly statistical differences among three groups. While, the cardiac blood pool remaining time score was 3.0±0 in 14 hospital death patients (HD), 1.9±1.0 in 46 alive patients (AL). The intrahepatic distribution score was 2.2±0.8 in HD, 0.5±0.9 in AL. The EHBD and intestine appearance time score was 2.1±1.2 in HD, 1.2±1.1 in AL. The total score was 7.3±1.3 in HD, 3.6±2.2 in AL. There were significantly statistical differences in these groups. The optimal finding score of 99m Tc-PMT hepatobiliary scintigraphy was useful in establishing the diagnosis and prognosis of FH. (author)

  19. Characterization of cDNA for PMT: a Partial Nicotine Biosynthesis-Related Gene Isolated from Indonesian Local Tobacco (Nicotiana tabacum cv. Sindoro1

    Directory of Open Access Journals (Sweden)

    SESANTI BASUKI

    2013-12-01

    Full Text Available Nicotine is the major alkaloid compound in cultivated tobacco (Nicotiana tabacum that could potentially be converted into carcinogenic compound (nor-nicotine. The PMT gene encoding putrescine N-methyltransferase (PMT is one of the two key genes that play a prominent role in nicotine biosynthesis. The aimed of this study was to isolate and characterize the cDNA sequence originated from Indonesian local tobacco cv. Sindoro1 (Ntpmt_Sindoro1. The results showed that the Ntpmt_Sindoro1 was 1124 bp in length. This cDNA fragment encodes for 374 amino acid residues. The predicted polypeptide from the cDNA is a hidrophilic protein, and has a predicted molecular weight of 40.95 kDa. The predicted amino acids sequence also showed high similarity to the PMT gene product Nicotiana sp. available in the GenBank data base. The amino acid sequences also exert conserved residues specifically exhibited only by PMT gene originated from N. tabacum. Clustering analysis revealed that Ntpmt_Sindoro1 belongs to the same clade as the PMT3 gene, a member of the N. tabacum PMT gene family. The Ntpmt_Sindoro1 cDNA sequence covering exon1-exon8 of the PMT gene fragment has been registered in the GenBank data base, under the accession number JX978277.

  20. Analysis and Toxicity of Plain (PMP) and Blended (PMT) Indian Pan Masala (PM).

    Science.gov (United States)

    Nigam, Suresh Kumar; Venkatakrishna-Bhatt, H

    2013-02-01

    Betel leaf combined with areca nut is known as betel quid pan masala (PM), and tobacco with areca nut, catechu and lime is pan masala (PMT) blended with gulkhand. These narcotics are popular among young and old individuals. A prima facia chemical analysis and a toxicity assessment of PM in mice were conducted to study the relationship between longtime consumption of PM and health hazards. Chemical analysis of different types of PM was done employing HPLC, GLC, AAS, ES, TLC, GCMS and sequential extraction for PAH, pesticides, metals and minerals, electrolytes, drugs and xenobiotics. Ethanolic PM extracts were tested by IP and PO routes in inbred Swiss mice. PAH, which are known xenobiotics for pre-cancerous lesions, were significantly high (peffect on blood and organ weights (kidney, heart, spleen and liver), but we did observe attenuated testis. However, in the bone marrow of the mice, chromosomes were most affected in the mice fed PM-Zarda blend for 3 months. The chromosomal abnormalities included ploidy, loss, breaks, gaps, deletions and exchanges in ring chromosomes. The PM caused sperm head anomalies (narrow, blunt, triangular and banana shapes), and the sperm were irregular, amorphous, tailless and rudimentary, with the maximum effect among the groups fed PM for 3 months. Significantly higher levels (p<0.01) of testis glycogen, cholesterol and protein were found. The group fed for 16 days showed no change in red blood corpuscles (RBC), white blood corpuscles (WBC), hemoglobin and erythrocyte sedimentation counts.

  1. Optimization of the electron collection efficiency of a large area MCP-PMT for the JUNO experiment

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Lin, E-mail: chenlin@opt.cn [State Key Laboratory of Transient Optics and Photonics, Xi’an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi’an 710119 (China); Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Xi’an Jiaotong University, Xi’an 710049 (China); Tian, Jinshou [Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Liu, Chunliang [Xi’an Jiaotong University, Xi’an 710049 (China); Wang, Yifang; Zhao, Tianchi [Institute of High Energy Physics (IHEP) of CAS, Beijing 100049 (China); Liu, Hulin; Wei, Yonglin; Sai, Xiaofeng [Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Chen, Ping [State Key Laboratory of Transient Optics and Photonics, Xi’an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi’an 710119 (China); Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Wang, Xing; Lu, Yu [Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Hui, Dandan; Guo, Lehui [State Key Laboratory of Transient Optics and Photonics, Xi’an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi’an 710119 (China); Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Liu, Shulin; Qian, Sen; Xia, Jingkai; Yan, Baojun; Zhu, Na [Institute of High Energy Physics (IHEP) of CAS, Beijing 100049 (China); Sun, Jianning; Si, Shuguang [North Night Vision Technology (NNVT) CO., LTD, Nanjing 210110 (China); and others

    2016-08-11

    A novel large-area (20-inch) photomultiplier tube based on microchannel plate (MCP-PMTs) is proposed for the Jiangmen Underground Neutrino Observatory (JUNO) experiment. Its photoelectron collection efficiency C{sub e} is limited by the MCP open area fraction (A{sub open}). This efficiency is studied as a function of the angular (θ), energy (E) distributions of electrons in the input charge cloud and the potential difference (U) between the PMT photocathode and the MCP input surface, considering secondary electron emission from the MCP input electrode. In CST Studio Suite, Finite Integral Technique and Monte Carlo method are combined to investigate the dependence of C{sub e} on θ, E and U. Results predict that C{sub e} can exceed A{sub open}, and are applied to optimize the structure and operational parameters of the 20-inch MCP-PMT prototype. C{sub e} of the optimized MCP-PMT is expected to reach 81.2%. Finally, the reduction of the penetration depth of the MCP input electrode layer and the deposition of a high secondary electron yield material on the MCP are proposed to further optimize C{sub e}.

  2. Cross Talk Study to the Single Photon Response of a Flat Panel PMT for the RICH Upgrade at LHCb

    CERN Multimedia

    Arnaboldi, C; Calvi, M; Fanchini, E; Gotti, C; Maino, M; Matteuzzi, C; Perego, D L; Pessina, G; Wang, J C

    2009-01-01

    The Ring Imaging CHerenkov, RICH, detector at LHCb is now readout by Hybrid Photon Detectors. In view of its upgrade a possible option is the adoption of the flat panel Photon Multipliers Tubes, PMT. An important issue for the good determination of the rings produced in the sensitive media is a negligible level of cross talk. We have experimentally studied the cross talk from the 64x64 pixels of the H9500 PMT from Hamamatsu. Results have shown that at the single photon signal level, as expected at LHCb, the statistics applied to the small number of electrons generated at the first dynode of the PMT chain leads to a cross talk mechanism that must be interpreted in term of the percentage of the number of induced signals rather than on the amplitude of the induced signals. The threshold to suppress cross talk must be increased to a significant fraction of the single photon signal for the worst case. The number of electrons generated at the first dynode is proportional to the biasing voltage. Measurements have sh...

  3. Optimization of the electron collection efficiency of a large area MCP-PMT for the JUNO experiment

    International Nuclear Information System (INIS)

    Chen, Lin; Tian, Jinshou; Liu, Chunliang; Wang, Yifang; Zhao, Tianchi; Liu, Hulin; Wei, Yonglin; Sai, Xiaofeng; Chen, Ping; Wang, Xing; Lu, Yu; Hui, Dandan; Guo, Lehui; Liu, Shulin; Qian, Sen; Xia, Jingkai; Yan, Baojun; Zhu, Na; Sun, Jianning; Si, Shuguang

    2016-01-01

    A novel large-area (20-inch) photomultiplier tube based on microchannel plate (MCP-PMTs) is proposed for the Jiangmen Underground Neutrino Observatory (JUNO) experiment. Its photoelectron collection efficiency C e is limited by the MCP open area fraction (A open ). This efficiency is studied as a function of the angular (θ), energy (E) distributions of electrons in the input charge cloud and the potential difference (U) between the PMT photocathode and the MCP input surface, considering secondary electron emission from the MCP input electrode. In CST Studio Suite, Finite Integral Technique and Monte Carlo method are combined to investigate the dependence of C e on θ, E and U. Results predict that C e can exceed A open , and are applied to optimize the structure and operational parameters of the 20-inch MCP-PMT prototype. C e of the optimized MCP-PMT is expected to reach 81.2%. Finally, the reduction of the penetration depth of the MCP input electrode layer and the deposition of a high secondary electron yield material on the MCP are proposed to further optimize C e .

  4. Utilization of FADC for reconstruction and analysis of the background data in the Chooz neutrino experiment; Utilisation des FADC pour la reconstruction et l`analyse des donnees de bruit de fond dans l`experience neutrino de Chooz

    Energy Technology Data Exchange (ETDEWEB)

    Veron, Didier [Universite Claude Bernard, 69 - Lyon (France)

    1997-03-25

    This thesis describes a particular contribution to the Chooz experiment. The latter looks for the oscillations, over a distance of 1 km, of antineutrons emitted by two nuclear reactors. The electron-type antineutrinos are detected through their inverse beta interaction with a target`s proton. The neutron is detected through its capture by a gadolinium nucleus revealed by an 8 MeV gamma emission. In the first part we describe the reconstruction of events as simulated by the GIANT software. We show that the positron`s and neutron`s stopping point can actually be reconstructed with an accuracy of 10 and 20 cm respectively. In the second part, we proceed to the analysis of the calibration`s data as recorded with Fast Wave Form Digitizers. This confirms the reliability of the Monte-Carlo results and allows measurement of both the neutrons` capture probability and time by the target gadolinium. The last part deals with the background (reactor turned off) data analysis and the pin-pointing of its various sources. In order to reduce their contribution, we define spatial cuts. These cuts` reliability is validated by analysis of data obtained not only with a neutron source, but also with neutrons issued from cosmic rays. We end up with a background contribution of two to three events per day, about ten times less than the expected neutrino rate at full reactor power. (author) 81 refs., 152 figs.,43 tabs.

  5. Lessons learned from ten years of terrestrial radio - ecological monitoring campaigns conducted around chooz NPP between 1995 and 2005

    International Nuclear Information System (INIS)

    Burton, O.; Bourdon, M; Aubinet, M.; Calande, E. C.; Tomasevszky, D.; Sombre, L.

    2006-01-01

    Radio-ecological monitoring campaigns around the Chooz PWR nuclear power plant (Ardennes - France), located at a few kilometres of the Belgian border, have been conducted on the Belgian territory, between 1995 and 2005, with the aim of observing the concentrations of radionuclides of major environmental significance in soils and agricultural products and their time evolution. The following conclusions are drawn from these campaigns : - the time evolution of the observed radioactivity levels remains rather constant ; - except 1 4C which is of natural origin but is also released in airborne discharges of nuclear power plants, the artificial isotopes still significantly detected in the agricultural ecosystem are the 1 37Cs (generated by the Chernobyl accident and the military test explosions) and the 9 0Sr (generated by the military test explosions) ; - grass remains the best indicator of contamination of the agricultural ecosystem by 1 37Cs and 9 0Sr ; - the major contributors to the total soil and plant activities are from far radionuclides of natural origin, the major contributor being 4 0K

  6. Measurement of θ_1_3 in Double Chooz using neutron captures on hydrogen with novel background rejection techniques

    International Nuclear Information System (INIS)

    Abe, Y.; Appel, S.; Abrahão, T.; Almazan, H.

    2016-01-01

    The Double Chooz collaboration presents a measurement of the neutrino mixing angle θ_1_3 using reactor ν̄_e observed via the inverse beta decay reaction in which the neutron is captured on hydrogen. This measurement is based on 462.72 live days data, approximately twice as much data as in the previous such analysis, collected with a detector positioned at an average distance of 1050 m from two reactor cores. Several novel techniques have been developed to achieve significant reductions of the backgrounds and systematic uncertainties. Accidental coincidences, the dominant background in this analysis, are suppressed by more than an order of magnitude with respect to our previous publication by a multi-variate analysis. These improvements demonstrate the capability of precise measurement of reactor ν̄_e without gadolinium loading. Spectral distortions from the ν̄_e reactor flux predictions previously reported with the neutron capture on gadolinium events are confirmed in the independent data sample presented here. A value of sin"2 2θ_1_3=0.095_−_0_._0_3_9"+"0"."0"3"8(stat+syst) is obtained from a fit to the observed event rate as a function of the reactor power, a method insensitive to the energy spectrum shape. A simultaneous fit of the hydrogen capture events and of the gadolinium capture events yields a measurement of sin"2 2θ_1_3=0.088±0.033(stat+syst).

  7. Chooz-B1, the new Electricite de France PWR: calculation scheme of neutron leakages from the reactor cavity

    International Nuclear Information System (INIS)

    Champion, G.; Thiriet, A.; Vergnaud, T.; Bourdet, L.; Nimal, J.C.; Brandicourt, G.

    1987-04-01

    A new calculation scheme has been set up to assess the neutron field characteristics inside French PWR. In order to take into account multiple neutron scattering and the complexity of the reactor geometry, the use of Monte-Carlo methods have been heavily increased. They are coupled with classical SN.-methods. The main goal aimed at was to find out the neutron field characteristics at the level of the reactor pit openings. These radiation reference sources will be used to check the neutron shielding efficiencies. The new calculation scheme has been applied to CHOOZ-B1, the first unit of the new N4 program. The former results have been compared with the measurement results related to PALUEL-I and II PWR, two units of the previous P4 program. Although the core and the geometry are not entirely similar, it is possible to check with confidence the calculation results along the vessel and at the core midplane level with the measurement results at the same locations. It appears that they are in good agreement. Consequently, the new calculation scheme appears reliable

  8. Promoting scopolamine biosynthesis in transgenic Atropa belladonna plants with pmt and h6h overexpression under field conditions.

    Science.gov (United States)

    Xia, Ke; Liu, Xiaoqiang; Zhang, Qiaozhuo; Qiang, Wei; Guo, Jianjun; Lan, Xiaozhong; Chen, Min; Liao, Zhihua

    2016-09-01

    Atropa belladonna is one of the most important plant sources for producing pharmaceutical tropane alkaloids (TAs). T1 progeny of transgenic A. belladonna, in which putrescine N-methyltransferase (EC. 2.1.1.53) from Nicotiana tabacum (NtPMT) and hyoscyamine 6β-hydroxylase (EC. 1.14.11.14) from Hyoscyamus niger (HnH6H) were overexpressed, were established to investigate TA biosynthesis and distribution in ripe fruits, leaves, stems, primary roots and secondary roots under field conditions. Both NtPMT and HnH6H were detected at the transcriptional level in transgenic plants, whereas they were not detected in wild-type plants. The transgenes did not influence the root-specific expression patterns of endogenous TA biosynthetic genes in A. belladonna. All four endogenous TA biosynthetic genes (AbPMT, AbTRI, AbCYP80F1 and AbH6H) had the highest/exclusive expression levels in secondary roots, suggesting that TAs were mainly synthesized in secondary roots. T1 progeny of transgenic A. belladonna showed an impressive scopolamine-rich chemotype that greatly improved the pharmaceutical value of A. belladonna. The higher efficiency of hyoscyamine conversion was found in aerial than in underground parts. In aerial parts of transgenic plants, hyoscyamine was totally converted to downstream alkaloids, especially scopolamine. Hyoscyamine, anisodamine and scopolamine were detected in underground parts, but scopolamine and anisodamine were more abundant than hyoscyamine. The exclusively higher levels of anisodamine in roots suggested that it might be difficult for its translocation from root to aerial organs. T1 progeny of transgenic A. belladonna, which produces scopolamine at very high levels (2.94-5.13 mg g(-1)) in field conditions, can provide more valuable plant materials for scopolamine production. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  9. Forward physics in CMS: Simulation of PMT hits in HF and Higgs mass reconstruction methods with a focus on forward jet tagging

    CERN Document Server

    Moeller, Anthony Richard

    2014-01-01

    Abnormally high energy events were seen in the Hadronic Forward (HF) calorimeter for pion and muon data during testbeam in 2004. Analysis of testbeam data suggested that such events were caused by particles traveling the entire length of HF and striking the photomultiplier (PMT) windows in the readout box behind HF. Charged particles traversing the window of the PMT emit cerenkov radiation, which creates abnormally high energy events in the data. To further study these events, a modification of the existing official CMS HF simulation was created that added the PMT windows to the simulation as sensitive detectors. In agreement with testbeam data, abnormally high energy events in the PMTs were seen in the simulation for muons and pions. The simulation was then extended to jets simulated with Pythia, and then for collision like events as well. PMT hits were seen in both of these cases. Energy sharing between PMTs for long and short fibers in HF as well as timing differences between normal HF events and PMT event...

  10. PERILAKU MAKAN MURID SEKOLAH DASAR PENERIMA PMT-AS DI DESA CIHEULEUT DAN PASIR GAOK KABUPATEN BOGOR

    Directory of Open Access Journals (Sweden)

    Hermina Hermina

    2012-11-01

    Full Text Available FOOD CONSUMPTION BEHAVIOR OF ELEMENTARY SCHOOL PUPILS PARTICIPATING IN "PMT-AS" PROGRAM AT THE CIHEULEUT AND PASIR GAOK VILLAGE DISTRICT OF BOGOR.Objective: To collect informations regarding actual food consumption behaviour of the pupils, i.e. to develop right message to improve food consumption and nutrition status of the pupils.Results: Most of the pupils have not been applying good and acceptable food consumption behavior, i.e. quantitatively and qualitatively as well; their dietary food consumption patterns relatively monotoneous, vegetables are consumted very limited and also protein sources are less varieties. Snack foods which are usually consumed at school are less varieties and relatively unsafe.Conclusions: There are important messages developed to improve food consumption and nutrition status of the pupils, i.e. eat breakfast before go to school, have complete meal 2-3 times a day and consumed vegetables every day.Key Words: food consumption behavior, school suplementary feeding program (PMT-AS, nutrition education, elementary school pupils

  11. PCR method for the rapid detection and discrimination of Legionella spp. based on the amplification of pcs, pmtA, and 16S rRNA genes.

    Science.gov (United States)

    Janczarek, Monika; Palusińska-Szysz, Marta

    2016-05-01

    Legionella bacteria are organisms of public health interest due to their ability to cause pneumonia (Legionnaires' disease) in susceptible humans and their ubiquitous presence in water supply systems. Rapid diagnosis of Legionnaires' disease allows the use of therapy specific for the disease. L. pneumophila serogroup 1 is the most common cause of infection acquired in community and hospital environments. The non-L. pneumophila infections are likely under-detected because of a lack of effective diagnosis. In this work, simplex and duplex PCR assays with the use of new molecular markers pcs and pmtA involved in phosphatidylcholine synthesis were specified for rapid and cost-efficient identification and distinguishing Legionella species. The sets of primers developed were found to be sensitive and specific for reliable detection of Legionella belonging to the eight most clinically relevant species. Among these, four primer sets I, II, VI, and VII used for duplex-PCRs proved to have the highest identification power and reliability in the detection of the bacteria. Application of this PCR-based method should improve detection of Legionella spp. in both clinical and environmental settings and facilitate molecular typing of these organisms.

  12. Assessment the Effect of Educational Intervention on Preventive Behaviors of Home Accidents in Mothers with Children Less than 5- Year Based on Protection Motivation Theory (PMT

    Directory of Open Access Journals (Sweden)

    Farbod Ebadi Fardazar

    2016-07-01

    Full Text Available Background: The accidents are the leading cause of morbidity and mortality among children in in the world. The aim of this study was to determine the effect of Educational intervention on promotion of prevention behaviors of home accidents in mothers with children less than 5- year based on protection motivation theory (PMT in 2015. Materials and Methods: In this controlled interventional study 190 mothers with children less than 5 years were participated (95 in intervention group and 95 in control group.The data collection tool was researcher made questionnaire based on the structures of PMT. After done pre-test and the results obtained from it, appropriate educational intervention designed and was conducted only in intervention group. Then two months after the educational intervention, evaluation was done and data analysis was using SPSS-20. Results: Statistically significant difference was found between mean scores of all structures of PMT in intervention and control groups after the educational intervention (P

  13. Structural Redesigning Arabidopsis Lignins into Alkali-Soluble Lignins through the Expression of p-Coumaroyl-CoA:Monolignol Transferase PMT1

    Science.gov (United States)

    Sibout, Richard; Le Bris, Philippe; Cézard, Laurent

    2016-01-01

    Grass lignins can contain up to 10% to 15% by weight of p-coumaric esters. This acylation is performed on monolignols under the catalysis of p-coumaroyl-coenzyme A monolignol transferase (PMT). To study the impact of p-coumaroylation on lignification, we first introduced the Brachypodium distachyon Bradi2g36910 (BdPMT1) gene into Arabidopsis (Arabidopsis thaliana) under the control of the constitutive maize (Zea mays) ubiquitin promoter. The resulting p-coumaroylation was far lower than that of lignins from mature grass stems and had no impact on stem lignin content. By contrast, introducing either the BdPMT1 or the Bradi1g36980 (BdPMT2) gene into Arabidopsis under the control of the Arabidopsis cinnamate-4-hydroxylase promoter boosted the p-coumaroylation of mature stems up to the grass lignin level (8% to 9% by weight), without any impact on plant development. The analysis of purified lignin fractions and the identification of diagnostic products confirmed that p-coumaric acid was associated with lignins. BdPMT1-driven p-coumaroylation was also obtained in the fah1 (deficient for ferulate 5-hydroxylase) and ccr1g (deficient for cinnamoyl-coenzyme A reductase) lines, albeit to a lower extent. Lignins from BdPMT1-expressing ccr1g lines were also found to be feruloylated. In Arabidopsis mature stems, substantial p-coumaroylation of lignins was achieved at the expense of lignin content and induced lignin structural alterations, with an unexpected increase of lignin units with free phenolic groups. This higher frequency of free phenolic groups in Arabidopsis lignins doubled their solubility in alkali at room temperature. These findings suggest that the formation of alkali-leachable lignin domains rich in free phenolic groups is favored when p-coumaroylated monolignols participate in lignification in a grass in a similar manner. PMID:26826222

  14. Simulation of the electron collection efficiency of a PMT based on the MCP coated with high secondary yield material

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Lin, E-mail: chenlin@opt.cn [State Key Laboratory of Transient Optics and Photonics, Xi' an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi' an 710119 (China); Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Xi' an Jiaotong University, Xi' an 710049 (China); Collaborative Innovation Center of Extreme Optics, Shanxi University, Taiyuan 030006 (China); Tian, Jinshou [State Key Laboratory of Transient Optics and Photonics, Xi' an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi' an 710119 (China); Collaborative Innovation Center of Extreme Optics, Shanxi University, Taiyuan 030006 (China); Zhao, Tianchi [Institute of High Energy Physics (IHEP) of CAS, Beijing 100049 (China); Liu, Chunliang [Xi' an Jiaotong University, Xi' an 710049 (China); Liu, Hulin; Wei, Yonglin; Sai, Xiaofeng [State Key Laboratory of Transient Optics and Photonics, Xi' an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi' an 710119 (China); Chen, Ping [State Key Laboratory of Transient Optics and Photonics, Xi' an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi' an 710119 (China); Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Wang, Xing; Lu, Yu [State Key Laboratory of Transient Optics and Photonics, Xi' an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi' an 710119 (China); Hui, Dandan [State Key Laboratory of Transient Optics and Photonics, Xi' an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi' an 710119 (China); Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China)

    2016-11-01

    Owning to the serious loss of photoelectrons striking at the input electrode of traditional microchannel plate (MCP), photoelectron collection efficiency (CE) of photomultiplier tubes based on MCP (MCP-PMTs) fluctuates around the MCP open area fraction and cannot make a breakthrough. Depositing a thin film of high secondary electron yield material on the MCP is proposed as an effective approach to improve the CE. The available simulation and experimental data to validate it, however, is sparse. In our work, a three-dimensional small area MCP model is developed in CST Studio Suite to evaluate the collection efficiencies of PMTs based on the traditional MCP and the coated one, respectively. Results predict that CE of the PMT based on the coated MCP has a significant increase and a better uniformity, which is expected to reach 100%.

  15. Validation of GEANT3 simulation studies with a dual-head PMT ClearPET TM prototype

    CERN Document Server

    Ziemons, K; Streun, M; Pietrzyk, U

    2004-01-01

    The ClearPET TM project is proposed by working groups of the Crystal Clear Collaboration (CCC) to develop a 2/sup nd/ generation high performance small animal positron emission tomograph (PET). High sensitivity and high spatial resolution is foreseen for the ClearPET TM camera by using a phoswich arrangement combining mixed lutetium yttrium aluminum perovskite (LuYAP:Ce) and lutetium oxyorthosilicate (LSO) scintillating crystals. Design optimizations for the first photomultiplier tube (PMT) based ClearPET camera are done with a Monte-Carlo simulation package implemented on GEANT3 (CERN, Geneva, Switzerland). A dual-head prototype has been built to test the frontend electronics and was used to validate the implementation of the GEANT3 simulation tool. Multiple simulations were performed following the experimental protocols to measure the intrinsic resolution and the sensitivity profile in axial and radial direction. Including a mean energy resolution of about 27.0% the simulated intrinsic resolution is about (...

  16. Noise Filter Studies for CMS Forward Hadron Calorimeter (HF) Between Old and New PMT's Using Data in 2012

    CERN Document Server

    Dumanoglu, Isa; Gurpinar, Emine; Kunori, Shuichi; Lezki, Samet; Tali, Bayram

    2016-01-01

    During the data taking before 2012 some abnormal events which have higher signals than expected were observed. Most of these were due to muons. When a muon hits the PMT glass window it creates a huge signal. To eliminate this kind of events 24 old HF PMTs (Hamamatsu R7525) in HF Minus at iphi 43 (corresponds to one sector) were replaced with new multi anode PMTs (Hamamatsu multi anode R7600) which have thin glass windows. These new PMTs were installed and tested in H2 test beam area in 2009 [1]. To check whether these new PMTs perform better than the old ones data taken in 2012 were analyzed using various predefined noise filters. Noisy rechits percentage was found to be around 6-7 \\% for the new PMTs while it varies between 29-66 \\% for the old PMTs for various trigger selections and for HFLongShortFilter after an energy cut of 500GeV [2].

  17. Faktor – Faktor yang Berhubungan demgan Pemberian Makanan Tambahan (PMT pada Bayi Usia (0-6 Bulan di Wilayah Kerja Puskesmas Garuda Kelurahan Tangkerang Tengah Kota Pekanbaru

    Directory of Open Access Journals (Sweden)

    Meliza Rasyid

    2017-12-01

    Full Text Available Pemberian Makanan Tambahan (PMT pada bayi adalah pemberian makanan atau minuman yang mengandung zat gizi pada bayi atau anak usia 6-24 bulan untuk memenuhi kebutuhan gizi setelah pemberian ASI Eksklusif. Pencapaian angka pemberian ASI eksklusif di Provinsi Riau Tahun 2011 adalah 45,9%, tahun 2012 meningkat menjadi 46,2%. Cakupan ASI Eksklusif Puskesmas tahun 2012 sebesar 60,4%, tahun 2013 menurun menjadi 32,5%. Tujuan penelitian untuk mengetahui faktor-faktor yang berhubungan dengan pemberian makanan tambahan (PMT pada bayi usia (0-6 bulan di Wilayah Kerja Puskesmas Garuda Kelurahan Tangkerang Tengah Kota Pekanbaru. Penelitian ini bersifat analitik kuantitatif observasional dengan desain (cross sectional dengan variable dependen pemberian makanan tambahan (PMT dan variabel independen (pendidikan, pekerjaan, pengetahua, dan sumber informasi. Populasi dalam penelitian ini adalah seluruh ibu-ibu yang memiliki bayi usia (0-6 bulan sebanyak 388 orang dengan sampel sebagian ibu-ibu yang memiliki bayi usia (0-6 bulan sebanyak 128. Teknik pengambilan sampel adalah quota sampling. Jenis data terdiri dari data primer dan data sekunder. Pengumpulan data primer diperoleh langsung dari pengamatan di lapangan melalui wawancara dengan alat pengukuran kuesioner. Analisis yang digunakan adalah analisis univariat, bivariat dengan uji Chi-square dan multivariat. Hasil penelitian menunjukkan terdapat hubungan antara pendidikan dengan Pemberian Makanan Tambahan dengan (P value 0,032, POR 95% CI = 2,338 1,137-4,808, pengetahuan dengan (P value 0,002, nilai POR 95% CI = 3,844 1,710-8,639 Disarankan ke instansi terkait untuk meningkatkan program komunikasi, informasi, dan edukasi (KIE, menjalin kerja sama lintas program dan lintas sektor, lebih aktif memberikan informasi kepada ibu yang memiliki bayi usia (0-6 bulan dengan pendidikan dan pengetahuan yang masih rendah salah satunya melalui penyuluhan tentang pemberian makanan tambahan (PMT.   Kata Kunci

  18. First Tests of a New Fast Waveform Digitizer for PMT Signal Read-out from Liquid Argon Dark Matter Detectors

    Science.gov (United States)

    Szelc, A. M.; Canci, N.; Cavanna, F.; Cortopassi, A.; D'Incecco, M.; Mini, G.; Pietropaolo, F.; Romboli, A.; Segreto, E.; Acciarri, R.

    A new generation Waveform Digitizer board as been recently made available on the market by CAEN. The new board CAEN V1751 with 8 Channels per board, 10 bit, 1 GS/s Flash ADC Waveform Digitizer (or 4 channel, 10 bit, 2 GS/s Flash ADC Waveform Digitizer -Dual Edge Sampling mode) with threshold and Auto-Trigger capabilities provides an ideal (relatively low-cost) solution for reading signals from liquid Argon detectors for Dark Matter search equipped with an array of PMTs for the detection of scintillation light. The board was extensively used in real experimental conditions to test its usefulness for possible future uses and to compare it with a state of the art digital oscilloscope. As results, PMT Signal sampling at 1 or 2 GS/s is appropriate for the reconstruction of the fast component of the signal scintillation in Argon (characteristic time of about 4 ns) and the extended dynamic range, after a small customization, allows for the detection of signals in the range of energy needed. The bandwidth is found to be adequate and the intrinsic noise is very low.

  19. Assessment of hepatic functional reserve for hepatic resection using {sup 99m}Tc-PMT scintigraphy in comparison with {sup 99m}Tc-GSA scintigraphy

    Energy Technology Data Exchange (ETDEWEB)

    Sakuma, Atsushi [Dokkyo Univ. School of Medicine, Mibu, Tochigi (Japan)

    2000-03-01

    {sup 99m}Tc-diethylenetriamine-pentaacetic acid-galactosyl human serum albumin({sup 99m}Tc-GSA) scintigraphy has been reported as a useful study of hepatic functional reserve recently. We have performed {sup 99m}Tc-N-pyridoxyl-5-methyl-tryptophan({sup 99m}Tc-PMT) and {sup 99m}Tc-GSA preoperatively for evaluation of hepatic functional reserve and compared the usefulness of those scintigraphy study. Twenty-four patients who were the candidates of hepatic resection underwent {sup 99m}Tc-PMT scintigraphy preoperatively. Hepatic blood flow coefficient (K value), the amount of hepatic blood flow (HBF), and the ratio of portal blood flow (PVR) were computed. {sup 99m}Tc-GSA scintigraphy was also performed within two weeks of the {sup 99m}Tc-PMT scintigraphy, and the ratio of disappearance (HH{sub 15}) and the hepatic uptake ratio (LHL{sub 15}) were computed. The relationship between K value, HBF, PVR, HH{sub 15} and LHL{sub 15} was analyzed. Their correlation with other liver function tests was also examined. K value and HBF did not show statistically significant correlations with HH{sub 15} and LHL{sub 15}, PVR correlated statistically significantly HH{sub 15} and LHL{sub 15}. K value correlated with the preoperative values of cholinesterase, Fischer ratio, {gamma}-globulin, ICGR{sub 15}, albumin, and platelet count. There was a statistically significant correlation between LHL{sub 15} and the value of cholinesterase, {gamma}-globulin, platelet count, and Fischer ratio. When the liver resection of subsegmentectomy or more was indicated in 10 patients, nine patients had LHL{sub 15} value less than 0.9 which delineated possibility of poor prognosis. However, judging from K value and HBF, liver resection was considered feasible and it was all successfully performed, resulting in good prognosis. From this study, it is suspected that {sup 99m}Tc-GSA scintigraphy reflect the severity of liver fibrosis and the amount of portal blood flows, and {sup 99m}Tc-PMT scintigraphy

  20. Assessment of hepatic functional reserve for hepatic resection using 99mTc-PMT scintigraphy in comparison with 99mTc-GSA scintigraphy

    International Nuclear Information System (INIS)

    Sakuma, Atsushi

    2000-01-01

    99m Tc-diethylenetriamine-pentaacetic acid-galactosyl human serum albumin( 99m Tc-GSA) scintigraphy has been reported as a useful study of hepatic functional reserve recently. We have performed 99m Tc-N-pyridoxyl-5-methyl-tryptophan( 99m Tc-PMT) and 99m Tc-GSA preoperatively for evaluation of hepatic functional reserve and compared the usefulness of those scintigraphy study. Twenty-four patients who were the candidates of hepatic resection underwent 99m Tc-PMT scintigraphy preoperatively. Hepatic blood flow coefficient (K value), the amount of hepatic blood flow (HBF), and the ratio of portal blood flow (PVR) were computed. 99m Tc-GSA scintigraphy was also performed within two weeks of the 99m Tc-PMT scintigraphy, and the ratio of disappearance (HH 15 ) and the hepatic uptake ratio (LHL 15 ) were computed. The relationship between K value, HBF, PVR, HH 15 and LHL 15 was analyzed. Their correlation with other liver function tests was also examined. K value and HBF did not show statistically significant correlations with HH 15 and LHL 15 , PVR correlated statistically significantly HH 15 and LHL 15 . K value correlated with the preoperative values of cholinesterase, Fischer ratio, γ-globulin, ICGR 15 , albumin, and platelet count. There was a statistically significant correlation between LHL 15 and the value of cholinesterase, γ-globulin, platelet count, and Fischer ratio. When the liver resection of subsegmentectomy or more was indicated in 10 patients, nine patients had LHL 15 value less than 0.9 which delineated possibility of poor prognosis. However, judging from K value and HBF, liver resection was considered feasible and it was all successfully performed, resulting in good prognosis. From this study, it is suspected that 99m Tc-GSA scintigraphy reflect the severity of liver fibrosis and the amount of portal blood flows, and 99m Tc-PMT scintigraphy reflect the hepatic blood flow and ability of protein synthesis. It was proved that 99m Tc-PMT scintigraphy is

  1. QUALITY ASSESSMENT OF CONFOCAL MICROSCOPY SLIDE-BASED SYSTEMS: INSTABLITY

    Science.gov (United States)

    Background: All slide-based fluorescence cytometry detections systems basically include an excitation light source, intermediate optics, and a detection device (CCD or PMT). Occasionally, this equipment becomes unstable, generating unreliable and inferior data. Methods: A num...

  2. The data acquisition system for a SPECT with cylindrical detector

    International Nuclear Information System (INIS)

    Jin Yongjie; Liu Yinong; Li Yuanjing

    1995-01-01

    The data acquisition and position estimation system has been developed for a multi-crystal SPECT with modular cylindrical detector. The electronics screen photon energy determines the detector module stricken by incident photon. The relevant PMT outputs are digitized and passed onto a Pentium PC. Then PMT gain normalization, detector bar identification, energy correction, event coordinates calculation and linearity correction are real-time performed by the PC. The system has been employed in clinical brain imaging

  3. Decree no. 96-927 from October 16, 1996 giving permission to Electricite de France to operate the Ardennes nuclear power plant including the basic nuclear installations no. 1 (reactor and auxiliary circuits), no. 2 (radioactive effluents processing plant) and no. 3 (fuel storage building), located on the territory of Chooz town (Ardennes)

    International Nuclear Information System (INIS)

    Borotra, F.

    1996-01-01

    This decree from the French ministry of industry and postal services gives to Electricite de France (EDF) the official permission to operate the Chooz nuclear power plant previously operated by the French-Belgium nuclear energy Society of the Ardennes. The operation will follow the conditions previously imposed to this Society. (J.S.)

  4. Electronics for a prototype variable field of view PET camera using the PMT-quadrant-sharing detector array

    Science.gov (United States)

    Li, H.; Wong, Wai-Hoi; Zhang, N.; Wang, J.; Uribe, J.; Baghaei, H.; Yokoyama, S.

    1999-06-01

    Electronics for a prototype high-resolution PET camera with eight position-sensitive detector modules has been developed. Each module has 16 BGO (Bi/sub 4/Ge/sub 3/O/sub 12/) blocks (each block is composed of 49 crystals). The design goals are component and space reduction. The electronics is composed of five parts: front-end analog processing, digital position decoding, fast timing, coincidence processing and master data acquisition. The front-end analog circuit is a zone-based structure (each zone has 3/spl times/3 PMTs). Nine ADCs digitize integration signals of an active zone identified by eight trigger clusters; each cluster is composed of six photomultiplier tubes (PMTs). A trigger corresponding to a gamma ray is sent to a fast timing board to obtain a time-mark, and the nine digitized signals are passed to the position decoding board, where a real block (four PMTs) can be picked out from the zone for position decoding. Lookup tables are used for energy discrimination and to identify the gamma-hit crystal location. The coincidence board opens a 70-ns initial timing window, followed by two 20-ns true/accidental time-mark lookup table windows. The data output from the coincidence board can be acquired either in sinogram mode or in list mode with a Motorola/IRONICS VME-based system.

  5. Automatic test system of the photomultipliers

    International Nuclear Information System (INIS)

    Shiino, Kazuo; Kono, Koji; Ishii, Takanobu; Kasai, Seiji; Yamada, Sakue; Kitamura, Shoichi.

    1990-03-01

    A test system of R580 photomultipliers (PMTs) was constructed for the ZEUS experiment HERA. In this report, we will describe the general feature of the test system, each component of the setup, the procedure of the measurements, the data analyses and the results of the first 800 PMT measurements. (author)

  6. Computer-based expert system aids underground mine planning

    Energy Technology Data Exchange (ETDEWEB)

    Britton, S.G.

