Directory of Open Access Journals (Sweden)
A. Aliboni
2015-09-01
Full Text Available Chlorobium limicola belongs to the green sulphur bacteria that has a potential for technological applications such as biogas clean up oxidising hydrogen sulphide to elemental sulphur through photosynthetic process. In the present work, analytical methods are described for the determination of different sulphur species in C. limicola cultures – sulphide by GC-FPD, sulphate by ionic HPLC and elemental sulphur by RP HPLC. The latter method eliminates the need for chloroform extraction of water suspensions of elemental sulphur. Data from sulphide and elemental sulphur analyses have been compared with ones coming from more traditional analytical methodologies.
Enriched reaction center preparation from green photosynthetic bacteria. [Chlorobium limicola
Energy Technology Data Exchange (ETDEWEB)
Olson, J M; Giddings, Jr, T H; Shaw, E K
1976-01-01
Bacteriochlorophyll a reaction-center complex I from Chlorobium limicola f. thiosulfatophilum 6230 (Tassajara) was incubated in 2 M guanidine . HCl and then chromatographed on cross-linked dextran or agarose gel. Two principal components were separated: a larger component with photochemical activity (bacteriochlorophyll a reaction-center complex II) and a smaller component without activity (bacteriochlorophyll a protein). Complex II contains carotenoid, bacteriochlorophyll a, reaction center(s), and cytochromes b and c, but lacks the well characterized bacteriochlorophyll a protein contained in Complex I. Complex II carries out a light-induced reduction of cytochrome b along with an oxidation of cytochrome c.
[Metabolism of carbohydrates in the cells of green sulphur bacteria Chlorobium limicola Ya-2002].
Horishnyĭ, M B; Hudz', S P; Hnatush, S O
2009-01-01
The nature of carbohydrates that accumulate in the cells of photosynthetic green sulphur bacteria of Chlorobium limicola Ya-2002 has been investigated. It is shown by infra-red spectrometry, that carbohydrates accumulated in the cells of bacteria are identical (by 90-95%) to glycogen of the bull liver. Exogenous glucose, saccharose, maltose, did not stimulate formation of glycogen. Growth of glycogen level in the cells of bacteria was observed at addition of acetate or piruvate in the conditions of bacteria cultivation in the light and in the presence CO2 and H2S in the environment. Washed cells of C. limicola Ya-2002 did not use glucose of the environment neither in the conditions of illumination nor in darkness, however acetate and piruvate are actively used in the light. During incubation of the washed cells in darkness the level of glycogen fell down approximately three times. Its amount during cells incubation in the light did not change. The decline of glycogen level in cells during their incubation in darkness was accompanied by piling up of carbonic acids in the environment acetate prevailing among them.
DEFF Research Database (Denmark)
Kjaer, B; Frigaard, N-U; Yang, F
1998-01-01
Photosynthetically active reaction center complexes were prepared from the green sulfur bacterium Chlorobium vibrioforme NCIMB 8327, and the content of quinones was determined by extraction and high-performance liquid chromatography. The analysis showed a stoichiometry of 1.7 molecules of menaqui......Photosynthetically active reaction center complexes were prepared from the green sulfur bacterium Chlorobium vibrioforme NCIMB 8327, and the content of quinones was determined by extraction and high-performance liquid chromatography. The analysis showed a stoichiometry of 1.7 molecules...
DEFF Research Database (Denmark)
Frigaard, N-U; Bryant, D A
2001-01-01
Conditions for inactivating chromosomal genes of Chlorobium tepidum by natural transformation and homologous recombination were established. As a model, mutants unable to perform nitrogen fixation were constructed by interrupting nifD with various antibiotic resistance markers. Growth of wild...
Photoproduction of hydrogen by membranes of green photosynthetic bacteria
Energy Technology Data Exchange (ETDEWEB)
Bernstein, J D; Olson, J M
1980-01-01
Photoproduction of H/sub 2/ from ascorbate by unit-membrane vesicles from Chlorobium limicola f. thiosulfatophilum was achieved with a system containing gramicidin D, tetramethyl-p-phenylenediamine, methyl viologen, dithioerythritol, Clostridium hydrogenase, and an oxygen-scavenging mixture of glucose, glucose oxidase, ethanol, and catalase. Maximum quantum yield was less than one percent. Half maximum rate of H/sub 2/ production occurred at a white-light intensity of approximately 0.15 cm/sup -2/. The reaction was inhibited completely by 0.3% sodium dodecylbenzene sulfonate, 1% Triton X-100, or preheating the vesicles at 100/sup 0/C for 5 minutes. Low concentrations (0.01 and 0.05%) of Triton X-100 about doubled the reaction rate.
DEFF Research Database (Denmark)
Frigaard, Niels-Ulrik; Chew, Aline Gomez Maqueo; Li, Hui
2003-01-01
Green sulfur bacteria are obligate, anaerobic photolithoautotrophs that synthesize unique bacteriochlorophylls (BChls) and a unique light-harvesting antenna structure, the chlorosome. One organism, Chlorobium tepidum, has emerged as a model for this group of bacteria primarily due to its relative...
Genetic manipulation of carotenoid biosynthesis in the green sulfur bacterium Chlorobium tepidum
DEFF Research Database (Denmark)
Frigaard, Niels-Ulrik; Maresca, Julia A; Yunker, Colleen E
2004-01-01
The green sulfur bacterium Chlorobium tepidum is a strict anaerobe and an obligate photoautotroph. On the basis of sequence similarity with known enzymes or sequence motifs, nine open reading frames encoding putative enzymes of carotenoid biosynthesis were identified in the genome sequence of C....... tepidum, and all nine genes were inactivated. Analysis of the carotenoid composition in the resulting mutants allowed the genes encoding the following six enzymes to be identified: phytoene synthase (crtB/CT1386), phytoene desaturase (crtP/CT0807), zeta-carotene desaturase (crtQ/CT1414), gamma......-carotene desaturase (crtU/CT0323), carotenoid 1',2'-hydratase (crtC/CT0301), and carotenoid cis-trans isomerase (crtH/CT0649). Three mutants (CT0180, CT1357, and CT1416 mutants) did not exhibit a discernible phenotype. The carotenoid biosynthetic pathway in C. tepidum is similar to that in cyanobacteria and plants...