    1987-04-01

    Artificial intelligence (AI) systems have been rapidly expanded over the last few years to aid in the decision making processes in a whole range of industries, including the use of machines for operating in high risk/dangerous areas such as at the working faces in longwall mining. Using Prolog software a program for mine management is being developed called CHOOZ. This system can help managers identify staffing problems and change manpower shifts to cope with unexpected labor problems such as absenteeism and sickness. All the programs have been developed for the IBM PC microcomputer.

  7. The performance of a high speed pipelined photomultiplier readout system in the Fermilab KTe V experiment

    International Nuclear Information System (INIS)

    Whitmore, J.

    1997-08-01

    The KTeV fixed target experiment at Fermilab is using an innovative scheme for reading out its 3100 channel CsI electromagnetic calorimeter. This pipelined readout system digitizes photomultiplier tube (PMT) signals over a 16-bit dynamic range with 8-bits of resolution at 53 MHz. The crucial element of the system is a custom Bi-CMOS integrated circuit which, in conjunction with an 8-bit Flash ADC, integrates and digitizes the PMT signal charge over each 18.9 nsec clock cycle (53 MHz) in a deadtimeless fashion.The digitizer circuit is local to the PMT base, and has an in-situ charge integration noise figure of 3 fC/sample. In this article, the readout system will be described and its performance including noise, cross-talk, linearity, stability, and reliability will be discussed

  8. Pulse Shape Tuning in Neutrino Detector Scintillator Systems

    Energy Technology Data Exchange (ETDEWEB)

    Aberle, Ch.; Buck, Ch.; Hartmann, F.X.; Schoenert, St. [Max Planck Institute for Nuclear Physics, Heidelberg (Germany); Hartmann, F.X. [Hartmann Scientific, City of Virginia Beach, Virginia (United States)

    2009-07-01

    Full text of publication follows: A new light yield model based on energy transfer pathways in codoped organic liquid scintillator systems is created and used to determine experimentally non-radiative energy transfer rate constants from which time dependent light pulse shapes and total light yields are predicted for multi-component liquids. Such constants determine effective Forster-Dexter critical concentrations. A surprising discovery regarding the critical concentration in n-dodecane permits tuning the pulse shape for different regions in the Double Chooz neutrino detector. (authors)

  9. Design and simulation of a novel method for determining depth-of-interaction in a PET scintillation crystal array using a single-ended readout by a multi-anode PMT

    International Nuclear Information System (INIS)

    Ito, Mikiko; Sim, Kwang-Souk; Lee, Jae Sung; Park, Min-Jae; Hong, Seong Jong

    2010-01-01

    PET detectors with depth-of-interaction (DOI) encoding capability allow high spatial resolution and high sensitivity to be achieved simultaneously. To obtain DOI information from a mono-layer array of scintillation crystals using a single-ended readout, the authors devised a method based on light spreading within a crystal array and performed Monte Carlo simulations with individual scintillation photon tracking to prove the concept. A scintillation crystal array model was constructed using a grid method. Conventional grids are constructed using comb-shaped reflector strips with rectangular teeth to isolate scintillation crystals optically. However, the authors propose the use of triangularly shaped teeth, such that scintillation photons spread only in the x-direction in the upper halves of crystals and in the y-direction in lower halves. DOI positions can be estimated by considering the extent of two-dimensional light dispersion, which can be determined from the multiple anode outputs of a position-sensitive PMT placed under the crystal array. In the main simulation, a crystal block consisting of a 29 x 29 array of 1.5 mm x 1.5 mm x 20 mm crystals and a multi-anode PMT with 16 x 16 pixels were used. The effects of crystal size and non-uniform PMT output gain were also explored by simulation. The DOI resolution estimated for 1.5 x 1.5 x 20 mm 3 crystals was 2.16 mm on average. Although the flood map was depth dependent, each crystal was well identified at all depths when a corner of the crystal array was irradiated with 511 keV gamma rays (peak-to-valley ratio ∼9:1). DOI resolution was better than 3 mm up to a crystal length of 28 mm with a 1.5 x 1.5 mm 2 or 2.0 x 2.0 mm 2 crystal surface area. The devised light-sharing method allowed excellent DOI resolutions to be obtained without the use of dual-ended readout or multiple crystal arrays.

  10. High-Resolution Imaging System (HiRIS) based on H9500 PSPMT

    International Nuclear Information System (INIS)

    Trotta, C.; Massari, R.; Trinci, G.; Palermo, N.; Boccalini, S.; Scopinaro, F.; Soluri, A.

    2008-01-01

    The H8500 PhotoMultiplier Tube (PMT) from Hamamatsu has been used in the last years to assemble several scintigraphic devices in order to achieve high-resolution gamma cameras. If the detector is coupled to discrete scintillator with millimetric pixel size, the resulting charge distribution that emerges is not properly sampled by its anodes (6x6 mm 2 ). The new position sensitive PMT H9500, with its 3x3 mm 2 anodes, allows a better charge distribution sampling, improving both spatial resolution and linearity of the system. In this paper, we investigate the imaging performances of the H9500 PMT coupled with a CsI(Tl) array having 1 mm pixel size and compare the results with the same scintillator coupled with H8500 PMT. A portable imaging system named HiRIS (High-Resolution Imaging System) was then realized using a miniaturized readout electronic. Thanks to its lightness, it can be easily used in Medical Imaging. We used HiRIS, together with a rotating system, to carry out a tomographic reconstruction of the biodistribution of a radiopharmaceutical in rats

  11. The system SnTe-InSe

    International Nuclear Information System (INIS)

    Gurshumov, A.P.; Alidzhanov, M.A.; Aliev, A.S.; Gadzhiev, T.G.; Mamedov, N.A.

    1986-01-01

    This paper discusses the nature of the interaction and physicochemical properties of the alloys of the system SnTe-InSe. The DTA was performed on an NTR-74 pyrometer, XPA on a Dron-2.0 diffractometer and MSA on an MIM-7 metallographic microscope. The microhardness of the samples was determined on a PMT-3 microhardness tester. The congruently melting compound SnInTeSe and solid solutions based on the starting components are formed in the system

  12. Online Data Monitoring Framework Based on Histogram Packaging in Network Distributed Data Acquisition Systems

    International Nuclear Information System (INIS)

    Konno, T; Ishitsuka, M; Kuze, M; Cabarera, A; Sakamoto, Y

    2011-01-01

    O nline monitor frameworkis a new general software framework for online data monitoring, which provides a way to collect information from online systems, including data acquisition, and displays them to shifters far from experimental sites. 'Monitor Server', a core system in this framework gathers the monitoring information from the online subsystems and the information is handled as collections of histograms named H istogram Package . Monitor Server broadcasts the histogram packages to 'Monitor Viewers', graphical user interfaces in the framework. We developed two types of the viewers with different technologies: Java and web browser. We adapted XML based file for the configuration of GUI components on the windows and graphical objects on the canvases. Monitor Viewer creates its GUIs automatically with the configuration files.This monitoring framework has been developed for the Double Chooz reactor neutrino oscillation experiment in France, but can be extended for general application to be used in other experiments. This document reports the structure of the online monitor framework with some examples from the adaption to the Double Chooz experiment.

  13. Electronics and Calibration system for the CMS Beam Halo Monitor

    CERN Document Server

    Tosi, Nicolò; Fabbri, Franco L; Finkel, Alexey; Orfanelli, Stella; Loos, R; Montanari, Alessandro; Rusack, R; Stickland, David P

    2014-01-01

    In the context of increasing luminosity of LHC, it will be important to accurately measure the Machine Induced Background. A new monitoring system will be installed in the cavern of the Compact Muon Solenoid (CMS) experiment for measuring the beam background at high radius. This detector is composed of synthetic quartz Cherenkov radiators, coupled to fast photomultiplier tubes (PMT). The readout chain of this detector will make use of many components developed for the Phase 1 upgrade to the CMS Hadron Calorimeter electronics, with a dedicated firmware and readout adapted to the beam monitoring requirements. The PMT signal will be digitized by a charge integrating ASIC (QIE10), providing both the signal rise time and the charge integrated over one bunch crossing. The backend electronics will record bunch-by-bunch histograms, which will be published to CMS and the LHC using the newly designed CMS beam instrumentation specific DAQ. A calibration monitoring system has been designed to generate triggered pulses of...

  14. Development and evaluation of a Gamma Camera tuning system

    International Nuclear Information System (INIS)

    Arista Romeu, E. J.; Diaz Garcia, A.; Osorio Deliz, J. F.

    2015-01-01

    Correct operation of conventional analogue Gamma Cameras implies a good conformation of the position signals that correspond to a specific photo-peak of the radionuclide of interest. In order to achieve this goal the energy spectrum from each photo multiplier tube (PMT) has to be set within the same energy window. For this reason a reliable tuning system is an important part of all gamma cameras processing systems. In this work is being tested and evaluated a new prototype of tuning card that was developed and setting up for this purpose. The hardware and software of the circuit allow the regulation if each PMT high voltage. By this means a proper gain control for each of them is accomplished. The Tuning Card prototype was simulated in a virtual model and its satisfactory operation was proven in a Siemens Orbiter Gamma Camera. (Author)

  15. A novel portable system for detecting and measuring tritium

    International Nuclear Information System (INIS)

    Barillari, Domenico

    2007-01-01

    A novel tritium detector configuration is described based on the anthracene scintillation method. Tritium-bearing samples are applied to a plate-bearing finely sublimed anthracene crystals and viewed in a field-able PMT-based reader against a standard plate. A microprocessor-based control and signal analysis system delivers a reading with a sensitivity of better than 5 nCi 3 H in approximately 3 min, and 2.3 nCi in 10 min of counting

  16. A system for the characterization of the HAWC PMTs sensitivity

    Science.gov (United States)

    Langarica, R.; Lara, G.; Martinez, L. A.; Tinoco, S.; Alfaro, R.; Iriarte, A.; Sandoval, A.; Vanegas, P.

    2012-07-01

    The HAWC Project is a very high-energy gamma-ray observatory under construction at the Sierra Negra volcano (4100 meters above sea level) in the Pico de Orizaba National Park located in central Mexico. HAWC will reuse the 900 Hamamatsu R5912 photomultipliers (PMTs) from Milagro Observatory for the 300 Water Cherenkov Detectors. In order to characterize their present performance it is necessary to scan the active area of the photocathode by measuring its efficiency and gain. A characterization system was designed and manufactured to achieve an automated measurement of over 100 points distributed on the PMT active spherical surface. Preliminary results show the variation of QE of PMTs with respect of the position of incoming photons, as well as the changes in the PMTs response due to the Earth's magnetic field and gain vs. high voltage. The system allows automated PMT characterization improving its performance, reliability, precision and repeatability. In this work we present the characterization system and preliminary results on the PMT efficiency.

  17. Fluorescence detection system for microfluidic droplets

    Science.gov (United States)

    Chen, Binyu; Han, Xiaoming; Su, Zhen; Liu, Quanjun

    2018-05-01

    In microfluidic detection technology, because of the universality of optical methods in laboratory, optical detection is an attractive solution for microfluidic chip laboratory equipment. In addition, the equipment with high stability and low cost can be realized by integrating appropriate optical detection technology on the chip. This paper reports a detection system for microfluidic droplets. Photomultiplier tubes (PMT) is used as a detection device to improve the sensitivity of detection. This system improves the signal to noise ratio by software filtering and spatial filter. The fluorescence intensity is proportional to the concentration of the fluorescence and intensity of the laser. The fluorescence micro droplets of different concentrations can be distinguished by this system.

  18. The electronics system for the LBNL positron emission mammography (PEM) camera

    CERN Document Server

    Moses, W W; Baker, K; Jones, W; Lenox, M; Ho, M H; Weng, M

    2001-01-01

    Describes the electronics for a high-performance positron emission mammography (PEM) camera. It is based on the electronics for a human brain positron emission tomography (PET) camera (the Siemens/CTI HRRT), modified to use a detector module that incorporates a photodiode (PD) array. An application-specified integrated circuit (ASIC) services the photodetector (PD) array, amplifying its signal and identifying the crystal of interaction. Another ASIC services the photomultiplier tube (PMT), measuring its output and providing a timing signal. Field-programmable gate arrays (FPGAs) and lookup RAMs are used to apply crystal-by-crystal correction factors and measure the energy deposit and the interaction depth (based on the PD/PMT ratio). Additional FPGAs provide event multiplexing, derandomization, coincidence detection, and real-time rebinning. Embedded PC/104 microprocessors provide communication, real-time control, and configure the system. Extensive use of FPGAs make the overall design extremely flexible, all...

  19. A new type gamma-ray spectrum monitoring system

    CERN Document Server

    Cheng Bo; Zhou Jian Bin; Zhang Zhi Ming; Tong Yun Fu

    2002-01-01

    This new radiation monitoring system can be used to monitor the radiation of building materials and the radiation of atmosphere, to explore and evaluate rock for building in the field, and this system can be used to monitor the gamma irradiation near the nuclear establishments in the average situation and in the serious situation of the radiation incident have happened. The control core of this monitoring system is SCM-AT89C52, and gamma-ray sensing head consists of scintillator phi 50 mm x 50 mm NaI(Tl) and PMT GDB44. This system can be used to measure the whole gamma-ray spectrum of 256 channels

  20. Forward Period Analysis Method of the Periodic Hamiltonian System.

    Directory of Open Access Journals (Sweden)

    Pengfei Wang

    Full Text Available Using the forward period analysis (FPA, we obtain the period of a Morse oscillator and mathematical pendulum system, with the accuracy of 100 significant digits. From these results, the long-term [0, 1060] (time unit solutions, ranging from the Planck time to the age of the universe, are computed reliably and quickly with a parallel multiple-precision Taylor series (PMT scheme. The application of FPA to periodic systems can greatly reduce the computation time of long-term reliable simulations. This scheme provides an efficient way to generate reference solutions, against which long-term simulations using other schemes can be tested.

  1. Design and Demonstration of a Miniature Lidar System for Rover Applications

    Science.gov (United States)

    Robinson, Benjamin

    2010-01-01

    A basic small and portable lidar system for rover applications has been designed. It uses a 20 Hz Nd:YAG pulsed laser, a 4-inch diameter telescope receiver, a custom-built power distribution unit (PDU), and a custom-built 532 nm photomultiplier tube (PMT) to measure the lidar signal. The receiving optics have been designed, but not constructed yet. LabVIEW and MATLAB programs have also been written to control the system, acquire data, and analyze data. The proposed system design, along with some measurements, is described. Future work to be completed is also discussed.

  2. Comparison of (31)P saturation and inversion magnetization transfer in human liver and skeletal muscle using a clinical MR system and surface coils.

    Science.gov (United States)

    Buehler, Tania; Kreis, Roland; Boesch, Chris

    2015-02-01

    (31)P MRS magnetization transfer ((31)P-MT) experiments allow the estimation of exchange rates of biochemical reactions, such as the creatine kinase equilibrium and adenosine triphosphate (ATP) synthesis. Although various (31)P-MT methods have been successfully used on isolated organs or animals, their application on humans in clinical scanners poses specific challenges. This study compared two major (31)P-MT methods on a clinical MR system using heteronuclear surface coils. Although saturation transfer (ST) is the most commonly used (31)P-MT method, sequences such as inversion transfer (IT) with short pulses might be better suited for the specific hardware and software limitations of a clinical scanner. In addition, small NMR-undetectable metabolite pools can transfer MT to NMR-visible pools during long saturation pulses, which is prevented with short pulses. (31)P-MT sequences were adapted for limited pulse length, for heteronuclear transmit-receive surface coils with inhomogeneous B1 , for the need for volume selection and for the inherently low signal-to-noise ratio (SNR) on a clinical 3-T MR system. The ST and IT sequences were applied to skeletal muscle and liver in 10 healthy volunteers. Monte-Carlo simulations were used to evaluate the behavior of the IT measurements with increasing imperfections. In skeletal muscle of the thigh, ATP synthesis resulted in forward reaction constants (k) of 0.074 ± 0.022 s(-1) (ST) and 0.137 ± 0.042 s(-1) (IT), whereas the creatine kinase reaction yielded 0.459 ± 0.089 s(-1) (IT). In the liver, ATP synthesis resulted in k = 0.267 ± 0.106 s(-1) (ST), whereas the IT experiment yielded no consistent results. ST results were close to literature values; however, the IT results were either much larger than the corresponding ST values and/or were widely scattered. To summarize, ST and IT experiments can both be implemented on a clinical body scanner with heteronuclear transmit-receive surface coils; however, ST results are

  3. Inspection of Chooz power plant after ten years operation

    International Nuclear Information System (INIS)

    Saglio, Robert.

    1978-01-01

    This report is intended to discuss the results from the complete technical audit of the vessel effected in 1976 at the Ardennes reactor (CNA 305 MWe). This audit had a special character as far as this power plant has never been inspected before: the start-up had taken place in 1967 and was then prior to the development of French regulations (and even to the first version of the ASME code, Section XI). In that time, no inspection was expected; it has yet been possible to have a complete audit in ten days. The automatic start-up of focused ultrasonic testing so appeared to have reached the required reliability and a good sensitivity [fr

  4. Test of the photon detection system for the LHCb RICH Upgrade in a charged particle beam

    CERN Document Server

    Baszczyk, M.K.

    2017-01-16

    The LHCb detector will be upgraded to make more efficient use of the available luminosity at the LHC in Run III and extend its potential for discovery. The Ring Imaging Cherenkov detectors are key components of the LHCb detector for particle identification. In this paper we describe the setup and the results of tests in a charged particle beam, carried out to assess prototypes of the upgraded opto-electronic chain from the Multi-Anode PMT photosensor to the readout and data acquisition system.

  5. Data acquisition architecture and online processing system for the HAWC gamma-ray observatory

    Science.gov (United States)

    Abeysekara, A. U.; Alfaro, R.; Alvarez, C.; Álvarez, J. D.; Arceo, R.; Arteaga-Velázquez, J. C.; Ayala Solares, H. A.; Barber, A. S.; Baughman, B. M.; Bautista-Elivar, N.; Becerra Gonzalez, J.; Belmont-Moreno, E.; BenZvi, S. Y.; Berley, D.; Bonilla Rosales, M.; Braun, J.; Caballero-Lopez, R. A.; Caballero-Mora, K. S.; Carramiñana, A.; Castillo, M.; Cotti, U.; Cotzomi, J.; de la Fuente, E.; De León, C.; DeYoung, T.; Diaz-Cruz, J.; Diaz Hernandez, R.; Díaz-Vélez, J. C.; Dingus, B. L.; DuVernois, M. A.; Ellsworth, R. W.; Fiorino, D. W.; Fraija, N.; Galindo, A.; Garfias, F.; González, M. M.; Goodman, J. A.; Grabski, V.; Gussert, M.; Hampel-Arias, Z.; Harding, J. P.; Hui, C. M.; Hüntemeyer, P.; Imran, A.; Iriarte, A.; Karn, P.; Kieda, D.; Kunde, G. J.; Lara, A.; Lauer, R. J.; Lee, W. H.; Lennarz, D.; León Vargas, H.; Linares, E. C.; Linnemann, J. T.; Longo Proper, M.; Luna-García, R.; Malone, K.; Marinelli, A.; Marinelli, S. S.; Martinez, O.; Martínez-Castro, J.; Martínez-Huerta, H.; Matthews, J. A. J.; McEnery, J.; Mendoza Torres, E.; Miranda-Romagnoli, P.; Moreno, E.; Mostafá, M.; Nellen, L.; Newbold, M.; Noriega-Papaqui, R.; Oceguera-Becerra, T.; Patricelli, B.; Pelayo, R.; Pérez-Pérez, E. G.; Pretz, J.; Rivière, C.; Rosa-González, D.; Ruiz-Velasco, E.; Ryan, J.; Salazar, H.; Salesa Greus, F.; Sanchez, F. E.; Sandoval, A.; Schneider, M.; Silich, S.; Sinnis, G.; Smith, A. J.; Sparks Woodle, K.; Springer, R. W.; Taboada, I.; Toale, P. A.; Tollefson, K.; Torres, I.; Ukwatta, T. N.; Villaseñor, L.; Weisgarber, T.; Westerhoff, S.; Wisher, I. G.; Wood, J.; Yapici, T.; Yodh, G. B.; Younk, P. W.; Zaborov, D.; Zepeda, A.; Zhou, H.

    2018-04-01

    The High Altitude Water Cherenkov observatory (HAWC) is an air shower array devised for TeV gamma-ray astronomy. HAWC is located at an altitude of 4100 m a.s.l. in Sierra Negra, Mexico. HAWC consists of 300 Water Cherenkov Detectors, each instrumented with 4 photomultiplier tubes (PMTs). HAWC re-uses the Front-End Boards from the Milagro experiment to receive the PMT signals. These boards are used in combination with Time to Digital Converters (TDCs) to record the time and the amount of light in each PMT hit (light flash). A set of VME TDC modules (128 channels each) is operated in a continuous (dead time free) mode. The TDCs are read out via the VME bus by Single-Board Computers (SBCs), which in turn are connected to a gigabit Ethernet network. The complete system produces ≈500 MB/s of raw data. A high-throughput data processing system has been designed and built to enable real-time data analysis. The system relies on off-the-shelf hardware components, an open-source software technology for data transfers (ZeroMQ) and a custom software framework for data analysis (AERIE). Multiple trigger and reconstruction algorithms can be combined and run on blocks of data in a parallel fashion, producing a set of output data streams which can be analyzed in real time with minimal latency (system and the real-time data processing system. The performance of these systems is also discussed.

  6. Ferroelectric properties of bismuth-doped PMT-PT ceramics

    International Nuclear Information System (INIS)

    Hyun, June Won; Kim, Yeon Jung; Kim, Gang Bae

    2010-01-01

    This study examined the ferroelectric properties of Bi-doped 0.66(Pb (1-3x/2) Bi x )(Mg 1/3 Ta 2/3 )O 3 - 0.34PbTiO 3 ceramics for use as a piezoelectric transformer. The optimum conditions for obtaining samples with high density and improved electrical properties were a sintering temperature of 1200 .deg. C/4 h and the addition of 3 mol% Bi. The temperature dependent dielectric constant of the ceramics was examined at frequencies ranging from 1 kHz to 100 kHz. The broad dielectric constant anomaly coupled with a shift in the dielectric maximum towards higher temperature with increasing frequency indicates a relaxor-type behavior in the ceramics. The piezoelectric coefficient (d 33 ) and the planar coupling factor (K p ) increase with the addition of 3 mol% Bi, and then decrease with further addition of Bi. The dielectric constant and the dissipation factor at room temperature could be improved by the addition of 3 mol% Bi.

  7. ATLAS Tile calorimeter calibration and monitoring systems

    CERN Document Server

    Boumediene, Djamel Eddine; The ATLAS collaboration

    2017-01-01

    The ATLAS Tile Calorimeter (TileCal) is the central section of the hadronic calorimeter of the ATLAS experiment and provides important information for reconstruction of hadrons, jets, hadronic decays of tau leptons and missing transverse energy. This sampling calorimeter uses steel plates as absorber and scintillating tiles as active medium. The light produced by the passage of charged particles is transmitted by wavelength shifting fibres to photomultiplier tubes (PMTs). PMT signals are then digitized at 40 MHz and stored on detector and are only transferred off detector once the first level trigger acceptance has been confirmed. The readout is segmented into about 5000 cells (longitudinally and transversally), each of them being read out by two PMTs in parallel. To calibrate and monitor the stability and performance of each part of the readout chain, a set of calibration systems is used. The TileCal calibration system comprises Cesium radioactive sources, laser, charge injection elements and an integrator b...

  8. The upgrade of the laser calibration system for the ATLAS hadron calorimeter TileCal

    CERN Document Server

    Spalla, Margherita; The ATLAS collaboration

    2014-01-01

    The Tile Calorimeter (TileCal), the central section of the hadronic calorimeter of the ATLAS experiment, is a key detector component to detect hadrons, jets and taus and to measure the missing transverse energy. TileCal is built of steel and scintillating tiles coupled to optical fibers and read‐out by photomultipliers (PMT). The performance of TileCal relies on a continuous, high resolution calibration of the individual response of the 10,000 channels forming the detector. The calibration is based on a three level architecture: a charge injection system used to monitor the full electronics chain including front-end amplifiers, digitizers and event builder blocks for each individual channel; a distributed optical system using laser pulses to excite all PMTs; and a mobile Cesium radiative source which is driven through the detector cell floating inside a pipe system. This architecture allows for a cascade calibration of the electronics, of the PMT and electronics, and of full chain including the active detec...

  9. Operation of ADITYA Thomson scattering system: measurement of temperature and density

    International Nuclear Information System (INIS)

    Thomas, Jinto; Pillai, Vishal; Singh, Neha; Patel, Kiran; Lingeshwari, G.; Hingrajiya, Zalak; Kumar, Ajai

    2015-01-01

    ADITYA Thomson scattering (TS) system is a single point measurement system operated using a 10 J ruby laser and a 1 meter grating spectrometer. Multi-slit optical fibers are arranged at the image plane of the spectrometer so that each fiber slit collects 2 nm band of scattered spectrum. Each slit of the fiber bundle is coupled to high gain Photomultiplier tubes (PMT). Standard white light source is used to calibrate the optical fiber transmission and the laser light itself is used to calibrate the relative gain of the PMT. Rayleigh scattering has been performed for the absolute calibration of the TS system. The temperature of ADITYA plasma has been calculated using the conventional method of estimation (calculated using the slope of logarithmic intensity vs the square of delta lambda). It has been observed that the core temperature of ADITYA Tokamak plasma is in the range of 300 to 600 eV for different plasma shots and the density 2-3 X 10 13 /cc. The time evolution of the plasma discharge has been studied by firing the laser at different times of the discharge assuming the shots are identical. In some of the discharges, the velocity distribution appears to be non Maxwellian. (author)

  10. A time-domain fluorescence diffusion optical tomography system for breast tumor diagnosis

    Science.gov (United States)

    Zhang, Wei; Gao, Feng; Wu, LinHui; Ma, Wenjuan; Yang, Fang; Zhou, Zhongxing; Zhang, Limin; Zhao, Huijuan

    2011-02-01

    A prototype time-domain fluorescence diffusion optical tomography (FDOT) system using near-infrared light is presented. The system employs two pulsed light sources, 32 source fibers and 32 detection channels, working separately for acquiring the temporal distribution of the photon flux on the tissue surface. The light sources are provided by low power picosecond pulsed diode lasers at wavelengths of 780 nm and 830 nm, and a 1×32-fiber-optic-switch sequentially directs light sources to the object surface through 32 source fibers. The light signals re-emitted from the object are collected by 32 detection fibers connected to four 8×1 fiber-optic-switch and then routed to four time-resolved measuring channels, each of which consists of a collimator, a filter wheel, a photomultiplier tube (PMT) photon-counting head and a time-correlated single photon counting (TCSPC) channel. The performance and efficacy of the designed multi-channel PMT-TCSPC system are assessed by reconstructing the fluorescent yield and lifetime images of a solid phantom.

  11. A computer - aided system for the the E.D.F. 1400 MW. Nuclear power plants control

    International Nuclear Information System (INIS)

    Beltranda, G.; Philipps, C.

    1988-01-01

    The future E.D.F. 1400 MW nuclear power plants (due to be commissioned in 1991 at CHOOZ) are provided with a control and instrumentation system including the following levels: - sensors and actuators (LEVEL 0): this is the interface of the elementary acquisition and control signals; - the programmable logical and numerical controllers (LEVEL 1) for the logical control sequences and analog adjustment sequences for the whole equipment of the facilities; - the control room (LEVEL 2) including the computer-aided operation system as well as the wall mimic diagram and the auxiliary panel directly connected to the controllers. This is the processing and control conversational level; - the maintenance and site computer-aided systems (LEVEL 3). This paper aims at describing the computer-aided operation system (called KIC N4), its main functions, its architecture and the solutions retained as regards its softwares and the high-quality of data required. The achievement of this system has been entrusted by EDF to the SEMA. METRA/CIMSA-SINTRA grouping, among which SEMA.METRA is the leading company

  12. Upgrade Analog Readout and Digitizing System for ATLAS TileCal Demonstrator

    CERN Document Server

    Tang, F; Anderson, K; Bohm, C; Hildebrand, K; Muschter, S; Oreglia, M

    2015-01-01

    The TileCal Demonstrator is a prototype for a future upgrade to the ATLAS hadron calorimeter when the Large Hadron Collider increases luminosity in year 2023 (HL-LHC). It will be used for functionality and performance tests. The Demonstrator has 48 channels of upgraded readout and digitizing electronics and a new digital trigger capability, but is backwards-compatible with the present detector system insofar as it also provides analog trigger signals. The Demonstrator is comprised of 4 identical mechanical mini-drawers, each equipped with up to 12 photomultipliers (PMTs). The on-detector electronics includes 45 Front-End Boards, each serving an individual PMT; 4 Main Boards, each to control and digitize up to 12 PMT signals, and 4 corresponding high-speed Daughter Boards serving as data hubs between on-detector and off-detector electronics. The Demonstrator is fully compatible with the present system, accepting ATLAS triggers, timing and slow control commands for the data acquisition, detector control, and de...

  13. Analog Readout and Digitizing System for ATLAS TileCal Demonstrator

    CERN Document Server

    Tang, F; The ATLAS collaboration

    2014-01-01

    The TileCal Demonstrator is a prototype for a future upgrade to the ATLAS hadron calorimeter when the Large Hadron Collider increases luminosity in year 2023 (HL-LHC). It will be used for functionality and performance tests. The Demonstrator has 48 channels of upgraded readout and digitizing electronics and a new digital trigger capability, but is backwards-compatible with the present detector system insofar as it also provides analog trigger signals. The Demonstrator is comprised of 4 identical mechanical mini-drawers, each equipped with up to 12 photomultipliers (PMTs). The on-detector electronics includes 45 Front-End Boards, each serving an individual PMT; 4 Main Boards, each to control and digitize up to 12 PMT signals, and 4 corresponding high-speed Daughter Boards serving as data hubs between on-detector and off-detector electronics. The Demonstrator is fully compatible with the present system, accepting ATLAS triggers, timing and slow control commands for the data acquisition, detector control, and de...

  14. The electronics, trigger and data acquisition system for the liquid argon time projection chamber of the DarkSide-50 search for dark matter

    Energy Technology Data Exchange (ETDEWEB)

    Agnes, P.; Albuquerque, I. F. M.; Alexander, T.; Alton, A. K.; Arisaka, K.; Asner, D. M.; Ave, M.; Back, H. O.; Baldin, B.; Biery, K.; Bocci, V.; Bonfini, G.; Bonivento, W.; Bossa, M.; Bottino, B.; Brigatti, A.; Brodsky, J.; Budano, F.; Bussino, S.; Cadeddu, M.; Cadoni, M.; Calaprice, F.; Canci, N.; Candela, A.; Cao, H.; Caravati, M.; Cariello, M.; Carlini, M.; Catalanotti, S.; Cataudella, V.; Cavalcante, P.; Chepurnov, A.; Cicaló, C.; Cocco, A. G.; Covone, G.; Crippa, L.; D' Angelo, D.; D' Incecco, M.; Davini, S.; de Candia, A.; Cecco, S. De; Deo, M. De; Filippis, G. De; Rosa, G. De; Vincenzi, M. De; Derbin, A.; Devoto, A.; Eusanio, F. Di; Dionisi, C.; Pietro, G. Di; Edkins, E.; Empl, A.; Fan, A.; Fiorillo, G.; Fomenko, K.; Forster, G.; Franco, D.; Gabriele, F.; Galbiati, C.; Giagu, S.; Giganti, C.; Giovanetti, G. K.; Goretti, A. M.; Granato, F.; Grandi, L.; Gromov, M.; Guan, M.; Guardincerri, Y.; Hackett, B. R.; Herner, K. R.; Hughes, D.; Humble, P.; Hungerford, E. V.; Ianni, A.; Ianni, A.; James, I.; Johnson, T. N.; Keeter, K.; Kendziora, C. L.; Kobychev, V.; Koh, G.; Korablev, D.; Korga, G.; Kubankin, A.; Li, X.; Lissia, M.; Loer, B.; Lombardi, P.; Longo, G.; Luitz, S.; Ma, Y.; Machado, A.; Machulin, I. N.; Mandarano, A.; Mari, S. M.; Maricic, J.; Marini, L.; Martoff, C. J.; Meyers, P. D.; Miletic, T.; Milincic, R.; Montanari, D.; Monte, A.; Montuschi, M.; Monzani, M. E.; Mosteiro, P.; Mount, B. J.; Muratova, V. N.; Musico, P.; Agasson, A. Navrer; Nelson, A.; Odrowski, S.; Oleinik, A.; Orsini, M.; Ortica, F.; Pagani, L.; Pallavicini, M.; Pantic, E.; Parmeggiano, S.; Pelczar, K.; Pelliccia, N.; Pocar, A.; Pordes, S.; Pugachev, D. A.; Qian, H.; Randle, K.; Ranucci, G.; Razeti, M.; Razeto, A.; Reinhold, B.; Renshaw, A. L.; Rescigno, M.; Riffard, Q.; Romani, A.; Rossi, B.; Rossi, N.; Rountree, S. D.; Sablone, D.; Saggese, P.; Saldanha, R.; Sands, W.; Sangiorgio, S.; Savarese, C.; Schlitzer, B.; Segreto, E.; Semenov, D. A.; Shields, E.; Singh, P. N.; Skorokhvatov, M. D.; Smirnov, O.; Sotnikov, A.; Stanford, C.; Suvorov, Y.; Tartaglia, R.; Tatarowicz, J.; Testera, G.; Tonazzo, A.; Trinchese, P.; Unzhakov, E. V.; Verducci, M.; Vishneva, A.; Vogelaar, R. B.; Wada, M.; Walker, S.; Wang, H.; Wang, Y.; Watson, A. W.; Westerdale, S.; Wojcik, M. M.; Xiang, X.; Xiao, X.; Xu, J.; Yang, C.; Yoo, J.; Zavatarelli, S.; Zec, A.; Zhong, W.; Zhu, C.; Zuzel, G.

    2017-12-01

    The DarkSide-50 experiment at the Laboratori Nazionali del Gran Sasso is a search for dark matter using a dual phase time projection chamber with 50 kg of low radioactivity argon as target. Light signals from interactions in the argon are detected by a system of 38 photo-multiplier tubes (PMTs), 19 above and 19 below the TPC volume inside the argon cryostat. We describe the electronics which processes the signals from the photo-multipliers, the trigger system which identifies events of interest, and the data-acquisition system which records the data for further analysis. The electronics include resistive voltage dividers on the PMTs, custom pre-amplifiers mounted directly on the PMT voltage dividers in the liquid argon, and custom amplifier/discriminators (at room temperature). After amplification, the PMT signals are digitized in CAEN waveform digitizers, and CAEN logic modules are used to construct the trigger, the data acquisition system for the TPC is based on the Fermilab "artdaq" software. The system has been in operation since early 2014.

  15. Light scattering by ultrasonically-controlled small particles: system design, calibration, and measurement results

    Science.gov (United States)

    Kassamakov, Ivan; Maconi, Göran; Penttilä, Antti; Helander, Petteri; Gritsevich, Maria; Puranen, Tuomas; Salmi, Ari; Hæggström, Edward; Muinonen, Karri

    2018-02-01

    We present the design of a novel scatterometer for precise measurement of the angular Mueller matrix profile of a mm- to µm-sized sample held in place by sound. The scatterometer comprises a tunable multimode Argon-krypton laser (with possibility to set 1 of the 12 wavelengths in visible range), linear polarizers, a reference photomultiplier tube (PMT) for monitoring the beam intensity, and a micro-PMT module mounted radially towards the sample at an adjustable radius. The measurement angle is controlled by a motor-driven rotation stage with an accuracy of 15'. The system is fully automated using LabVIEW, including the FPGA-based data acquisition and the instrument's user interface. The calibration protocol ensures accurate measurements by using a control sphere sample (diameter 3 mm, refractive index of 1.5) fixed first on a static holder followed by accurate multi-wavelength measurements of the same sample levitated ultrasonically. To demonstrate performance of the scatterometer, we conducted detailed measurements of light scattered by a particle derived from the Chelyabinsk meteorite, as well as planetary analogue materials. The measurements are the first of this kind, since they are obtained using controlled spectral angular scattering including linear polarization effects, for arbitrary shaped objects. Thus, our novel approach permits a non-destructive, disturbance-free measurement with control of the orientation and location of the scattering object.

  16. Design of remote laser-induced fluorescence system's acquisition circuit

    Science.gov (United States)

    Wang, Guoqing; Lou, Yue; Wang, Ran; Yan, Debao; Li, Xin; Zhao, Xin; Chen, Dong; Zhao, Qi

    2017-10-01

    Laser-induced fluorescence system(LIfS) has been found its significant application in identifying one kind of substance from another by its properties even it's thimbleful, and becomes useful in plenty of fields. Many superior works have reported LIfS' theoretical analysis , designs and uses. However, the usual LIPS is always constructed in labs to detect matter quite closely, for the system using low-power laser as excitation source and charge coupled device (CCD) as detector. Promoting the detectivity of LIfS is of much concern to spread its application. Here, we take a high-energy narrow-pulse laser instead of commonly used continuous wave laser to operate sample, thus we can get strong fluorescent. Besides, photomultiplier (PMT) with high sensitivity is adopted in our system to detect extremely weak fluorescence after a long flight time from the sample to the detector. Another advantage in our system, as the fluorescence collected into spectroscopy, multiple wavelengths of light can be converted to the corresponding electrical signals with the linear array multichannel PMT. Therefore, at the cost of high-powered incentive and high-sensitive detector, a remote LIFS is get. In order to run this system, it is of importance to turn light signal to digital signal which can be processed by computer. The pulse width of fluorescence is deeply associated with excitation laser, at the nanosecond(ns) level, which has a high demand for acquisition circuit. We design an acquisition circuit including, I/V conversion circuit, amplifying circuit and peak-holding circuit. The simulation of circuit shows that peak-holding circuit can be one effective approach to reducing difficulty of acquisition circuit.

  17. A readout system for the wavelength-shifting optical module

    Energy Technology Data Exchange (ETDEWEB)

    Foesig, Carl-Christian; Boeser, Sebastian [Johannes Gutenberg-Universitaet, Mainz (Germany); Collaboration: IceCube-Collaboration

    2016-07-01

    The success of IceCube and the plans for an IceCube-Gen2 stimulate the development of new photo sensors. The approach of the Wavelength-shifting Optical Module is to provide a device which has a low dark noise rate combined with a high detection efficiency. A small PMT is used to detect red shifted photons guided in a coated PMMA tube, originally emitted by a wavelength shifting coating that absorbs photons in the UV Region. We have studied several PMTs for their usability with the IceCube-Gen2 readout system. Relevant parameters are the pulse widths in relation to the bandwidth of the IceCube-Gen2 readout electronics and the dark noise rates.

  18. The LUCID detector ATLAS luminosity monitor and its electronic system

    CERN Document Server

    AUTHOR|(INSPIRE)INSPIRE-00378808; The ATLAS collaboration

    2016-01-01

    Starting from 2015 LHC is performing a new run, at higher center of mass energy (13 TeV) and with 25 ns bunch-spacing. The ATLAS luminosity monitor LUCID has been completely renewed, both on detector design and in the electronics, in order to cope with the new running conditions. The new detector electronics is presented, featuring a new read-out board (LUCROD), for signal acquisition and digitization, PMT-charge integration and single-side luminosity measurements, and the revisited LUMAT board for side-A-side-C combination. The contribution covers the new boards design, the firmware and software developments, the implementation of luminosity algorithms, the optical communication between boards and the integration into the ATLAS TDAQ system.

  19. LSNR Airborne LIDAR Mapping System Design and Early Results (Invited)

    Science.gov (United States)

    Shrestha, K.; Carter, W. E.; Slatton, K. C.

    2009-12-01

    Low signal-to-noise ratio (LSNR) detection techniques allow for implementation of airborne light detection and range (LIDAR) instrumentation aboard platforms with prohibitive power, size, and weight restrictions. The University of Florida has developed the Coastal Area Tactical-mapping System (CATS), a prototype LSNR LIDAR system capable of single photon laser ranging. CATS is designed to operate in a fixed-wing aircraft flying 600 m above ground level, producing 532 nm, 480 ps, 3 μJ output pulses at 8 kHz. To achieve continuous coverage of the terrain with 20 cm spatial resolution in a single pass, a 10x10 array of laser beamlets is scanned. A Risley prism scanner (two rotating V-coated optical wedges) allows the array of laser beamlets to be deflected in a variety of patterns, including conical, spiral, and lines at selected angles to the direction of flight. Backscattered laser photons are imaged onto a 100 channel (10x10 segmented-anode) photomultiplier tube (PMT) with a micro-channel plate (MCP) amplifier. Each channel of the PMT is connected to a multi-stop 2 GHz event timer. Here we report on tests in which ranges for known targets were accumulated for repeated laser shots and statistical analyses were applied to evaluate range accuracy, minimum separation distance, bathymetric mapping depth, and atmospheric scattering. Ground-based field test results have yielded 10 cm range accuracy and sub-meter feature identification at variable scan settings. These experiments also show that a secondary surface can be detected at a distance of 15 cm from the first. Range errors in secondary surface identification for six separate trials were within 7.5 cm, or within the timing resolution limit of the system. Operating at multi-photon sensitivity may have value for situations in which high ambient noise precludes single-photon sensitivity. Low reflectivity targets submerged in highly turbid waters can cause detection issues. CATS offers the capability to adjust the

  20. A new FPGA-based time-over-threshold system for the time of flight detectors at the BGO-OD experiment

    Energy Technology Data Exchange (ETDEWEB)

    Freyermuth, Oliver [Physikalisches Institut, Nussallee 12, D-53115 Bonn (Germany); Collaboration: BGO-OD-Collaboration

    2015-07-01

    The BGO-OD experiment at the ELSA accelerator facility at Bonn is built for the systematic investigation of meson photoproduction in the GeV region. It features the unique combination of a central, highly segmented BGO crystal calorimeter covering almost 4π in acceptance and a forward magnetic spectrometer complemented by time of flight walls. The readout of the ToF scintillator bars was upgraded to an FPGA-based VME-board equipped with discriminator mezzanines including per-channel remotely adjustable thresholds. A firmware was developed combining a time-over-threshold (ToT) measurement by implementing a dual-edge TDC, a configurable meantimer trigger logic including a special cosmics trigger, adjustable input delays and gateable scalers, all inside a single electronics module. An experimentally obtained relation between ToT and slope of a PMT signal can be used for a time walk correction to achieve time resolutions comparable to a classical chain of CFD and standard TDC. Additionally, the time-over-threshold information can be exploited for gain matching and allows to monitor online the gain-stability and check for electronics problems such as pulse reflections or baseline jitter. The system is well-suited for a wide range of PMT-based fast detectors with many channels and further applications foreseen.

  1. A double photomultiplier Compton camera and its readout system for mice imaging

    Energy Technology Data Exchange (ETDEWEB)

    Fontana, Cristiano Lino [Physics Department Galileo Galilei, University of Padua, Via Marzolo 8, Padova 35131 (Italy) and INFN Padova, Via Marzolo 8, Padova 35131 (Italy); Atroshchenko, Kostiantyn [Physics Department Galileo Galilei, University of Padua, Via Marzolo 8, Padova 35131 (Italy) and INFN Legnaro, Viale dell' Universita 2, Legnaro PD 35020 (Italy); Baldazzi, Giuseppe [Physics Department, University of Bologna, Viale Berti Pichat 6/2, Bologna 40127, Italy and INFN Bologna, Viale Berti Pichat 6/2, Bologna 40127 (Italy); Bello, Michele [INFN Legnaro, Viale dell' Universita 2, Legnaro PD 35020 (Italy); Uzunov, Nikolay [Department of Natural Sciences, Shumen University, 115 Universitetska str., Shumen 9712, Bulgaria and INFN Legnaro, Viale dell' Universita 2, Legnaro PD 35020 (Italy); Di Domenico, Giovanni [Physics Department, University of Ferrara, Via Saragat 1, Ferrara 44122 (Italy) and INFN Ferrara, Via Saragat 1, Ferrara 44122 (Italy)

    2013-04-19

    We have designed a Compton Camera (CC) to image the bio-distribution of gamma-emitting radiopharmaceuticals in mice. A CC employs the 'electronic collimation', i.e. a technique that traces the gamma-rays instead of selecting them with physical lead or tungsten collimators. To perform such a task, a CC measures the parameters of the Compton interaction that occurs in the device itself. At least two detectors are required: one (tracker), where the primary gamma undergoes a Compton interaction and a second one (calorimeter), in which the scattered gamma is completely absorbed. Eventually the polar angle and hence a 'cone' of possible incident directions are obtained (event with 'incomplete geometry'). Different solutions for the two detectors are proposed in the literature: our design foresees two similar Position Sensitive Photomultipliers (PMT, Hamamatsu H8500). Each PMT has 64 output channels that are reduced to 4 using a charge multiplexed readout system, i.e. a Series Charge Multiplexing net of resistors. Triggering of the system is provided by the coincidence of fast signals extracted at the last dynode of the PMTs. Assets are the low cost and the simplicity of design and operation, having just one type of device; among drawbacks there is a lower resolution with respect to more sophisticated trackers and full 64 channels Readout. This paper does compare our design of our two-Hamamatsu CC to other solutions and shows how the spatial and energy accuracy is suitable for the inspection of radioactivity in mice.

  2. Insights into the molecular mechanisms of Polygonum multiflorum Thunb-induced liver injury: a computational systems toxicology approach.

    Science.gov (United States)

    Wang, Yin-Yin; Li, Jie; Wu, Zeng-Rui; Zhang, Bo; Yang, Hong-Bin; Wang, Qin; Cai, Ying-Chun; Liu, Gui-Xia; Li, Wei-Hua; Tang, Yun

    2017-05-01

    An increasing number of cases of herb-induced liver injury (HILI) have been reported, presenting new clinical challenges. In this study, taking Polygonum multiflorum Thunb (PmT) as an example, we proposed a computational systems toxicology approach to explore the molecular mechanisms of HILI. First, the chemical components of PmT were extracted from 3 main TCM databases as well as the literature related to natural products. Then, the known targets were collected through data integration, and the potential compound-target interactions (CTIs) were predicted using our substructure-drug-target network-based inference (SDTNBI) method. After screening for hepatotoxicity-related genes by assessing the symptoms of HILI, a compound-target interaction network was constructed. A scoring function, namely, Ascore, was developed to estimate the toxicity of chemicals in the liver. We conducted network analysis to determine the possible mechanisms of the biphasic effects using the analysis tools, including BiNGO, pathway enrichment, organ distribution analysis and predictions of interactions with CYP450 enzymes. Among the chemical components of PmT, 54 components with good intestinal absorption were used for analysis, and 2939 CTIs were obtained. After analyzing the mRNA expression data in the BioGPS database, 1599 CTIs and 125 targets related to liver diseases were identified. In the top 15 compounds, seven with Ascore values >3000 (emodin, quercetin, apigenin, resveratrol, gallic acid, kaempferol and luteolin) were obviously associated with hepatotoxicity. The results from the pathway enrichment analysis suggest that multiple interactions between apoptosis and metabolism may underlie PmT-induced liver injury. Many of the pathways have been verified in specific compounds, such as glutathione metabolism, cytochrome P450 metabolism, and the p53 pathway, among others. Hepatitis symptoms, the perturbation of nine bile acids and yellow or tawny urine also had corresponding pathways

  3. Improvement of Equipment reliability for Auxiliary Feed Water System

    Energy Technology Data Exchange (ETDEWEB)

    Deok, Lee Sang; Kwan, Lee Yong [KEPCO International Nuclear Graduate School, Ulsan (Korea, Republic of)

    2013-10-15

    According to AP913 ER) of INPO, Number of the event related to equipment is higher than others like external or human performance. In the top 25 systems, Auxiliary feed water system is the seventh highest among systems. AWFS consists of many component and complex system and Main Function of AFWS is to supply feedwater to the steam generators for the removal of heat from the RCS(Reactor Coolant System) in event the main feedwater system is unavailable following a transient or accident. Reliability of component means how well operate on demands and monitoring is necessary to keep track of condition of component. If component performance is lower than the required value, corrective action for failure mode should be done. The objective of this study is focused to improve of AF pump by adding the tasks of SHR(System Health Report) into the task of system engineer walkdown of PMT(Preventive Maintenance Template). Increasing the reliability of AF pump will contribute to improvement of reliability of AFWS. Based on operating history, there was high vibration of AF pump during performance test. In that case, there were a lot of maintenance works for normal operation of AF pump. Vibration problem related pump can't be detected by tasks of SE walkdown because it's not running during normal operation except for surveillance test. CHR(Component Health Report) of AF pump in AFWS can be made from necessary part which means monitoring and functional failure because problem of Stand-by pump can be covered by conducting monitoring and analysis of functional failure. To improve reliability of AF pump, walkdown of PMT and SHR should be conducted both in accordance with surveillance test frequency. Health of AF pump based on operation history can be verified first and then can find out which parts of pump are weak. Finally, weak part can be managed intensively and failure can be reduced according to SE walkdown. But this work can be risky and burdensome because all parts of

  4. Design and simulations for RFPI system test jig

    International Nuclear Information System (INIS)

    Keshwani, Rajesh; Khole, Shailesh; Sujo, C.I.; Shukla, Hitesh; Afaash, M.; Bharade, Sandeep; Joshi, Gopal

    2015-01-01

    RFPI system for condition monitoring and protection of RF systems of LEHIPA has been designed. The intention of this system is to protect and monitor different high power RF components. The system consists of variety of analog and digital cards to process, acquire and monitor signals from RF sensors, photo multiplier tubes (PMT), field emission probes, photo sensors, etc. The system can also accept and process digital inputs or contacts and analog input signals from other subsystems, indicating their status. It comprises of analog signal processing electronics, condition monitoring, data acquisition and fault reporting features. Since RFPI system should process and take action within prescribed time limit, the testing of system is critical issue. In order to carry out stand-alone field testing of such elaborate electronic system, variety of carefully designed electronic test circuit with suitable rangeability is required. These include fast current sources, fast amplifiers, fast rectifiers, etc. This paper elaborates on specifications, design approach, circuit design and simulations for various circuits used in test jig

  5. The LCLS Undulator Beam Loss Monitor Readout System

    Energy Technology Data Exchange (ETDEWEB)

    Dusatko, John; Browne, M.; Fisher, A.S.; Kotturi, D.; Norum, S.; Olsen, J.; /SLAC

    2012-07-23

    The LCLS Undulator Beam Loss Monitor System is required to detect any loss radiation seen by the FEL undulators. The undulator segments consist of permanent magnets which are very sensitive to radiation damage. The operational goal is to keep demagnetization below 0.01% over the life of the LCLS. The BLM system is designed to help achieve this goal by detecting any loss radiation and indicating a fault condition if the radiation level exceeds a certain threshold. Upon reception of this fault signal, the LCLS Machine Protection System takes appropriate action by either halting or rate limiting the beam. The BLM detector consists of a PMT coupled to a Cherenkov radiator located near the upstream end of each undulator segment. There are 33 BLMs in the system, one per segment. The detectors are read out by a dedicated system that is integrated directly into the LCLS MPS. The BLM readout system provides monitoring of radiation levels, computation of integrated doses, detection of radiation excursions beyond set thresholds, fault reporting and control of BLM system functions. This paper describes the design, construction and operational performance of the BLM readout system.

  6. The electronics readout and data acquisition system of the KM3NeT neutrino telescope node

    Energy Technology Data Exchange (ETDEWEB)

    Real, Diego [IFIC, Instituto de Física Corpuscular, CSIC-Universidad de Valencia, C/Catedrático José Beltrán, 2, 46980 Paterna (Spain); Collaboration: KM3NeT Collaboration

    2014-11-18

    The KM3NeT neutrino telescope will be composed by tens of thousands of glass spheres, called Digital Optical Module (DOM), each of them containing 31 PMTs of small photocathode area (3'). The readout and data acquisition system of KM3NeT have to collect, treat and send to shore, in an economic way, the enormous amount of data produced by the photomultipliers and at the same time to provide time synchronization between each DOM at the level of 1 ns. It is described in the present article the Central Logic Board, that integrates the Time to Digital Converters and the White Rabbit protocol used for the DOM synchronization in a transparent way, the Power Board used in the DOM, the PMT base to readout the photomultipliers and the respective collecting boards, the so called Octopus Board.

  7. The electronics readout and data acquisition system of the KM3NeT neutrino telescope node

    International Nuclear Information System (INIS)

    Real, Diego

    2014-01-01

    The KM3NeT neutrino telescope will be composed by tens of thousands of glass spheres, called Digital Optical Module (DOM), each of them containing 31 PMTs of small photocathode area (3'). The readout and data acquisition system of KM3NeT have to collect, treat and send to shore, in an economic way, the enormous amount of data produced by the photomultipliers and at the same time to provide time synchronization between each DOM at the level of 1 ns. It is described in the present article the Central Logic Board, that integrates the Time to Digital Converters and the White Rabbit protocol used for the DOM synchronization in a transparent way, the Power Board used in the DOM, the PMT base to readout the photomultipliers and the respective collecting boards, the so called Octopus Board

  8. Systems

    International Nuclear Information System (INIS)

    Anon.

    1980-01-01

    Papers in this session describe the concept of mined geologic disposal system and methods for ensuring that the system, when developed, will meet all technical requirements. Also presented in the session are analyses of system parameters, such as cost and nuclear criticality potential, as well as a technical analysis of a requirement that the system permit retrieval of the waste for some period of time. The final paper discusses studies under way to investigate technical alternatives or complements to the mined geologic disposal system. Titles of the presented papers are: (1) Waste Isolation System; (2) Waste Isolation Economics; (3) BWIP Technical Baseline; (4) Criticality Considerations in Geologic Disposal of High-Level Waste; (5) Retrieving Nuclear Wastes from Repository; (6) NWTS Programs for the Evaluation of Technical Alternatives or Complements to Mined Geologic Repositories - Purpose and Objectives

  9. systems

    Directory of Open Access Journals (Sweden)

    Alexander Leonessa

    2000-01-01

    Full Text Available A nonlinear robust control-system design framework predicated on a hierarchical switching controller architecture parameterized over a set of moving nominal system equilibria is developed. Specifically, using equilibria-dependent Lyapunov functions, a hierarchical nonlinear robust control strategy is developed that robustly stabilizes a given nonlinear system over a prescribed range of system uncertainty by robustly stabilizing a collection of nonlinear controlled uncertain subsystems. The robust switching nonlinear controller architecture is designed based on a generalized (lower semicontinuous Lyapunov function obtained by minimizing a potential function over a given switching set induced by the parameterized nominal system equilibria. The proposed framework robustly stabilizes a compact positively invariant set of a given nonlinear uncertain dynamical system with structured parametric uncertainty. Finally, the efficacy of the proposed approach is demonstrated on a jet engine propulsion control problem with uncertain pressure-flow map data.

  10. Characterization of the Pichia pastoris protein-O-mannosyltransferase gene family.

    Directory of Open Access Journals (Sweden)

    Juergen H Nett

    Full Text Available The methylotrophic yeast, Pichiapastoris, is an important organism used for the production of therapeutic proteins. However, the presence of fungal-like glycans, either N-linked or O-linked, can elicit an immune response or enable the expressed protein to bind to mannose receptors, thus reducing their efficacy. Previously we have reported the elimination of β-linked glycans in this organism. In the current report we have focused on reducing the O-linked mannose content of proteins produced in P. pastoris, thereby reducing the potential to bind to mannose receptors. The initial step in the synthesis of O-linked glycans in P. pastoris is the transfer of mannose from dolichol-phosphomannose to a target protein in the yeast secretory pathway by members of the protein-O-mannosyltransferase (PMT family. In this report we identify and characterize the members of the P. pastoris PMT family. Like Candida albicans, P. pastoris has five PMT genes. Based on sequence homology, these PMTs can be grouped into three sub-families, with both PMT1 and PMT2 sub-families possessing two members each (PMT1 and PMT5, and PMT2 and PMT6, respectively. The remaining sub-family, PMT4, has only one member (PMT4. Through gene knockouts we show that PMT1 and PMT2 each play a significant role in O-glycosylation. Both, by gene knockouts and the use of Pmt inhibitors we were able to significantly reduce not only the degree of O-mannosylation, but also the chain-length of these glycans. Taken together, this reduction of O-glycosylation represents an important step forward in developing the P. pastoris platform as a suitable system for the production of therapeutic glycoproteins.

  11. Arf6-Dependent Intracellular Trafficking of Pasteurella multocida Toxin and pH-Dependent Translocation from Late Endosomes

    Directory of Open Access Journals (Sweden)

    Tracy P. M. Chong

    2011-03-01

    Full Text Available The potent mitogenic toxin from Pasteurella multocida (PMT is the major virulence factor associated with a number of epizootic and zoonotic diseases caused by infection with this respiratory pathogen. PMT is a glutamine-specific protein deamidase that acts on its intracellular G-protein targets to increase intracellular calcium, cytoskeletal, and mitogenic signaling. PMT enters cells through receptor-mediated endocytosis and then translocates into the cytosol through a pH-dependent process that is inhibited by NH4Cl or bafilomycin A1. However, the detailed mechanisms that govern cellular entry, trafficking, and translocation of PMT remain unclear. Co-localization studies described herein revealed that while PMT shares an initial entry pathway with transferrin (Tfn and cholera toxin (CT, the trafficking pathways of Tfn, CT, and PMT subsequently diverge, as Tfn is trafficked to recycling endosomes, CT is trafficked retrograde to the ER, and PMT is trafficked to late endosomes. Our studies implicate the small regulatory GTPase Arf6 in the endocytic trafficking of PMT. Translocation of PMT from the endocytic vesicle occurs through a pH-dependent process that is also dependent on both microtubule and actin dynamics, as evidenced by inhibition of PMT activity in our SRE-based reporter assay, with nocodazole and cytochalasin D, respectively, suggesting that membrane translocation and cytotoxicity of PMT is dependent on its transfer to late endosomal compartments. In contrast, disruption of Golgi-ER trafficking with brefeldin A increased PMT activity, suggesting that inhibiting PMT trafficking to non-productive compartments that do not lead to translocation, while promoting formation of an acidic tubulovesicle system more conducive to translocation, enhances PMT translocation and activity.

  12. The CMS Beam Halo Monitor Detector System

    CERN Document Server

    CMS Collaboration

    2015-01-01

    A new Beam Halo Monitor (BHM) detector system has been installed in the CMS cavern to measure the machine-induced background (MIB) from the LHC. This background originates from interactions of the LHC beam halo with the final set of collimators before the CMS experiment and from beam gas interactions. The BHM detector uses the directional nature of Cherenkov radiation and event timing to select particles coming from the direction of the beam and to suppress those originating from the interaction point. It consists of 40 quartz rods, placed on each side of the CMS detector, coupled to UV sensitive PMTs. For each bunch crossing the PMT signal is digitized by a charge integrating ASIC and the arrival time of the signal is recorded. The data are processed in real time to yield a precise measurement of per-bunch-crossing background rate. This measurement is made available to CMS and the LHC, to provide real-time feedback on the beam quality and to improve the efficiency of data taking. In this talk we will describ...

  13. New development of EPICS based data acquisition system for H-Alpha diagnostic

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Taegu, E-mail: glory@nfri.re.kr; Lee, Woongryol; Son, Souhun; Park, Jinseop

    2015-10-15

    Highlights: • The H-Alpha DAQ system was modified to measure the low current signal from the PMT. • We developed a new H-Alpha data acquisition system with a CPCI based digitizer. • We developed a signal conditioning box for converting the current to voltage. • The new signal condition box (SCB) has three input range level (400 nA, 1 μA and 2 μA). • It was successfully performed and stably operates more than the previous DAQ system. - Abstract: The H-Alpha diagnostic system has been developed to measure the line integrated intensity in the direction of toroidal and poloidal. The data acquisition (DAQ) system for H-Alpha diagnostics of the Korea Superconducting Tokamak Advanced Research (KSTAR) at the beginning of the first plasma in 2008 was developed with VME form factor digitizer in the Linux OS platform. The VME digitizer module of H-Alpha data acquisition system was modified to measure the low current signal from the photo-multiplier tubes (PMT). The input maximum current values of modified digitizer module are 400 nA and low current data is expressed as the value of the voltage between −10 V and +10 V. At first time, there was no problem to measure H-Alpha signal, but it could not measure the H-Alpha data signal as the KSTAR Plasma density increased. It exceeds digitizer input range, which means the H-Alpha signal is over 400 nA, so we should manually change the resistor on the digitizer board to measure the 400 nA over current. This is not easy to do and showed instability in the long time operation with high sampling data acquisition. In order to overcome these weak points, a new H-Alpha data acquisition system has been developed with a compact PCI (cPCI) based digitizer and a signal conditioning box for converting the current to voltage in the Linux OS platform. The new data acquisition system was developed based on Experimental Physics and Industrial Control System (EPICS) framework like other KSTAR diagnostics with standard framework (SFW

  14. Nuclear safety and radiation protection report of Chooz nuclear facilities - 2012

    International Nuclear Information System (INIS)

    2013-01-01

    This safety report was established in accordance with articles L. 125-15 and L. 125-16 of the French environmental code. It presents, first, the NPPs (INBs no. 139, 144 and 163 (under dismantling)). Then, the nuclear safety and radiation protection measures taken regarding the facilities are reviewed: nuclear safety definition, radiation protection of intervening parties, safety and radiation protection improvement paths, crisis management, external and internal controls, technical situation of facilities, administrative procedures in progress. The incidents and accidents which occurred in 2012, if any, are reported as well as the radioactive and non-radioactive effluents discharge in the environment. Finally, the radioactive materials and wastes generated by the facility are presented (type of waste, quantities, conditioning process). The document concludes with a presentation of the actions of communication and public information made by the direction of the facility. A glossary and the list of recommendations from the Committees for health, safety and working conditions are given in appendix. (J.S.)

  15. Nuclear safety and radiation protection report of the Chooz nuclear facilities - 2014

    International Nuclear Information System (INIS)

    2015-01-01

    This safety report was established in accordance with articles L. 125-15 and L. 125-16 of the French environmental code. It presents, first, the NPPs (INBs no. 139, 144 and 163 (under dismantling)). Then, the nuclear safety and radiation protection measures taken regarding the facilities are reviewed: nuclear safety definition, radiation protection of intervening parties, safety and radiation protection improvement paths, crisis management, external and internal controls, technical situation of facilities, administrative procedures in progress. The incidents and accidents which occurred in 2014, if any, are reported as well as the radioactive and non-radioactive effluents discharge in the environment. Finally, the radioactive materials and wastes generated by the facility are presented (type of waste, quantities, conditioning process). The document concludes with a presentation of the actions of communication and public information made by the direction of the facility. A glossary and the list of recommendations from the Committees for health, safety and working conditions are given in appendix

  16. Nuclear safety and radiation protection report of the Chooz nuclear facilities - 2013

    International Nuclear Information System (INIS)

    2014-01-01

    This safety report was established in accordance with articles L. 125-15 and L. 125-16 of the French environmental code. It presents, first, the NPPs (INBs no. 139, 144 and 163 (under dismantling)). Then, the nuclear safety and radiation protection measures taken regarding the facilities are reviewed: nuclear safety definition, radiation protection of intervening parties, safety and radiation protection improvement paths, crisis management, external and internal controls, technical situation of facilities, administrative procedures in progress. The incidents and accidents which occurred in 2013, if any, are reported as well as the radioactive and non-radioactive effluents discharge in the environment. Finally, the radioactive materials and wastes generated by the facility are presented (type of waste, quantities, conditioning process). The document concludes with a presentation of the actions of communication and public information made by the direction of the facility. A glossary and the list of recommendations from the Committees for health, safety and working conditions are given in appendix

  17. SYSTEM

    Directory of Open Access Journals (Sweden)

    K. Swarnalatha

    2013-01-01

    Full Text Available Risk analysis of urban aquatic systems due to heavy metals turns significant due to their peculiar properties viz. persis tence, non-degradab ility, toxicity, and accumulation. Akkulam Veli (AV, an urba n tropical lake in south India is subjected to various environmental stresses due to multiple waste discharge, sand mining, developmental activities, tour ism related activitie s etc. Hence, a comprehensive approach is adopted for risk assessment using modified degree of contamination factor, toxicity units based on numerical sediment quality guidelines (SQGs, and potentialecological risk indices. The study revealed the presence of toxic metals such as Cr, C d, Pb and As and the lake is rated under ‘low ecological risk’ category.

  18. Improvements in detection system for pulse radiolysis facility

    CERN Document Server

    Rao, V N; Manimaran, P; Mishra, R K; Mohan, H; Mukherjee, T; Nadkarni, S A; Sapre, A V; Shinde, S J; Toley, M

    2002-01-01

    This report describes the improvements made in the detection system of the pulse radiolysis facility based on a 7 MeV Linear Electron Accelerator (LINAC) located in the Radiation Chemistry and Chemical Dynamics Division of Bhabha Atomic Research Centre. The facility was created in 1986 for kinetic studies of transient species whose absorption lies between 200 and 700 nm. The newly developed detection circuits consist of a silicon (Si) photodiode (PD) detector for the wavelength range 450-1100 nm and a germanium (Ge) photodiode detector for the wavelength range 900-1600 nm. With these photodiode-based detection set-up, kinetic experiments are now routinely carried out in the wavelength range 450-1600 nm. The performance of these circuits has been tested using standard chemical systems. The rise time has been found to be 150 ns. The photo-multiplier tube (PMT) bleeder circuit has been modified. A new DC back-off circuit has been built and installed in order to avoid droop at longer time scales. A steady baselin...

  19. Environmental Measurement While Drilling System for Real-Time Field Screening of Contaminants

    International Nuclear Information System (INIS)

    Lockwood, G.J.; Normann, R.A.; Williams, C.V.

    1999-01-01

    -thallium activated crystal coupled to a photomultiplier tube (PMT). The output of the PMT goes to a multichannel analyzer (MCA).The MCA data is transmitted to the surface via a signal conditioning and transmitter board similar to that used with the GMT. The EMWD system is described and the results of the GRS field tests and field demonstration are presented

  20. A multichannel front end ASIC for PMT readout in LHAASO WCDA

    Science.gov (United States)

    Liang, Y.; Zhao, L.; Guo, Y.; Qin, J.; Yang, Y.; Cheng, B.; Liu, S.; An, Q.

    2018-01-01

    Time and charge measurements over a large dynamic range from 1 Photo Electron (P.E.) to 4000 P.E. are required for the Water Cherenkov Detector Array (WCDA), which is one of the key components in the Large High Altitude Air Shower Observatory (LHAASO). To simplify the circuit structure of the readout electronics, a front end ASIC was designed. Based on the charge-to-time conversion method, the output pulse width of the ASIC corresponds to the input signal charge information while time information of the input signal is picked off through a discriminator, and thus the time and charge information can be digitized simultaneously using this ASIC and a following Time-to-Digital Converter (TDC). To address the challenge of mismatch among the channels observed in the previous prototype version, this work presents approaches for analyzing the problem and optimizing the circuits. A new version of the ASIC was designed and fabricated in the GLOBALFOUNDRIES 0.35 μm CMOS technology, which integrates 6 channels (corresponding to the readout of the 3 PMTs) in each chip. The test results indicate that the mismatch between the channels is significantly reduced to less than 20% using the proposed approach. The time measurement resolution better than 300 ps is achieved, and the charge measurement resolution is better than 10% at 1 P.E., and 1% at 4000 P.E., which meets the application requirements.

  1. Multi-PMT optical module for the KM3NeT neutrino telescope

    NARCIS (Netherlands)

    Kavatsyuk, O.; Dorosti-Hasankiadeh, Q.; Löhner, H.

    2012-01-01

    The future cubic kilometre scale neutrino telescope KM3NeT will employ a novel type of a Digital Optical Module (DOM), developed during the recent FP6 Design Study. A pressure-resistant glass sphere hosts 31 photomultiplier tubes (PMTs) of 3-in, diameter, together with all the electronics for

  2. Using the EPRI Risk-Informed ISI Methodology on Piping Systems in Forsmark 3

    Energy Technology Data Exchange (ETDEWEB)

    O' Regan, Patrick (Electric Power Research Inst., Knoxville, TN (United States)); Moody, Jim (JHM Consulting, Strafford (United States)); Loetman, Jan (Forsmarks Kraftgrupp AB (Sweden)); Sandstedt, Johan (Risk Pilot AB, Stockholm (Sweden))

    2010-12-15

    The objective of this project was a pilot plant demonstration of the EPRI RI-ISI Methodology to selected systems at Forsmark, Unit 3 (F3). This scope of this study encompasses five systems and is based upon F3 implementation of SKIFs guidance as well as other consideration as documented in the PMT program. As described in section 2, five systems were selected for evaluation. These systems were selected because they allow this project to focus on a number of issues of interest in developing a RI-ISI methodology and RI-ISI program. This includes the following: - Several different types of degradation may be identified, - Several different types of 'consequence of failure' may be identified, - Different types of safety systems are evaluated - Non-safety systems are evaluated Using the results of this application, insights and comparisons between SKIFS and the EPRI methodologies' are provided including the following: - Consequence of pressure boundary failure (PBF) as described in Section 3.14. - Degradation mechanism evaluation as described in Section 4.8. - Risk ranking as described in Section 5. - Element selection for inspection as described in Section 6. - Risk impact as described in Section 7

  3. Using the EPRI Risk-Informed ISI Methodology on Piping Systems in Forsmark 3

    International Nuclear Information System (INIS)

    O'Regan, Patrick; Moody, Jim; Loetman, Jan; Sandstedt, Johan

    2010-12-01

    The objective of this project was a pilot plant demonstration of the EPRI RI-ISI Methodology to selected systems at Forsmark, Unit 3 (F3). This scope of this study encompasses five systems and is based upon F3 implementation of SKIFs guidance as well as other consideration as documented in the PMT program. As described in section 2, five systems were selected for evaluation. These systems were selected because they allow this project to focus on a number of issues of interest in developing a RI-ISI methodology and RI-ISI program. This includes the following: - Several different types of degradation may be identified, - Several different types of 'consequence of failure' may be identified, - Different types of safety systems are evaluated - Non-safety systems are evaluated Using the results of this application, insights and comparisons between SKIFS and the EPRI methodologies' are provided including the following: - Consequence of pressure boundary failure (PBF) as described in Section 3.14. - Degradation mechanism evaluation as described in Section 4.8. - Risk ranking as described in Section 5. - Element selection for inspection as described in Section 6. - Risk impact as described in Section 7

  4. 4th International Conference on New Photo-Detectors

    CERN Document Server

    2016-01-01

    The purpose of this Conference is to discuss new ideas and recent developments in photo-detectors and their applications in various fields: high energy physics, neutrino physics, particle and astroparticle physics, nuclear physics, nuclear medicine and industry. The main topics of the Conference relate to APD, SiPM, PMT, Hybrid PMT, MCP-PMT, and electronics: front-end and readout of large systems.

  5. Design and testing of a unique active Compton-suppressed LaBr3(Ce) detector system for improved sensitivity assays of TRU in remote-handled TRU wastes

    Energy Technology Data Exchange (ETDEWEB)

    J. K. Hartwell; M. E. McIlwain; J. A. Kulisek

    2007-10-01

    The US Department of Energy’s transuranic (TRU) waste inventory includes about 4,500 m3 of remote-handled TRU (RH-TRU) wastes composed of a variety of containerized waste forms having a contact surface dose rate that exceeds 2 mSv/hr (200 mrem/hr) containing waste materials with a total TRU concentration greater than 3700 Bq/g (100 nCi/g). As part of a research project to investigate the use of active Compton-suppressed room-temperature gamma-ray detectors for direct non-destructive quantification of the TRU content of these RH-TRU wastes, we have designed and purchased a unique detector system using a LaBr3(Ce) primary detector and a NaI(Tl) suppression mantle. The LaBr3(Ce) primary detector is a cylindrical unit ~25 mm in diameter by 76 mm long viewed by a 38 mm diameter photomultiplier. The NaI(Tl) suppression mantle (secondary detector) is 175 mm by 175 mm with a center well that accommodates the primary detector. An important feature of this arrangement is the lack of any “can” between the primary and secondary detectors. These primary and secondary detectors are optically isolated by a thin layer (.003") of aluminized kapton, but the hermetic seal and thus the aluminum can surrounds the outer boundary of the detector system envelope. The hermetic seal at the primary detector PMT is at the PMT wall. This arrangement virtually eliminates the “dead” material between the primary and secondary detectors, a feature that preliminary modeling indicated would substantially improve the Compton suppression capability of this device. This paper presents both the expected performance of this unit determined from modeling with MCNPX, and the performance measured in our laboratory with radioactive sources.

  6. Time-resolved laser-induced fluorescence system

    Science.gov (United States)

    Bautista, F. J.; De la Rosa, J.; Gallegos, F. J.

    2006-02-01

    Fluorescence methods are being used increasingly in the measurement of species concentrations in gases, liquids and solids. Laser induced fluorescence is spontaneous emission from atoms or molecules that have been excited by laser radiation. Here we present a time resolved fluorescence instrument that consists of a 5 μJ Nitrogen laser (337.1 nm), a sample holder, a quartz optical fiber, a spectrometer, a PMT and a PC that allows the measurement of visible fluorescence spectra (350-750 nm). Time response of the system is approximately 5 ns. The instrument has been used in the measurement of colored bond paper, antifreeze, diesel, cochineal pigment and malignant tissues. The data acquisition was achieved through computer control of a digital oscilloscope (using General Purpose Interface Bus GPIB) and the spectrometer via serial (RS232). The instrument software provides a graphic interface that lets make some data acquisition tasks like finding fluorescence spectra, and fluorescence lifetimes. The software was developed using the Lab-View 6i graphic programming package and can be easily managed in order to add more functions to it.

  7. X-ray and gamma ray detector readout system

    Science.gov (United States)

    Tumer, Tumay O; Clajus, Martin; Visser, Gerard

    2010-10-19

    A readout electronics scheme is under development for high resolution, compact PET (positron emission tomography) imagers based on LSO (lutetium ortho-oxysilicate, Lu.sub.2SiO.sub.5) scintillator and avalanche photodiode (APD) arrays. The key is to obtain sufficient timing and energy resolution at a low power level, less than about 30 mW per channel, including all required functions. To this end, a simple leading edge level crossing discriminator is used, in combination with a transimpedance preamplifier. The APD used has a gain of order 1,000, and an output noise current of several pA/ Hz, allowing bipolar technology to be used instead of CMOS, for increased speed and power efficiency. A prototype of the preamplifier and discriminator has been constructed, achieving timing resolution of 1.5 ns FWHM, 2.7 ns full width at one tenth maximum, relative to an LSO/PMT detector, and an energy resolution of 13.6% FWHM at 511 keV, while operating at a power level of 22 mW per channel. Work is in progress towards integration of this preamplifier and discriminator with appropriate coincidence logic and amplitude measurement circuits in an ASIC suitable for a high resolution compact PET instrument. The detector system and/or ASIC can also be used for many other applications for medical to industrial imaging.

  8. The Monitoring and Calibration Web Systems for the ATLAS Tile Calorimeter Data Quality Analysis

    International Nuclear Information System (INIS)

    Sivolella, A; Maidantchik, C; Ferreira, F

    2012-01-01

    The Tile Calorimeter (TileCal) is one of the ATLAS sub-detectors. The read-out is performed by about 10,000 PhotoMultiplier Tubes (PMTs). The signal of each PMT is digitized by an electronic channel. The Monitoring and Calibration Web System (MCWS) supports the data quality analysis of the electronic channels. This application was developed to assess the detector status and verify its performance. It can provide to the user the list of TileCal known problematic channels, that is stored in the ATLAS condition database (COOL DB). The bad channels list guides the data quality validator in identifying new problematic channels and is used in data reconstruction and the system allows to update the channels list directly in the COOL database. MCWS can generate summary results, such as eta-phi plots and comparative tables of the masked channels percentage. Regularly, during the LHC (Large Hadron Collider) shutdown a maintenance of the detector equipments is performed. When a channel is repaired, its calibration constants stored in the COOL database have to be updated. Additionally MCWS system manages the update of these calibration constants values in the COOL database. The MCWS has been used by the Tile community since 2008, during the commissioning phase, and was upgraded to comply with ATLAS operation specifications. Among its future developments, it is foreseen an integration of MCWS with the TileCal control Web system (DCS) in order to identify high voltage problems automatically.