DEFF Research Database (Denmark)
Maresca, Julia A; Gomez Maqueo Chew, Aline; Ponsatí, Marta Ros
2004-01-01
that restores the correct reading frame in bchU. The bchU gene was inactivated in C. tepidum, a BChl c-producing species, and the resulting mutant produced only BChl d. Growth rate measurements showed that BChl c- and d-producing strains of the same organism (C. tepidum or C. vibrioforme) have similar growth...... rates at high and intermediate light intensities but that strains producing BChl c grow faster than those with BChl d at low light intensities. Thus, the bchU gene encodes the C-20 methyltransferase for BChl c biosynthesis in Chlorobium species, and methylation at the C-20 position to produce BChl c...
DEFF Research Database (Denmark)
Frigaard, Niels-Ulrik; Li, Hui; Martinsson, Peter
2005-01-01
Chlorosomes are the light-harvesting organelles in photosynthetic green bacteria and typically contain large amounts of bacteriochlorophyll (BChl) c in addition to smaller amounts of BChl a, carotenoids, and several protein species. We have isolated vestigial chlorosomes, denoted carotenosomes......, from a BChl c-less, bchK mutant of the green sulfur bacterium Chlorobium tepidum. The physical shape of the carotenosomes (86 +/- 17 nm x 66 +/- 13 nm x 4.3 +/- 0.8 nm on average) was reminiscent of a flattened chlorosome. The carotenosomes contained carotenoids, BChl a, and the proteins CsmA and Csm...... that the carotenosomes have an intact baseplate made of remarkably stable oligomeric CsmA-BChl a complexes but are flattened in structure due to the absence of BChl c. Carotenosomes thus provide a valuable material for studying the biogenesis, structure, and function of the photosynthetic antennae in green bacteria....
Energy Technology Data Exchange (ETDEWEB)
Bernstein, J.D.; Olson, J.M.
1981-01-01
Photohydrogen production, 200-700 ..mu..mol H/sub 2/ h/sup -1/ (mg bacteriochlorophyll a)/sup -1/ has been obtained in a system containing unit membrane vesicles (Complex I) from the green photosynthetic bacterium Chlorobium limicola f. thiosulfatophilum, ascorbate, N,N,N',N'-tetramethyl-p-phenylenediamine, dithioerythritol, an oxygen scavenging mixture, either methyl viologen (MV) or clostridial ferredoxin (CPS Fd) as electron carrier, and either CPS hydrogenase or platinum asbestos as catalyst. All components are necessary for maximum activity, and spinach Fd cannot be substituted for CPS Fd. Higher rates of photohydrogen production are obtained using MV or CPS Fd with hydrogenase than with MV and Pt asbestos. The highest quantum efficiencies (7-10% at 0.2-0.9 mW absorbed light and over 20% at lower light) were obtained with CPS Fd, hydrogenase and non-saturating 812 nm light. With saturating white light, however, rates of photohydrogen production varied relatively little among the various combinations of electron carrier and catalyst tested. The reaction rate is unaffected by 0.03% Triton X-100, and is insensitive to treatment with antimycin a or m-chloro-carbonyl cyanide phenylhydrazone.This indicates that neither electron flow through an endogenous cyclic chain, nor maintenance of a proton gradient are involved in this process.
A reverse KREBS cycle in photosynthesis: consensus at last
Buchanan, B. B.; Arnon, D. I.
1990-01-01
The Krebs cycle (citric acid or tricarboxylic acid cycle), the final common pathway in aerobic metabolism for the oxidation of carbohydrates, fatty acids and amino acids, is known to be irreversible. It liberates CO2 and generates NADH whose aerobic oxidation yields ATP but it does not operate in reverse as a biosynthetic pathway for CO2 assimilation. In 1966, our laboratory described a cyclic pathway for CO2 assimilation (Evans, Buchanan and Arnon 1966) that was unusual in two respects: (i) it provided the first instance of an obligate photoautotroph that assimilated CO2 by a pathway different from Calvin's reductive pentose phosphate cycle (Calvin 1962) and (ii) in its overall effect the new cycle was a reversal of the Krebs cycle. Named the 'reductive carboxylic acid cycle' (sometimes also called the reductive tricarboxylic acid cycle) the new cycle appeared to be the sole CO2 assimilation pathway in Chlorobium thiosulfatophilum (Evans et al. 1966) (now known as Chlorobium limicola forma thiosulfatophilum). Chlorobium is a photosynthetic green sulfur bacterium that grows anaerobically in an inorganic medium with sulfide and thiosulfate as electron donors and CO2 as an obligatory carbon source. In the ensuing years, the new cycle was viewed with skepticism. Not only was it in conflict with the prevailing doctrine that the 'one important property ... shared by all (our emphasis) autotrophic species is the assimilation of CO2 via the Calvin cycle' (McFadden 1973) but also some of its experimental underpinnings were challenged. It is only now that in the words of one of its early skeptics (Tabita 1988) 'a long and tortuous controversy' has ended with general acceptance of the reductive carboxylic acid cycle as a photosynthetic CO2 assimilation pathway distinct from the pentose cycle. (Henceforth, to minimize repetitiveness, the reductive pentose phosphate cycle will often be referred to as the pentose cycle and the reductive carboxylic acid cycle as the carboxylic
Final Report - "CO2 Sequestration in Cell Biomass of Chlorobium Thiosulfatophilum"
Energy Technology Data Exchange (ETDEWEB)
James L. Gaddy, PhD; Ching-Whan Ko, PhD
2009-05-04
World carbon dioxide emissions from the combustion of fossil fuels have increased at a rate of about 3 percent per year during the last 40 years to over 24 billion tons today. While a number of methods have been proposed and are under study for dealing with the carbon dioxide problem, all have advantages as well as disadvantages which limit their application. The anaerobic bacterium Chlorobium thiosulfatophilum uses hydrogen sulfide and carbon dioxide to produce elemental sulfur and cell biomass. The overall objective of this project is to develop a commercial process for the biological sequestration of carbon dioxide and simultaneous conversion of hydrogen sulfide to elemental sulfur. The Phase I study successfully demonstrated the technical feasibility of utilizing this bacterium for carbon dioxide sequestration and hydrogen sulfide conversion to elemental sulfur by utilizing the bacterium in continuous reactor studies. Phase II studies involved an advanced research and development to develop the engineering and scale-up parameters for commercialization of the technology. Tasks include culture isolation and optimization studies, further continuous reactor studies, light delivery systems, high pressure studies, process scale-up, a market analysis and economic projections. A number of anaerobic and aerobic microorgansims, both non-photosynthetic and photosynthetic, were examined to find those with the fastest rates for detailed study to continuous culture experiments. C. thiosulfatophilum was selected for study to anaerobically produce sulfur and Thiomicrospira crunogena waws selected for study to produce sulfate non-photosynthetically. Optimal conditions for growth, H2S and CO2 comparison, supplying light and separating sulfur were defined. The design and economic projections show that light supply for photosynthetic reactions is far too expensive, even when solar systems are considered. However, the aerobic non-photosynthetic reaction to produce sulfate with T
Rails - Spears and Didion Ranches [ds310
California Natural Resource Agency — These data are the detections of Virginia rail (Rallus limicola), Sora (Porzana carolina), and California black rail (Laterallus jamaicensis) from 13 survey points...