  9. MV-Switchgear Performance Evaluation of Electrical System at RSG-GAS after by Refunctioning

    International Nuclear Information System (INIS)

    T-Sulsistyo; T-Komarudin; Kiswanto; Y- Andriyanto

    2005-01-01

    Switchgear represents equipment link functioning to decide or connect source ration especial energy of PLN with building RSG-GAS distribution system burden. This system is provided with equipment circuit breaker (PMT) and disconnecting switch (PMS), which aim to the insulation, controlling, and protection electrical system RSG-GAS and equipment. Evaluation Method used by that is by perceiving nominal tension condition, nominal current, performance normal good switchgear in a condition, treatment and also trouble condition and also calculate change temperature effect of electric fire bow. Pursuant to calculation result, for the mean current 800 A, room; chamber temperature 24 o C, tension 24 kV, current disconnection time link to shorten 3 second, obtained temperature of equal to 90.5 o C (T1), and room temperature 40 o C obtained by temperature of equal to 108.5 o C (T2), so that of average temperature equal to 4.63 o C. While for the mean current 1250 A, room temperature 24 o C, tension 24 kV, current disconnection time link to shorten 3 second, obtained temperature equal to 282 o C (T1), and room temperature 40 o C obtained temperature equal to 298 o C (T2), so that average temperature equal to 4.0 o C. Result of evaluation job indicates that switchgear of electrical system RSG-GAS after re-functioning function goodness. (author)

  10. Correction of distortions in a discontinuous image

    International Nuclear Information System (INIS)

    Geagan, M.J.; Chase, B.B.; Muehllehner, G.

    1994-01-01

    Large area position-sensitive NaI detectors have been successfully applied to positron emission tomography (PET). Typical PET studies involve detector singles rates in excess of 500 kcps, which can lead to pile-up and image degradation as a function of countrate. Better high countrate performance can be achieved with a local centroid algorithm, in which the position of each event is calculated from a small group of photomultipliers (PMTs) immediately surrounding the PMT with the highest signal (the peak PMT). The local centroid contains most of the light from the scintillation. If a local centroid of only seven PMTs is used, the position resolution becomes quite stable at high countrates, however, discontinuities appear in the detector flood image as events cluster around each PMT. We therefore developed a method for distortion correction of a discontinuous flood image. For each PMT on the detector, a peak PMT domain is defined. The peak PMT domain is the area on the detector where that PMT could have the highest signal. The peak PMT domains overlap slightly, so that all combinations of peak PMT and position are represented. A collimated source is moved through a regular grid of points - a template - over each peak PMT region. A short collection is performed at each point, and the real and measured position data are recorded. For each point in the spatial range of a given PMT, distortion correction offsets are computed by interpolating between the data points which correspond to that PMT. This new method has been implemented and evaluated. System resolution has been measured at low and high countrates. The high countrate resolution is better with the new method, with no degradation in low countrate resolution. The axial sensitivity profile is also more stable at high countrates, compared to the previously developed method. 3-D brain phantom images show a clear improvement in image quality at high countrates. ((orig.))

  11. Construction of prototype of on-line analyzer detection system for coal on belt conveyor using neutron activation technique

    International Nuclear Information System (INIS)

    Rony Djokorayono; Agus Cahyono; MP Indarzah; SG Usep; Sukandar

    2015-01-01

    The use of on-line neutron activation technique for coal analysis is proposed as an alternative method for analysis based on sampling technique. Compared to this conventional technique, the on-line neutron activation technique has much shorter time of analysis and more accurate results. The construction of detection system prototype for the on-line analyzer is described in this paper. This on-line analyzer consists of detection system, data acquisition system, and computer console. This detection system comprises several modules, i.e. NaI(Tl) scintillation detector completed with a photomultiplier tube (PMT), pre-amplifier, single channel analyzer (SCA), and analog signal transmitter and pulse counter processor. The construction processes of these four modules include the development of configuration block, lay out, and selection of electronic components. The modules have been integrated and tested. This detection system was tested using radioactive element Zn-65 having energy of 1115.5 keV and activity of 1 μCi. The test results show that the prototype of the on-line analyzer detection system has functioned as expected. (author)

  12. Design and study of photomultiplier pulse-shaping amplifier powered by the current flowing through a voltage divider

    International Nuclear Information System (INIS)

    Vladimir Popov

    2003-01-01

    A new version of Photomultiplier Tube (PMT) pulse amplifier, entirely powered by the current flowing through the base voltage divider, was designed and tested. This amplifier was designed for application in the JLAB G0 Experiment E00-006 as a part of high voltage base for XP2262 Photonis PMT. According to JLAB G0 experiment requirement, these PMT's operate with plastic scintillators at high counting rate (about MHz). Tests in JLAB experimental Hall C indicate that low energy gamma background cause up to 0.1 mA of PMT average anode current (without amplifier). At this radiation condition, PMT gain decreases by 50% within about 1 month of operation. The amplifier needs to reduce PMT anode current and to shape PMT anode pulse prior to sending it through a long cable line (more then 400 ft of RG-213 and RG-58 coax cables). Shaping of the PMT output pulse helps to reduce attenuation effect of the long cable line without significant reduction of timing accuracy. The results of this study of designed amplifier and PMT plus amplifier system are presented

  13. The research of data acquisition system for Raman spectrometer

    Science.gov (United States)

    Cui, Xiao; Guo, Pan; Zhang, Yinchao; Chen, Siying; Chen, He; Chen, Wenbo

    2011-11-01

    Raman spectrometer has been widely used as an identification tool for analyzing material structure and composition in many fields. However, Raman scattering echo signal is very weak, about dozens of photons at most in one laser plus signal. Therefore, it is a great challenge to design a Raman spectrum data acquisition system which could accurately receive the weak echo signal. The system designed in this paper receives optical signals with the principle of photon counter and could detect single photon. The whole system consists of a photoelectric conversion module H7421-40 and a photo counting card including a field programmable gate array (FPGA) chip and a PCI9054 chip. The module H7421-40 including a PMT, an amplifier and a discriminator has high sensitivity on wavelength from 300nm to 720nm. The Center Wavelength is 580nm which is close to the excitation wavelength (532nm), QE 40% at peak wavelength, Count Sensitivity is 7.8*105(S-1PW-1) and Count Linearity is 1.5MHZ. In FPGA chip, the functions are divided into three parts: parameter setting module, controlling module, data collection and storage module. All the commands, parameters and data are transmitted between FPGA and computer by PCI9054 chip through the PCI interface. The result of experiment shows that the Raman spectrum data acquisition system is reasonable and efficient. There are three primary advantages of the data acquisition system: the first one is the high sensitivity with single photon detection capability; the second one is the high integrated level which means all the operation could be done by the photo counting card; and the last one is the high expansion ability because of the smart reconfigurability of FPGA chip.

  14. Development of continuous detectors for a high resolution animal PET system

    International Nuclear Information System (INIS)

    Siegel, S.; Cherry, S.R.; Ricci, A.R.; Shao, Y.; Phelps, M.E.

    1995-01-01

    The authors propose a design for a high resolution, gamma-camera style detector that is suitable for use in a positron emission tomograph dedicated to small animal research. Through Monte Carlo simulation the authors modeled the performance of a detector composed of one 76.2 x 76.2 x 8 mm thick LSO crystal coupled to a 3 in. square position sensitive photomultiplier tube (PS-PMT). The authors investigated the effect of optical coupling compounds, surface treatment and dept of interaction on the quantity (efficiency) and distribution (spread) of scintillation photons reaching the photocathode. They also investigated linearization of the position response. The authors propose a PET system consisting of fourteen of these detectors in 2 rings, yielding a 16 cm diameter by 15 cm long tomograph. It would operate in 3-D mode subtending a 68% solid angle to the center. The expected spatial resolution is (≤2 mm), with a system efficiency of ∼ 10% at the center (200 keV lower threshold) and a singles count rate capability of approximately 10 6 cps per detector

  15. Some activities in France related to life management of nuclear power plants

    International Nuclear Information System (INIS)

    Petrequin, P.

    1998-01-01

    Significant events concerned with life management of NPPs in France were: replacement of steam generators of TRICASTIN 1 NPP, defect detected in the emergency cooling system of DAMPIERRE 1 reactor and expertise of decommissioned CHOOZ A reactor. Programs in progress described in this report are: irradiation of materials for internal components and fracture toughness studies of irradiated materials

  16. Performance of waveform digitizers as a compact data acquisition system for the ISMRAN experiment

    International Nuclear Information System (INIS)

    Mitra, A.; Netrakanti, P.K.; Kashyap, V.K.S.; Behera, S.P.; Jha, V.; Mishra, D.K.; Pant, L.M.

    2016-01-01

    The Indian Scintillator Matrix for Reactor Anti-Neutrino (ISMRAN) detector is proposed at the Dhruva reactor, BARC, to measure the anti-neutrinos (υ-bar ) for the purpose of reactor monitoring and sterile neutrino search. A one ton detector, consisting of 100 plastic scintillator bars (10cm x 10cm x 100cm), wrapped with the Gadolinium (Gd) coated mylar foils and coupled with photomultiplier tubes (PMT) at both ends, is planned for this purpose. One of the key components for such an experiment is the development of a dedicated and economical data acquisition system (DAQ) for the detector setup. The FPGA based waveform digitizers are suitable for this purpose, where data from a large number of detectors need to be read out simultaneously. This effectively reduces the burden of the intermediate conventional pulse processing electronics between the detectors and the DAQ. We have procured the CAEN made 16 channel, model V1730, 14bit, 500 MS/s VME based waveform digitizers for this purpose. A series of measurements have been carried out to evaluate the performance of the digitizers. We are also working on the related auxiliary software and data format to be used extensively for ISMRAN DAQ

  17. Concept and design of an alignment monitoring system for the CBM RICH mirrors

    Energy Technology Data Exchange (ETDEWEB)

    Bendarouach, Jordan [Justus Liebig University (Germany); Collaboration: CBM-Collaboration

    2016-07-01

    The Compressed Baryonic Matter (CBM) experiment at the future FAIR (Facility for Antiproton and Ion Research) complex will investigate the phase diagram of strongly interacting matter at high baryon density and moderate temperatures in A+A collisions from 2-11 AGeV (SIS100) beam energy. One of the key detector components required for this CBM physics program is the RICH (Ring Imaging CHerenkov) detector, developed for efficient and clean electron identification and pion suppression. The detector consists of about 80 spherical glass mirror tiles, distributed over two sphere parts. An important aspect to guarantee a stable operation of the RICH detector is the alignment of the mirrors. A method originally developed and inspired by the HERA-B experiment uses recorded data to assess mirror alignment of the RICH mirror system. Measurements of Cherenkov distances and angles on the PMT plane may reveal potential misalignments of the considered tile. If mirror misalignment is revealed, it can be subsequently included and rectified by correction routines, which should mostly increase ring reconstruction as well as ring-track matching efficiencies. Results of this alignment method based on simulated events, reproducing potential mirror misalignments, its limits and first correction routines are presented.

  18. A Full Slice Test Version of a Tentative Upgraded Readout System for TileCal

    CERN Document Server

    Muschter, S; The ATLAS collaboration; Bohm, C; Eriksson, D; Kavianipour, H; Oreglia, M; Tang, F

    2011-01-01

    The upgrade plans on the ATLAS hadronic calorimeter (TileCal) include the full readout of all data to the counting room. In order to study functional requirements of the future upgraded TileCal readout system we have assembled a minimal TDAQ slice. The aim is to implement a tentative readout chain for TileCal, starting with a newly developed 3-in-1 FE-board from University of Chicago and ending with the storage of triggered data on a PC. Later we will use PMT pulses, amplified and shaped by the 3-in-1 board, as a data source. However, for simplicity we start by using well defined calibration pulses also generated by the 3-in-1 board. The pulses are sampled by a 12 bit ADC, which is connected to an ML605 evaluation board from XILINX. These boards emulate the new on-detector electronics. The ML605 communicates via two 5Gb/s optical links with a Virtex-6 FPGA development board from HighTech Global which emulates the off-detector electronics. The off-detector board is situated in a PC and uses PCIe for readout an...

  19. Implementation of 3D tomographic visualisation through planar ICT data from experimental gamma-ray tomographic system

    International Nuclear Information System (INIS)

    Umesh Kumar; Singh, Gursharan; Ravindran, V.R.

    2001-01-01

    Industrial Computed Tomography (ICT) is one of the latest methods of non-destructive testing and examination. Different prototypes of Computed Industrial Tomographic Imaging System (CITIS) have been developed and experimental data have been generated in Isotope Applications Division. The experimental gamma-rays based tomographic imaging system comprises of beam generator containing approx. 220 GBq (6 Curies) of 137 Cs, a single NaI(Tl) -PMT integral assembly in a thick shielding and associated electronics, stepper motor controlled mechanical manipulator, collimators and required software. CITIS data is normally acquired in one orientation of the sample. It may be sometimes required to view a tomographic plane in a different orientation. Also, 3D visualization may be required with the available 2D data set. All these can be achieved by processing the available data. We have customized some of the routines for this purpose provided IDL (Integrated Data Language) package to suit our requirements. The present paper discusses methodology adopted for this purpose with an illustrative example. (author)

  20. Analysis of time resolution in a dual head LSO+PSPMT PET system using low pass filter interpolation and digital constant fraction discriminator techniques

    International Nuclear Information System (INIS)

    Monzo, Jose M.; Lerche, Christoph W.; Martinez, Jorge D.; Esteve, Raul; Toledo, Jose; Gadea, Rafael; Colom, Ricardo J.; Herrero, Vicente; Ferrando, Nestor; Aliaga, Ramon J.; Mateo, Fernando; Sanchez, Filomeno; Mora, Francisco J.; Benlloch, Jose M.; Sebastia, Angel

    2009-01-01

    PET systems need good time resolution to improve the true event rate, random event rejection, and pile-up rejection. In this study we propose a digital procedure for this task using a low pass filter interpolation plus a Digital Constant Fraction Discriminator (DCFD). We analyzed the best way to implement this algorithm on our dual head PET system and how varying the quality of the acquired signal and electronic noise analytically affects timing resolution. Our detector uses two continuous LSO crystals with a position sensitive PMT. Six signals per detector are acquired using an analog electronics front-end and these signals are processed using an in-house digital acquisition board. The test bench developed simulates the electronics and digital algorithms using Matlab. Results show that electronic noise and other undesired effects have a significant effect on the timing resolution of the system. Interpolated DCFD gives better results than non-interpolated DCFD. In high noise environments, differences are reduced. An optimum delay selection, based on the environment noise, improves time resolution.

  1. Analysis of time resolution in a dual head LSO+PSPMT PET system using low pass filter interpolation and digital constant fraction discriminator techniques

    Energy Technology Data Exchange (ETDEWEB)

    Monzo, Jose M. [Digital Systems Design (DSD) Group, ITACA Institute, Universidad Politecnica de Valencia, Camino de Vera s/n, 46022 Valencia (Spain)], E-mail: jmonfer@aaa.upv.es; Lerche, Christoph W.; Martinez, Jorge D.; Esteve, Raul; Toledo, Jose; Gadea, Rafael; Colom, Ricardo J.; Herrero, Vicente; Ferrando, Nestor; Aliaga, Ramon J.; Mateo, Fernando [Digital Systems Design (DSD) Group, ITACA Institute, Universidad Politecnica de Valencia, Camino de Vera s/n, 46022 Valencia (Spain); Sanchez, Filomeno [Nuclear Medical Physics Group, IFIC Institute, Consejo Superior de Investigaciones Cientificas (CSIC), 46980 Paterna (Spain); Mora, Francisco J. [Digital Systems Design (DSD) Group, ITACA Institute, Universidad Politecnica de Valencia, Camino de Vera s/n, 46022 Valencia (Spain); Benlloch, Jose M. [Nuclear Medical Physics Group, IFIC Institute, Consejo Superior de Investigaciones Cientificas (CSIC), 46980 Paterna (Spain); Sebastia, Angel [Digital Systems Design (DSD) Group, ITACA Institute, Universidad Politecnica de Valencia, Camino de Vera s/n, 46022 Valencia (Spain)

    2009-06-01

    PET systems need good time resolution to improve the true event rate, random event rejection, and pile-up rejection. In this study we propose a digital procedure for this task using a low pass filter interpolation plus a Digital Constant Fraction Discriminator (DCFD). We analyzed the best way to implement this algorithm on our dual head PET system and how varying the quality of the acquired signal and electronic noise analytically affects timing resolution. Our detector uses two continuous LSO crystals with a position sensitive PMT. Six signals per detector are acquired using an analog electronics front-end and these signals are processed using an in-house digital acquisition board. The test bench developed simulates the electronics and digital algorithms using Matlab. Results show that electronic noise and other undesired effects have a significant effect on the timing resolution of the system. Interpolated DCFD gives better results than non-interpolated DCFD. In high noise environments, differences are reduced. An optimum delay selection, based on the environment noise, improves time resolution.

  2. Selección de Personal basada en la misión: Prosocial Motivation Test (PMT)

    OpenAIRE

    María C., Córdoba Llamas

    2017-01-01

    Las personas y su motivación son la clave de éxito de las empresas. Para que una empresa pueda mantenerse en un mundo globalizado de cambios continuos y alta competitividad es necesario que cuente con las personas adecuadas, ya que el capital humano se ha convertido en el capital más importante de las empresas, su capital diferencial. Pero, ¿qué quiere decir las “personas más adecuadas”? Revisando la bibliografía, se observa que las respuestas a esta pregunta responden a una preocupación tan ...

  3. Development of a new fast shower maximum detector based on microchannel plates photomultipliers (MCP-PMT) as an active element

    Energy Technology Data Exchange (ETDEWEB)

    Ronzhin, A., E-mail: ronzhin@fnal.gov [Fermilab, Batavia, IL 60510 (United States); Los, S.; Ramberg, E. [Fermilab, Batavia, IL 60510 (United States); Spiropulu, M.; Apresyan, A.; Xie, S. [California Institute of Technology, Pasadena, CA (United States); Kim, H. [University of Chicago, Chicago, IL 60637 (United States); Zatserklyaniy, A. [University of California, Santa Cruz, CA (United States)

    2014-09-21

    One possibility to make a fast and radiation resistant shower maximum (SM) detector is to use a secondary emitter as an active element. We present below test beam results, obtained with different types of photodetectors based on microchannel plates (MCPs) as the secondary emitter. We performed the measurements at the Fermilab Test Beam Facility with 120 GeV proton beam and 12 GeV and 32 GeV secondary beams. The goal of the measurement with 120 GeV protons was to determine time resolution for minimum ionizing particles (MIPs). The SM time resolution we obtained for this new type of detector is at the level of 20–30 ps. We estimate that a significant contribution to the detector response originates from secondary emission of the MCP. This work can be considered as the first step in building a new type of calorimeter based on this principle.

  4. Vertical profiles of atmospheric fluorescent aerosols observed by a mutil-channel lidar spectrometer system

    Science.gov (United States)

    Huang, Z.; Huang, J.; Zhou, T.; Sugimoto, N.; Bi, J.

    2015-12-01

    Zhongwei Huang1*, Jianping Huang1, Tian Zhou1, Nobuo Sugimoto2, Jianrong Bi1 and Jinsen Shi11Key Laboratory for Semi-Arid Climate Change of the Ministry of Education, College of Atmospheric Sciences, Lanzhou University, Lanzhou, China. 2Atmospheric Environment Division, National Institutes for Environmental Studies, Tsukuba, Japan Email: huangzhongwei@lzu.edu.cn Abstract Atmospheric aerosols have a significant impact on regional and globe climate. The challenge in quantifying aerosol direct radiative forcing and aerosol-cloud interactions arises from large spatial and temporal heterogeneity of aerosol concentrations, compositions, sizes, shape and optical properties (IPCC, 2007). Lidar offers some remarkable advantages for determining the vertical structure of atmospheric aerosols and their related optical properties. To investigate the characterization of atmospheric aerosols (especially bioaerosols) with high spatial and temporal resolution, we developed a Raman/fluorescence/polarization lidar system employed a multi-channel spectrometer, with capabilities of providing measurements of Raman scattering and laser-induced fluorescence excitation at 355 nm from atmospheric aerosols. Meanwhile, the lidar system operated polarization measurements both at 355nm and 532nm wavelengths, aiming to obtain more information of aerosols. It employs a high power pulsed laser and a received telescope with 350mm diameter. The receiver could simultaneously detect a wide fluorescent spectrum about 178 nm with spectral resolution 5.7 nm, mainly including an F/3.7 Crossed Czerny-Turner spectrograph, a grating (1200 gr/mm) and a PMT array with 32 photocathode elements. Vertical structure of fluorescent aerosols in the atmosphere was observed by the developed lidar system at four sites across northwest China, during 2014 spring field observation that conducted by Lanzhou University. It has been proved that the developed lidar could detect the fluorescent aerosols with high temporal and

  5. Program Management Tool

    Science.gov (United States)

    Gawadiak, Yuri; Wong, Alan; Maluf, David; Bell, David; Gurram, Mohana; Tran, Khai Peter; Hsu, Jennifer; Yagi, Kenji; Patel, Hemil

    2007-01-01

    The Program Management Tool (PMT) is a comprehensive, Web-enabled business intelligence software tool for assisting program and project managers within NASA enterprises in gathering, comprehending, and disseminating information on the progress of their programs and projects. The PMT provides planning and management support for implementing NASA programmatic and project management processes and requirements. It provides an online environment for program and line management to develop, communicate, and manage their programs, projects, and tasks in a comprehensive tool suite. The information managed by use of the PMT can include monthly reports as well as data on goals, deliverables, milestones, business processes, personnel, task plans, monthly reports, and budgetary allocations. The PMT provides an intuitive and enhanced Web interface to automate the tedious process of gathering and sharing monthly progress reports, task plans, financial data, and other information on project resources based on technical, schedule, budget, and management criteria and merits. The PMT is consistent with the latest Web standards and software practices, including the use of Extensible Markup Language (XML) for exchanging data and the WebDAV (Web Distributed Authoring and Versioning) protocol for collaborative management of documents. The PMT provides graphical displays of resource allocations in the form of bar and pie charts using Microsoft Excel Visual Basic for Application (VBA) libraries. The PMT has an extensible architecture that enables integration of PMT with other strategic-information software systems, including, for example, the Erasmus reporting system, now part of the NASA Integrated Enterprise Management Program (IEMP) tool suite, at NASA Marshall Space Flight Center (MSFC). The PMT data architecture provides automated and extensive software interfaces and reports to various strategic information systems to eliminate duplicative human entries and minimize data integrity

  6. In-treatment tests for the monitoring of proton and carbon-ion therapy with a large area PET system at CNAO

    Energy Technology Data Exchange (ETDEWEB)

    Rosso, V., E-mail: valeria.rosso@pi.infn.it [Department of Physics, University of Pisa and INFN, Pisa (Italy); Battistoni, G. [INFN Sezione di Milano, Milano (Italy); Belcari, N.; Camarlinghi, N. [Department of Physics, University of Pisa and INFN, Pisa (Italy); Ciocca, M. [Fondazione CNAO, Pavia (Italy); Collini, F. [Department of Physical Sciences, Earth and Environment, University of Siena and INFN, Pisa (Italy); Ferretti, S.; Kraan, A.C.; Lucenò, S. [Department of Physics, University of Pisa and INFN, Pisa (Italy); Molinelli, S.; Pullia, M. [Fondazione CNAO, Pavia (Italy); Sportelli, G.; Zaccaro, E.; Del Guerra, A. [Department of Physics, University of Pisa and INFN, Pisa (Italy)

    2016-07-11

    One of the most promising new radiotherapy techniques makes use of charged particles like protons and carbon ions, rather than photons. At present, there are more than 50 particle therapy centers operating worldwide, and many new centers are being constructed. Positron Emission Tomography (PET) is considered a well-established non-invasive technique to monitor range and delivered dose in patients treated with particle therapy. Nuclear interactions of the charged hadrons with the patient tissue lead to the production of β+ emitting isotopes (mainly {sup 15}O and {sup 11}C), that decay with a short lifetime producing a positron. The two 511 keV annihilation photons can be detected with a PET detector. In-beam PET is particularly interesting because it could allow monitoring the ions range also during dose delivery. A large area dual head PET prototype was built and tested. The system is based on an upgraded version of the previously developed DoPET prototype. Each head covers now 15×15 cm{sup 2} and is composed by 9 (3×3) independent modules. Each module consists of a 23×23 LYSO crystal matrix (2 mm pitch) coupled to H8500 PMT and is readout by custom front-end and a FPGA based data acquisition electronics. Data taken at the CNAO treatment facility in Pavia with proton and carbon beams impinging on heterogeneous phantoms demonstrate the DoPET capability to detect the presence of a small air cavity in the phantom.

  7. Review: two-photon scanning systems for clinical high resolution in vivo tissue imaging

    Science.gov (United States)

    König, K.; Müller, J.; Höfer, M.; Müller, C.; Weinigel, M.; Bückle, R.; Elsner, P.; Kaatz, M.; Messerschmidt, B.

    2008-02-01

    The femtosecond laser multiphoton tomograph DermaInspect as well as high NA two-photon GRIN microendoscopes for in vivo tomography of human skin have been used to detect malignant melanoma as well as to study the diffusion and intradermal accumulation of topically applied cosmetical and pharmaceutical components. So far, more than 500 patients and volunteers in Europe, Australia, and Asia have been investigated with this unique tomograph. Near infrared 80 MHz picojoule femtosecond laser pulses were employed to excite endogenous fluorophores such as NAD(P)H, flavoproteins, melanin, and elastin as well as fluorescent components of a variety of ointments via a twophoton excitation process. In addition, collagen has been imaged by second harmonic generation. Using a two-PMT detection system, the ratio of elastin to collagen was determined during optical sectioning. A high submicron spatial resolution and 50 picosecond temporal resolution was achieved using galvoscan mirrors and piezodriven focusing optics as well as a time-correlated single photon counting module with a fast microchannel plate detector and fast photomultipliers. Individual intratissue cells, mitochondria, melanosomes, and the morphology of the nuclei as well as extracellular matrix elements could be clearly visualized due to molecular imaging and the calculation of fluorescence lifetime images. Nanoparticles and intratissue drugs have been detected non-invasively, in situ and over a period of up to 3 months. In addition, hydration effects and UV effects were studied by monitoring modifications of cellular morphology and autofluorescence. The system was used to observe the diffusion through the stratum corneum and the accumulation and release of functionalized nanoparticles along hair shafts and epidermal ridges. The DermaInspect been also employed to gain information on skin age and wound healing in patients with ulcers. Novel developments include a galvo/piezo-scan driven flexible articulated arm as

  8. Basic performance of Mg co-doped new scintillator used for TOF-DOI-PET systems

    International Nuclear Information System (INIS)

    Kobayashi, Takahiro; Yamamoto, Seiichi; Okumura, Satoshi; Yeom, Jung Yeol; Kamada, Kei; Yoshikawa, Akira

    2017-01-01

    Phoswich depth-of-interaction (DOI) detectors utilizing multiple scintillators with different decay time are a useful device for developing a high spatial resolution, high sensitivity PET scanner. However, in order to apply pulse shape discrimination (PSD), there are not many combinations of scintillators for which phoswich technique can be implemented. Ce doped Gd_3Ga_3Al_2O_1_2 (GFAG) is a recently developed scintillator with a fast decay time. This scintillator is similar to Ce doped Gd_3Al_2Ga_3O_1_2 (GAGG), which is a promising scintillator for PET detector with high light yield. By stacking these scintillators, it may be possible to realize a high spatial resolution and high timing resolution phoswich DOI detector. Such phoswich DOI detector may be applied to time-of-flight (TOF) systems with high timing performance. Therefore, in this study, we tested the basic performance of the new scintillator –GFAG for use in a TOF phoswich detector. The measured decay time of a GFAG element of 2.9 mmx2.9 mmx10 mm in dimension, which was optically coupled to a photomultiplier tube (PMT), was faster (66 ns) than that of same sized GAGG (103 ns). The energy resolution of the GFAG element was 5.7% FWHM which was slightly worse than that of GAGG with 4.9% FWHM for 662 keV gamma photons without saturation correction. Then we assembled the GFAG and the GAGG crystals in the depth direction to form a 20 mm long phoswich element (GFAG/GAGG). By pulse shape analysis, the two types of scintillators were clearly resolved. Measured timing resolution of a pair of opposing GFAG/GAGG phoswich scintillator coupled to Silicon Photomultipliers (Si-PM) was good with coincidence resolving time of 466 ps FWHM. These results indicate that the GFAG combined with GAGG can be a candidate for TOF-DOI-PET systems.

  9. The Agr Quorum Sensing System Represses Persister Formation through Regulation of Phenol Soluble Modulins in Staphylococcus aureus

    Directory of Open Access Journals (Sweden)

    Tao Xu

    2017-11-01

    Full Text Available The opportunistic pathogen Staphylococcus aureus has become an increasing threat to public health. While the Agr quorum sensing (QS system is a master regulator of S. aureus virulence, its dysfunction has been frequently reported to promote bacteremia and mortality in clinical infections. Here we show that the Agr system is involved in persister formation in S. aureus. Mutation of either agrCA or agrD but not RNAIII resulted in increased persister formation of stationary phase cultures. RNA-seq analysis showed that in stationary phase AgrCA/AgrD and RNAIII mutants showed consistent up-regulation of virulence associated genes (lip and splE, etc. and down-regulation of metabolism genes (bioA and nanK, etc.. Meanwhile, though knockout of agrCA or agrD strongly repressed expression of phenol soluble modulin encoding genes psmα1-4, psmβ1-2 and phenol soluble modulins (PSM transporter encoding genes in the pmt operon, mutation of RNAIII enhanced expression of the genes. We further found that knockout of psmα1-4 or psmβ1-2 augmented persister formation and that co-overexpression of PSMαs and PSMβs reversed the effects of AgrCA mutation on persister formation. We also detected the effects on persister formation by mutations of metabolism genes (arcA, hutU, narG, nanK, etc. that are potentially regulated by Agr system. It was found that deletion of the ManNAc kinase encoding gene nanK decreased persister formation. Taken together, these results shed new light on the PSM dependent regulatory role of Agr system in persister formation and may have implications for clinical treatment of MRSA persistent infections.

  10. E3 Success Story - Plastic Molding Technology, Inc.

    Science.gov (United States)

    Customer surveys prompted PMT to address new areas which included sustainability issues and reduction goals for energy, water and solid wastes; they were looking for a way to link their reduction projects into their system.

  11. A computer based I and C to improve nuclear power plant operation and safety

    International Nuclear Information System (INIS)

    Appell, Bernard; Beltranda, Guy

    1995-01-01

    Chooz B1 is the head of 1400 MW N4 series (up to now, a programme of 4 identical units have been ordered) will be put on the French national grid this year (1995). Hot tests were performed last autumn. Loading fuel is scheduled in June 95. Chooz B2 will follow 6 months later. This nuclear power plant series is fully French designed. It comprises, compared to the former 1300 MW series, evolution concerning mainly the turbine, the steam generators, the primary pumps, the I and C and the man machine interface. A major improvement for the plant operation and safety is the computerised I and C which comprises the protection system (specific controllers), the process automation system (off the shelf equipment), the computer based and conventional man machine interfaces associated. These systems were put in service last year. This paper is focused on them. (author)

  12. Options and strategies in decontamination for decommissioning: after safe enclosure or directly after shutdown. Experiences in 2012; Opciones y Estrategias en Descontaminacion para el Desmantelamiento: Desmantelamiento aplazado o inmediato. Experiencias en 2012

    Energy Technology Data Exchange (ETDEWEB)

    Sempere Belda, L.; Topf, C.; Moreira do Amaral, J. P.

    2013-07-01

    During the last years AREVA has been performing numerous large scale chemical decontaminations, including the simultaneous decontamination of the complete primary circuit and auxiliary systems ('Full System Decontamination'). Three of them have were completed during the course of the last twelve months, in the nuclear power plants of Chooz A in France and of Unterweser and Neckarwestheim 1 in Germany. This paper compares the consequences for the performance of the decontamination derived from the different decommissioning philosophies adopted: Immediate decommissioning after ceasing operation in the case of Unterweser and Neckarwestheim 1, and delayed dismantlement after safe enclosure (SAFSTORE) in the case of Chooz A. The authors, responsible for the application and process control also from a technical point of view, comment on the results obtained and on the differences between these approaches.

  13. Analysis of Information Requirements and Design of the Consolidated AFIT Database and Information System (CADIS) with an AFIT/CI Implementation Design.

    Science.gov (United States)

    1982-12-01

    STUDENT INVOICES STUDENT UEADER (DI) VOUCHER NUMBER VOUCHER AMOUNT PMT CODE INCLUSI \\ DATES DATE-POSTED AMOUNT REQUESTED TE-. TYPE RE, AKS LINE FUN tI i...CODE INCLUSI ’ . DATES DATE POSTED AOUN_ REQUESTED TERM TYPE RE ,1KS LINE FUN

  14. A unique charge-coupled device/xenon arc lamp based imaging system for the accurate detection and quantitation of multicolour fluorescence.

    Science.gov (United States)

    Spibey, C A; Jackson, P; Herick, K

    2001-03-01

    In recent years the use of fluorescent dyes in biological applications has dramatically increased. The continual improvement in the capabilities of these fluorescent dyes demands increasingly sensitive detection systems that provide accurate quantitation over a wide linear dynamic range. In the field of proteomics, the detection, quantitation and identification of very low abundance proteins are of extreme importance in understanding cellular processes. Therefore, the instrumentation used to acquire an image of such samples, for spot picking and identification by mass spectrometry, must be sensitive enough to be able, not only, to maximise the sensitivity and dynamic range of the staining dyes but, as importantly, adapt to the ever changing portfolio of fluorescent dyes as they become available. Just as the available fluorescent probes are improving and evolving so are the users application requirements. Therefore, the instrumentation chosen must be flexible to address and adapt to those changing needs. As a result, a highly competitive market for the supply and production of such dyes and the instrumentation for their detection and quantitation have emerged. The instrumentation currently available is based on either laser/photomultiplier tube (PMT) scanning or lamp/charge-coupled device (CCD) based mechanisms. This review briefly discusses the advantages and disadvantages of both System types for fluorescence imaging, gives a technical overview of CCD technology and describes in detail a unique xenon/are lamp CCD based instrument, from PerkinElmer Life Sciences. The Wallac-1442 ARTHUR is unique in its ability to scan both large areas at high resolution and give accurate selectable excitation over the whole of the UV/visible range. It operates by filtering both the excitation and emission wavelengths, providing optimal and accurate measurement and quantitation of virtually any available dye and allows excellent spectral resolution between different fluorophores

  15. Interaction of promethazine and adiphenine to human hemoglobin: A comparative spectroscopic and computational analysis

    Science.gov (United States)

    Maurya, Neha; ud din Parray, Mehraj; Maurya, Jitendra Kumar; Kumar, Amit; Patel, Rajan

    2018-06-01

    The binding nature of amphiphilic drugs viz. promethazine hydrochloride (PMT) and adiphenine hydrochloride (ADP), with human hemoglobin (Hb) was unraveled by fluorescence, absorbance, time resolved fluorescence, fluorescence resonance energy transfer (FRET) and circular dichroism (CD) spectral techniques in combination with molecular docking and molecular dynamic simulation methods. The steady state fluorescence spectra indicated that both PMT and ADP quenches the fluorescence of Hb through static quenching mechanism which was further confirmed by time resolved fluorescence spectra. The UV-Vis spectroscopy suggested ground state complex formation. The activation energy (Ea) was observed more in the case of Hb-ADP than Hb-PMT interaction system. The FRET result indicates the high probability of energy transfer from β Trp37 residue of Hb to the PMT (r = 2.02 nm) and ADP (r = 2.33 nm). The thermodynamic data reveal that binding of PMT with Hb are exothermic in nature involving hydrogen bonding and van der Waal interaction whereas in the case of ADP hydrophobic forces play the major role and binding process is endothermic in nature. The CD results show that both PMT and ADP, induced secondary structural changes of Hb and unfold the protein by losing a large helical content while the effect is more pronounced with ADP. Additionally, we also utilized computational approaches for deep insight into the binding of these drugs with Hb and the results are well matched with our experimental results.

  16. Investigation of innovative radiation imaging method and system for radiological environments

    Energy Technology Data Exchange (ETDEWEB)

    Nguyen, H. [School of Biomedical Engineering, Korea University, Seoul (Korea, Republic of); Joung, J., E-mail: jinhun.joung@nucaremed.com [School of Biomedical Engineering, Korea University, Seoul (Korea, Republic of); Nucare, Inc., Incheon (Korea, Republic of); Kim, Y. [School of Biomedical Engineering, Korea University, Seoul (Korea, Republic of); Nucare, Inc., Incheon (Korea, Republic of); Lee, K. [School of Biomedical Engineering, Korea University, Seoul (Korea, Republic of)

    2017-03-01

    We have developed a novel imaging method that can be applied to most applications in the field of radiological environment imaging. It resolves either two-dimensional (2D) or three-dimensional (3D) distributions of radioactive sources in applications for homeland security, environmental monitoring, radiation contamination monitoring, baggage inspection, nuclear power plant monitoring, and more. The proposed imaging method uses a simple detector configured as a radiation-counting detector with spectroscopic capabilities. The detector module consists of two components: a flat field-of-view (FOV) collimator with a 30° FOV opening and a typical single-channel radiation detector made of a 2 in.×2 in. NaI(Tl) scintillator coupled to a 2 in photomultiplier tube (PMT). This simple detector module makes it possible to develop a cost-effective imaging system and provide design freedom in extending the system configuration to include one-dimensional (1D) or 2D detector-array shapes to meet the needs of various applications. One of most distinctive features of the new imaging method is that it uses only a pair of 2D projections to obtain a 3D reconstruction. The projections are measured by the proposed detector module at two positions orthogonal to one another; the measured projections are manipulated to enhance the resolution of the reconstructed 3D image. The imaging method comprises several steps performed consecutively: projection measurement, energy re-binning, projection separation, resolution and attenuation recovery, image reconstruction, and image consolidation and quantitative analysis. The resolution and attenuation recovery step provides the most distinctive and important processing by which the poor quality of projection data is enhanced. Such poor quality is mainly due to the use of a simple detector with a wide-opening flat FOV collimator. Simulation and experimental studies have been conducted to validate the proposed method. In this investigation, we

  17. CSIR NLC - South Africa - mobile LIDAR - system description

    CSIR Research Space (South Africa)

    Sivakumar, V

    2008-05-01

    Full Text Available to an altitude of 3 km with a ruby laser [4], and in 1970, Inaba and Kobayasi [5] and Kobayasi and Inaba [6][7], with the same laser, performed spectral analysis of nitrogen, oxygen and several pollutants. Since these pioneering attempts, laser remote... 532 nm) Beam Expander 3 x (optional) Pulse width 7 ns Pulse repetition rate 10 Hz Beam Divergence 0.2 mRad Receiver Telescope type Newtonian Diameter 404 mm Field of View 1 mRad PMT...