ORF Sequence: NC_002932 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ase [Chlorobium tepidum TLS] MNILGIETSCDETSAAVLSDGSVRSNIVSSQRCHTDFGGVVPELASREHERLIVSIVDAAITEANIAKNDLDVIAATAG...PGLIGAVMVGLCFAEGLAWALGKPFVPVNHVEAHIFSPFISDEPGHREPKGDFVSLTVSGGHTLLSVVRQDLGYEVIGRTIDDAAGEAFDKTGKMLGLGYPAGPVIDR
Selts : kurvitsalised (Limicolae) / Jaanus Elts
Elts, Jaanus, 1966-
2006-01-01
Mudanepp, tikutaja, rohunepp, metskurvits, väiketüll, liivatüll, suurkoovitaja, väikekoovitaja, väikekajakas, naerukajakas, kalakajakas, alk, krüüsel, väiketiir, jõgitiir, randtiir, räusk, tutt-tiir, punajalg, merisk, jõgitilder, kivirullija. Järgneb juuni nr. 6, lk. 34-35, juuli nr. 7, lk. 40, nr. 8/9, lk. 54-55, nr. 11, lk. 30-31, nr. 12, lk. 46-47 2007, nr. 2, lk. 42-43, nr. 3, lk. 40-41, nr. 4, lk. 34-35, nr. 7, lk. 36-37, nr. 8/9, lk. 54-55, nr. 10, lk. 46-47
Final Environmental Assessment for Planned Growth Hulrburd Field, Florida
2009-08-01
snake1 Thamnophis sirtalis Eastern garter snake1 Trachemys scripta Yellow-belly slider Virginia striatula Rough earth snake Virginia valeriae...tailed grackle Quiscalus quiscula Common grackle1 Rallus elegans King rail Rallus limicola Virginia rail Rallus longirostris Clapper rail Regulus
ORF Alignment: NC_002932 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Chlorobium tepidum TLS] ... Length = 101 ... Query: 7 ... TRKELTILKLEEPIFDVRYADCFKATIDSMISTGTSKNIIIDFSQVKAIDS...SGIGSMLLA 66 ... TRKELTILKLEEPIFDVRYADCFKATIDSMISTGTSKNIIIDFSQVKAIDS...SGIGSMLLA Sbjct: 1 ... TRKELTILKLEEPIFDVRYADCFKATIDSMISTGTSKNIIIDFSQVKAIDSSGIGSMLLA 60 ...
ORF Alignment: NC_002932 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Chlorobium tepidum TLS] ... Length = 114 ... Query: 9 ... DPLKMFEDVFNERLTPFISSMGSMMAPAFKVDISEDEKAIYLS...ADIPGVKKEDVKVSIED 68 ... DPLKMFEDVFNERLTPFISSMGSMMAPAFKVDISEDEKAIYLSADIPGV...KKEDVKVSIED Sbjct: 1 ... DPLKMFEDVFNERLTPFISSMGSMMAPAFKVDISEDEKAIYLSADIPGVKKEDVKVSIED 60 ...
ORF Alignment: NC_002932 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ytidylate ... deaminase family protein [Chlorobium tepidum TLS] ... Length = 155 ... Query: 30 ... EARMRFV...VGASRKSVEEVSGGPFAAAVFEIESGRLVSLGVNLVLTQNSSILHAEMVAIVL 89 ... EARMRFV...VGASRKSVEEVSGGPFAAAVFEIESGRLVSLGVNLVLTQNSSILHAEMVAIVL Sbjct: 1 ... EARMRFVVGASRKSVEEVSGGPFAAAVFEIESGRLVSLGVNLV
ORF Alignment: NC_002932 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available nterchange ... protein, thioredoxin family [Chlorobium tepidum TLS] ... Length = 139 ... Query: 41 ... MAPA...FTLKTLEGKELNSSQLAGRPYIVNFFASWCPPCREELPGMVALQKKYAKQGFTFVG 100 ... MAPA...FTLKTLEGKELNSSQLAGRPYIVNFFASWCPPCREELPGMVALQKKYAKQGFTFVG Sbjct: 1 ... MAPAFTLKTLEGKELNSSQLAGRPYIVNFFASWCPPCR
The Earthworms (Oligochaeta: Lumbricidae)of Wyoming, USA, Revisited.
This survey of the earthworms from 22 of the 23 counties of Wyoming recorded 13 species of terrestrial Oligochaeta, all members of the family Lumbricidae. One of these species, Aporrectodea limicola, is reported for the first time from the state. Current nomenclature is applied to historical records...
ORF Alignment: NC_002932 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available orobium tepidum TLS] gb|AAM72447.1| thioredoxin ... [Chlorobium tepidum TLS] ... Length = 99 ... Query: 8 ... DFQNDVI...ERSKTVPVLVDFWAQWCGPCRILAPVLEKLAERHAGKWVLVKVNTEEFPEISA 67 ... DFQNDVIERSKTVPVLVDFWAQ...WCGPCRILAPVLEKLAERHAGKWVLVKVNTEEFPEISA Sbjct: 1 ... DFQNDVIERSKTVPVLVDFWAQWCGPCRILAPVLEKLAERHAGKWVLVKVNTEEFPEISA 60 ...
Gauger, Tina; Byrne, James M.; Konhauser, Kurt O.; Obst, Martin; Crowe, Sean; Kappler, Andreas
2016-06-01
Most studies on microbial phototrophic Fe(II) oxidation (photoferrotrophy) have focused on purple bacteria, but recent evidence points to the importance of green-sulfur bacteria (GSB). Their recovery from modern ferruginous environments suggests that these photoferrotrophs can offer insights into how their ancient counterparts grew in Archean oceans at the time of banded iron formation (BIF) deposition. It is unknown, however, how Fe(II) oxidation rates, cell-mineral aggregate formation, and Fe-mineralogy vary under environmental conditions reminiscent of the geological past. To address this, we studied the Fe(II)-oxidizer Chlorobium ferrooxidans KoFox, a GSB living in co-culture with the heterotrophic Geospirillum strain KoFum. We investigated the mineralogy of Fe(III) metabolic products at low/high light intensity, and in the presence of dissolved silica and/or fumarate. Silica and fumarate influenced the crystallinity and particle size of the produced Fe(III) minerals. The presence of silica also enhanced Fe(II) oxidation rates, especially at high light intensities, potentially by lowering Fe(II)-toxicity to the cells. Electron microscopic imaging showed no encrustation of either KoFox or KoFum cells with Fe(III)-minerals, though weak associations were observed suggesting co-sedimentation of Fe(III) with at least some biomass via these aggregates, which could support diagenetic Fe(III)-reduction. Given that GSB are presumably one of the most ancient photosynthetic organisms, and pre-date cyanobacteria, our findings, on the one hand, strengthen arguments for photoferrotrophic activity as a likely mechanism for BIF deposition on a predominantly anoxic early Earth, but, on the other hand, also suggest that preservation of remnants of Fe(II)-oxidizing GSB as microfossils in the rock record is unlikely.
Czech Academy of Sciences Publication Activity Database
Chappaz-Gillot, C.; Marek, P.L.; Blaive, B.J.; Canard, G.; Burck, J.; Hahn, H.; Jávor fi, T.; Kelemen, L.; Krupke, R.; Mossinger, D.; Ormos, P.; Reddy, C.M.; Roussel, C.; Steinbach, G.; Szabo, M.; Ulrich, A.S.; Vanthuyne, V.N.; Vijayaraghavan, A.; Župčanová, Anita; Balaban, T.S.
2012-01-01
Roč. 134, č. 2 (2012), s. 944-954 ISSN 0002-7863 Institutional support: RVO:60077344 Keywords : Green photosynthetic bacteria * Bacteriochlorophyll-C * Chlorobium-Tepidum Subject RIV: CE - Biochemistry Impact factor: 10.677, year: 2012
Czech Academy of Sciences Publication Activity Database
Furumaki, S.; Vácha, František; Habuchi, S.; Tsukatani, Y.; Bryant, D.A.; Vácha, M.
2011-01-01
Roč. 133, č. 17 (2011), s. 6703-6710 ISSN 0002-7863 R&D Projects: GA ČR GA206/09/0375 Institutional research plan: CEZ:AV0Z50510513 Keywords : CHLOROBIUM-TEPIDUM * BACTERIOCHLOROPHYLL-C * SUPRAMOLECULAR ORGANIZATION Subject RIV: EF - Botanics Impact factor: 9.907, year: 2011
DEFF Research Database (Denmark)
Persson, S; Sönksen, C P; Frigaard, N U
2000-01-01
We have used matrix-assisted laser desorption ionization time-of-flight mass spectrometry (MALDI-TOF-MS) for mass determination of pigments and proteins in chlorosomes, the light-harvesting organelles from the photosynthetic green sulfur bacterium Chlorobium tepidum. By applying a small volume (1...... microL) of a concentrated suspension of isolated chlorosomes directly to the target of the mass spectrometer we have been able to detect bacteriochlorophyll a and all the major homologs of bacteriochlorophyll c. The peak heights of the different bacteriochlorophyll c homologs in the MALDI spectra were...... proportional to peak areas obtained from HPLC analysis of the same sample. The same result was also obtained when whole cells of Chl. tepidum were applied to the target, indicating that MALDI-MS can provide a rapid method for obtaining a semiquantitative determination or finger-print of the bacteriochlorophyll...
DEFF Research Database (Denmark)
Liu, W.-T.; Nielsen, Alex Toftgaard; Wu, JH
2001-01-01
, electron microscopy with energy-dispersive X-ray analysis was used to validate the staining specificity of 4,6-diamino-2-phenylindole (DAPI) for intracellular polyphosphate and revealed the composition of polyphosphate granules accumulated in predominant bacteria as mostly P, Ca and Na. As a result, DAPI......, one novel rod-shaped group, closely related to coccus-shaped Tetrasphaera, and one filamentous group resembling Candidatus Nostocoidia limicola in the HGC group were found to accumulate polyphosphate but not PHA, No cellular inclusions were detected in most members of the alpha -Proteobacteria...
Directory of Open Access Journals (Sweden)
Shawna T. Park
2014-01-01
Full Text Available The chytrid fungus Batrachochytrium dendrobatidis is a significant cause of the worldwide decline in amphibian populations; however, various amphibian species are capable of coexisting with B. dendrobatidis. Among them are boreal toads ( Anaxyrus ( Bufo boreas boreas located in Grand Teton National Park (GTNP in Wyoming, USA. The purpose of this study was to identify cultivable bacterial isolates from the skin microbiota of boreal toads from GTNP and determine if they were capable of inhibiting B. dendrobatidis in vitro, and therefore might be a factor in the toad's coexistence with this pathogen. Isolates from 6 of 21 genera tested were found to inhibit the growth of B. dendrobatidis. These bacteria represent diverse lineages such as the Gammaproteobacteria, the Betaproteobacteria, and the Bacteroidetes/Chlorobium groups. We propose that these bacteria compete via microbial antagonism with B. dendrobatidis.
Identification of a fourth family of lycopene cyclases in photosynthetic bacteria
Maresca, Julia A.; Graham, Joel E.; Wu, Martin; Eisen, Jonathan A.; Bryant, Donald A.
2007-01-01
A fourth and large family of lycopene cyclases was identified in photosynthetic prokaryotes. The first member of this family, encoded by the cruA gene of the green sulfur bacterium Chlorobium tepidum, was identified in a complementation assay with a lycopene-producing strain of Escherichia coli. Orthologs of cruA are found in all available green sulfur bacterial genomes and in all cyanobacterial genomes that lack genes encoding CrtL- or CrtY-type lycopene cyclases. The cyanobacterium Synechoc...
Studies of alkyl porphyrin distributions in organic-rich sediments using LC-MS
International Nuclear Information System (INIS)
Eckardt, C.B.; Carter, J.F.; Keely, B.J.; Maxwell, J.R.; Kilpatrick, G.