  18. System Budgets

    DEFF Research Database (Denmark)

    Jeppesen, Palle

    1996-01-01

    The lecture note is aimed at introducing system budgets for optical communication systems. It treats optical fiber communication systems (six generations), system design, bandwidth effects, other system impairments and optical amplifiers.......The lecture note is aimed at introducing system budgets for optical communication systems. It treats optical fiber communication systems (six generations), system design, bandwidth effects, other system impairments and optical amplifiers....

  19. ATLAS TileCal Sub-Module Production at UIUC

    CERN Multimedia

    Errede, Steve

    2001-01-01

    Photos of Current PMT Test Setup: Photo 1 - View of the PC, Electronics Rack and PMT Dark Box Photo 2 - Another View of the PC, Electronics Rack and PMT Dark Box. Photo 3 - Overhead shot of PMT Grid inside PMT Dark Box. Photo 4 - View of inside of PMT Light Box.

  20. Neutrino Interactions

    International Nuclear Information System (INIS)

    Kamyshkov, Yuri; Handler, Thomas

    2016-01-01

    The neutrino group of the University of Tennessee, Knoxville was involved from 05/01/2013 to 04/30/2015 in the neutrino physics research funded by DOE-HEP grant DE-SC0009861. Contributions were made to the Double Chooz nuclear reactor experiment in France where second detector was commissioned during this period and final series of measurements has been started. Although Double Chooz was smaller experimental effort than competitive Daya Bay and RENO experiments, its several advantages make it valuable for understanding of systematic errors in measurements of neutrino oscillations. Double Chooz was the first experiment among competing three that produced initial result for neutrino angle θ_1_3 measurement, giving other experiments the chance to improve measured value statistically. Graduate student Ben Rybolt defended his PhD thesis on the results of Double Chooz experiment in 2015. UT group has fulfilled all the construction and analysis commitments to Double Chooz experiment, and has withdrawn from the collaboration by the end of the mentioned period to start another experiment. Larger effort of UT neutrino group during this period was devoted to the participation in another DOE-HEP project - NOvA experiment. The 14,000-ton 'FAR' neutrino detector was commissioned in northern Minnesota in 2014 together with 300-ton 'NEAR' detector located at Fermilab. Following that, the physics measurement program has started when Fermilab accelerator complex produced the high-intensity neutrino beam propagating through Earth to detector in MInnessota. UT group contributed to NOvA detector construction and developments in several aspects. Our Research Associate Athanasios Hatzikoutelis was managing (Level 3 manager) the construction of the Detector Control System. This work was successfully accomplished in time with the commissioning of the detectors. Group was involved in the development of the on-line software and study of the signatures of the cosmic ray backgrounds

  1. Neutrino Interactions

    Energy Technology Data Exchange (ETDEWEB)

    Kamyshkov, Yuri [Univ. of Tennesse, Knoxville, TN (United States); Handler, Thomas [Univ. of Tennesse, Knoxville, TN (United States)

    2016-10-24

    The neutrino group of the University of Tennessee, Knoxville was involved from 05/01/2013 to 04/30/2015 in the neutrino physics research funded by DOE-HEP grant DE-SC0009861. Contributions were made to the Double Chooz nuclear reactor experiment in France where second detector was commissioned during this period and final series of measurements has been started. Although Double Chooz was smaller experimental effort than competitive Daya Bay and RENO experiments, its several advantages make it valuable for understanding of systematic errors in measurements of neutrino oscillations. Double Chooz was the first experiment among competing three that produced initial result for neutrino angle θ13 measurement, giving other experiments the chance to improve measured value statistically. Graduate student Ben Rybolt defended his PhD thesis on the results of Double Chooz experiment in 2015. UT group has fulfilled all the construction and analysis commitments to Double Chooz experiment, and has withdrawn from the collaboration by the end of the mentioned period to start another experiment. Larger effort of UT neutrino group during this period was devoted to the participation in another DOE-HEP project - NOvA experiment. The 14,000-ton "FAR" neutrino detector was commissioned in northern Minnesota in 2014 together with 300-ton "NEAR" detector located at Fermilab. Following that, the physics measurement program has started when Fermilab accelerator complex produced the high-intensity neutrino beam propagating through Earth to detector in MInnessota. UT group contributed to NOvA detector construction and developments in several aspects. Our Research Associate Athanasios Hatzikoutelis was managing (Level 3 manager) the construction of the Detector Control System. This work was successfully accomplished in time with the commissioning of the detectors. Group was involved in the development of the on-line software and study of the signatures of the cosmic ray backgrounds

  2. Ventilation systems

    International Nuclear Information System (INIS)

    Gossler

    1980-01-01

    The present paper deals with - controlled area ventilation systems - ventilation systems for switchgear-building and control-room - other ventilation systems for safety equipments - service systems for ventilation systems. (orig./RW)

  3. Pengaruh Pemberian Makanan Tambahan Pemulihan (Pmt-p) terhadap Pertumbuhan Balita Bawah Garis Merah (Bgm) di Puskesmas Kota Wilayah Selatan Kediri

    OpenAIRE

    Hari Poernomo, Dewi Ika Sari; Anggraeni, Santi

    2011-01-01

    Less nutrition in under five years children was manifested of less weight and growth with under red line influence brain development, it is very close relationship to mental development and thinking capability. Because of sufficient nutrient will create human resources who have health, cleverness, activeness and productivity. Less nutrition in this age effects in disorder that can delay further development. Giving recovered supplementary food correctly, in purpose, to add intake nutrient in u...

  4. Massive Pulmonary Embolism: Treatment with the Rotarex Thrombectomy System

    International Nuclear Information System (INIS)

    Liu Sheng; Shi Haibin; Gu Jianping; Yang Zhengqiang; Chen Liang; Lou Wensheng; He Xu; Zhou Weizhong; Zhou Chungao; Zhao Linbo; Xia Jinguo; Li Linsun

    2011-01-01

    This study was designed to evaluate the efficacy and safety of percutaneous mechanical thrombectomy (PMT) for acute massive pulmonary embolism (PE). Fourteen patients (8 men, 6 women) with a mean age of 55.4 (range, 38–71) years with acute massive PE were initially diagnosed by computed tomography (CT) and confirmed by pulmonary angiography. All patients presented with acute PE symptoms and hemodynamic compromise. Each patient was treated with Straub Rotarex thrombectomy device and five patients received additional thrombolysis. Technique success and clinical improvement were achieved in all patients without major complications. The mean pulmonary artery pressure (PAP) decreased from 37.6 ± 6.6 to 29 ± 6.4 mmHg (P 2 (PaO 2 ) increased from 61.1 ± 9.2 to 88 ± 5.1 mmHg (P < 0.01). The Miller index was 0.67 ± 0.11 and 0.37 ± 0.13 (P < 0.01), respectively, before and after PMT (P < 0.01). Eleven patients had no recurrence of PE on a mean follow-up of 28.3 months, whereas the other three patients were lost to follow-up. The preliminary experience in our series suggests that the Straub Rotarex thrombectomy device, which has been utilized in peripheral arteries, also is useful for the treatment of acute massive PE.

  5. Embedded Systems

    Indian Academy of Sciences (India)

    Embedded system, micro-con- troller ... Embedded systems differ from general purpose computers in many ... Low cost: As embedded systems are extensively used in con- .... operating systems for the desktop computers where scheduling.

  6. Thermal systems; Systemes thermiques

    Energy Technology Data Exchange (ETDEWEB)

    Lalot, S. [Valenciennes Univ. et du Hainaut Cambresis, LME, 59 (France); Lecoeuche, S. [Ecole des Mines de Douai, Dept. GIP, 59 - Douai (France)]|[Lille Univ. des Sciences et Technologies, 59 - Villeneuve d' Ascq (France); Ahmad, M.; Sallee, H.; Quenard, D. [CSTB, 38 - Saint Martin d' Heres (France); Bontemps, A. [Universite Joseph Fourier, LEGI/GRETh, 38 - Grenoble (France); Gascoin, N.; Gillard, P.; Bernard, S. [Laboratoire d' Energetique, Explosion, Structure, 18 - Bourges (France); Gascoin, N.; Toure, Y. [Laboratoire Vision et Robotique, 18 - Bourges (France); Daniau, E.; Bouchez, M. [MBDA, 18 - Bourges (France); Dobrovicescu, A.; Stanciu, D. [Bucarest Univ. Polytechnique, Faculte de Genie Mecanique (Romania); Stoian, M. [Reims Univ. Champagne Ardenne, Faculte des Sciences, UTAP/LTM, 51 (France); Bruch, A.; Fourmigue, J.F.; Colasson, S. [CEA Grenoble, Lab. Greth, 38 (France); Bontemps, A. [Universite Joseph Fourier, LEGI/GRETh, 38 - Grenoble (France); Voicu, I.; Mare, T.; Miriel, J. [Institut National des Sciences Appliquees (INSA), LGCGM, IUT, 35 - Rennes (France); Galanis, N. [Sherbrooke Univ., Genie Mecanique, QC (Canada); Nemer, M.; Clodic, D. [Ecole des Mines de Paris, Centre Energetique et Procedes, 75 (France); Lasbet, Y.; Auvity, B.; Castelain, C.; Peerhossaini, H. [Nantes Univ., Ecole Polytechnique, Lab. de Thermocinetiquede Nantes, UMR-CNRS 6607, 44 (France)

    2005-07-01

    This session about thermal systems gathers 26 articles dealing with: neural model of a compact heat exchanger; experimental study and numerical simulation of the thermal behaviour of test-cells with walls made of a combination of phase change materials and super-insulating materials; hydraulic and thermal modeling of a supercritical fluid with pyrolysis inside a heated channel: pre-dimensioning of an experimental study; energy analysis of the heat recovery devices of a cryogenic system; numerical simulation of the thermo-hydraulic behaviour of a supercritical CO{sub 2} flow inside a vertical tube; mixed convection inside dual-tube exchangers; development of a nodal approach with homogenization for the simulation of the brazing cycle of a heat exchanger; chaotic exchanger for the cooling of low temperature fuel cells; structural optimization of the internal fins of a cylindrical generator; a new experimental approach for the study of the local boiling inside the channels of exchangers with plates and fins; experimental study of the flow regimes of boiling hydrocarbons on a bundle of staggered tubes; energy study of heat recovery exchangers used in Claude-type refrigerating systems; general model of Carnot engine submitted to various operating constraints; the free pistons Stirling cogeneration system; natural gas supplied cogeneration system with polymer membrane fuel cell; influence of the CRN coating on the heat flux inside the tool during the wood unrolling process; transport and mixture of a passive scalar injected inside the wake of a Ahmed body; control of a laser welding-brazing process by infrared thermography; 2D self-adaptative method for contours detection: application to the images of an aniso-thermal jet; exergy and exergy-economical study of an 'Ericsson' engine-based micro-cogeneration system; simplified air-conditioning of telephone switching equipments; parametric study of the 'low-energy' individual dwelling; brief synthesis of

  7. Data Systems vs. Information Systems

    OpenAIRE

    Amatayakul, Margret K.

    1982-01-01

    This paper examines the current status of “hospital information systems” with respect to the distinction between data systems and information systems. It is proposed that the systems currently existing are incomplete data dystems resulting in ineffective information systems.

  8. EXPERT SYSTEMS

    OpenAIRE

    Georgiana Marin; Mihai Catalin Andrei

    2011-01-01

    In recent decades IT and computer systems have evolved rapidly in economic informatics field. The goal is to create user friendly information systems that respond promptly and accurately to requests. Informatics systems evolved into decision assisted systems, and such systems are converted, based on gained experience, in expert systems for creative problem solving that an organization is facing. Expert systems are aimed at rebuilding human reasoning on the expertise obtained from experts, sto...

  9. Multibody Systems

    DEFF Research Database (Denmark)

    Wagner, Falko Jens

    1999-01-01

    Multibody Systems is one area, in which methods for solving DAEs are of special interst. This chapter is about multibody systems, why they result in DAE systems and what kind of problems that can arise when dealing with multibody systems and formulating their corresponding DAE system....

  10. Development of the LBNL positron emission mammography camera

    International Nuclear Information System (INIS)

    Huber, Jennifer S.; Choong, Woon-Seng; Wang, Jimmy; Maltz, Jonathon S.; Qi, Jinyi; Mandelli, Emanuele; Moses, William W.

    2002-01-01

    We present the construction status of the LBNL Positron Emission Mammography (PEM) camera, which utilizes a PET detector module with depth of interaction measurement consisting of 64 LSO crystals (3x3x30 mm3) coupled on one end to a single photomultiplier tube (PMT) and on the opposite end to a 64 pixel array of silicon photodiodes (PDs). The PMT provides an accurate timing pulse, the PDs identify the crystal of interaction, the sum provides a total energy signal, and the PD/(PD+PMT) ratio determines the depth of interaction. We have completed construction of all 42 PEM detector modules. All data acquisition electronics have been completed, fully tested and loaded onto the gantry. We have demonstrated that all functions of the custom IC work using the production rigid-flex boards and data acquisition system. Preliminary detector module characterization and coincidence data have been taken using the production system, including initial images

  11. System dynamics

    International Nuclear Information System (INIS)

    Kim, Do Hun; Mun, Tae Hun; Kim, Dong Hwan

    1999-02-01

    This book introduces systems thinking and conceptual tool and modeling tool of dynamics system such as tragedy of single thinking, accessible way of system dynamics, feedback structure and causal loop diagram analysis, basic of system dynamics modeling, causal loop diagram and system dynamics modeling, information delay modeling, discovery and application for policy, modeling of crisis of agricultural and stock breeding products, dynamic model and lesson in ecosystem, development and decadence of cites and innovation of education forward system thinking.

  12. Was the Scanner Calibration Slide used for its intended purpose?

    Directory of Open Access Journals (Sweden)

    Zong Yaping

    2011-04-01

    Full Text Available Abstract In the article, Scanner calibration revisited, BMC Bioinformatics 2010, 11:361, Dr. Pozhitkov used the Scanner Calibration Slide, a key product of Full Moon BioSystems to generate data in his study of microarray scanner PMT response and proposed a mathematic model for PMT response 1. In the end, the author concluded that "Full Moon BioSystems calibration slides are inadequate for performing calibration," and recommended "against using these slides." We found these conclusions are seriously flawed and misleading, and his recommendation against using the Scanner Calibration Slide was not properly supported.

  13. Digitization of instrumentation and control in nuclear power plants

    International Nuclear Information System (INIS)

    Hofmann, A.; Buschhorn, W.; Pache, K.; Kimmel, W.; Hoeing, M.

    1997-01-01

    Unit 1 of the Chooz NPP was connected to the grid in August 1996. Unit 2 will soon be connected. In the western part of the center of France, not far from the town Poitiers, there is an identical construction site where likewise two NPP units are being erected. The French firm Sema Group is the supplier of the control and monitoring system (KIC) and as the prime contractor also is responsible for coordination of work and cooperation with the firm Hartmann and Braun. Hartmann and Braun developed the Contronic E automation system and are one of the major instrumentation and control suppliers for these units. (orig./DG) [de

  14. Effects of system geometry and other physical factors on photon sensitivity of high-resolution positron emission tomography

    Science.gov (United States)

    Habte, F.; Foudray, A. M. K.; Olcott, P. D.; Levin, C. S.

    2007-07-01

    We are studying two new detector technologies that directly measure the three-dimensional coordinates of 511 keV photon interactions for high-resolution positron emission tomography (PET) systems designed for small animal and breast imaging. These detectors are based on (1) lutetium oxyorthosilicate (LSO) scintillation crystal arrays coupled to position-sensitive avalanche photodiodes (PSAPD) and (2) cadmium zinc telluride (CZT). The detectors have excellent measured 511 keV photon energy resolutions (oriented 'edge-on' with respect to incoming 511 keV annihilation photons and arranged to form a compact FOV with detectors very close to, or in contact with, the subject tissues. In this paper, we used Monte Carlo simulation to study various factors that limit the photon sensitivity of a high-resolution PET system dedicated to small animal imaging. To optimize the photon sensitivity, we studied several possible system geometries for a fixed 8 cm transaxial and 8 cm axial FOV. We found that using rectangular-shaped detectors arranged into a cylindrical geometry does not yield the best photon sensitivity. This is due to the fact that forming rectangular-shaped detectors into a ring produces significant wedge-shaped inter-module gaps, through which Compton-scattered photons in the detector can escape. This effect limits the center point source photon sensitivity to 8% photon sensitivity for the LSO-PSAPD box configuration and >15% for CZT box geometry, using a 350-650 keV energy window setting. These simulation results compare well with analytical estimations. The trend is different for a clinical whole-body PET system that uses conventional LSO-PMT block detectors with larger crystal elements. Simulations predict roughly the same sensitivity for both box and cylindrical detector configurations. This results from the fact that a large system diameter (>80 cm) results in relatively small inter-module gaps in clinical whole-body PET. In addition, the relatively large block

  15. Coupling component systems towards systems of systems

    OpenAIRE

    Autran , Frédéric; Auzelle , Jean-Philippe; Cattan , Denise; Garnier , Jean-Luc; Luzeaux , Dominique; Mayer , Frédérique; Peyrichon , Marc; Ruault , Jean-René

    2008-01-01

    International audience; Systems of systems (SoS) are a hot topic in our "fully connected global world". Our aim is not to provide another definition of what SoS are, but rather to focus on the adequacy of reusing standard system architecting techniques within this approach in order to improve performance, fault detection and safety issues in large-scale coupled systems that definitely qualify as SoS, whatever the definition is. A key issue will be to secure the availability of the services pr...

  16. Systems effectiveness

    CERN Document Server

    Habayeb, A R

    1987-01-01

    Highlights three principal applications of system effectiveness: hardware system evaluation, organizational development and evaluation, and conflict analysis. The text emphasizes the commonality of the system effectiveness discipline. The first part of the work presents a framework for system effectiveness, partitioning and hierarchy of hardware systems. The second part covers the structure, hierarchy, states, functions and activities of organizations. Contains an extended Appendix on mathematical concepts and also several project suggestions.

  17. Auxiliary systems

    International Nuclear Information System (INIS)

    Meyer, P.J.

    1981-01-01

    Systems included under the heading ''Reactor Auxillary Systems'' are those immediately involved with the reactor operation. These include the systems for dosing and letdown of reactor coolant, as well as for the chemical dosing, purification and treatment of the reactor coolant and the cooling system in the controlled area. The ancillary systems are mainly responsible for liquid and gaseous treatment and the waste treatment for final storage. (orig.)

  18. Vaccination with Recombinant Non-transmembrane Domain of Protein Mannosyltransferase 4 Improves Survival during Murine Disseminated Candidiasis.

    Science.gov (United States)

    Wang, Li; Yan, Lan; Li, Xing Xing; Xu, Guo Tong; An, Mao Mao; Jiang, Yuan Ying

    2015-01-01

    Candida albicans is the most common cause of invasive fungal infections in humans. The C. albicans cell wall proteins play an important role in crucial host-fungus interactions and might be ideal vaccine targets to induce protective immune response in host. Meanwhile, protein that is specific to C. albicans is also an ideal target of vaccine. In this study, 11 proteins involving cell wall biosynthesis, yeast-to-hypha formation, or specific to C. albicans were chosen and were successfully cloned, purified and verified. The immune protection of vaccination with each recombinant protein respectively in preventing systemic candidiasis in BALB/c mice was assessed. The injection of rPmt4p vaccination significantly increased survival rate, decreased fungal burdens in the heart, liver, brain, and kidneys, and increased serum levels of both immunoglobulin G (IgG) and IgM against rPmt4p in the immunized mice. Histopathological assessment demonstrated that rPmt4p vaccination protected the tissue structure, and decreased the infiltration of inflammatory cells. Passive transfer of the rPmt4p immunized serum increased survival rate against murine systemic candidiasis and significantly reduced organ fungal burden. The immune serum enhanced mouse neutrophil killing activity by directly neutralizing rPmt4p effects in vitro. Levels of interleukin (IL)-4, IL-10, IL-12p70, IL-17A and tumor necrosis factor (TNF)-α in serum were higher in the immunized mice compared to those in the adjuvant control group. In conclusion, our results suggested that rPmt4p vaccination may be considered as a potential vaccine candidate against systemic candidiasis.

  19. Volcanic eruptions and the increases in the stratospheric aerosol content: Lidar measurements from 1982 to 1986

    Science.gov (United States)

    Hayashida, S.; Iikura, Y.; Shimizu, H.; Sasano, Y.; Nakane, H.; Sugimoto, N.; Matsui, I.; Takeuchi, N.

    1986-01-01

    The results of the observation for stratospheric aerosols which were carried out since the autumn of 1982 by using the NIES large lidar are described. Specifications of the lidar system are shown. The lidar has two wavelenghts of 1.06 and 0.53 micrometers. The 0.53 micrometer is mainly used for the stratospheric aerosols, because the PMT for 0.53 micrometers has higher sensitivity that that for 1.06 micrometers and the total efficiency is higher in the former. A switching circuit is used to control the PMT gain for avoiding signal induced noise in PMT. For the last four years, the stratospheric aerosol layer which was significantly perturbed by the El Chichon volcanic eruption was observed. The scattering ratio profiles observed from 1982 through 1983 are given.

  20. Evaluation of cell lysis procedures and use of a micro fluidic system for an automated DNA-based cell identification in interplanetary missions

    Science.gov (United States)

    Hall, J. A.; Felnagle, E.; Fries, M.; Spearing, S.; Monaco, L.; Steele, A.

    2006-12-01

    A Modular Assay System for Solar System Exploration (MASSE) is being developed to include sample handling, pre-treatment, separation and analysis of biological target compounds by both DNA and protein microarrays. To better design sensitive and accurate initial upstream sample handling of the MASSE instrument, experiments investigating the sensitivity and potential extraction bias of commercially available DNA extraction kits between classes of environmentally relevant prokaryotes such as gram-negative bacteria ( Escherichia coli), gram-positive bacteria ( Bacillus megatarium), and Archaea ( Haloarcula marismortui) were performed. For extractions of both planktonic cultures and spiked Mars simulated regolith, FTA ® paper demonstrated the highest sensitivity, with detection as low as ˜1×10 1 cells and ˜3.3×10 2 cells, respectively. In addition to the highest sensitivity, custom modified application of FTA ® paper extraction protocol is the simplest in terms of incorporation into MASSE and displayed little bias in sensitivity with respect to prokaryotic cell type. The implementation of FTA paper for environmental microbiology investigations appears to be a viable and effective option potentially negating the need for other pre-concentration steps such as filtration and negating concerns regarding extraction efficiency of cells. In addition to investigations on useful technology for upstream sample handling in MASSE, we have also evaluated the potential for μTAS to be employed in the MASSE instrument by employing proprietary lab-on-a-chip development technology to investigate the potential for microfluidic cell lysis of different prokaryotic cells employing both chemical and biological lysis agents. Real-time bright-field microscopy and quantitative PMT detection indicated that that gram positive, gram negative and archaeal cells were effectively lyzed in a few seconds using the microfluidic chip protocol developed. This included employing a lysis buffer with

  1. Bitcoin System

    Directory of Open Access Journals (Sweden)

    Jan Lánský

    2017-06-01

    Full Text Available Cryptocurrency systems are purely digital and decentralized systems that use cryptographic principles to confirm transactions. Bitcoin is the first and also the most widespread cryptocurrency. The aim of this article is to introduce Bitcoin system using a language understandable also to readers without computer science education. This article captures the Bitcoin system from three perspectives: internal structure, network and users. Emphasis is placed on brief and clear definitions (system components and their mutual relationships. A new system view of the stated terms constitutes author’s own contribution.

  2. JOSHUA system

    International Nuclear Information System (INIS)

    Honeck, H.C.

    1975-04-01

    A major computational system called JOSHUA has been under development at the Savannah River Laboratory since 1968. The JOSHUA System has two major parts: the Operating System and the Application System. The Operating System has been in production use since 1970 and provides data management, terminal, and job execution facilities. The Application System uses these facilities in solving problems in reactor physics and engineering. Features of the Application System are the two-dimensional lattice physics and three-dimensional transient reactor physics capabilities, which have been in use since 1971 and 1974, respectively. The capabilities of the JOSHUA System are summarized, and statistics on size, use, and development effort are provided. (U.S.)

  3. Systems thinking.

    Science.gov (United States)

    Cabrera, Derek; Colosi, Laura; Lobdell, Claire

    2008-08-01

    Evaluation is one of many fields where "systems thinking" is popular and is said to hold great promise. However, there is disagreement about what constitutes systems thinking. Its meaning is ambiguous, and systems scholars have made diverse and divergent attempts to describe it. Alternative origins include: von Bertalanffy, Aristotle, Lao Tsu or multiple aperiodic "waves." Some scholars describe it as synonymous with systems sciences (i.e., nonlinear dynamics, complexity, chaos). Others view it as taxonomy-a laundry list of systems approaches. Within so much noise, it is often difficult for evaluators to find the systems thinking signal. Recent work in systems thinking describes it as an emergent property of four simple conceptual patterns (rules). For an evaluator to become a "systems thinker", he or she need not spend years learning many methods or nonlinear sciences. Instead, with some practice, one can learn to apply these four simple rules to existing evaluation knowledge with transformative results.

  4. Cognitive Systems

    DEFF Research Database (Denmark)

    The tutorial will discuss the definition of cognitive systems as the possibilities to extend the current systems engineering paradigm in order to perceive, learn, reason and interact robustly in open-ended changing environments. I will also address cognitive systems in a historical perspective...... to be modeled within a limited set of predefined specifications. There will inevitably be a need for robust decisions and behaviors in novel situations that include handling of conflicts and ambiguities based on the capability and knowledge of the artificial cognitive system. Further, there is a need...... in cognitive systems include e.g. personalized information systems, sensor network systems, social dynamics system and Web2.0, and cognitive components analysis. I will use example from our own research and link to other research activities....

  5. Crystal Systems.

    Science.gov (United States)

    Schomaker, Verner; Lingafelter, E. C.

    1985-01-01

    Discusses characteristics of crystal systems, comparing (in table format) crystal systems with lattice types, number of restrictions, nature of the restrictions, and other lattices that can accidently show the same metrical symmetry. (JN)

  6. Filter systems

    International Nuclear Information System (INIS)

    Vanin, V.R.

    1990-01-01

    The multidetector systems for high resolution gamma spectroscopy are presented. The observable parameters for identifying nuclides produced simultaneously in the reaction are analysed discussing the efficiency of filter systems. (M.C.K.)

  7. Expert systems

    International Nuclear Information System (INIS)

    Haldy, P.A.

    1988-01-01

    The definitions of the terms 'artificial intelligence' and 'expert systems', the methodology, areas of employment and limits of expert systems are discussed. The operation of an expert system is described, especially the presentation and organization of knowledge as well as interference and control. Methods and tools for expert system development are presented and their application in nuclear energy are briefly addressed. 7 figs., 2 tabs., 6 refs

  8. Expert System

    DEFF Research Database (Denmark)

    Hildebrandt, Thomas Troels; Cattani, Gian Luca

    2016-01-01

    An expert system is a computer system for inferring knowledge from a knowledge base, typically by using a set of inference rules. When the concept of expert systems was introduced at Stanford University in the early 1970s, the knowledge base was an unstructured set of facts. Today the knowledge b...... for the application of expert systems, but also raises issues regarding privacy and legal liability....

  9. Retrofitting Systems

    DEFF Research Database (Denmark)

    Rose, Jørgen

    1997-01-01

    This report gives an overview of the different retrofitting possibilities that are available today. The report looks at both external and internal systems for external wall constructions, roof constructions, floor constructions and foundations. All systems are described in detail in respect to use...... and methods, and the efficiency of the different systems are discussed....

  10. Multifunction system

    International Nuclear Information System (INIS)

    Wauthier, J.; Fiori, R.

    1990-01-01

    The development, the characteristics and the applications of a multifunction system are presented. The system is used on the RBES laboratory pipes, at Marcoule. The system was developed in order to allow, without time loss, the modification of the circuit function by replacing only one component. The following elements form the multifunction system: a fixed base, which is part of the tube, a removable piece, which is inserted into the base, a cover plate and its locking system. The material, chosen among commercial trade marks, required small modifications in order to be used in the circuit [fr

  11. Operating systems

    CERN Document Server

    Tsichritzis, Dionysios C; Rheinboldt, Werner

    1974-01-01

    Operating Systems deals with the fundamental concepts and principles that govern the behavior of operating systems. Many issues regarding the structure of operating systems, including the problems of managing processes, processors, and memory, are examined. Various aspects of operating systems are also discussed, from input-output and files to security, protection, reliability, design methods, performance evaluation, and implementation methods.Comprised of 10 chapters, this volume begins with an overview of what constitutes an operating system, followed by a discussion on the definition and pr

  12. Pharmacomechanical Thrombectomy in Paget–Schroetter Syndrome

    Energy Technology Data Exchange (ETDEWEB)

    Kärkkäinen, Jussi M., E-mail: jkarkkai@gmail.com [Kuopio University Hospital, Heart Center (Finland); Nuutinen, Henrik [Kuopio University Hospital, Department of Surgery (Finland); Riekkinen, Teemu [Kuopio University Hospital, Heart Center (Finland); Sihvo, Eero [Central Finland Central Hospital, Department of Surgery (Finland); Turtiainen, Johanna [North Karelia Central Hospital, Department of Surgery (Finland); Saari, Petri [Kuopio University Hospital, Department of Clinical Radiology (Finland); Mäkinen, Kimmo [Kuopio University Hospital, Heart Center (Finland); Manninen, Hannu [Kuopio University Hospital, Department of Clinical Radiology (Finland)

    2016-09-15

    PurposeThe purpose of the study was to evaluate feasibility of pharmacomechanical thrombectomy (PMT) in the treatment of Paget–Schroetter syndrome (PSS) followed by thoracoscopic or open surgical decompression of the subclavian vein.MethodsTwenty-two out of 27 consecutive patients with PSS received PMT using the Trellis-8 peripheral infusion system (Covidien) between 2010 and 2014. Subsequent surgery was performed in 18 of those patients, 9 patients were treated with thoracoscopic, 7 patients with subclavicular, and 2 patients with transaxillary first rib resection, 4 patients were treated with PMT and anticoagulation alone. Technical success, complications, and patency were registered.ResultsPMT was successful in 21 (95 %) patients; 1 patient with unsatisfactory lysis received further catheter-directed thrombolysis, which, however, did not improve the result. The mean endovascular procedure time was 105 ± 33 min (range 70–200 min), and the required median amount of thrombolytic agent was 500,000 international unit (IU; range 250,000–1,000,000 IU). Adjunctive balloon venoplasty and aspiration were used in 18 (82 %) and 7 (32 %) cases, respectively. One patient had an intimal tear of the subclavian vein that was discovered and repaired during surgery. There were no other complications related to the endovascular procedure. At follow-up, 18 of 21 patients (86 %) with follow-up imaging available had patent subclavian vein, and all except 1 of the 22 patients were asymptomatic. The mean follow-up time was 25 ± 17 months.ConclusionsIn experienced hands, PMT is effective for early thrombus removal in PSS. Surgical decompression must be considered after PMT.

  13. Systems integration.

    Science.gov (United States)

    Siemieniuch, C E; Sinclair, M A

    2006-01-01

    The paper presents a view of systems integration, from an ergonomics/human factors perspective, emphasising the process of systems integration as is carried out by humans. The first section discusses some of the fundamental issues in systems integration, such as the significance of systems boundaries, systems lifecycle and systems entropy, issues arising from complexity, the implications of systems immortality, and so on. The next section outlines various generic processes for executing systems integration, to act as guides for practitioners. These address both the design of the system to be integrated and the preparation of the wider system in which the integration will occur. Then the next section outlines some of the human-specific issues that would need to be addressed in such processes; for example, indeterminacy and incompleteness, the prediction of human reliability, workload issues, extended situation awareness, and knowledge lifecycle management. For all of these, suggestions and further readings are proposed. Finally, the conclusions section reiterates in condensed form the major issues arising from the above.

  14. Ternary systems

    International Nuclear Information System (INIS)

    Kagan, D.N.; Hubberstey, P.; Barker, M.G.

    1985-01-01

    The paper reviews the experimental and theoretical studies carried out on multicomponent alkali metal systems. Solid-liquid phase equilibria studies are mainly concerned with the systems Na-K-Rb and Na-K-Cs, and data on the liquidus temperatures in these systems are presented. The thermodynamic properties of the ternary Na-K-Cs eutectic system have been determined experimentally, and the enthalpy, heat capacity and excess functions of the alloy are given. An analysis of calculational methods used in determining thermodynamic functions of ternary liquid metals systems is described. Finally, data are tabulated for the density, compressibility, saturated vapour pressure, viscosity and thermal conductivity of the ternary Na-K-Cs eutectic system. (UK)

  15. A remotely triggered fast neutron detection instrument based on a plastic organic scintillator

    Science.gov (United States)

    Jones, A. R.; Aspinall, M. D.; Joyce, M. J.

    2018-02-01

    A detector system for the characterization of radiation fields of both fast neutrons and γ rays is described comprising of a gated photomultiplier tube (PMT), an EJ299-33 solid organic scintillator detector, and an external trigger circuit. The objective of this development was to conceive a means by which the PMT in such a system can be actuated remotely during the high-intensity bursts of pulsed γ-ray contamination that can arise during active interrogation procedures. The system is used to detect neutrons and γ rays using established pulse-shape discrimination (PSD) techniques. The gating circuit enables the PMT to be switched off remotely. This is compatible with use during intense radiation transients to avoid saturation and the disruption of the operation of the PMT during the burst. Data are presented in the form of pulse-height spectra and PSD scatter plots for the system triggered with a strobed light source. These confirm that the gain of the system and the throughput for both triggered and un-triggered scenarios are as expected, given the duty cycle of the stimulating radiation. This demonstrates that the triggering function does not perturb the system response of the detector.

  16. Recommender systems

    CERN Document Server

    Kembellec, Gérald; Saleh, Imad

    2014-01-01

    Acclaimed by various content platforms (books, music, movies) and auction sites online, recommendation systems are key elements of digital strategies. If development was originally intended for the performance of information systems, the issues are now massively moved on logical optimization of the customer relationship, with the main objective to maximize potential sales. On the transdisciplinary approach, engines and recommender systems brings together contributions linking information science and communications, marketing, sociology, mathematics and computing. It deals with the understan

  17. Material Systems

    DEFF Research Database (Denmark)

    Jensen, Mads Brath; Mortensen, Henrik Rubæk; Mullins, Michael

    2009-01-01

    This paper describes and reflects upon the results of an investigative project which explores the setting up of a material system - a parametric and generative assembly consisting of and taking into consideration material properties, manufacturing constraints and geometric behavior. The project...... approaches the subject through the construction of a logic-driven system aiming to explore the possibilities of a material system that fulfills spatial, structural and performative requirements concurrently and how these are negotiated in situations where they might be conflicting....

  18. Systems Engineering

    OpenAIRE

    Vaughan, William W.

    2016-01-01

    The term “systems engineering” when entered into the Google search page, produces a significant number of results, evidence that systems engineering is recognized as being important for the success of essentially all products. Since most readers of this item will be rather well versed in documents concerning systems engineering, I have elected to share some of the points made on this subject in a document developed by the European Cooperation for Space Standardization (ECSS), a component of t...

  19. Energetic Systems

    Data.gov (United States)

    Federal Laboratory Consortium — The Energetic Systems Division provides full-spectrum energetic engineering services (project management, design, analysis, production support, in-service support,...

  20. Intelligent systems

    CERN Document Server

    Irwin, J David

    2011-01-01

    Technology has now progressed to the point that intelligent systems are replacing humans in the decision making processes as well as aiding in the solution of very complex problems. In many cases intelligent systems are already outperforming human activities. Artificial neural networks are not only capable of learning how to classify patterns, such images or sequence of events, but they can also effectively model complex nonlinear systems. Their ability to classify sequences of events is probably more popular in industrial applications where there is an inherent need to model nonlinear system

  1. Systemic darwinism.

    Science.gov (United States)

    Winther, Rasmus Grønfeldt

    2008-08-19

    Darwin's 19th century evolutionary theory of descent with modification through natural selection opened up a multidimensional and integrative conceptual space for biology. We explore three dimensions of this space: explanatory pattern, levels of selection, and degree of difference among units of the same type. Each dimension is defined by a respective pair of poles: law and narrative explanation, organismic and hierarchical selection, and variational and essentialist thinking. As a consequence of conceptual debates in the 20th century biological sciences, the poles of each pair came to be seen as mutually exclusive opposites. A significant amount of 21st century research focuses on systems (e.g., genomic, cellular, organismic, and ecological/global). Systemic Darwinism is emerging in this context. It follows a "compositional paradigm" according to which complex systems and their hierarchical networks of parts are the focus of biological investigation. Through the investigation of systems, Systemic Darwinism promises to reintegrate each dimension of Darwin's original logical space. Moreover, this ideally and potentially unified theory of biological ontology coordinates and integrates a plurality of mathematical biological theories (e.g., self-organization/structure, cladistics/history, and evolutionary genetics/function). Integrative Systemic Darwinism requires communal articulation from a plurality of perspectives. Although it is more general than these, it draws on previous advances in Systems Theory, Systems Biology, and Hierarchy Theory. Systemic Darwinism would greatly further bioengineering research and would provide a significantly deeper and more critical understanding of biological reality.

  2. Caste System

    OpenAIRE

    Hoff, Karla

    2016-01-01

    In standard economics, individuals are rational actors and economic forces undermine institutions that impose large inefficiencies. The persistence of the caste system is evidence of the need for psychologically more realistic models of decision-making in economics. The caste system divides South Asian society into hereditary groups whose lowest ranks are represented as innately polluted. ...

  3. Recommender systems

    OpenAIRE

    Lu L.; Medo M.; Yeung C.H.; Zhang Y.-C.; Zhang Z.-K.; Zhou T.

    2012-01-01

    The ongoing rapid expansion of the Internet greatly increases the necessity of effective recommender systems for filtering the abundant information. Extensive research for recommender systems is conducted by a broad range of communities including social and computer scientists, physicists, and interdisciplinary researchers. Despite substantial theoretical and practical achievements, unification and comparison of different approaches are lacking, which impedes further advances. In this article...

  4. GEOMASS system

    International Nuclear Information System (INIS)

    Ohyama, Takuya; Saegusa, Hiromitsu

    2009-03-01

    As a part of the research and development regarding characterisation of deep geological environment, the GEOMASS (GEOLOGICAL MODELLING ANALYSIS AND SIMULATION SOFTWARE) system has been developed by the Japan Atomic Energy Agency in order to carry out geological and hydrogeological modelling and groundwater flow simulation and so on. The GEOMASS system integrates a commercial geological interpretation system (EarthVision), which is used for geological modelling and visualisation, with a proprietary code for groundwater flow (FracAffinity). This integrated system allows users to make rapid improvement of models as data increases. Also, it is possible to perform more realistic groundwater flow simulation due to the capability of modelling the rock mass as a continuum with discrete hydro-structural features in the rock mass. This paper consists of 'Overview of GEOMASS system', FracAffinity Theoretical Background' and 'FracAffinity User Guide' and is edited as a GEOMASS system manual. 'Overview of GEOMASS system' describes the outline of this system. 'FracAffinity Theoretical Background' describes the information of technical background of FracAffinity software. FracAffinity User Guide' describes the structure of the FracAffinity input files, the usage of FracAffinity Interface and flow-solver. Updating of the FracAffinity has been continued as needed and FracAffinity version3.3 is the latest version at present (July 2008). (author)

  5. Systems integration (automation system). System integration (automation system)

    Energy Technology Data Exchange (ETDEWEB)

    Fujii, K; Komori, T; Fukuma, Y; Oikawa, M [Nippon Steal Corp., Tokyo (Japan)

    1991-09-26

    This paper introduces business activities on an automation systems integration (SI) started by a company in July,1988, and describes the SI concepts. The business activities include, with the CIM (unified production carried out on computers) and AMENITY (living environment) as the mainstays, a single responsibility construction ranging from consultation on structuring optimal systems for processing and assembling industries and intelligent buildings to system design, installation and after-sales services. With an SI standing on users {prime} position taken most importantly, the business starts from a planning and consultation under close coordination. On the conceptual basis of structuring optimal systems using the ompany {prime}s affluent know-hows and tools and adapting and applying with multi-vendors, open networks, centralized and distributed systems, the business is promoted with the accumulated technologies capable of realizing artificial intelligence and neural networks in its background, and supported with highly valuable business results in the past. 10 figs., 1 tab.

  6. Creative Systems

    DEFF Research Database (Denmark)

    Manelius, Anne-Mette; Beim, Anne

    2007-01-01

    Opsamling af diskussioner på konferencen og udstillingen Creative Systems i september/oktober 2007. Konferencen og Udstillingen Creative Systems sætter fokus på systemer som en positiv drivkraft i den kreative skabelsesproces. CINARK inviterede fire internationale kapaciteter, som indenfor hver...... deres felt har beskæftiget sig med udviklingen af systemer. Kieran Timberlake, markant amerikansk tegnestue; Mark West, Professor på University of Manitoba, Canada, og pioner indenfor anvendelse af tekstilforskalling til betonstøbninger; Matilda McQuaid, Arkitekturhistoriker og kurator på udstillingen...... om Extreme Textiles på amerikanske Cooper Hewit Design Museum, samt Professor Ludger Hovestadt, ved ETH, Zürich der fokuserer på udvikling og anvendelse af logaritmiske systemtilgange. Udstillingen diskuterede ud fra deres meget forskellige arbejder, det kreative potentiale i anvendelsen af systemer...

  7. Reactive Systems

    DEFF Research Database (Denmark)

    Aceto, Luca; Ingolfsdottir, Anna; Larsen, Kim Guldstrand

    A reactive system comprises networks of computing components, achieving their goals through interaction among themselves and their environment. Thus even relatively small systems may exhibit unexpectedly complex behaviours. As moreover reactive systems are often used in safety critical systems......, the need for mathematically based formal methodology is increasingly important. There are many books that look at particular methodologies for such systems. This book offers a more balanced introduction for graduate students and describes the various approaches, their strengths and weaknesses, and when...... they are best used. Milner's CCS and its operational semantics are introduced, together with the notions of behavioural equivalences based on bisimulation techniques and with recursive extensions of Hennessy-Milner logic. In the second part of the book, the presented theories are extended to take timing issues...

  8. Upgraded RECOVER system - CASDAC system

    International Nuclear Information System (INIS)

    Yamamoto, Yoichi; Koyama, Kinji

    1992-03-01

    The CASDAC (Containment And Surveillance Data Authenticated Communication) system has been developed by JAERI for nuclear safeguards and physical protection of nuclear material. This system was designed and constructed as an upgraded RECOVER system, design concept of which was based on the original RECOVER system and also the TRANSEAVER system. Both of them were developed several years ago as a remote monitoring system for continual verification of security and safeguards status of nuclear material. The system consists of two subsystems, one of them is a Grand Command Center (GCC) subsystem and the other is a facility subsystem. Communication between the two subsystems is controlled through the international telephone line network. Therefore all communication data are encrypted to prevent access by an unauthorized person who may intend to make a falsification, or tapping. The facility subsystem has an appropriate measure that ensure data security and reliable operation under unattended mode of operator. The software of this system is designed so as to be easily used in other different types of computers. This report describes the outline of the CASDAC system and the results of its performance test. This work has been carried out in the framework of Japan Support Programme for Agency Safeguards (JASPAS) as a project, JA-1. (author)

  9. Watchdog System

    DEFF Research Database (Denmark)

    Madsen, Tanja Kidholm Osmann; Bahnsen, Chris Holmberg; Jensen, Morten Bornø

    This deliverable is part of WP4. Overall WP4 is motivated by the need for automatic systems that can ease the task of annotating massive amounts of traffic data. Concretely this deliverable is related to WP4.2 - the watchdog system. The idea with the watchdog is to develop a system that can remov...... huge chunks of video data where no events/interactions of interest are occurring and hence let a user focus on manually annotation of only the interesting stuff....

  10. Dynamical systems

    CERN Document Server

    Sternberg, Shlomo

    2010-01-01

    Celebrated mathematician Shlomo Sternberg, a pioneer in the field of dynamical systems, created this modern one-semester introduction to the subject for his classes at Harvard University. Its wide-ranging treatment covers one-dimensional dynamics, differential equations, random walks, iterated function systems, symbolic dynamics, and Markov chains. Supplementary materials offer a variety of online components, including PowerPoint lecture slides for professors and MATLAB exercises.""Even though there are many dynamical systems books on the market, this book is bound to become a classic. The the

  11. Water systems

    International Nuclear Information System (INIS)

    Riess, R.

    1980-01-01

    The present paper describes the coolant chemistry and its consequences for 1300 MWsub(e) KWU PWR plants. Some selected systems, i.e. primary heat transport system, steam water cycle and cooling water arrangements, are chosen for this description. Various aspects of coolant chemistry regarding general corrosion, selective types of corrosion and deposits on heat transfer surfaces have been discussed. The water supply systems necessary to fulfill the requirements of the coolant chemistry are discussed as well. It has been concluded that a good operating performance can only be achieved when - beside other factors - the water chemistry has been given sufficient consideration. (orig./RW)

  12. Water systems

    International Nuclear Information System (INIS)

    Riess, R.

    1981-01-01

    The present paper describes the coolant chemistry and its consequences for 1300 MWsub(e) KWU PWR plants. Some selected systems, i.e. primary heat transport system, steam water cycle and cooling water arrangements, are chosen for this description. Various aspects of coolant chemistry regarding general corrosion, selective types of corrosion and deposits on heat transfer surface have been discussed. The water supply systems necessary to fulfill the requirements of the coolant chemistry are discussed as well. It has been concluded that a good operating performance can only be achieved when - beside other factors - the water chemistry has been given sufficient consideration. (orig./RW)

  13. Imaging system

    International Nuclear Information System (INIS)

    Froggatt, R.J.

    1981-01-01

    The invention provides a two dimensional imaging system in which a pattern of radiation falling on the system is detected to give electrical signals for each of a plurality of strips across the pattern. The detection is repeated for different orientations of the strips and the whole processed by compensated back projection. For a shadow x-ray system a plurality of strip x-ray detectors are rotated on a turntable. For lower frequencies the pattern may be rotated with a Dove prism and the strips condensed to suit smaller detectors with a cylindrical lens. (author)

  14. Kaonic systems

    Directory of Open Access Journals (Sweden)

    Oset E.

    2012-12-01

    Full Text Available I make a short review of the situation of the kaonic systems, with novel information supporting the two Λ(1405 states from the K-d → nπΣ reaction. A review is made of the K¯$ar K$NN system with recent calculations converging to smaller bindings and larger widths. Novel systems involving two kaons and one nucleon or three kaons are also reported and finally a short discussion is made of the analogous state DNN for which recent studies find a large binding and a small width.

  15. The systems integration modeling system

    International Nuclear Information System (INIS)

    Danker, W.J.; Williams, J.R.

    1990-01-01

    This paper discusses the systems integration modeling system (SIMS), an analysis tool for the detailed evaluation of the structure and related performance of the Federal Waste Management System (FWMS) and its interface with waste generators. It's use for evaluations in support of system-level decisions as to FWMS configurations, the allocation, sizing, balancing and integration of functions among elements, and the establishment of system-preferred waste selection and sequencing methods and other operating strategies is presented. SIMS includes major analysis submodels which quantify the detailed characteristics of individual waste items, loaded casks and waste packages, simulate the detailed logistics of handling and processing discrete waste items and packages, and perform detailed cost evaluations

  16. ring system

    African Journals Online (AJOL)

    1,3,2-DIAZABORACYCLOALKANE. RING SYSTEM. Negussie Retta" and Robert H. Neilson. 'Department of Chemistry, Addis Ababa University, P.O. Box 1176, Addis Ababa, Ethiopia. Department of Chemistry, Texas Christian University.

  17. Septic Systems

    Science.gov (United States)

    The web site provides guidance and technical assistance for homeowners, government officials, industry professionals, and EPA partners about how to properly develop and manage individual onsite and community cluster systems that treat domestic wastewater.

  18. Respiratory system

    Science.gov (United States)

    Bartlett, R. G., Jr.

    1973-01-01

    The general anatomy and function of the human respiratory system is summarized. Breathing movements, control of breathing, lung volumes and capacities, mechanical relations, and factors relevant to respiratory support and equipment design are discussed.

  19. Bubble systems

    CERN Document Server

    Avdeev, Alexander A

    2016-01-01

    This monograph presents a systematic analysis of bubble system mathematics, using the mechanics of two-phase systems in non-equilibrium as the scope of analysis. The author introduces the thermodynamic foundations of bubble systems, ranging from the fundamental starting points to current research challenges. This book addresses a range of topics, including description methods of multi-phase systems, boundary and initial conditions as well as coupling requirements at the phase boundary. Moreover, it presents a detailed study of the basic problems of bubble dynamics in a liquid mass: growth (dynamically and thermally controlled), collapse, bubble pulsations, bubble rise and breakup. Special emphasis is placed on bubble dynamics in turbulent flows. The analysis results are used to write integral equations governing the rate of vapor generation (condensation) in non-equilibrium flows, thus creating a basis for solving a number of practical problems. This book is the first to present a comprehensive theory of boil...

  20. Systems Biology

    Indian Academy of Sciences (India)

    IAS Admin

    study and understand the function of biological systems, particu- larly, the response of such .... understand the organisation and behaviour of prokaryotic sys- tems. ... relationship of the structure of a target molecule to its ability to bind a certain ...

  1. Bricks / Systems

    DEFF Research Database (Denmark)

    At first glance, this book may appear eclectic. It contains writings from architectural practice in a language and structure based on subjective views and experiences, combined with research contributions based on systematic design investigations of discrete computational systems. Discussions range......, and it aims to illustrate and identify new modes of working in architecture, particularly with regards to brickwork and other complex systems of modular assemblies, whether physical or digital....

  2. Expert Systems

    OpenAIRE

    Lucas, P.J.F.

    2005-01-01

    Expert systems mimic the problem-solving activity of human experts in specialized domains by capturing and representing expert knowledge. Expert systems include a knowledge base, an inference engine that derives conclusions from the knowledge, and a user interface. Knowledge may be stored as if-then rules, orusing other formalisms such as frames and predicate logic. Uncertain knowledge may be represented using certainty factors, Bayesian networks, Dempster-Shafer belief functions, or fuzzy se...

  3. Nanorobotic Systems

    Directory of Open Access Journals (Sweden)

    Lixin Dong

    2008-11-01

    Full Text Available Two strategies towards the realization of nanotechnology have been presented, i.e., top-down and bottom up. The former one is mainly based on nanofabrication and includes technologies such as nano-lithography, nano-imprint, and etching. Presently, they are still 2D fabrication processes with low resolution. The later one is an assembly-based technique. At present, it includes such items as self-assembly, dip-pen lithography, and directed self-assembly. These techniques can generate regular nano patterns in large scales. To fabricate 3D complex nano devices there are still no effective ways by so far. Here we show our effort on the development of a nano laboratory, a prototype nanomanufacturing system, based on nanorobotic manipulations. In which, we take a hybrid strategy as shown in Fig. 1. In this system, nano fabrication and nano assembly can be performed in an arbitrary order to construct nano building blocks and finally nano devices. The most important feature in this system is that the products can be fed back into the system to shrink the system part by part leading to nanorobots. Property characterization can be performed in each intermediate process. Due to the nanorobotic manipulation system, dynamic measurement can be performed rather than conventional static observations.

  4. Fiscal system analysis - contractual systems

    International Nuclear Information System (INIS)

    Kaiser, M.J.

    2006-01-01

    Production sharing contracts are one of the most popular forms of contractual system used in petroleum agreements around the world, but the manner in which the fiscal terms and contract parameters impact system measures is complicated and not well understood. The purpose of this paper is to quantify the influence of private and market uncertainty in contractual fiscal systems. A meta-modelling approach is employed that couples the results of a simulation model with regression analysis to construct numerical functionals that quantify the fiscal regime. Relationships are derived that specify how the present value, rate of return, and take statistics vary as a function of the system parameters. The deepwater Girassol field development in Angola is taken as a case study. (author)

  5. Reactor system

    International Nuclear Information System (INIS)

    Miyano, Hiroshi; Narabayashi, Naoshi.

    1990-01-01

    The represent invention concerns a reactor system with improved water injection means to a pressure vessel of a BWR type reactor. A steam pump is connected to a heat removing system pipeline, a high pressure water injection system pipeline and a low pressure water injection system pipeline for injecting water into the pressure vessel. A pump actuation pipeline is disposed being branched from a main steam pump or a steam relieaf pipeline system, through which steams are supplied to actuate the steam pump and supply cooling water into the pressure vessel thereby cooling the reactor core. The steam pump converts the heat energy into the kinetic energy and elevates the pressure of water to a level higher than the pressure of the steams supplied by way of a pressure-elevating diffuser. Cooling water can be supplied to the pressure vessel by the pressure elevation. This can surely inject cooling water into the pressure vessel upon loss of coolant accident or in a case if reactor scram is necessary, without using an additional power source. (I.N.)

  6. ARAC system

    International Nuclear Information System (INIS)

    Kelly, M.F.; Wyman, R.H.

    1975-01-01

    In spite of the remarkable safety record of the nuclear industry as a whole, recent public concern over the potential impact of the industry's accelerated growth has prompted ERDA to expand its emergency response procedures. The Atmospheric Release Advisory Capability, ARAC, is a computer communications system designed to enhance the existing emergency response capability of ERDA nuclear facilities. ARAC will add at least two new functions to this capability: centralized, real-time data acquisition and storage, and simulation of the long range atmospheric transport of hazardous materials. To perform these functions, ARAC employs four major sub-systems or facilities: the site facility, the central facility, the global weather center and the regional model. The system has been under development for the past two years at the Lawrence Livermore Laboratory of the University of California

  7. Microbiology System

    Science.gov (United States)

    1992-01-01

    Technology originating in a NASA-sponsored study of the measurement of microbial growth in zero gravity led to the development of Biomerieux Vitek, Inc.'s VITEK system. VITEK provides a physician with accurate diagnostic information and identifies the most effective medication. Test cards are employed to identify organisms and determine susceptibility to antibiotics. A photo-optical scanner scans the card and monitors changes in the growth of cells contained within the card. There are two configurations - VITEK and VITEK JR as well as VIDAS, a companion system that detects bacteria, viruses, etc. from patient specimens. The company was originally created by McDonnell Douglas, the NASA contractor.

  8. Spin systems

    CERN Document Server

    Caspers, W J

    1989-01-01

    This book is about spin systems as models for magnetic materials, especially antiferromagnetic lattices. Spin-systems are well-defined models, for which, in special cases, exact properties may be derived. These special cases are for the greater part, one- dimensional and restricted in their applicability, but they may give insight into general properties that also exist in higher dimension. This work pays special attention to qualitative differences between spin lattices of different dimensions. It also replaces the traditional picture of an (ordered) antiferromagnetic state of a Heisenberg sy

  9. Distributed systems

    CERN Document Server

    Van Steen, Maarten

    2017-01-01

    For this third edition of "Distributed Systems," the material has been thoroughly revised and extended, integrating principles and paradigms into nine chapters: 1. Introduction 2. Architectures 3. Processes 4. Communication 5. Naming 6. Coordination 7. Replication 8. Fault tolerance 9. Security A separation has been made between basic material and more specific subjects. The latter have been organized into boxed sections, which may be skipped on first reading. To assist in understanding the more algorithmic parts, example programs in Python have been included. The examples in the book leave out many details for readability, but the complete code is available through the book's Website, hosted at www.distributed-systems.net.

  10. Immune System

    Science.gov (United States)

    ... of the Immune System Print en español El sistema inmunitario Whether you're stomping through the showers ... of Use Notice of Nondiscrimination Visit the Nemours Web site. Note: All information on TeensHealth® is for ...

  11. Operating Systems

    Indian Academy of Sciences (India)

    areas in which this type is useful are multimedia, virtual reality, and advanced scientific projects such as undersea exploration and planetary rovers. Because of the expanded uses for soft real-time functionality, it is finding its way into most current operating systems, including major versions of Unix and Windows NT OS.

  12. Barrier Systems

    NARCIS (Netherlands)

    Heteren, S. van

    2015-01-01

    Barrier-system dynamics are a function of antecedent topography and substrate lithology, Relative sea-level (RSL) changes, sediment availability and type, climate, vegetation type and cover, and various aero- and hydrodynamic processes during fair-weather conditions and extreme events. Global change

  13. Systems Science

    Science.gov (United States)

    Christakis, Alexander; Hammond, Debora; Jackson, Michael; Laszlo, Alexander; Mitroff, Ian; Snowden, Dave; Troncale, Len; Carr-Chellman, Alison; Spector, J. Michael; Wilson, Brent

    2013-01-01

    Scholars representing the field of systems science were asked to identify what they considered to be the most exciting and imaginative work currently being done in their field, as well as how that work might change our understanding. The scholars included Alexander Christakis, Debora Hammond, Michael Jackson, Alexander Laszlo, Ian Mitroff, Dave…

  14. Transport system

    NARCIS (Netherlands)

    Drenth, K.F.

    1999-01-01

    The transport system comprises at least one road surface (2) and at least one vehicle (4) on wheels (6). The road surface (2) has a substantially bowl-shaped cross section and the vehicle (4) is designed so that the wheels (6) run directly on the road surface (2) while the road surface (2) acts as a

  15. Quorum Systems

    DEFF Research Database (Denmark)

    Wattenhofer, Roger; Förster, Klaus-Tycho

    2016-01-01

    What happens if a single server is no longer powerful enough to service all your customers? The obvious choice is to add more servers and to use the majority approach (e.g. Paxos, Chapter 2) to guarantee consistency. However, even if you buy one million servers, a client still has to access more ...... study the theory behind overlapping sets, known as quorum systems....

  16. System Dynamics

    Science.gov (United States)

    Morecroft, John

    System dynamics is an approach for thinking about and simulating situations and organisations of all kinds and sizes by visualising how the elements fit together, interact and change over time. This chapter, written by John Morecroft, describes modern system dynamics which retains the fundamentals developed in the 1950s by Jay W. Forrester of the MIT Sloan School of Management. It looks at feedback loops and time delays that affect system behaviour in a non-linear way, and illustrates how dynamic behaviour depends upon feedback loop structures. It also recognises improvements as part of the ongoing process of managing a situation in order to achieve goals. Significantly it recognises the importance of context, and practitioner skills. Feedback systems thinking views problems and solutions as being intertwined. The main concepts and tools: feedback structure and behaviour, causal loop diagrams, dynamics, are practically illustrated in a wide variety of contexts from a hot water shower through to a symphony orchestra and the practical application of the approach is described through several real examples of its use for strategic planning and evaluation.

  17. System Description:

    DEFF Research Database (Denmark)

    Schürmann, Carsten; Poswolsky, Adam

    2009-01-01

    Delphin is a functional programming language [Adam Poswolsky and Carsten Schürmann. Practical programming with higher-order encodings and dependent types. In European Symposium on Programming (ESOP), 2008] utilizing dependent higher-order datatypes. Delphin's two-level type-system cleanly separates...

  18. Immune System

    Science.gov (United States)

    A properly functioning immune system is essential to good health. It defends the body against infectious agents and in some cases tumor cells. Individuals with immune deficiencies resulting from genetic defects, diseases (e.g., AIDS, leukemia), or drug therapies are more suscepti...

  19. Bioenergy systems

    International Nuclear Information System (INIS)

    Mitchell, C.P.

    1997-01-01

    The objective of this paper is to demonstrate that a bioenergy system has to be considered as an integrated process in which each stage or step interacts with other steps in the overall process. There are a number of stages in the supply and conversion of woody biomass for energy. Each step in the chain has implications for the next step and for overall system efficiency. The resource can take many forms and will have varying physical and chemical characteristics which will influence the efficiency and cost of conversion. The point in the supply chain at which size and moisture content is reduced and the manner in which it is done is influential in determining feedstock delivered cost and overall system costs. To illustrate the interactions within the overall system, the influence of the nature, size and moisture content of delivered feedstocks on costs of generating electricity via thermal conversion processes is examined using a model developed to investigate the inter-relationships between the stages in the supply chain. (author)

  20. Urogenital system

    International Nuclear Information System (INIS)

    Hamm, B.; Asbach, P.; Beyersdorff, D.; Hein, P.; Zaspel, U.

    2007-01-01

    The book is focussed on the radiological diagnostics of diseases in the urogential system. The description of the specific diseases, the identification by modern imaging techniques, the interpretation of examinatory results and therapeutic options are systematically treated in 4 chapters: kidney and adrenal glands, urinary tract, male genitals, female genitals

  1. Mirror systems.

    Science.gov (United States)

    Fogassi, Leonardo; Ferrari, Pier Francesco

    2011-01-01

    Mirror neurons are a class of visuomotor neurons, discovered in the monkey premotor cortex and in an anatomically connected area of the inferior parietal lobule, that activate both during action execution and action observation. They constitute a circuit dedicated to match actions made by others with the internal motor representations of the observer. It has been proposed that this matching system enables individuals to understand others' behavior and motor intentions. Here we will describe the main features of mirror neurons in monkeys. Then we will present evidence of the presence of a mirror system in humans and of its involvement in several social-cognitive functions, such as imitation, intention, and emotion understanding. This system may have several implications at a cognitive level and could be linked to specific social deficits in humans such as autism. Recent investigations addressed the issue of the plasticity of the mirror neuron system in both monkeys and humans, suggesting also their possible use in rehabilitation. WIREs Cogn Sci 2011 2 22-38 DOI: 10.1002/wcs.89 For further resources related to this article, please visit the WIREs website. Copyright © 2010 John Wiley & Sons, Ltd.

  2. Systemic Planning

    DEFF Research Database (Denmark)

    Leleur, Steen

    This book presents principles and methodology for planning in a complex world. It sets out a so-called systemic approach to planning, among other things, by applying “hard” and “soft” methodologies and methods in combination. The book is written for Ph.D and graduate students in engineering...

  3. Energy systems

    International Nuclear Information System (INIS)

    Haefele, W.

    1974-01-01

    Up to the present the production, transmission and distribution of energy has been considered mostly as a fragmented problem; at best only subsystems have been considered. Today the scale of energy utilization is increasing rapidly, and correspondingly, the reliance of societies on energy. Such strong quantitative increases influence the qualitative nature of energy utilization in most of its aspects. Resources, reserves, reliability and environment are among the key words that may characterize the change in the nature of the energy utilization problem. Energy can no longer be considered an isolated technical and economical problem, rather it is embedded in the ecosphere and the society-technology complex. Restraints and boundary conditions have to be taken into account with the same degree of attention as in traditional technical problems, for example a steam turbine. This results in a strong degree of interweaving. Further, the purpose of providing energy becomes more visible, that is, to make survival possible in a civilized and highly populated world on a finite globe. Because of such interweaving and finiteness it is felt that energy should be considered as a system and therefore the term 'energy systems' is used. The production of energy is only one component of such a system; the handling of energy and the embedding of energy into the global and social complex in terms of ecology, economy, risks and resources are of similar importance. he systems approach to the energy problem needs more explanation. This paper is meant to give an outline of the underlying problems and it is hoped that by so doing the wide range of sometimes confusing voices about energy can be better understood. Such confusion starts already with the term 'energy crisis'. Is there an energy crisis or not? Much future work is required to tackle the problems of energy systems. This paper can only marginally help in that respect. But it is hoped that it will help understand the scope of the

  4. Energy systems

    Energy Technology Data Exchange (ETDEWEB)

    Haefele, W [Nuclear Research Centre, Applied Systems Analysis and Reactor Physics, Karlsruhe (Germany); International Institute for Applied Systems Analysis, Laxenburg (Austria)

    1974-07-01

    Up to the present the production, transmission and distribution of energy has been considered mostly as a fragmented problem; at best only subsystems have been considered. Today the scale of energy utilization is increasing rapidly, and correspondingly, the reliance of societies on energy. Such strong quantitative increases influence the qualitative nature of energy utilization in most of its aspects. Resources, reserves, reliability and environment are among the key words that may characterize the change in the nature of the energy utilization problem. Energy can no longer be considered an isolated technical and economical problem, rather it is embedded in the ecosphere and the society-technology complex. Restraints and boundary conditions have to be taken into account with the same degree of attention as in traditional technical problems, for example a steam turbine. This results in a strong degree of interweaving. Further, the purpose of providing energy becomes more visible, that is, to make survival possible in a civilized and highly populated world on a finite globe. Because of such interweaving and finiteness it is felt that energy should be considered as a system and therefore the term 'energy systems' is used. The production of energy is only one component of such a system; the handling of energy and the embedding of energy into the global and social complex in terms of ecology, economy, risks and resources are of similar importance. he systems approach to the energy problem needs more explanation. This paper is meant to give an outline of the underlying problems and it is hoped that by so doing the wide range of sometimes confusing voices about energy can be better understood. Such confusion starts already with the term 'energy crisis'. Is there an energy crisis or not? Much future work is required to tackle the problems of energy systems. This paper can only marginally help in that respect. But it is hoped that it will help understand the scope of the

  5. TUBO system

    International Nuclear Information System (INIS)

    Barbosa, H.J.C.; Guerreiro, J.N.C.; Toledo, E.M.

    1980-01-01

    Proceedings recently incorporated to TUBO system like the seismic analysis and the stress verification acccording to ASME-Boiler Rule and Pressure Vessel Code-section III are presented. The seismic analysis comprehend the consideration of uniform motion of the support, its multiple excitation, and the attainment of the spectral response for both cases. The module for stress verification uses stresses resulting fromthe combination of the loads specified by the user, in the automatic verification of permissible stresses for the pipings class 1 and 2, based on criteria NB-3650 and NC-3650 of ASME. The implementation of these proceedings in the TUBO system are discussed and a numerical example that covers the different phases of a stress analysis in a piping is presented [pt

  6. Solar Systems

    Science.gov (United States)

    1979-01-01

    The solar collectors shown are elements of domestic solar hot water systems produced by Solar One Ltd., Virginia Beach, Virginia. Design of these systems benefited from technical expertise provided Solar One by NASA's Langley Research Center. The company obtained a NASA technical support package describing the d e sign and operation of solar heating equipment in NASA's Tech House, a demonstration project in which aerospace and commercial building technology are combined in an energy- efficient home. Solar One received further assistance through personal contact with Langley solar experts. The company reports that the technical information provided by NASA influenced Solar One's panel design, its selection of a long-life panel coating which increases solar collection efficiency, and the method adopted for protecting solar collectors from freezing conditions.

  7. Bilateral system. The ABACC system

    International Nuclear Information System (INIS)

    Nicolas, Ruben O.

    2001-01-01

    After relating the antecedents of the creation of the Brazilian-Argentine Agency for the Accounting and Control of Nuclear Materials (ABACC), the paper describes the common system of accounting and control set up by Argentina and Brazil. The organization of ABACC is also outlined

  8. Physical system requirements: Overall system

    International Nuclear Information System (INIS)

    1992-01-01

    The Nuclear Waste Policy Act (NWPA) of 1982 assigned to the Department of Energy (DOE) the responsibility for managing the disposal of spent nuclear fuel and high-level radioactive waste and established the Office of Civilian Radioactive Waste Management (OCRWM) for that purpose. The Secretary of Energy, in his November 1989 report to Congress (DOE/RW-0247), announced three new initiatives for conduct of the Civilian Radioactive Waste Management (CRWM) program. One of these initiatives was to establish improved management structure and procedures. In response, OCRWM performed a management study and the Direct subsequently issued the Management Systems Improvement Strategy (MSIS) on August 10, 1990, calling for a rigorous implementation of systems engineering principles with a special emphasis on functional analysis. This approach establishes a framework for integrating the program management efforts with the technical requirements analysis into a single, unified, and consistent program. The functional analysis approach recognizes that just the facilities and equipment comprising the physical waste management system must perform certain functions, so must certain programmatic and management functions be performed within the program in order to successfully bring the physical system into being

  9. Security system

    Science.gov (United States)

    Baumann, Mark J.; Kuca, Michal; Aragon, Mona L.

    2016-02-02

    A security system includes a structure having a structural surface. The structure is sized to contain an asset therein and configured to provide a forceful breaching delay. The structure has an opening formed therein to permit predetermined access to the asset contained within the structure. The structure includes intrusion detection features within or associated with the structure that are activated in response to at least a partial breach of the structure.

  10. Cardiovascular system

    International Nuclear Information System (INIS)

    Soulen, R.L.; Grosh, J.

    1984-01-01

    Invasive cardiovascular diagnostic procedures involve a finite risk and therefore can be recommended only when the benefit appears to exceed the risk by a substantial margin. The risk/benefit ratio varies not only with the procedure concerned but with the status of the vascular system, concomitant diseases, and the risks of both the suspected illness and its treatment. The risks inherent in the procedures per se are detailed in the sections to follow

  11. Priority Systems

    OpenAIRE

    Gössler , Gregor; Sifakis , Joseph

    2004-01-01

    Projet POP_ART; We present a framework for the incremental construction of deadlock-free systems meeting given safety properties. The framework borrows concepts and basic results from the controller synthesis paradigm by considering a step in the construction process as a controller synthesis problem. We show that priorities are expressive enough to represent restrictions induced by deadlock-free controllers preserving safety properties. We define a correspondence between such restrictions an...

  12. Imaging system

    International Nuclear Information System (INIS)

    Rushbrooke, J.G.; Ansorge, R.E.

    1987-01-01

    A moving object such as a container on a conveyor belt is imaged by an optical system onto a charge coupled device array in which the lines of the array are arranged perpendicular to the direction of motion of the object. The speed of movement of the object is sensed to generate electrical signals which are processed to provide shift signals enabling the shifting of data row to row in the array in synchronism with the movement of the container. The electrical charge associated with a given point on the array is transferred from one line to the other until it appears at the last line of the array, from which it is read out in known manner in conjunction with all other electrical charges associated with the row of charge coupled devices in the last line of the array. Due to the integrating effect achieved, the aperture of the imaging system can be much smaller than otherwise would be required, and/or the level of light illumination can be reduced. The imaging system can be applied to X-ray inspection devices, aerial surveillance or scanning of moving documents in copying processes. (author)

  13. Braking system

    Science.gov (United States)

    Norgren, D.U.

    1982-09-23

    A balanced braking system comprising a plurality of braking assemblies located about a member to be braked. Each of the braking assemblies consists of a spring biased piston of a first material fitted into a body of a different material which has a greater contraction upon cooling than the piston material. The piston is provided with a recessed head portion over which is positioned a diaphragm and forming a space therebetween to which is connected a pressurized fluid supply. The diaphragm is controlled by the fluid in the space to contact or withdraw from the member to be braked. A cooling means causes the body within which the piston is fitted to contract more than the piston, producing a tight shrink fit therebetween. The braking system is particularly applicable for selectively braking an arbor of an electron microscope which immobilizes, for example, a vertically adjustable low temperature specimen holder during observation. The system provides balanced braking forces which can be easily removed and re-established with minimal disturbance to arbor location.

  14. Protecting information in systems of systems

    NARCIS (Netherlands)

    Trivellato, D.

    2012-01-01

    Systems of systems are coalitions of autonomous and heterogeneous systems that collaborate to achieve a common goal. The component systems of a system of systems often belong to different security domains, which are governed by different authorities (hereafter called parties). Furthermore, systems

  15. Dynamical systems

    CERN Document Server

    Birkhoff, George D

    1927-01-01

    His research in dynamics constitutes the middle period of Birkhoff's scientific career, that of maturity and greatest power. -Yearbook of the American Philosophical Society The author's great book€¦is well known to all, and the diverse active modern developments in mathematics which have been inspired by this volume bear the most eloquent testimony to its quality and influence. -Zentralblatt MATH In 1927, G. D. Birkhoff wrote a remarkable treatise on the theory of dynamical systems that would inspire many later mathematicians to do great work. To a large extent, Birkhoff was writing about his o

  16. Nuclear systems

    CERN Document Server

    Todreas, Neil E

    2011-01-01

    Principal Characteristics of Power ReactorsIntroductionPower CyclesPrimary Coolant SystemsReactor CoresFuel AssembliesAdvanced Water- and Gas-Cooled Reactors (Generation III And III+)Advanced Thermal and Fast Neutron Spectrum Reactors (Generation IV)ReferencesProblemsThermal Design Principles and ApplicationIntroductionOverall Plant Characteristics Influenced by Thermal Hydraulic ConsiderationsEnergy Production and Transfer ParametersThermal Design LimitsThermal Design MarginFigures of Merit for Core Thermal PerformanceThe Inverted Fuel ArrayThe Equivalent Annulus ApproximationReferencesProble

  17. Videobasierte Systeme

    Science.gov (United States)

    Knoll, Peter

    Videosensoren spielen für Fahrerassistenz systeme eine zentrale Rolle, da sie die Interpretation visueller Informationen (Objektklassifikation) gezielt unterstützen. Im Heckbereich kann die Video sensorik in der einfachsten Variante die ultraschallbasierte Einparkhilfe bei Einpark- und Rangiervorgängen unterstützen. Beim Nachtsichtsystem NightVision wird das mit Infrarotlicht angestrahlte Umfeld vor dem Fahrzeug mit einer Frontkamera aufgenommen und im Fahrzeugcockpit auf einem Display dem Fahrer angezeigt (s. Nachtsichtsysteme). Andere Fahrerassistenzsysteme verarbeiten die Videosignale und generieren daraus gezielt Informationen, die für eigenständige Funktionen (z. B. Spurverlassenswarner) oder aber als Zusatzinformation für andere Funktionen ausgewertet werden (Sensordatenfusion).

  18. Relaxation System

    Science.gov (United States)

    1987-01-01

    Environ Corporation's relaxation system is built around a body lounge, a kind of super easy chair that incorporates sensory devices. Computer controlled enclosure provides filtered ionized air to create a feeling of invigoration, enhanced by mood changing aromas. Occupant is also surrounded by multidimensional audio and the lighting is programmed to change colors, patterns, and intensity periodically. These and other sensory stimulators are designed to provide an environment in which the learning process is stimulated, because research has proven that while an individual is in a deep state of relaxation, the mind is more receptive to new information.

  19. Bearing system

    Science.gov (United States)

    Kapich, Davorin D.

    1987-01-01

    A bearing system includes backup bearings for supporting a rotating shaft upon failure of primary bearings. In the preferred embodiment, the backup bearings are rolling element bearings having their rolling elements disposed out of contact with their associated respective inner races during normal functioning of the primary bearings. Displacement detection sensors are provided for detecting displacement of the shaft upon failure of the primary bearings. Upon detection of the failure of the primary bearings, the rolling elements and inner races of the backup bearings are brought into mutual contact by axial displacement of the shaft.

  20. Propulsion Systems

    Science.gov (United States)

    2011-03-31

    stand.    CV CS x dAvvdVov dt d F   (18-1) Where  denotes density and vx is the velocity in the x-direction. The first term on the...by  but to avoid confusion with  from Eqs. 18-7 to 10, it is denoted k in this formula . Ru is the universal gas constant (8.314472 J/mol K), pe is...Russian Federation Used on Phobos spacecraft as main engines 74 1.03 NTO/ UDMH 13.73-19.61 316-325 Orbital Maneuvering System 1 Aerojet Shuttle

  1. Expert Systems: What Is an Expert System?

    Science.gov (United States)

    Duval, Beverly K.; Main, Linda

    1994-01-01

    Describes expert systems and discusses their use in libraries. Highlights include parts of an expert system; expert system shells; an example of how to build an expert system; a bibliography of 34 sources of information on expert systems in libraries; and a list of 10 expert system shells used in libraries. (Contains five references.) (LRW)

  2. System analysis and design

    International Nuclear Information System (INIS)

    Son, Seung Hui

    2004-02-01

    This book deals with information technology and business process, information system architecture, methods of system development, plan on system development like problem analysis and feasibility analysis, cases for system development, comprehension of analysis of users demands, analysis of users demands using traditional analysis, users demands analysis using integrated information system architecture, system design using integrated information system architecture, system implementation, and system maintenance.

  3. Posting system

    International Nuclear Information System (INIS)

    Hackney, S.