1992-01-01
In recent years, structure elucidation of a wide variety of sedimentary tetrapyrroles has provided clear molecular evidence for the presence of primary photosynthetic communities in palaeo water columns. The reported structures indicate an origin from algal chlorophylls c for certain components, while an origin from photosynthetic bacteria is apparent from the carbon skeletons of other components. In particular, the structures of ≤C 34 porphyrin carboxylic acids in the Eocene Messel shale indicate an origin from Chloroblum bacteria. Since such bacteria are strict anaerobes, the presence of these species is evidence for anoxic conditions extending into the photic zone of Messel lake. By analogy, the presence in the more widely-occurring alkyl porphyrin distributions of components >C 33 would also suggest a Chlorobium chlorophyll origin. Hence, in this paper, the authors studied by LC-MS, the distributions of alkyl porphyrins in selected sediments and searched for the presence of such components, in order to determine photic zone anoxia in the respective palaeo environments
Dicty_cDB: Contig-U15045-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available e) Bacillus anthracis str. CDC 684... 286 2e-75 EU302126_1( EU302126 |pid:none) Luciola terminali... AE006470_46( AE006470 |pid:none) Chlorobium tepidum TLS, complete ... 207 2e-51 AM494956_128( AM494956 |pid...centrotus purpuratus clone R3-42P23, WOR... 36 0.051 11 ( EK354403 ) 1095468426890 Global-Ocean-Sampling_GS-...** SEQUENCI... 38 0.25 13 ( EJ594751 ) 1092961073324 Global-Ocean-Sampling_GS-29-01-01-1... 40 0.26 2 ( BA00...170 ) 1093018401251 Global-Ocean-Sampling_GS-36-01-01-2... 50 0.35 1 ( ER486373 ) 1093015301415 Global-Ocean-Sampli
Dicty_cDB: Contig-U06515-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available bicolorF (DH5a methyl filtered) S... 46 1.5 1 ( FL639764 ) TG_26_G7 Termite gut library Reticuliterm...0375 ) 1092960187571 Global-Ocean-Sampling_GS-31-01-01-1... 44 6.0 1 ( CT500356 ) A BAC library has been constructed...01013_1( AK301013 |pid:none) Homo sapiens cDNA FLJ60076 complet... 54 4e-06 EU973819_1( EU973819 |pid:none) ...K290984 |pid:none) Homo sapiens cDNA FLJ75459 complet... 51 2e-05 CP001097_2035( CP001097 |pid:none) Chlorobium lim... ( EJ751844 ) 1092963041016 Global-Ocean-Sampling_GS-30-02-01-1... 46 1.5 1 ( EJ5
International Nuclear Information System (INIS)
Eissa, N.A.; Sheta, N.H.; Ahmed, M.A.
1992-01-01
Coal has been recently discovered in Maghara mine at Northern Sinai, Egypt. Coal samples have been collected from different depths and were measured by XRD, XRF, and MS, in order to characterize this type of coal. It has been found that the iron bearing minerals are mainly pyrite and different sulphates depending on the depth of the sample. The second part contains the application of desulphurization techniques to Egyptian coal which are: floatation (one step and two steps), chemical [(HCl+HNO 3 ), and Fe 2 (SO 4 ) 3 ] and bacterial methods (Chromatium and Chlorobium species). The efficiency of each technique was calculated. A comparative discussion is given of each desulphurization method, from which the bacterial method has proved to be the most efficient one. (orig.)
Mechanisms and evolution of oxidative sulfur metabolism in green sulfur bacteria
DEFF Research Database (Denmark)
Gregersen, Lea Haarup; Bryant, Donald A.; Frigaard, Niels-Ulrik
2011-01-01
Green sulfur bacteria (GSB) constitute a closely related group of photoautotrophic and thiotrophic bacteria with limited phenotypic variation. They typically oxidize sulfide and thiosulfate to sulfate with sulfur globules as an intermediate. Based on genome sequence information from 15 strains...... product is further oxidized to sulfite by the dissimilatory sulfite reductase (DSR) system. This system consists of components horizontally acquired partly from sulfide-oxidizing and partly from sulfate-reducing bacteria. Depending on the strain, the sulfite is probably oxidized to sulfate by one of two...... in sulfate formation in other bacteria has been replaced by the DSR system in GSB. Sequence analyses suggested that the conserved soxJXYZAKBW gene cluster was horizontally acquired by Chlorobium phaeovibrioides DSM 265 from the Chlorobaculum lineage and that this acquisition was mediated by a mobile genetic...
34S/32S fractionation in sulfur cycles catalyzed by anaerobic bacteria
Fry, B.; Gest, H.; Hayes, J. M.
1988-01-01
Stable isotopic distributions in the sulfur cycle were studied with pure and mixed cultures of the anaerobic bacteria, Chlorobium vibrioforme and Desulfovibrio vulgaris. D. vulgaris and C. vibrioforme can catalyze three reactions constituting a complete anaerobic sulfur cycle: reduction of sulfate to sulfide (D. vulgaris), oxidation of sulfide to elemental sulfur (C. vibrioforme), and oxidation of sulfur to sulfate (C. vibrioforme). In all experiments, the first and last reactions favored concentration of the light 32S isotope in products (isotopic fractionation factor epsilon = -7.2 and -1.7%, respectively), whereas oxidation of sulfide favored concentration of the heavy 34S isotope in products (epsilon = +1.7%). Experimental results and model calculations suggest that elemental sulfur enriched in 34S versus sulfide may be a biogeochemical marker for the presence of sulfide-oxidizing bacteria in modern and ancient environments.
DEFF Research Database (Denmark)
Cedhagen, Tomas; Tendal, Ole S.
1989-01-01
Laboratory observations and experiments demonstrate that the naked rhizopods Amoeba gigantea SANDAHL, 1857 and Megamoebomyxa argillo~ia NYHOLM, 1950, and the foraminifers Astrorhiza arenifera STSCHEDRlNA, 1946, A. sabulifera STSCHEDRINA, 1946 and A. arctlca STSCHEDRINA, 1958 are synonyms of Astro......Laboratory observations and experiments demonstrate that the naked rhizopods Amoeba gigantea SANDAHL, 1857 and Megamoebomyxa argillo~ia NYHOLM, 1950, and the foraminifers Astrorhiza arenifera STSCHEDRlNA, 1946, A. sabulifera STSCHEDRINA, 1946 and A. arctlca STSCHEDRINA, 1958 are synonyms...
Phototrophic Fe(II-oxidation in the chemocline of a ferruginous meromictic lake
Directory of Open Access Journals (Sweden)
Xavier Alexis eWalter
2014-12-01
Full Text Available Precambrian Banded Iron Formation (BIF deposition was conventionally attributed to the precipitation of iron-oxides resulting from the abiotic reaction of ferrous iron (Fe(II with photosynthetically-produced oxygen. Earliest traces of oxygen date from 2.7 Ga, thus raising questions as to what may have caused BIF precipitation before oxygenic photosynthesis evolved. The discovery of anoxygenic phototrophic bacteria thriving through the oxidation of Fe(II has provided support for a biological origin for some BIFs, but despite reports suggesting that anoxygenic phototrophs may oxidize Fe(II in the environment, a model ecosystem of an ancient ocean where they are demonstrably active was lacking. Here we show that anoxygenic phototrophic bacteria contribute to Fe(II oxidation in the water column of the ferruginous sulfate-poor, meromictic lake La Cruz (Spain. We observed in-situ photoferrotrophic activity through stimulation of phototrophic carbon uptake in the presence of Fe(II, and determined light-dependent Fe(II-oxidation by the natural chemocline microbiota. Moreover, a photoferrotrophic bacterium most closely related to Chlorobium ferrooxidans was enriched from the ferruginous water column. Our study for the first time demonstrates a direct link between anoxygenic photoferrotrophy and the anoxic precipitation of Fe(III-oxides in a ferruginous water column, providing a plausible mechanism for the bacterial origin of BIF’s before the advent of free oxygen.
Energy Technology Data Exchange (ETDEWEB)
Buck, D. R. [Iowa State Univ., Ames, IA (United States)
2000-09-12
Theoretical simulations and ultrafast pump-probe laser spectroscopy experiments were used to study photosynthetic pigment-protein complexes and antennae found in green sulfur bacteria such as Prosthecochloris aestuarii, Chloroflexus aurantiacus, and Chlorobium tepidum. The work focused on understanding structure-function relationships in energy transfer processes in these complexes through experiments and trying to model that data as we tested our theoretical assumptions with calculations. Theoretical exciton calculations on tubular pigment aggregates yield electronic absorption spectra that are superimpositions of linear J-aggregate spectra. The electronic spectroscopy of BChl c/d/e antennae in light harvesting chlorosomes from Chloroflexus aurantiacus differs considerably from J-aggregate spectra. Strong symmetry breaking is needed if we hope to simulate the absorption spectra of the BChl c antenna. The theory for simulating absorption difference spectra in strongly coupled photosynthetic antenna is described, first for a relatively simple heterodimer, then for the general N-pigment system. The theory is applied to the Fenna-Matthews-Olson (FMO) BChl a protein trimers from Prosthecochloris aestuarii and then compared with experimental low-temperature absorption difference spectra of FMO trimers from Chlorobium tepidum. Circular dichroism spectra of the FMO trimer are unusually sensitive to diagonal energy disorder. Substantial differences occur between CD spectra in exciton simulations performed with and without realistic inhomogeneous distribution functions for the input pigment diagonal energies. Anisotropic absorption difference spectroscopy measurements are less consistent with 21-pigment trimer simulations than 7-pigment monomer simulations which assume that the laser-prepared states are localized within a subunit of the trimer. Experimental anisotropies from real samples likely arise from statistical averaging over states with diagonal energies shifted by
Photosynthetic antennae systems: energy transport and optical absorption
International Nuclear Information System (INIS)
Reineker, P.; Supritz, Ch.; Warns, Ch.; Barvik, I.
2004-01-01
The energy transport and the optical line shape of molecular aggregates, modeling bacteria photosynthetic light-harvesting systems (chlorosomes in the case of Chlorobium tepidum or Chloroflexus aurantiacus and LH2 in the case of Rhodopseudomonas acidophila) is investigated theoretically. The molecular units are described by two-level systems with an average excitation energy ε and interacting with each other through nearest-neighbor interactions. For LH2 an elliptical deformation of the ring is also allowed. Furthermore, dynamic and in the case of LH2 also quasi-static fluctuations of the local excitation energies are taken into account, simulating fast molecular vibrations and slow motions of the protein backbone, respectively. The fluctuations are described by Gaussian Markov processes in the case of the chlorosomes and by colored dichotomic Markov processes, with exponentially decaying correlation functions, with small (λ s ) and large (λ) decay constants, in the case of LH2
Modelling of oscillations in two-dimensional echo-spectra of the Fenna-Matthews-Olson complex
International Nuclear Information System (INIS)
Hein, Birgit; Kreisbeck, Christoph; Kramer, Tobias; Rodríguez, Mirta
2012-01-01
Recent experimental observations of time-dependent beatings in the two-dimensional echo-spectra of light-harvesting complexes at ambient temperatures have opened up the question of whether coherence and wave-like behaviour play a significant role in photosynthesis. We carry out a numerical study of the absorption and echo-spectra of the Fenna-Matthews-Olson (FMO) complex in Chlorobium tepidum and analyse the requirements in the theoretical model needed to reproduce beatings in the calculated spectra. The energy transfer in the FMO pigment-protein complex is theoretically described by an exciton Hamiltonian coupled to a phonon bath which accounts for the pigments' electronic and vibrational excitations, respectively. We use the hierarchical equations of motions method to treat the strong couplings in a non-perturbative way. We show that the oscillations in the two-dimensional echo-spectra persist in the presence of thermal noise and static disorder. (paper)
Pheophytinization of bacteriochlorophyll c and energy transfer in cells of Chlorobium tepidum
DEFF Research Database (Denmark)
Tokita, S; Hirota, M; Frigaard, N-U
1999-01-01
medium, normal growth was observed after a short lag phase, and the absorption spectrum of the growing cells showed the presence of a normal amount of BChl c. During the growth of C. tepidum in the new culture, the BChl c concentration was nearly proportional to the cell density measured by turbidity (OD...