    1983-01-01

    A system for posting hazardous materials into and out of an enclosure, such as a glovebox, through a port in a wall of the enclosure. The port is normally closed by a door which cooperates with a removable end closure, on a container or the like when the latter is presented to and secured at the port. The container is secured in position at the port by means of a rotatable coupling ring. A single interlock ensures that the door cannot be opened in the absence of a container at the port and also that the container cannot be removed from the port when the door is open. In place of the container, a glove secured to a rigid sleeve may be used to enable the operator to perform a work function within the glovebox. (author)

  4. hydrothermal systems

    Directory of Open Access Journals (Sweden)

    L. Bayón

    2002-01-01

    Full Text Available In this paper, we revise the classical formulation of the problem depriving it of the concepts that are superfluous from the mathematical point of view. We observe that a number of power stations can be substituted by a single one that behaves equivalently to the entire set. Proceeding in this way, we obtain a variational formulation in its purest sense (without restrictions. This formulation allows us to employ the theory of calculus of variations to the highest degree. We then calculate the equivalent minimizer in the case where the cost functions are second-order polynomials. We prove that the equivalent minimizer is a second-order polynomial with piece-wise constant coefficients. Moreover, it belongs to the class C1. Finally, we present various examples prompted by real systems and perform the proposed algorithms using Mathematica.

  5. Nonlinear systems

    CERN Document Server

    Palmero, Faustino; Lemos, M; Sánchez-Rey, Bernardo; Casado-Pascual, Jesús

    2018-01-01

    This book presents an overview of the most recent advances in nonlinear science. It provides a unified view of nonlinear properties in many different systems and highlights many  new developments. While volume 1 concentrates on mathematical theory and computational techniques and challenges, which are essential for the study of nonlinear science, this second volume deals with nonlinear excitations in several fields. These excitations can be localized and transport energy and matter in the form of breathers, solitons, kinks or quodons with very different characteristics, which are discussed in the book. They can also transport electric charge, in which case they are known as polarobreathers or solectrons. Nonlinear excitations can influence function and structure in biology, as for example, protein folding. In crystals and other condensed matter, they can modify transport properties, reaction kinetics and interact with defects. There are also engineering applications in electric lattices, Josephson junction a...

  6. Posting system

    International Nuclear Information System (INIS)

    Jones, E.L.

    1983-01-01

    A posting system for the movement of equipment, such as a manipulator, into and out of an enclosure e.g. a cell or glovebox, for toxic or radioactive materials has the manipulator arranged within a collapsible bellows-like container with an end of the container cooperating with a port entry to the enclosure. The collapsible container isolates the manipulator from the environment outside the enclosure and allows the manipulator to enter and leave the contaminated enclosure without breach of the containment. A particular construction of cell for use with radioactive material is described, having a thick wall of shielding material such as concrete provided with a door normally closed by a Pb shutter and having a cylindrical gamma shield block located over the shutter on the exterior of the wall. (author)

  7. Annual public information report about the Chooz nuclear facilities - 2015. This report is written in compliance with articles L. 125-15 and L125-16 of the French environment code

    International Nuclear Information System (INIS)

    2016-01-01

    This safety report was established in accordance with articles L. 125-15 and L. 125-16 of the French environmental code. It presents, first, the NPPs (INBs no. 139, 144 and 163 (under dismantling)). Then, the nuclear safety and radiation protection measures taken regarding the facilities are reviewed: nuclear safety definition, radiation protection of intervening parties, safety and radiation protection improvement paths, crisis management, external and internal controls, technical situation of facilities, administrative procedures in progress. The incidents and accidents which occurred in 2015, if any, are reported as well as the radioactive and non-radioactive effluents discharge in the environment. Finally, the radioactive materials and wastes generated by the facility are presented (type of waste, quantities, conditioning process). The document concludes with a presentation of the actions of communication and public information made by the direction of the facility. A glossary and the list of recommendations from the Committees for health, safety and working conditions are given in appendix

  8. Evaluating the fall risk among elderly population by choice step reaction test

    Directory of Open Access Journals (Sweden)

    Wang D

    2016-08-01

    Full Text Available Donghai Wang,1 Jian Zhang,1 Yuliang Sun,2 Wenfei Zhu,2 Shiliu Tian,1 Yu Liu1 1Key Laboratory of Exercise and Health Sciences of the Ministry of Education, Shanghai University of Sport, Shanghai, People’s Republic of China; 2School of Physical Education, Shaanxi Normal University, Xian, People’s Republic of China Abstract: Falls during daily activities are often associated with injuries and physical disabilities, thereby affecting quality of life among elder adults. Balance control, which is crucial in avoiding falls, is composed of two elements: muscle strength and central nervous system (CNS control. A number of studies have reported that reduced muscle strength raises the risk of falling. However, to date there has been only limited research focused on the relationship between fall risk and the CNS. This study aimed to investigate the relationship between CNS and risk of falling among the elderly. A total of 140 elderly people (92 females and 48 males were divided into faller and nonfaller groups based on questionnaire responses concerning falls in their daily life. Participants undertook a choice step reaction test in which they were required to respond to random visual stimuli using foot movements as fast as possible in the left or right directions. Response time was quantified as premotor time (PMT and motor time (MT. In addition, the participants’ electromyography data were recorded during the choice step reaction test. A maximal isokinetic torque test was also performed. PMT was greater in the fallers than in the nonfallers group. There was a significant difference between fall status and direction on PMT. PMT of the left limb in nonfallers was faster than the right, but in fallers there was no difference between left and right limbs. A similar phenomenon was also observed for MT. There were significant differences between fallers and nonfallers in maximum isokinetic torque at knee and ankle joints. The correct rate of PMT was

  9. Systems engineering simplified

    CERN Document Server

    Cloutier, Robert; Bone, Mary Alice

    2015-01-01

    IntroductionOverviewDiscussion of Common TerminologyThe Case for Systems EngineeringA Brief History of Systems EngineeringSystem ExamplesSummaryThe System Life CycleManaging System Development-The Vee ModelSystem ProductionSystem Utilization and SupportSystem Retirement and DisposalOther Systems Engineering Development ModelsSpiral ModelAgile Model for Systems EngineeringSystem of InterestAbstraction and DecompositionIntegrationDeveloping and Managing RequirementsCyclone Requiremen

  10. NJOY system

    International Nuclear Information System (INIS)

    Gil, Choong Sup; Kim, Jung Do

    1998-01-01

    The NJOY Nuclear Data Processing System is used to convert evaluated nuclear data in ENDF format into forms useful for applications. The NJOY code is a modular computer code designed to read evaluated data in ENDF format, transform the data in various ways, and output the results as libraries designed to be used in various applications. The modules are essentially independent programs, and they communicate with each other using input and output files, plus a very few common variables. The NJOY code can work with neutrons, photons, and charged particles. The evaluated nuclear data are reconstructed to pointwise cross sections from ENDF resonance parameters and interpolation schemes. The pointwise data can be Doppler broadened to the temperatures requested by users. The data in unresolved energy range can be computed to effective self-shielded pointwise cross sections. The cross sections and scattering matrices for free or bound scatterers in the thermal energy range are able to be produced. The self-shielded multigroup cross sections, group-to-group scattering matrices, photon-production matrices, and charged-particle cross sections from pointwise data can be generated for various application codes

  11. Chem systems

    International Nuclear Information System (INIS)

    Anon.

    1992-01-01

    This paper reports that world styrene demand, paced by a near doubling of combined requirements in East Asia and Oceania, could reach 19.3 million metric tons by 2000, an average growth rate of 3.7%/year. So concludes Chem Systems Inc., Tarrytown, N.Y., in a study of world styrene markets through the end of the century. Pacific Rim styrene production and consumption throughout the 1990s are predicted to make up increasingly larger shares of world markets, while demand and production lag in the U.S. and western Europe. Demand and capacity in other parts of the world will grow in real terms, increasing combined market shares only slightly. Most of the increase will be driven by demand in East Asia and Oceania, where consumption by century's end is expected to increase 4.48 million metric tons from 2.25 million tons in 1991. Meantime, Japan's styrene demand in 2000 is projected at 2.64 million tons, a 500,000 ton increase from 1991 demand but a net market loss of 1.9%

  12. Characterizing ICF Neutron Scintillation Diagnostics on the nTOF line at SUNY Geneseo

    Science.gov (United States)

    Lawson-Keister, Pat; Padawar-Curry, Jonah; Visca, Hannah; Fletcher, Kurt; Padalino, Stephen; Sangster, T. Craig; Regan, Sean

    2015-11-01

    Neutron scintillator diagnostics for ICF and HEDP can be characterized using the neutron time-of-flight (nTOF) line on Geneseo's 1.7 MV tandem Pelletron accelerator. Neutron signals can be differentiated from gamma signals by employing coincidence methods. A 1.8-MeV beam of deuterons incident on a deuterated polyethylene target produces neutrons via the 2H(d,n)3He reaction. Neutrons emerging at a lab angle of 88° have an energy of 2.96 MeV; the 3He ions associated with these neutrons are detected at a scattering angle of 43° using a surface barrier detector. The time of flight of the neutron can be measured by using the 3He detection as a ``start'' signal and the scintillation detection as a ``stop'' signal. This time of flight requirement is used to identify the 2.96-MeV neutron signals in the scintillator. To measure the light curve produced by these monoenergetic neutrons, two photomultiplier (PMT) tubes are attached to the scintillator. The full aperture PMT establishes the nTOF coincidence. The other PMT is fitted with a pinhole to collect single events. The time between the full aperture PMT signal and the arrival of the signal in the pinhole PMT is used to determine the light curve for the scintillator. This system will enable the neutron response of various scintillators to be compared. Supported in part by the Department of Energy National Nuclear Security Administration under Award Number DE-NA0001944.

  13. Effect of cyclic, low dose pyrimethamine treatment in patients with Late Onset Tay Sachs: an open label, extended pilot study.

    Science.gov (United States)

    Osher, Etty; Fattal-Valevski, Aviva; Sagie, Liora; Urshanski, Nataly; Sagiv, Nadav; Peleg, Leah; Lerman-Sagie, Tally; Zimran, Ari; Elstein, Deborah; Navon, Ruth; Valevski, Avi; Stern, Naftali

    2015-04-17

    Late Onset Tay- Sachs disease (LOTS) is a rare neurodegenerative lysosomal storage disease which results from mutations in the gene encoding the α subunit (HEXA) of β-hexosaminidase enzyme (HexA). At the present time, no effective treatment exists for LOTS and other neurodegenerative diseases involving the central nerve system (CNS). Pyrimethamine (PMT) was previously shown to act as a HexA chaperone in human fibroblasts in vitro carrying some (e.g., αG269S), but not all LOTS-related mutations. The present study assessed the effect of cyclic, low dose and long term pyrimethamine treatment on HexA in subjects with LOTS. In an open label trial in 4 LOTS patients, PMT was initiated at an average daily dose of ~2.7 mg and administered cyclically guided by blood lymphocyte HexA activity for a mean duration of 82.8 (±22.5; SD) weeks (~1.5 year). HexA activity rose in all subjects, with a mean peak increase of 2.24 folds (±0.52; SD) over baseline activity (range 1.87-3). The mean treatment time required to attain this peak was of 15.7 (±4.8; SD) weeks. Following increase in activity, HexA gradually declined with the continued use of PMT, which was then stopped, resulting in the return of HexA activity to baseline. A second cycle of PMT treatment was then initiated, resulting again in an increase in HexA activity. Three of the patients experienced a measurable neuropsychiatric deterioration whereas one subject remained entirely stable. Cyclic low dose of PMT can increase HexA activity in LOTS patients. However, the observed increase is repeatedly transient and not associated with discernible beneficial neurological or psychiatric effects.

  14. Inception of the light water reactor system in France and its fuel cycle

    International Nuclear Information System (INIS)

    Gaussot, D.; Elkouby, A.; Sornein, J.

    1977-01-01

    The electro-nuclear equipment program of Electricite de France (E.D.F.) currently is based on the construction or the commitment of a considerable number of units equiped with pressurized water reactors. The program was preceded by the construction jointly by EDF and Belgian electric utilities of nuclear plants at Chooz (SENA) and Tihange (SEMO). The program as such began with the construction of Units 1 and 2 at Fessenheim, (of which information is given on the start-up), then of Bugey 2, 3, 4 and 5. This was followed by the construction of a series of units of 900 MW, and since 1976, of a series of units of 1300 MW. The successful implementation of such a program is based on a number of technical and organizational guidelines, which are described. The main characteristics of the 3-loop 900 MW and 4-loop 1300 MW NSSS and their fuel are considered. Stress is laid in particular on the development of the 900 MW NSSS from Fessenheim to Bugey. These programs call for winning and processing a great deal of nuclear material right through the fuel cycle. Data are given on the quantities involved and on the production potential permitting the fulfillment of the program (nat. U, enriched UF 6 , fuel subassemblies, reprocessing). The requirements of the EDF, (the NSSS supplier and the industries), the contribution made by the French Atomic Energy Commission (CEA), and international cooperation now in progress, are described. Lastly a number of significant actions both under way and scheduled, are discussed [fr

  15. System safety education focused on system management

    Science.gov (United States)

    Grose, V. L.

    1971-01-01

    System safety is defined and characteristics of the system are outlined. Some of the principle characteristics include role of humans in hazard analysis, clear language for input and output, system interdependence, self containment, and parallel analysis of elements.

  16. Systems Biology and Health Systems Complexity in;

    NARCIS (Netherlands)

    Donald Combs, C.; Barham, S.R.; Sloot, P.M.A.

    2016-01-01

    Systems biology addresses interactions in biological systems at different scales of biological organization, from the molecular to the cellular, organ, organism, societal, and ecosystem levels. This chapter expands on the concept of systems biology, explores its implications for individual patients

  17. Airport Information Retrieval System (AIRS) System Design

    Science.gov (United States)

    1974-07-01

    This report presents the system design for a prototype air traffic flow control automation system developed for the FAA's Systems Command Center. The design was directed toward the immediate automation of airport data for use in traffic load predicti...

  18. System specifications for the NDS Dictionary System

    International Nuclear Information System (INIS)

    Attree, P.M.; Smith, P.M.

    1979-09-01

    The NDS Dictionary System is a computerized system for maintaining and distributing the EXFOR dictionaries and for preparing internal versions of these dictionaries for use in the NDS EXFOR System and other NDS systems. This document is an internal manual for the system specifications of the NDS Dictionary System. It includes flow charts, system and program summaries, input and output specifications and file and record descriptions. This manual is updated from time to time when system modifications are made; this is the version of January 1979

  19. Protein (Cyanobacteria): 78779802 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 1196 ... hypothetical protein PMT9312_1418 Prochlorococcus marinus str. MIT 9312 MKFLTTLFLKLLLLSNFVIAETIPTKSNILKQSSECIKDSQNQICRELVSKLEKLQYVVFDQNRFKCQSSLLGLQSELIEAYFLKSLSKKRISFMIPYVIKNC

  20. Quality management system

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Mu Sung

    2009-08-15

    This book deals with ISO9001 quality management system which includes summary of this system such as classification of quality, principle of quality management, and definition, requirement and procedure of quality management system, introduction of ISO9001 system like model of ISO9001 quality management system, ISO certificate system, structure of ISO9001 standard, requirement of ISO9001 quality management system, process approach and documentation of system, propel cases of ISO9001 quality management system.

  1. Quality management system

    International Nuclear Information System (INIS)

    Lee, Mu Sung

    2009-08-01

    This book deals with ISO9001 quality management system which includes summary of this system such as classification of quality, principle of quality management, and definition, requirement and procedure of quality management system, introduction of ISO9001 system like model of ISO9001 quality management system, ISO certificate system, structure of ISO9001 standard, requirement of ISO9001 quality management system, process approach and documentation of system, propel cases of ISO9001 quality management system.

  2. Experience feedback of computerized controlled nuclear power plants

    International Nuclear Information System (INIS)

    Poizat, F.

    2004-01-01

    The N4 step of French PWR-type nuclear power plants is characterized by an instrumentation and control system entirely computerized (operation procedures including normal and accidental operation). Four power plants of this type (Chooz and Civaux sites) of 1450 MWe each were connected to the power grid between August 1996 and December 1999. The achievement of this program make it possible and necessary to carry out an experience feedback about the development, successes and difficulties encountered in order to draw out some lessons for future realizations. This is the aim of this article: 1 - usefulness and difficulties of such an experience feedback: evolution of instrumentation and control systems, necessary cautions; 2 - a successful computerized control: checking of systems operation, advantages, expectations; 3 - efficiency of computerized systems: demonstration of operation safety, profitability; 4 - conclusions and interrogations: system approach instead of 'micro-software' approach, commercial or 'made to measure' products, contract agreement with a supplier, when and how upgrading. (J.S.)

  3. Protecting Information in Systems of Systems

    NARCIS (Netherlands)

    Trivellato, Daniel; Zannone, Nicola; Etalle, Sandro

    2011-01-01

    Systems of Systems (SoS) are dynamic, distributed coalitions of autonomous and heterogeneous systems that collaborate to achieve a common goal. While offering several advantages in terms of scalability and flexibility, the SoS paradigm has a strong impact on system interoperability and on the

  4. A security framework for systems of systems

    NARCIS (Netherlands)

    Trivellato, D.; Zannone, N.; Etalle, S.

    2011-01-01

    Systems of systems consist of a wide variety of dynamic, distributed coalitions of autonomous and heterogeneous systems that collaborate to achieve a common goal. While offering several advantages in terms of scalability and flexibility, this new paradigm has a strong impact on system

  5. A Security Framework for Systems of Systems

    NARCIS (Netherlands)

    Trivellato, Daniel; Zannone, Nicola; Etalle, Sandro

    2011-01-01

    Systems of systems consist of a wide variety of dynamic, distributed coalitions of autonomous and heterogeneous systems that collaborate to achieve a common goal. While offering several advantages in terms of scalability and flexibility, this new paradigm has a strong impact on system

  6. Systems theory of interconnected port contact systems

    NARCIS (Netherlands)

    Eberard, D.; Maschke, B.M.; Schaft, A.J. van der

    2005-01-01

    Port-based network modeling of a large class of complex physical systems leads to dynamical systems known as port-Hamiltonian systems. The key ingredient of any port-Hamiltonian system is a power-conserving interconnection structure (mathematically formalized by the geometric notion of a Dirac

  7. Digital processing data communication systems (bus systems)

    International Nuclear Information System (INIS)

    Fleck, K.

    1980-01-01

    After an introduction to the technology of digital processing data communication systems there are the following chapters: digital communication of processing data in automation technology, the technology of biserial communication, the implementaiton of a bus system, the data transmission of the TDC-2000 system of Honeywell's and the process bus CS 275 in the automation system TELEPERM M of Siemens AG. (WB) [de

  8. Networked control of microgrid system of systems

    Science.gov (United States)

    Mahmoud, Magdi S.; Rahman, Mohamed Saif Ur; AL-Sunni, Fouad M.

    2016-08-01

    The microgrid has made its mark in distributed generation and has attracted widespread research. However, microgrid is a complex system which needs to be viewed from an intelligent system of systems perspective. In this paper, a network control system of systems is designed for the islanded microgrid system consisting of three distributed generation units as three subsystems supplying a load. The controller stabilises the microgrid system in the presence of communication infractions such as packet dropouts and delays. Simulation results are included to elucidate the effectiveness of the proposed control strategy.

  9. D0 Cryo System Control System Autodialer

    Energy Technology Data Exchange (ETDEWEB)

    Urbin, J.; /Fermilab

    1990-04-17

    The DO cryogenic system is controlled by a TI565-PLC based control system. This allows the system to be unmanned when in steady state operation. System experts will need to be contacted when system parameters exceed normal operating points and reach alarm setpoints. The labwide FIRUS system provides one alarm monitor and communication link. An autodialer provides a second and more flexible alarm monitor and communication link. The autodialer monitors contact points in the control system and after receiving indication of an alarm accesses a list of experts which it calls until it receives an acknowledgement. There are several manufacturers and distributors of autodialer systems. This EN explains the search process the DO cryo group used to fmd an autodialer system that fit the cryo system's needs and includes information and specs for the unit we chose.

  10. Superspeed Maglev system Transrapid. System decription

    Energy Technology Data Exchange (ETDEWEB)

    Miller, L [Thyssen Henschel AG,, Maglev Transportation Technology, Muenchen (Germany)

    1996-12-31

    The superspeed maglev system Transrapid is a track-bound transportation system for passengern and priority freight transport. The transrapid trainsets are composed of self-sufficient vehicle section coupled together. The superspeed maglev system Transrapid is capable of revenue operation at speeds of 100 to 500 km/h. Besides the description of the system concept and system characteristics safety and availability are discussed. (HW)

  11. System design specification Brayton Isotope Power System (BIPS) Flight System (FS), and Ground Demonstration System (GDS)

    International Nuclear Information System (INIS)

    1976-01-01

    The system design specification for ground demonstration, development, and flight qualification of a Brayton Isotope Power System (BIPS) is presented. The requirements for both a BIPS conceptual Flight System (FS) and a Ground Demonstration System (GDS) are defined

  12. Situation awareness with systems of systems

    CERN Document Server

    Tretmans, Jan; Borth, Michael

    2013-01-01

    This book discusses various aspects, challenges, and solutions for developing systems-of-systems for situation awareness, using applications in the domain of maritime safety and security.  Topics include advanced, multi-objective visualization methods for situation awareness, stochastic outlier selection, rule-based anomaly detection, an ontology-based event model for semantic reasoning, new methods for semi-automatic generation of adapters bridging communication gaps, security policies for systems-of-systems, trust assessment, and methods to deal with the dynamics of systems-of-systems in run-time monitoring, testing, and diagnosis. Architectural considerations for designing information-centric systems-of-systems such as situation awareness systems, and an integrated demonstrator implementing many of the investigated aspects, complete the book.

  13. System specifications for the NDS EXFOR System

    International Nuclear Information System (INIS)

    Attree, P.M.; Smith, P.M.

    1979-07-01

    EXFOR is the agreed exchange format for the magnetic-tape exchange of nuclear reaction data between national and international nuclear data centres for the benefit of nuclear data users in all countries. The NDS EXFOR System is a computerized system for the storage and retrieval of EXFOR information compiled or received by the IAEA. This document is an internal manual for the system specifications of the NDS EXFOR System. It includes flow charts, system and program summaries, input and output specifications and file and record descriptions. The manual is updated from time to time when system modifications are made

  14. System specifications for the NDS EXFOR System

    Energy Technology Data Exchange (ETDEWEB)

    Attree, P M; Smith, P M

    1982-06-01

    EXFOR is the agreed exchange format for the magnetic-tape exchange of nuclear reaction data between national and international nuclear data centers for the benefit of nuclear data users in all countries. The NDS EXFOR System is a computerized system for the storage and retrieval of EXFOR information compiled or received of the IAEA. This document is an internal manual for the system specifications of the NDS EXFOR System. It includes flow charts, system and program summaries, input and output specifications and file and record descriptions. The manual is updated from time to time when system modifications are made; the first version was issued in July 1979. (author)

  15. Computer System Design System-on-Chip

    CERN Document Server

    Flynn, Michael J

    2011-01-01

    The next generation of computer system designers will be less concerned about details of processors and memories, and more concerned about the elements of a system tailored to particular applications. These designers will have a fundamental knowledge of processors and other elements in the system, but the success of their design will depend on the skills in making system-level tradeoffs that optimize the cost, performance and other attributes to meet application requirements. This book provides a new treatment of computer system design, particularly for System-on-Chip (SOC), which addresses th

  16. Beer-Lambert-Law Parametric Model of Reflectance Spectra for Dyed Fabrics

    Science.gov (United States)

    2016-06-06

    reflections from layered systems (i.e., scattering matrix formulations) [12,13,14], the Kubelka-Munk theory of diffuse reflectance (and formulations...mode. The Lambda 1050 incorporated a double beam, 150 mm integrating sphere housing a photomultiplier tube (PMT) detector for the UV-Vis (175 – 860 nm...of the combined system of dye and fabric. This relation follows from the Beer-Lambert law and formalism of the scattering- matrix [20]. In particular

  17. Smart electromechanical systems the central nervous system

    CERN Document Server

    Kurbanov, Vugar

    2017-01-01

    This book describes approaches to solving the problems of developing the central nervous system of robots (CNSR) based on smart electromechanical systems (SEMS) modules, principles of construction of the various modules of the central nervous system and variants of mathematical software CNSR in control systems for intelligent robots. It presents the latest advances in theory and practice at the Russian Academy of Sciences. Developers of intelligent robots to solve modern problems in robotics are increasingly addressing the use of the bionic approach to create robots that mimic the complexity and adaptability of biological systems. These have smart electromechanical system (SEMS), which are used in various cyber-physical systems (CPhS), and allow the functions of calculation, control, communications, information storage, monitoring, measurement and control of parameters and environmental parameters to be integrated. The behavior of such systems is based on the information received from the central nervous syst...

  18. Multiobjective Collaborative Optimization of Systems of Systems

    National Research Council Canada - National Science Library

    Wolf, Robert A

    2005-01-01

    ...; in other words an inefficient design of the system of systems. This thesis examines the simultaneous design of several ships using the sea base concept as an example application of a network of ships working together...

  19. Situation Awareness with Systems of Systems

    NARCIS (Netherlands)

    Laar, P. van de; Tretmans, J.; Borth, M.

    2013-01-01

    This book discusses various aspects, challenges, and solutions for developing systems-of-systems for situation awareness, using applications in the domain of maritime safety and security. Topics include advanced, multi-objective visualization methods for situation awareness, stochastic outlier

  20. Linking Political Systems and War Systems

    DEFF Research Database (Denmark)

    Harste, Gorm

    2009-01-01

    Decisive parts of the Western political system have demonstrated a seemingly surprising misinterpretation of military might. As Madelaine Albright has suggested, the mighty perceived themselves as "almighty". Political power seems to have invested in instrumental coercive power relations and found...... military coercion to be the appropriate mean. Using the system theory and the theory of systemic risks displayed by the German sociologist Niklas Luhmann the article demonstrates how military systems due to their own autonomy and autopoiesis do not fit into the idea of political government....... The Clausewitzian ideal of a political system that could continue its power games by means of war was moderated by Clausewitz' own analysis of "friction". How can a political system be so blind towards the possibilities of another system? What are the risks of systemic blind spots? The argument of the paper...

  1. Designing information systems

    CERN Document Server

    Blethyn, Stanley G

    2014-01-01

    Designing Information Systems focuses on the processes, methodologies, and approaches involved in designing information systems. The book first describes systems, management and control, and how to design information systems. Discussions focus on documents produced from the functional construction function, users, operators, analysts, programmers and others, process management and control, levels of management, open systems, design of management information systems, and business system description, partitioning, and leveling. The text then takes a look at functional specification and functiona

  2. Cognitive Medical Multiagent Systems

    OpenAIRE

    Barna Iantovics

    2010-01-01

    The development of efficient and flexible agent-based medical diagnosis systems represents a recent research direction. Medical multiagent systems may improve the efficiency of traditionally developed medical computational systems, like the medical expert systems. In our previous researches, a novel cooperative medical diagnosis multiagent system called CMDS (Contract Net Based Medical Diagnosis System) was proposed. CMDS system can solve flexibly a large variety of medical diagnosis problems...

  3. Report on the current situation and the perspectives for nuclear equipment in France

    International Nuclear Information System (INIS)

    Vietti, A.; Hubert, G.; Frant, G.

    1994-01-01

    1993 was the year the 1300 MW series was completed as the twentieth GOLFECH 2 unit came on line. The 1400 MW-N4 series has progressed as planned: the first CHOOZ B unit is due to be connected to the grid in the Winter of 95/96. The fourth unit of the series, CIVAUX 2 was engaged in 1993. As for the FNR system, 1994 should be the year when the CREYS-MALVILLE power plant project, which will play a vital role in gathering industrial experience on this system, is restarted. In spite of the present weak development forecasts, nuclear power has strong prospects over the next fifty years. Therefore, EDF is working on several projects with the object of reinforcing safety and maintaining economic competitiveness, while, at the same time, taking into account the results of the research carried out into different systems and industrial criteria. (authors). 5 figs

  4. Non linear system become linear system

    Directory of Open Access Journals (Sweden)

    Petre Bucur

    2007-01-01

    Full Text Available The present paper refers to the theory and the practice of the systems regarding non-linear systems and their applications. We aimed the integration of these systems to elaborate their response as well as to highlight some outstanding features.

  5. System Design of the SWRL Financial System.

    Science.gov (United States)

    Ikeda, Masumi

    To produce various management and accounting reports in order to maintain control of SWRL (Southwest Regional Laboratory) operational and financial activities, a computer-based SWRL financial system was developed. The system design is outlined, and various types of system inputs described. The kinds of management and accounting reports generated…

  6. Triggering system innovation in agricultural innovation systems

    NARCIS (Netherlands)

    Turner, James A.; Williams, Tracy; Nicholas, Graeme; Foote, Jeff; Rijswijk, Kelly; Barnard, Tim; Beechener, Sam; Horita, Akiko

    2017-01-01

    This article describes a process for stimulating engagement among change agents to develop a shared understanding of systemic problems in the agricultural innovation system (AIS), challenge prevalent institutional logics and identify actions they might undertake to stimulate system innovation.

  7. Port contact systems for irreversible thermodynamical systems

    NARCIS (Netherlands)

    Eberard, D.; Maschke, B.M.; Schaft, A.J. van der

    2005-01-01

    In this paper we propose a definition of control contact systems, generalizing input-output Hamiltonian systems, to cope with models arising from irreversible Thermodynamics. We exhibit a particular subclass of these systems, called conservative, that leaves invariant some Legendre submanifold (the

  8. Modeling learning technology systems as business systems

    NARCIS (Netherlands)

    Avgeriou, Paris; Retalis, Symeon; Papaspyrou, Nikolaos

    2003-01-01

    The design of Learning Technology Systems, and the Software Systems that support them, is largely conducted on an intuitive, ad hoc basis, thus resulting in inefficient systems that defectively support the learning process. There is now justifiable, increasing effort in formalizing the engineering

  9. General Systems Theory and Instructional Systems Design.

    Science.gov (United States)

    Salisbury, David F.

    1990-01-01

    Describes basic concepts in the field of general systems theory (GST) and identifies commonalities that exist between GST and instructional systems design (ISD). Models and diagrams that depict system elements in ISD are presented, and two matrices that show how GST has been used in ISD literature are included. (11 references) (LRW)

  10. Expert systems in process control systems

    International Nuclear Information System (INIS)

    Wittig, T.

    1987-01-01

    To illustrate where the fundamental difference between expert systems in classical diagnosis and in industrial control lie, the work of process control instrumentation is used as an example for the job of expert systems. Starting from the general process of problem-solving, two classes of expert systems can be defined accordingly. (orig.) [de

  11. Expert Systems for auditing management information systems

    Directory of Open Access Journals (Sweden)

    Gheroghe Popescu

    2007-05-01

    Full Text Available Expert systems are built with the help of: specialised programming languages or expert system generators (shell. But this structure was reached after tens of years of work and research, because expert systems are nothing but pragmatic capitalisation of the results of research carried out in artificial intelligence and theory of knowledge.

  12. Psychology of system design

    CERN Document Server

    Meister, D

    2014-01-01

    This is a book about systems, including: systems in which humans control machines; systems in which humans interact with humans and the machine component is relatively unimportant; systems which are heavily computerized and those that are not; and governmental, industrial, military and social systems. The book deals with both traditional systems like farming, fishing and the military, and with systems just now tentatively emerging, like the expert and the interactive computer system. The emphasis is on the system concept and its implications for analysis, design and evaluation of these many di

  13. Biomedical signals and systems

    CERN Document Server

    Tranquillo, Joseph V

    2013-01-01

    Biomedical Signals and Systems is meant to accompany a one-semester undergraduate signals and systems course. It may also serve as a quick-start for graduate students or faculty interested in how signals and systems techniques can be applied to living systems. The biological nature of the examples allows for systems thinking to be applied to electrical, mechanical, fluid, chemical, thermal and even optical systems. Each chapter focuses on a topic from classic signals and systems theory: System block diagrams, mathematical models, transforms, stability, feedback, system response, control, time

  14. Operating System Security

    CERN Document Server

    Jaeger, Trent

    2008-01-01

    Operating systems provide the fundamental mechanisms for securing computer processing. Since the 1960s, operating systems designers have explored how to build "secure" operating systems - operating systems whose mechanisms protect the system against a motivated adversary. Recently, the importance of ensuring such security has become a mainstream issue for all operating systems. In this book, we examine past research that outlines the requirements for a secure operating system and research that implements example systems that aim for such requirements. For system designs that aimed to

  15. Systems Measures of Water Distribution System Resilience

    Energy Technology Data Exchange (ETDEWEB)

    Klise, Katherine A. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Murray, Regan [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Walker, La Tonya Nicole [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2015-01-01

    Resilience is a concept that is being used increasingly to refer to the capacity of infrastructure systems to be prepared for and able to respond effectively and rapidly to hazardous events. In Section 2 of this report, drinking water hazards, resilience literature, and available resilience tools are presented. Broader definitions, attributes and methods for measuring resilience are presented in Section 3. In Section 4, quantitative systems performance measures for water distribution systems are presented. Finally, in Section 5, the performance measures and their relevance to measuring the resilience of water systems to hazards is discussed along with needed improvements to water distribution system modeling tools.

  16. Manager's assistant systems for space system planning

    Science.gov (United States)

    Bewley, William L.; Burnard, Robert; Edwards, Gary E.; Shoop, James

    1992-01-01

    This paper describes a class of knowledge-based 'assistant' systems for space system planning. Derived from technology produced for the DARPA/USAF Pilot's Associate program, these assistant systems help the human planner by doing the bookkeeping to maintain plan data and executing the procedures and heuristics currently used by the human planner to define, assess, diagnose, and revise plans. Intelligent systems for Space Station Freedom assembly sequence planning and Advanced Launch System modeling will be presented as examples. Ongoing NASA-funded work on a framework supporting the development of such tools will also be described.

  17. Lighting system with thermal management system

    Science.gov (United States)

    Arik, Mehmet; Weaver, Stanton; Stecher, Thomas; Seeley, Charles; Kuenzler, Glenn; Wolfe, Jr., Charles; Utturkar, Yogen; Sharma, Rajdeep; Prabhakaran, Satish; Icoz, Tunc

    2013-05-07

    Lighting systems having unique configurations are provided. For instance, the lighting system may include a light source, a thermal management system and driver electronics, each contained within a housing structure. The light source is configured to provide illumination visible through an opening in the housing structure. The thermal management system is configured to provide an air flow, such as a unidirectional air flow, through the housing structure in order to cool the light source. The driver electronics are configured to provide power to each of the light source and the thermal management system.

  18. EPICS based DAQ system

    International Nuclear Information System (INIS)

    Cheng Weixing; Chen Yongzhong; Zhou Weimin; Ye Kairong; Liu Dekang

    2002-01-01

    EPICS is the most popular developing platform to build control system and beam diagnostic system in modern physics experiment facilities. An EPICS based data acquisition system was built in Redhat 6.2 operation system. The system is successfully used in the beam position monitor mapping, it improves the mapping process a lot

  19. Autonomous photovoltaic lighting system

    OpenAIRE

    Hafez, Ahmed A. A.; Montesinos Miracle, Daniel; Sudrià Andreu, Antoni

    2012-01-01

    This paper introduces a comparison between the conventional and Photovoltaic (PV) lighting systems. A simple sizing procedure for a PV stand-alone system was advised. The paper also proposes a novel PV lighting system. The proposed system is simple, compact and reliable. The system operation was investigated by thoroughly mathematical and simulation work.

  20. FFTF control system experience

    International Nuclear Information System (INIS)

    Warrick, R.P.

    1981-01-01

    The FFTF control systems provide control equipment for safe and efficient operation of the plant. For convenience, these systems will be divided into three parts for discussions: (1) Plant Protection System (PPS); (2) Plant Control System (PCS); and (3) General Observations. Performance of each of these systems is discussed

  1. Automatic control systems engineering

    International Nuclear Information System (INIS)

    Shin, Yun Gi

    2004-01-01

    This book gives descriptions of automatic control for electrical electronics, which indicates history of automatic control, Laplace transform, block diagram and signal flow diagram, electrometer, linearization of system, space of situation, state space analysis of electric system, sensor, hydro controlling system, stability, time response of linear dynamic system, conception of root locus, procedure to draw root locus, frequency response, and design of control system.

  2. MEA vacuum system

    International Nuclear Information System (INIS)

    Stroo, R.; Schwebke, H.; Heine, E.

    1984-01-01

    This report describes construction and operation of the MEA vacuum system of NIKHEF (Netherlands). First, the klystron vacuum system, beam transport system, diode pump and a triode pump are described. Next, the isolation valve and the fast valves of the vacuum system are considered. Measuring instruments, vacuum system commands and messages of failures are treated in the last chapter. (G.J.P.)

  3. From systems biology to systems biomedicine.

    Science.gov (United States)

    Antony, Paul M A; Balling, Rudi; Vlassis, Nikos

    2012-08-01

    Systems Biology is about combining theory, technology, and targeted experiments in a way that drives not only data accumulation but knowledge as well. The challenge in Systems Biomedicine is to furthermore translate mechanistic insights in biological systems to clinical application, with the central aim of improving patients' quality of life. The challenge is to find theoretically well-chosen models for the contextually correct and intelligible representation of multi-scale biological systems. In this review, we discuss the current state of Systems Biology, highlight the emergence of Systems Biomedicine, and highlight some of the topics and views that we think are important for the efficient application of Systems Theory in Biomedicine. Copyright © 2011 Elsevier Ltd. All rights reserved.

  4. Mapping biological systems to network systems

    CERN Document Server

    Rathore, Heena

    2016-01-01

    The book presents the challenges inherent in the paradigm shift of network systems from static to highly dynamic distributed systems – it proposes solutions that the symbiotic nature of biological systems can provide into altering networking systems to adapt to these changes. The author discuss how biological systems – which have the inherent capabilities of evolving, self-organizing, self-repairing and flourishing with time – are inspiring researchers to take opportunities from the biology domain and map them with the problems faced in network domain. The book revolves around the central idea of bio-inspired systems -- it begins by exploring why biology and computer network research are such a natural match. This is followed by presenting a broad overview of biologically inspired research in network systems -- it is classified by the biological field that inspired each topic and by the area of networking in which that topic lies. Each case elucidates how biological concepts have been most successfully ...

  5. Environmental Management System

    Science.gov (United States)

    Goals Recycling Green Purchasing Pollution Prevention Reusing Water Resources Environmental Management Stewardship » Environmental Protection » Environmental Management System Environmental Management System An Environmental Management System is a systematic method for assessing mission activities, determining the

  6. System floorplanning optimization

    KAUST Repository

    Browning, David W.; Elansary, Ayman; Shalaby, Mohamed

    2012-01-01

    Notebook and Laptop Original Equipment Manufacturers (OEMs) place great emphasis on creating unique system designs to differentiate themselves in the mobile market. These systems are developed from the 'outside in' with the focus on how the system

  7. Connected motorcycle system performance.

    Science.gov (United States)

    2016-01-15

    This project characterized the performance of Connected Vehicle Systems (CVS) on motorcycles based on two key components: global positioning and wireless communication systems. Considering that Global Positioning System (GPS) and 5.9 GHz Dedicated Sh...