DEFF Research Database (Denmark)
Li, Hui; Frigaard, Niels-Ulrik; Bryant, Donald A
2006-01-01
type and mutants lacking a single chlorosome protein were cross-linked with the zero-length cross-linker 1-ethyl-3-[3-(dimethylamino)propyl]carbodiimide (EDC) and analyzed by gel electrophoresis. Similar cross-linking products were observed when the time and temperature were varied or when EDC...... was replaced with glutaraldehyde. Specific interactions between chlorosome proteins in cross-linked products were identified by immunoblotting with polyclonal antibodies raised against recombinant chlorosome proteins. We confirmed these interactions by demonstrating that these products were missing...... in appropriate mutants. Confirming the location of CsmA in the paracrystalline baseplate, cross-linking showed that CsmA forms dimers, trimers, and homomultimers as large as dodecamers and that CsmA directly interacts with the Fenna-Matthews-Olson protein. Cross-linking further suggests that the precursor form...
Examination of microbial fuel cell start-up times with domestic wastewater and additional amendments
Liu, Guangli
2011-08-01
Rapid startup of microbial fuel cells (MFCs) and other bioreactors is desirable when treating wastewaters. The startup time with unamended wastewater (118h) was similar to that obtained by adding acetate or fumarate (110-115h), and less than that with glucose (181h) or Fe(III) (353h). Initial current production took longer when phosphate buffer was added, with startup times increasing with concentration from 149h (25mM) to 251h (50mM) and 526h (100mM). Microbial communities that developed in the reactors contained Betaproteobacteria, Acetoanaerobium noterae, and Chlorobium sp. Anode biomass densities ranged from 200 to 600μg/cm2 for all amendments except Fe(Sh{cyrillic}) (1650μg/cm2). Wastewater produced 91mW/m2, with the other MFCs producing 50mW/m2 (fumarate) to 103mW/m2 (Fe(III)) when amendments were removed. These experiments show that wastewater alone is sufficient to acclimate the reactor without the need for additional chemical amendments. © 2011 Elsevier Ltd.
Liu, Guangli; Yates, Matthew D; Cheng, Shaoan; Call, Douglas F; Sun, Dan; Logan, Bruce E
2011-08-01
Rapid startup of microbial fuel cells (MFCs) and other bioreactors is desirable when treating wastewaters. The startup time with unamended wastewater (118 h) was similar to that obtained by adding acetate or fumarate (110-115 h), and less than that with glucose (181 h) or Fe(III) (353 h). Initial current production took longer when phosphate buffer was added, with startup times increasing with concentration from 149 h (25 mM) to 251 h (50 mM) and 526 h (100 mM). Microbial communities that developed in the reactors contained Betaproteobacteria, Acetoanaerobium noterae, and Chlorobium sp. Anode biomass densities ranged from 200 to 600 μg/cm(2) for all amendments except Fe(Ш) (1650 μg/cm(2)). Wastewater produced 91 mW/m(2), with the other MFCs producing 50 mW/m(2) (fumarate) to 103mW/m(2) (Fe(III)) when amendments were removed. These experiments show that wastewater alone is sufficient to acclimate the reactor without the need for additional chemical amendments. Copyright © 2011 Elsevier Ltd. All rights reserved.
Examination of microbial fuel cell start-up times with domestic wastewater and additional amendments
Liu, Guangli; Yates, Matthew D.; Cheng, Shaoan; Call, Douglas F.; Sun, Dan; Logan, Bruce E.
2011-01-01
Rapid startup of microbial fuel cells (MFCs) and other bioreactors is desirable when treating wastewaters. The startup time with unamended wastewater (118h) was similar to that obtained by adding acetate or fumarate (110-115h), and less than that with glucose (181h) or Fe(III) (353h). Initial current production took longer when phosphate buffer was added, with startup times increasing with concentration from 149h (25mM) to 251h (50mM) and 526h (100mM). Microbial communities that developed in the reactors contained Betaproteobacteria, Acetoanaerobium noterae, and Chlorobium sp. Anode biomass densities ranged from 200 to 600μg/cm2 for all amendments except Fe(Sh{cyrillic}) (1650μg/cm2). Wastewater produced 91mW/m2, with the other MFCs producing 50mW/m2 (fumarate) to 103mW/m2 (Fe(III)) when amendments were removed. These experiments show that wastewater alone is sufficient to acclimate the reactor without the need for additional chemical amendments. © 2011 Elsevier Ltd.
Identification of a fourth family of lycopene cyclases in photosynthetic bacteria.
Maresca, Julia A; Graham, Joel E; Wu, Martin; Eisen, Jonathan A; Bryant, Donald A
2007-07-10
A fourth and large family of lycopene cyclases was identified in photosynthetic prokaryotes. The first member of this family, encoded by the cruA gene of the green sulfur bacterium Chlorobium tepidum, was identified in a complementation assay with a lycopene-producing strain of Escherichia coli. Orthologs of cruA are found in all available green sulfur bacterial genomes and in all cyanobacterial genomes that lack genes encoding CrtL- or CrtY-type lycopene cyclases. The cyanobacterium Synechococcus sp. PCC 7002 has two homologs of CruA, denoted CruA and CruP, and both were shown to have lycopene cyclase activity. Although all characterized lycopene cyclases in plants are CrtL-type proteins, genes orthologous to cruP also occur in plant genomes. The CruA- and CruP-type carotenoid cyclases are members of the FixC dehydrogenase superfamily and are distantly related to CrtL- and CrtY-type lycopene cyclases. Identification of these cyclases fills a major gap in the carotenoid biosynthetic pathways of green sulfur bacteria and cyanobacteria.
DEFF Research Database (Denmark)
Cedhagen, Tomas
1993-01-01
earlier caused uncertainty about the identity of the species. "It was studied on the Swedish west coast, where it may reach 60 mm in length. It occurs below the halocline on bottoms with little bioturbation. It is a suspension feeder. The granuloreticulopodia are extended in the water, where they collect...... of the test are adaptations that also protect against bioturbation and predation but may restrict the respiratory surface. Field observations and laboratory experiments under anoxic conditions show that P arborescens can live anaerobically. Histological analysis of the protoplasm revealed large amounts...