  8. Antiskid braking system

    Science.gov (United States)

    Pazdera, J. S.

    1974-01-01

    Published report describes analytical development and simulation of braking system. System prevents wheels from skidding when brakes are applied, significantly reducing stopping distance. Report also presents computer simulation study on system as applied to aircraft.

  9. Bridge Management Systems

    DEFF Research Database (Denmark)

    Thoft-Christensen, Palle

    In this paper bridge management systems are discussed with special emphasis on management systems for reinforced concrete bridges. Management systems for prestressed concrete bridges, steel bridges, or composite bridges can be developed in a similar way....

  10. TWRSview system requirements specification

    International Nuclear Information System (INIS)

    Caldwell, J.A.; Lee, A.K.

    1995-12-01

    This document provides the system requirements specification for the TWRSview software system. The TWRSview software system is being developed to integrate electronic data supporting the development of the TWRS technical baseline

  11. Calo trigger acquisition system

    CERN Multimedia

    Franchini, Matteo

    2016-01-01

    Calo trigger acquisition system - Evolution of the acquisition system from a multiple boards system (upper, orange cables) to a single board one (below, light blue cables) where all the channels are collected in a single board.

  12. Lungs and Respiratory System

    Science.gov (United States)

    ... Videos for Educators Search English Español Lungs and Respiratory System KidsHealth / For Parents / Lungs and Respiratory System ... ll have taken at least 600 million breaths. Respiratory System Basics All of this breathing couldn't ...

  13. The Trinity System

    Energy Technology Data Exchange (ETDEWEB)

    Archer, Billy Joe [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Vigil, Benny Manuel [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2015-01-13

    This paper describes the Trinity system, the first ASC Advanced Technology System (ATS-1). We describe the Trinity procurement timeline, the ASC computing strategy, the Trinity specific mission needs, and the Trinity system specifications.

  14. Pneumatic transfer systems

    International Nuclear Information System (INIS)

    Bichler, H.; Boeck, H.; Hammer, J.; Buchtela, K.

    1988-11-01

    A pneumatic transfer system for research reactors, including a sample changer system and to be used for neutron activation analysis, is described. The system can be obtained commercially from the Atominstitut. 2 figs. (qui)

  15. Immune System Quiz

    Science.gov (United States)

    ... Safe Videos for Educators Search English Español Quiz: Immune System KidsHealth / For Kids / Quiz: Immune System Print How much do you know about your immune system? Find out by taking this quiz! About Us ...

  16. System floorplanning optimization

    KAUST Repository

    Browning, David W.; Ansary, Ayman M. El; Shalaby, Mohamed

    2013-01-01

    Notebook and Laptop Original Equipment Manufacturers (OEMs) place great emphasis on creating unique system designs to differentiate themselves in the mobile market. These systems are developed from the 'outside in' with the focus on how the system

  17. Autonomic Nervous System Disorders

    Science.gov (United States)

    Your autonomic nervous system is the part of your nervous system that controls involuntary actions, such as the beating of your heart ... breathing and swallowing Erectile dysfunction in men Autonomic nervous system disorders can occur alone or as the result ...

  18. Central Nervous System Vasculitis

    Science.gov (United States)

    ... of Vasculitis / Central Nervous System (CNS) Vasculitis Central Nervous System (CNS) Vasculitis Swap out your current Facebook Profile ... Facebook personal page. Replace with this image. Central nervous system (CNS) vasculitis is inflammation of blood vessel walls ...

  19. Wind energy systems

    Science.gov (United States)

    Stewart, H. J.

    1978-01-01

    A discussion on wind energy systems involved with the DOE wind energy program is presented. Some of the problems associated with wind energy systems are discussed. The cost, efficiency, and structural design of wind energy systems are analyzed.

  20. System Software 7 Macintosh

    CERN Multimedia

    1991-01-01

    System 7 is a single-user graphical user interface-based operating system for Macintosh computers and was part of the classic Mac OS line of operating systems. It was introduced on May 13, 1991, by Apple Computer. It succeeded System 6, and was the main Macintosh operating system until it was succeeded by Mac OS 8 in 1997. Features added with the System 7 release included virtual memory, personal file sharing, QuickTime, QuickDraw 3D, and an improved user interface. This is the first real major evolution of the Macintosh system, bringing a significant improvement in the user interface, improved stability and many new features such as the ability to use multiple applications at the same time. "System 7" is the last operating system name of the Macintosh that contains the word "system". Macintosh operating systems were later called "Mac OS" (for Macintosh Operating System).

  1. Marketing reporting system

    OpenAIRE

    Hanić Hasan M.

    2004-01-01

    The main components of a developed and good organized marketing information system are: internal reporting system, marketing reporting system, market research system and analytical marketing system. Marketing reporting system provides data and information about changes in business and micro marketing environment. This component of MIS ensures that marketing managers are up-to-date with what is going on, and to be informed about changes in company marketing environment.

  2. Marketing reporting system

    Directory of Open Access Journals (Sweden)

    Hanić Hasan M.

    2004-01-01

    Full Text Available The main components of a developed and good organized marketing information system are: internal reporting system, marketing reporting system, market research system and analytical marketing system. Marketing reporting system provides data and information about changes in business and micro marketing environment. This component of MIS ensures that marketing managers are up-to-date with what is going on, and to be informed about changes in company marketing environment.

  3. Propulsion Systems Panel deliberations

    Science.gov (United States)

    Bianca, Carmelo J.; Miner, Robert; Johnston, Lawrence M.; Bruce, R.; Dennies, Daniel P.; Dickenson, W.; Dreshfield, Robert; Karakulko, Walt; Mcgaw, Mike; Munafo, Paul M.

    1993-01-01

    The Propulsion Systems Panel was established because of the specialized nature of many of the materials and structures technology issues related to propulsion systems. This panel was co-chaired by Carmelo Bianca, MSFC, and Bob Miner, LeRC. Because of the diverse range of missions anticipated for the Space Transportation program, three distinct propulsion system types were identified in the workshop planning process: liquid propulsion systems, solid propulsion systems and nuclear electric/nuclear thermal propulsion systems.

  4. Small test SDHW systems

    DEFF Research Database (Denmark)

    Vejen, Niels Kristian

    1999-01-01

    Three small test SDHW systems was tested in a laboratory test facility.The three SDHW systems where all based on the low flow principe and a mantle tank but the design of the systems where different.......Three small test SDHW systems was tested in a laboratory test facility.The three SDHW systems where all based on the low flow principe and a mantle tank but the design of the systems where different....

  5. Battery systems engineering

    CERN Document Server

    Rahn, Christopher D

    2012-01-01

    A complete all-in-one reference on the important interdisciplinary topic of Battery Systems Engineering Focusing on the interdisciplinary area of battery systems engineering, this book provides the background, models, solution techniques, and systems theory that are necessary for the development of advanced battery management systems. It covers the topic from the perspective of basic electrochemistry as well as systems engineering topics and provides a basis for battery modeling for system engineering of electric and hybrid electric vehicle platforms. This original

  6. Gas transfer system

    International Nuclear Information System (INIS)

    Oberlin, J.C.; Frick, G.; Kempfer, C.; North, C.

    1988-09-01

    The state of work on the Vivitron gas transfer system and the system functions are summarized. The system has to: evacuate the Vivitron reservoir; transfer gas from storage tanks to the Vivitron; recirculate gas during operation; transfer gas from the Vivitron to storage tanks; and assure air input. The system is now being installed. Leak alarms are given by SF6 detectors, which set off a system of forced ventilation. Another system continuously monitors the amount of SF6 in the tanks [fr

  7. Large TileCal magnetic field simulation

    International Nuclear Information System (INIS)

    Nessi, M.; Bergsma, F.; Vorozhtsov, S.B.; Borisov, O.N.; Lomakina, O.V.; Karamysheva, G.A.; Budagov, Yu.A.

    1994-01-01

    The ATLAS magnetic field map has been estimated in the presence of the hadron tile calorimeter. This is an important issue in order to quantify the needs for individual PMT shielding, the effect on the scintillator light yield and its implications on the calibration. The field source is based on a central solenoid and 8 superconducting air-core toroidal coils. The maximum induction value in the scintillating tiles does not exceed 6 mT. When an iron plate is used to close the open drawer window the field inside the PMT near to the extended barrel edge does not exceed 0.6 mT. Estimation of ponder motive force distribution, acting on individual units of the system was performed. VF electromagnetic software OPERA-TOSCA and CERN POISCR code were used for the field simulation of the system. 10 refs., 4 figs

  8. Design of a cathodoluminescence image generator using a Raspberry Pi coupled to a scanning electron microscope

    Science.gov (United States)

    Benítez, Alfredo; Santiago, Ulises; Sanchez, John E.; Ponce, Arturo

    2018-01-01

    In this work, an innovative cathodoluminescence (CL) system is coupled to a scanning electron microscope and synchronized with a Raspberry Pi computer integrated with an innovative processing signal. The post-processing signal is based on a Python algorithm that correlates the CL and secondary electron (SE) images with a precise dwell time correction. For CL imaging, the emission signal is collected through an optical fiber and transduced to an electrical signal via a photomultiplier tube (PMT). CL Images are registered in a panchromatic mode and can be filtered using a monochromator connected between the optical fiber and the PMT to produce monochromatic CL images. The designed system has been employed to study ZnO samples prepared by electrical arc discharge and microwave methods. CL images are compared with SE images and chemical elemental mapping images to correlate the emission regions of the sample.

  9. First photoelectron timing error evaluation of a new scintillation detector model

    International Nuclear Information System (INIS)

    Petrick, N.; Clinthorne, N.H.; Rogers, W.L.; Hero, A.O. III

    1991-01-01

    In this paper, a general timing system model for a scintillation detector developed is experimentally evaluated. The detector consists of a scintillator and a photodetector such as a photomultiplier tube or an avalanche photodiode. The model uses a Poisson point process to characterize the light output from the scintillator. This timing model was used to simulate a BGO scintillator with a Burle 8575 PMT using first photoelectron timing detection. Evaluation of the model consisted of comparing the RMS error from the simulations with the error from the actual detector system. The authors find that the general model compares well with the actual error results for the BGO/8575 PMT detector. In addition, the optimal threshold is found to be dependent upon the energy of the scintillation. In the low energy part of the spectrum, the authors find a low threshold is optimal while for higher energy pulses the optimal threshold increases

  10. First photoelectron timing error evaluation of a new scintillation detector model

    International Nuclear Information System (INIS)

    Petrick, N.; Clinthorne, N.H.; Rogers, W.L.; Hero, A.O. III

    1990-01-01

    In this paper, a general timing system model for a scintillation detector that was developed, is experimentally evaluated. The detector consists of a scintillator and a photodetector such as a photomultiplier tube or an avalanche photodiode. The model uses a Poisson point process to characterize the light output from the scintillator. This timing model was used to simulated a BGO scintillator with a Burle 8575 PMT using first photoelectron timing detection. Evaluation of the model consisted of comparing the RMS error from the simulations with the error from the actual detector system. We find that the general model compares well with the actual error results for the BGO/8575 PMT detector. In addition, the optimal threshold is found to be dependent upon the energy of the scintillation. In the low energy part of the spectrum, we find a low threshold is optimal while for higher energy pulses the optimal threshold increases

  11. Cognitive Medical Multiagent Systems

    Directory of Open Access Journals (Sweden)

    Barna Iantovics

    2010-01-01

    Full Text Available The development of efficient and flexible agent-based medical diagnosis systems represents a recent research direction. Medical multiagent systems may improve the efficiency of traditionally developed medical computational systems, like the medical expert systems. In our previous researches, a novel cooperative medical diagnosis multiagent system called CMDS (Contract Net Based Medical Diagnosis System was proposed. CMDS system can solve flexibly a large variety of medical diagnosis problems. This paper analyses the increased intelligence of the CMDS system, which motivates its use for different medical problem’s solving.

  12. Airports Geographic Information System -

    Data.gov (United States)

    Department of Transportation — The Airports Geographic Information System maintains the airport and aeronautical data required to meet the demands of the Next Generation National Airspace System....

  13. Aeronautical Information System -

    Data.gov (United States)

    Department of Transportation — The Aeronautical Information System (AIS) is a leased weather automated system that provides a means of collecting and distributing aeronautical weather information...

  14. Credit Management System

    Data.gov (United States)

    US Agency for International Development — Credit Management System. Outsourced Internet-based application. CMS stores and processes data related to USAID credit programs. The system provides information...

  15. Control system design method

    Science.gov (United States)

    Wilson, David G [Tijeras, NM; Robinett, III, Rush D.

    2012-02-21

    A control system design method and concomitant control system comprising representing a physical apparatus to be controlled as a Hamiltonian system, determining elements of the Hamiltonian system representation which are power generators, power dissipators, and power storage devices, analyzing stability and performance of the Hamiltonian system based on the results of the determining step and determining necessary and sufficient conditions for stability of the Hamiltonian system, creating a stable control system based on the results of the analyzing step, and employing the resulting control system to control the physical apparatus.

  16. Neural Systems Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — As part of the Electrical and Computer Engineering Department and The Institute for System Research, the Neural Systems Laboratory studies the functionality of the...

  17. Integrated Systems Health Management for Intelligent Systems

    Science.gov (United States)

    Figueroa, Fernando; Melcher, Kevin

    2011-01-01

    The implementation of an integrated system health management (ISHM) capability is fundamentally linked to the management of data, information, and knowledge (DIaK) with the purposeful objective of determining the health of a system. It is akin to having a team of experts who are all individually and collectively observing and analyzing a complex system, and communicating effectively with each other in order to arrive at an accurate and reliable assessment of its health. In this paper, concepts, procedures, and approaches are presented as a foundation for implementing an intelligent systems ]relevant ISHM capability. The capability stresses integration of DIaK from all elements of a system. Both ground-based (remote) and on-board ISHM capabilities are compared and contrasted. The information presented is the result of many years of research, development, and maturation of technologies, and of prototype implementations in operational systems.

  18. System Analysis and Risk Assessment (SARA) system

    International Nuclear Information System (INIS)

    Krantz, E.A.; Russell, K.D.; Stewart, H.D.; Van Siclen, V.S.

    1986-01-01

    Utilization of Probabilistic Risk Assessment (PRA) related information in the day-to-day operation of plant systems has, in the past, been impracticable due to the size of the computers needed to run PRA codes. This paper discusses a microcomputer-based database system which can greatly enhance the capability of operators or regulators to incorporate PRA methodologies into their routine decision making. This system is called the System Analysis and Risk Assessment (SARA) system. SARA was developed by EG and G Idaho, Inc. at the Idaho National Engineering Laboratory to facilitate the study of frequency and consequence analyses of accident sequences from a large number of light water reactors (LWRs) in this country. This information is being amassed by several studies sponsored by the United States Nuclear Regulatory Commission (USNRC). To meet the need of portability and accessibility, and to perform the variety of calculations necessary, it was felt that a microcomputer-based system would be most suitable

  19. Systems engineering for very large systems

    Science.gov (United States)

    Lewkowicz, Paul E.

    Very large integrated systems have always posed special problems for engineers. Whether they are power generation systems, computer networks or space vehicles, whenever there are multiple interfaces, complex technologies or just demanding customers, the challenges are unique. 'Systems engineering' has evolved as a discipline in order to meet these challenges by providing a structured, top-down design and development methodology for the engineer. This paper attempts to define the general class of problems requiring the complete systems engineering treatment and to show how systems engineering can be utilized to improve customer satisfaction and profit ability. Specifically, this work will focus on a design methodology for the largest of systems, not necessarily in terms of physical size, but in terms of complexity and interconnectivity.

  20. Epilogue: Systems Approaches and Systems Practice

    Science.gov (United States)

    Reynolds, Martin; Holwell, Sue

    Each of the five systems approaches discussed in this volume: system dynamics (SD), the viable systems model (VSM), strategic options development and analysis (SODA), soft systems methodology (SSM) and critical systems heuristics (CSH) has a pedigree. Not in the sense of the sometimes absurd spectacle of animals paraded at dog shows. Rather, their pedigree derives from their systems foundations, their capacity to evolve and their flexibility in use. None of the five approaches has developed out of use in restricted and controlled contexts of either low or high levels of complicatedness. Neither has any one of them evolved as a consequence of being applied only to situations with either presumed stakeholder agreement on purpose, or courteous disagreement amongst stakeholders, or stakeholder coercion. The compilation is not a celebration of abstract ‘methodologies', but of theoretically robust approaches that have a genuine pedigree in practice.

  1. Systems analysis of a security alarm system

    International Nuclear Information System (INIS)

    Schiff, A.

    1975-01-01

    When the Lawrence Livermore Laboratory found that its security alarm system was causing more false alarms and maintenance costs than LLL felt was tolerable, a systems analysis was undertaken to determine what should be done about the situation. This report contains an analysis of security alarm systems in general and ends with a review of the existing Security Alarm Control Console (SACC) and recommendations for its improvement, growth and change. (U.S.)

  2. Precision digital control systems

    Science.gov (United States)

    Vyskub, V. G.; Rozov, B. S.; Savelev, V. I.

    This book is concerned with the characteristics of digital control systems of great accuracy. A classification of such systems is considered along with aspects of stabilization, programmable control applications, digital tracking systems and servomechanisms, and precision systems for the control of a scanning laser beam. Other topics explored are related to systems of proportional control, linear devices and methods for increasing precision, approaches for further decreasing the response time in the case of high-speed operation, possibilities for the implementation of a logical control law, and methods for the study of precision digital control systems. A description is presented of precision automatic control systems which make use of electronic computers, taking into account the existing possibilities for an employment of computers in automatic control systems, approaches and studies required for including a computer in such control systems, and an analysis of the structure of automatic control systems with computers. Attention is also given to functional blocks in the considered systems.

  3. L-system fractals

    CERN Document Server

    Mishra, Jibitesh

    2007-01-01

    The book covers all the fundamental aspects of generating fractals through L-system. Also it provides insight to various researches in this area for generating fractals through L-system approach & estimating dimensions. Also it discusses various applications of L-system fractals. Key Features: - Fractals generated from L-System including hybrid fractals - Dimension calculation for L-system fractals - Images & codes for L-system fractals - Research directions in the area of L-system fractals - Usage of various freely downloadable tools in this area - Fractals generated from L-System including hybrid fractals- Dimension calculation for L-system fractals- Images & codes for L-system fractals- Research directions in the area of L-system fractals- Usage of various freely downloadable tools in this area

  4. Power system protection 2 systems and methods

    CERN Document Server

    1995-01-01

    The worldwide growth in demand for electricity has forced the pace of developments in electrical power system design to meet consumer needs for reliable, secure and cheap supplies. Power system protection, as a technology essential to high quality supply, is widely recognised as a specialism of growing and often critical importance, in which power system needs and technological progress have combined to result in rapid developments in policy and practice in recent years. In the United Kingdom, the need for appropriate training in power system protection was recognised in the early 1960s with t

  5. Hot Spot Removal System: System description

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-09-01

    Hazardous wastes contaminated with radionuclides, chemicals, and explosives exist across the Department of Energy complex and need to be remediated due to environmental concerns. Currently, an opportunity is being developed to dramatically reduce remediation costs and to assist in the acceleration of schedules associated with these wastes by deploying a Hot Spot Removal System. Removing the hot spot from the waste site will remove risk driver(s) and enable another, more cost effective process/option/remedial alternative (i.e., capping) to be applied to the remainder of the site. The Hot Spot Removal System consists of a suite of technologies that will be utilized to locate and remove source terms. Components of the system can also be used in a variety of other cleanup activities. This Hot Spot Removal System Description document presents technologies that were considered for possible inclusion in the Hot Spot Removal System, technologies made available to the Hot Spot Removal System, industrial interest in the Hot Spot Removal System`s subsystems, the schedule required for the Hot Spot Removal System, the evaluation of the relevant technologies, and the recommendations for equipment and technologies as stated in the Plan section.

  6. Unmanned Aerial System, New System Manning Prediction

    National Research Council Canada - National Science Library

    Hunn, Bruce P

    2006-01-01

    .... System safety and effectiveness, training, contractor operations and working conditions were evaluated for current UASs, including Hunter, Shadow, Predator, Improved Gnat, and to a lesser degree...

  7. Site systems engineering: Systems engineering management plan

    Energy Technology Data Exchange (ETDEWEB)

    Grygiel, M.L. [Westinghouse Hanford Co., Richland, WA (United States)

    1996-05-03

    The Site Systems Engineering Management Plan (SEMP) is the Westinghouse Hanford Company (WHC) implementation document for the Hanford Site Systems Engineering Policy, (RLPD 430.1) and Systems Engineering Criteria Document and Implementing Directive, (RLID 430.1). These documents define the US Department of Energy (DOE), Richland Operations Office (RL) processes and products to be used at Hanford to implement the systems engineering process at the site level. This SEMP describes the products being provided by the site systems engineering activity in fiscal year (FY) 1996 and the associated schedule. It also includes the procedural approach being taken by the site level systems engineering activity in the development of these products and the intended uses for the products in the integrated planning process in response to the DOE policy and implementing directives. The scope of the systems engineering process is to define a set of activities and products to be used at the site level during FY 1996 or until the successful Project Hanford Management Contractor (PHMC) is onsite as a result of contract award from Request For Proposal DE-RP06-96RL13200. Following installation of the new contractor, a long-term set of systems engineering procedures and products will be defined for management of the Hanford Project. The extent to which each project applies the systems engineering process and the specific tools used are determined by the project`s management.

  8. Hot Spot Removal System: System description

    International Nuclear Information System (INIS)

    1997-09-01

    Hazardous wastes contaminated with radionuclides, chemicals, and explosives exist across the Department of Energy complex and need to be remediated due to environmental concerns. Currently, an opportunity is being developed to dramatically reduce remediation costs and to assist in the acceleration of schedules associated with these wastes by deploying a Hot Spot Removal System. Removing the hot spot from the waste site will remove risk driver(s) and enable another, more cost effective process/option/remedial alternative (i.e., capping) to be applied to the remainder of the site. The Hot Spot Removal System consists of a suite of technologies that will be utilized to locate and remove source terms. Components of the system can also be used in a variety of other cleanup activities. This Hot Spot Removal System Description document presents technologies that were considered for possible inclusion in the Hot Spot Removal System, technologies made available to the Hot Spot Removal System, industrial interest in the Hot Spot Removal System''s subsystems, the schedule required for the Hot Spot Removal System, the evaluation of the relevant technologies, and the recommendations for equipment and technologies as stated in the Plan section

  9. The central pixel of the MAGIC telescope for optical observations

    Science.gov (United States)

    Lucarelli, F.; Barrio, J. A.; Antoranz, P.; Asensio, M.; Camara, M.; Contreras, J. L.; Fonseca, M. V.; Lopez, M.; Miranda, J. M.; Oya, I.; Reyes, R. De Los; Firpo, R.; Sidro, N.; Goebel, F.; Lorenz, E.; Otte, N.

    2008-05-01

    The MAGIC telescope has been designed for the observation of Cherenkov light generated in Extensive Air Showers initiated by cosmic particles. However, its 17 m diameter mirror and optical design makes the telescope suitable for direct optical observations as well. In this paper, we report about the development of a system based on the use of a dedicated photo-multiplier (PMT) for optical observations. This PMT is installed in the centre of the MAGIC camera (the so-called central pixel). An electro-to-optical system has been developed in order to transmit the PMT output signal by an optical fibre to the counting room, where it is digitized and stored for off-line analysis. The performance of the system using the optical pulsation of the Crab nebula as calibration source is presented. The time required for a 5σ detection of the Crab pulsar in the optical band is less than 20 s. The central pixel will be mainly used to perform simultaneous observations of the Crab pulsar both in the optical and γ-ray regimes. It will also allow for periodic testing of the precision of the MAGIC timing system using the Crab rotational optical pulses as a very precise timing reference.

  10. Systems integration of business systems. Business system ni kanshite

    Energy Technology Data Exchange (ETDEWEB)

    Furukawa, H [Nippon Steel Corp., Tokyo (Japan)

    1991-09-26

    System integration (SI) is defined as combining hardwares and softwares as the infrastructures with know-hows for their use comprehensively to respond to high-level needs of users. This paper reports the features of an SI being developed by a company (E Company), its concept on the systematized development methodology, and the conceptual models. With the primary policy placed on creative integration standing on customers positions, the SI concept comprises three parts of models for evaluations as seen from the customers, evaluations as seen from the E Company, and the development object systems to link both parts. The third part is further consisted of several lower hierarchies including a customer controlled system hierarchy (this enables customers to control the system through visualization, for example, and includes three logic models (multiple solution selection, optimal solution under restricted conditions, and numerical solution)). 2 refs., 9 figs.

  11. Estimating the ROI on Implementation of RFID at the Ammunition Storage Warehouse and the 40th Supply Depot: KVA as a Methodology

    Science.gov (United States)

    2009-12-01

    Balanced Scorecard CAPM Capital Asset Pricing Model DIS Defense Information System DoD Department of...Measurement Tool (PMT) is the Balanced Scorecard (BSC) based on critical success factors and key performance indicators. The MND has referred to Jung’s...authors can replicate the methodology for multiple projects to generate a portfolio of projects. Similar to the Capital Asset Pricing Model ( CAPM ) or

  12. Study of influence with fourier transform on long cable in measurement of fall time of DPF neutron profile

    International Nuclear Information System (INIS)

    Guo Hongsheng; Li Rurong; Tang Dengpan; Yang Gaozhao; Hu Qingyuan; Si Fenni; Zhang Jianhua; Peng Taiping

    2011-01-01

    The influence of the Fourier Transform on long cable in the measurement of fall time of DPF neutron profile is discussed by mathematical methods. The application of anti-convolution function with the Fourier Transform on long cable is analysed. The time interval between the peak time and the time that the height falls 3 orders of magnitude after peak is measured with gated-detector array system which consists of PMT (photomultiplier tube) and organic scintillation crystal. (authors)

  13. Measurement of Photomultipier Plateau Curves and Single MIP response in the AD detector at ALICE

    CERN Document Server

    Sanchez Falero, Sebastian De Jesus

    2015-01-01

    The Alice Diffractive (AD) detector is a forward detector in the ALICE experiment at CERN. It is aimed to the triggering on diffractive events and extends the pseudorapidity coverage to about 4.9 < /n/ < 6.3. In this work, a PMT's efficiency plateau and single MIP response are measured using a replica of the detector's scintillator modules, electronic and data acquisition system and cosmic rays as particle source.

  14. Detecting and Characterizing Nighttime Lighting Using Multispectral and Hyperspectral Imaging

    Science.gov (United States)

    2012-12-01

    are a wide variety of statistically based methods for analysis of MSI data, but they can also be analyzed to some degree using MSI spectral signatures...the received signal for the detection of clouds at night using moonlight . The implementation of the PMT system allowed for an unintentional ability...been known since the 1970s, the early night-time mapping products were derived from analog data ( film ). Elvidge et al. (1997) presented the first

  15. Proposta de bioremediació de l'estany Olla del Rei de Castelldefels

    OpenAIRE

    Vidiella Martin, Maria

    2017-01-01

    The UPC campus and the Mediterranean Technology Park (PMT) is an educational and research site that includes a naturalized area that sets it apart: the lake called "Olla del Rei", included in the inventory of wetlands in Catalonia. The evolution of the system and the effects caused by the network of drainage channels connected to the lagoon, have generated huge problems that threaten the existence of the lake as a natural area: eutrophication and loss of quality of the water, the exponential ...

  16. CDMA systems capacity engineering

    CERN Document Server

    Kim, Kiseon

    2004-01-01

    This new hands-on resource tackles capacity planning and engineering issues that are crucial to optimizing wireless communication systems performance. Going beyond the system physical level and investigating CDMA system capacity at the service level, this volume is the single-source for engineering and analyzing systems capacity and resources.

  17. Smart SDHW systems

    DEFF Research Database (Denmark)

    Andersen, Elsa

    2000-01-01

    The aim of the project is to develop smart solar domestic hot water (SDHW) systems. A smart SDHW is a system in which the domestic water can bee heated both by solar collectors and by an auxiliary energy supply system. The auxiliary energy supply system heats up the hot-water tank from the top an...

  18. Information Systems Security Audit

    OpenAIRE

    Gheorghe Popescu; Veronica Adriana Popescu; Cristina Raluca Popescu

    2007-01-01

    The article covers:Defining an information system; benefits obtained by introducing new information technologies; IT management;Defining prerequisites, analysis, design, implementation of IS; Information security management system; aspects regarding IS security policy; Conceptual model of a security system; Auditing information security systems and network infrastructure security.

  19. Medical imaging systems

    Science.gov (United States)

    Frangioni, John V

    2013-06-25

    A medical imaging system provides simultaneous rendering of visible light and diagnostic or functional images. The system may be portable, and may include adapters for connecting various light sources and cameras in open surgical environments or laparascopic or endoscopic environments. A user interface provides control over the functionality of the integrated imaging system. In one embodiment, the system provides a tool for surgical pathology.

  20. Evolution of ERP systems

    NARCIS (Netherlands)

    Wortmann, J.C.; Bititci, U.S.; Carrie, A.S.

    1998-01-01

    This paper describes the development of ERP systems over time. It explores both the functionality and the technology of ERP-systems. It explains the increased importance of ERP systems in practice. The paper also addresses the difficulties encountered in implementing ERP systems in real life. Modern

  1. Digital processing data communication systems (bus systems). Digitale Prozessdaten-Kommunikations-Systeme (Bus Systeme)

    Energy Technology Data Exchange (ETDEWEB)

    Fleck, K

    1980-01-01

    After an introduction to the technology of digital processing data communication systems there are the following chapters: digital communication of processing data in automation technology, the technology of biserial communication, the implementaiton of a bus system, the data transmission of the TDC-2000 system of Honeywell's and the process bus CS 275 in the automation system TELEPERM M of Siemens AG.

  2. EUCLID ARCHIVE SYSTEM PROTOTYPE

    NARCIS (Netherlands)

    Belikov, Andrey; Williams, Owen; Droge, Bob; Tsyganov, Andrey; Boxhoorn, Danny; McFarland, John; Verdoes Kleijn, Gijs; Valentijn, E; Altieri, Bruno; Dabin, Christophe; Pasian, F.; Osuna, Pedro; Soille, P.; Marchetti, P.G.

    2014-01-01

    The Euclid Archive System prototype is a functional information system which is used to address the numerous challenges in the development of fully functional data processing system for Euclid. The prototype must support the highly distributed nature of the Euclid Science Ground System, with Science

  3. Product Service Systems

    DEFF Research Database (Denmark)

    Departing from Product Development models based on physical artefacts. Moving towards integrated Product Development and System Operations models suited Product/Service-systems......Departing from Product Development models based on physical artefacts. Moving towards integrated Product Development and System Operations models suited Product/Service-systems...

  4. Biogas plant control system

    International Nuclear Information System (INIS)

    Balasevicius, L.; Dervinis, G.; Macerauskas, V.

    2002-01-01

    This paper presents intelligent control system for the pig farm biogas production process. The system uses a fuzzy logic models based on knowledge of experts and operators. Four fuzzy models are introduced. The adequacy of fuzzy models is verified using real data and MATLAB simulation. Proposed expert system is implemented into traditional SCADA system for biogas process prediction and failure analyzing. (authors)

  5. System Performance and Testing

    NARCIS (Netherlands)

    Frei, U.; Oversloot, H.

    2004-01-01

    This chapter compares and contrasts the system performance of two widely used solar thermal systems using testing and simulation programs. Solar thermal systems are used in many countries for heating domestically used water. In addition to the simple thermosiphon systems, better designed pumped

  6. Hybrid intelligent engineering systems

    CERN Document Server

    Jain, L C; Adelaide, Australia University of

    1997-01-01

    This book on hybrid intelligent engineering systems is unique, in the sense that it presents the integration of expert systems, neural networks, fuzzy systems, genetic algorithms, and chaos engineering. It shows that these new techniques enhance the capabilities of one another. A number of hybrid systems for solving engineering problems are presented.

  7. ERP–systems

    OpenAIRE

    Shustova I.

    2016-01-01

    In this work, we analyzed the existing ERP–systems of foreign and domestic manufacturers. Popular ERP–systems in the Republic of Belarus were considered. The leading ERP-systems in the domestic market and their features were described in detail. Finally, we described the steps that must be taken to select the most suitable ERP-system for a particular company.

  8. Business advertisements management system

    OpenAIRE

    Rekel, Ernest

    2017-01-01

    Business Advertisements Management System The main goal of the project was to create a business advertisements management system, where users could easily create and find business advertisements. To accomplish this goal exist- ing systems were analyzed as well as their limitations. The end result is a working system which is able to store and proccess huge amount of data.

  9. Functional System Dynamics

    OpenAIRE

    Ligterink, N.E.

    2007-01-01

    Functional system dynamics is the analysis, modelling, and simulation of continuous systems usually described by partial differential equations. From the infinite degrees of freedom of such systems only a finite number of relevant variables have to be chosen for a practical model description. The proper input and output of the system are an important part of the relevant variables.

  10. Type Systems for Bigraphs

    DEFF Research Database (Denmark)

    Elsborg, Ebbe; Hildebrandt, Thomas; Sangiorgi, Davide

    of controls and a set of reaction rules, collectively a bigraphical reactive system (BRS). Possible advantages of developing bigraphical type systems include: a deeper understanding of a type system itself and its properties; transfer of the type systems to the concrete family of calculi that the BRS models...

  11. Computer Operating System Maintenance.

    Science.gov (United States)

    1982-06-01

    FACILITY The Computer Management Information Facility ( CMIF ) system was developed by Rapp Systems to fulfill the need at the CRF to record and report on...computer center resource usage and utilization. The foundation of the CMIF system is a System 2000 data base (CRFMGMT) which stores and permits access

  12. Balancing for nonlinear systems

    NARCIS (Netherlands)

    Scherpen, J.M.A.

    1993-01-01

    We present a method of balancing for nonlinear systems which is an extension of balancing for linear systems in the sense that it is based on the input and output energy of a system. It is a local result, but gives 'broader' results than we obtain by just linearizing the system. Furthermore, the

  13. EPICS system: system structure and user interface

    International Nuclear Information System (INIS)

    West, R.E.; Bartlett, J.F.; Bobbitt, J.S.; Lahey, T.E.; Kramper, B.J.; MacKinnon, B.A.

    1984-02-01

    This paper present the user's view of and the general organization of the EPICS control system at Fermilab. Various subsystems of the EPICS control system are discussed. These include the user command language, software protection, the device database, remote computer interfaces, and several application utilities. This paper is related to two other papers on EPICS: an overview paper and a detailed implementation paper

  14. Probabilistic fuzzy systems as additive fuzzy systems

    NARCIS (Netherlands)

    Almeida, R.J.; Verbeek, N.; Kaymak, U.; Costa Sousa, da J.M.; Laurent, A.; Strauss, O.; Bouchon-Meunier, B.; Yager, R.

    2014-01-01

    Probabilistic fuzzy systems combine a linguistic description of the system behaviour with statistical properties of data. It was originally derived based on Zadeh’s concept of probability of a fuzzy event. Two possible and equivalent additive reasoning schemes were proposed, that lead to the

  15. System of Systems Analytic Workbench - 2017

    Science.gov (United States)

    2017-08-31

    Genetic Algorithm and Particle Swarm Optimization with Type-2 Fuzzy Sets for Generating Systems of Systems Architectures. Procedia Computer Science...The application effort involves modeling an existing messaging network to perform real-time situational awareness. The Analytical Workbench’s

  16. On generalized Volterra systems

    Science.gov (United States)

    Charalambides, S. A.; Damianou, P. A.; Evripidou, C. A.

    2015-01-01

    We construct a large family of evidently integrable Hamiltonian systems which are generalizations of the KM system. The algorithm uses the root system of a complex simple Lie algebra. The Hamiltonian vector field is homogeneous cubic but in a number of cases a simple change of variables transforms such a system to a quadratic Lotka-Volterra system. We present in detail all such systems in the cases of A3, A4 and we also give some examples from higher dimensions. We classify all possible Lotka-Volterra systems that arise via this algorithm in the An case.

  17. Transdisciplinarity Needs Systemism

    Directory of Open Access Journals (Sweden)

    Wolfgang Hofkirchner

    2017-02-01

    Full Text Available The main message of this paper is that systemism is best suited for transdisciplinary studies. A description of disciplinary sciences, transdisciplinary sciences and systems sciences is given, along with their different definitions of aims, scope and tools. The rationale for transdisciplinarity is global challenges, which are complex. The rationale for systemism is the concretization of understanding complexity. Drawing upon Ludwig von Bertalanffy’s intention of a General System Theory, three items deserve attention—the world-view of a synergistic systems technology, the world picture of an emergentist systems theory, and the way of thinking of an integrationist systems method.

  18. Measuring Systemic Risk

    DEFF Research Database (Denmark)

    Acharya, Viral V.; Heje Pedersen, Lasse; Philippon, Thomas

    2017-01-01

    We present an economic model of systemic risk in which undercapitalization of the financial sector as a whole is assumed to harm the real economy, leading to a systemic risk externality. Each financial institution’s contribution to systemic risk can be measured as its systemic expected shortfall...... of components of SES to predict emerging systemic risk during the financial crisis of 2007–2009....

  19. Multiprocessor data acquisition system

    International Nuclear Information System (INIS)

    Haumann, J.R.; Crawford, R.K.

    1987-01-01

    A multiprocessor data acquisition system has been built to replace the single processor systems at the Intense Pulsed Neutron Source (IPNS) at Argonne National Laboratory. The multiprocessor system was needed to accommodate the higher data rates at IPNS brought about by improvements in the source and changes in instrument configurations. This paper describes the hardware configuration of the system and the method of task sharing and compares results to the single processor system

  20. Genetics, systems, and alcohol.

    Science.gov (United States)

    McClearn, G E

    1993-03-01

    Under a variety of rubrics (e.g., complexity, self-constructing systems, dissipative structures), interest has recently burgeoned in applying principles of complex systems to a wide variety of scientific issues. A major concern is with emergent properties of systems not derivable from the properties of components of the systems. In this paper, some elementary aspects of "systems" considerations are applied to phenomena of alcohol pharmacogenetics. It is likely that whole new families of informative phenotypes can be generated by this approach.