Directory of Open Access Journals (Sweden)
Lorenzini Emily
2007-05-01
Full Text Available Abstract Background The Bacteroidetes and Chlorobi species constitute two main groups of the Bacteria that are closely related in phylogenetic trees. The Bacteroidetes species are widely distributed and include many important periodontal pathogens. In contrast, all Chlorobi are anoxygenic obligate photoautotrophs. Very few (or no biochemical or molecular characteristics are known that are distinctive characteristics of these bacteria, or are commonly shared by them. Results Systematic blast searches were performed on each open reading frame in the genomes of Porphyromonas gingivalis W83, Bacteroides fragilis YCH46, B. thetaiotaomicron VPI-5482, Gramella forsetii KT0803, Chlorobium luteolum (formerly Pelodictyon luteolum DSM 273 and Chlorobaculum tepidum (formerly Chlorobium tepidum TLS to search for proteins that are uniquely present in either all or certain subgroups of Bacteroidetes and Chlorobi. These studies have identified > 600 proteins for which homologues are not found in other organisms. This includes 27 and 51 proteins that are specific for most of the sequenced Bacteroidetes and Chlorobi genomes, respectively; 52 and 38 proteins that are limited to species from the Bacteroidales and Flavobacteriales orders, respectively, and 5 proteins that are common to species from these two orders; 185 proteins that are specific for the Bacteroides genus. Additionally, 6 proteins that are uniquely shared by species from the Bacteroidetes and Chlorobi phyla (one of them also present in the Fibrobacteres have also been identified. This work also describes two large conserved inserts in DNA polymerase III (DnaE and alanyl-tRNA synthetase that are distinctive characteristics of the Chlorobi species and a 3 aa deletion in ClpB chaperone that is mainly found in various Bacteroidales, Flavobacteriales and Flexebacteraceae, but generally not found in the homologs from other organisms. Phylogenetic analyses of the Bacteroidetes and Chlorobi species is also
DEFF Research Database (Denmark)
Melø, T B; Frigaard, N-U; Matsuura, K
2000-01-01
S) spectra, recorded at ambient temperature and under non-reducing or reducing conditions, are reported. The carotenoid (Car) pigments in both species transfer their singlet excitation to bacteriochlorophyll c (BChlc) with an efficiency which is high (between 0.5 and 0.8) but smaller than unity; BChlc...
Summary of intrinsic and extrinsic factors affecting detection probability of marsh birds
Conway, C.J.; Gibbs, J.P.
2011-01-01
Many species of marsh birds (rails, bitterns, grebes, etc.) rely exclusively on emergent marsh vegetation for all phases of their life cycle, and many organizations have become concerned about the status and persistence of this group of birds. Yet, marsh birds are notoriously difficult to monitor due to their secretive habits. We synthesized the published and unpublished literature and summarized the factors that influence detection probability of secretive marsh birds in North America. Marsh birds are more likely to respond to conspecific than heterospecific calls, and seasonal peak in vocalization probability varies among co-existing species. The effectiveness of morning versus evening surveys varies among species and locations. Vocalization probability appears to be positively correlated with density in breeding Virginia Rails (Rallus limicola), Soras (Porzana carolina), and Clapper Rails (Rallus longirostris). Movement of birds toward the broadcast source creates biases when using count data from callbroadcast surveys to estimate population density. Ambient temperature, wind speed, cloud cover, and moon phase affected detection probability in some, but not all, studies. Better estimates of detection probability are needed. We provide recommendations that would help improve future marsh bird survey efforts and a list of 14 priority information and research needs that represent gaps in our current knowledge where future resources are best directed. ?? Society of Wetland Scientists 2011.
Energy Technology Data Exchange (ETDEWEB)
Matsuzaki, Satoshi [Iowa State Univ., Ames, IA (United States)
2001-01-01
This thesis contains the candidate's original work on excitonic structure and energy transfer dynamics of two bacterial antenna complexes as studied using spectral hole-burning spectroscopy. The general introduction is divided into two chapters (1 and 2). Chapter 1 provides background material on photosynthesis and bacterial antenna complexes with emphasis on the two bacterial antenna systems related to the thesis research. Chapter 2 reviews the underlying principles and mechanism of persistent nonphotochemical hole-burning (NPHB) spectroscopy. Relevant energy transfer theories are also discussed. Chapters 3 and 4 are papers by the candidate that have been published. Chapter 3 describes the application of NPHB spectroscopy to the Fenna-Matthews-Olson (FMO) complex from the green sulfur bacterium Prosthecochloris aestuarii; emphasis is on determination of the low energy vibrational structure that is important for understanding the energy transfer process associated within three lowest energy Qy-states of the complex. The results are compared with those obtained earlier on the FMO complex from Chlorobium tepidum. In Chapter 4, the energy transfer dynamics of the B800 molecules of intact LH2 and B800-deficient LH2 complexes of the purple bacterium Rhodopseudomonas acidophila are compared. New insights on the additional decay channel of the B800 ring of bacteriochlorophylla (BChla) molecules are provided. General conclusions are given in Chapter 5. A version of the hole spectrum simulation program written by the candidate for the FMO complex study (Chapter 3) is included as an appendix. The references for each chapter are given at the end of each chapter.
International Nuclear Information System (INIS)
Sharp, Leah Z.; Egorova, Dassia; Domcke, Wolfgang
2010-01-01
Two-dimensional (2D) photon-echo spectra of a single subunit of the Fenna-Matthews-Olson (FMO) bacteriochlorophyll trimer of Chlorobium tepidum are simulated, employing the equation-of-motion phase-matching approach (EOM-PMA). We consider a slightly extended version of the previously proposed Frenkel exciton model, which explicitly accounts for exciton coherences in the secular approximation. The study is motivated by a recent experiment reporting long-lived coherent oscillations in 2D transients [Engel et al., Nature 446, 782 (2007)] and aims primarily at accurate simulations of the spectroscopic signals, with the focus on oscillations of 2D peak intensities with population time. The EOM-PMA accurately accounts for finite pulse durations as well as pulse-overlap effects and does not invoke approximations apart from the weak-field limit for a given material system. The population relaxation parameters of the exciton model are taken from the literature. The effects of various dephasing mechanisms on coherence lifetimes are thoroughly studied. It is found that the experimentally detected multiple frequencies in peak oscillations cannot be reproduced by the employed FMO model, which calls for the development of a more sophisticated exciton model of the FMO complex.
DEFF Research Database (Denmark)
Pedersen, Marie Ø; Pham, Lan; Steensgaard, Dorte B
2008-01-01
chlorosomes were lyophilized and extracted with chloroform/methanol (1:1, v/v). The extract was further purified using gel filtration and reverse-phase HPLC and the purity of the preparation confirmed by SDS-PAGE. Mass spectrometric analysis showed an m/z of 6154.8, in agreement with the calculated mass...
Energy Technology Data Exchange (ETDEWEB)
Berrocal Escobar, M.; Lopez Fernandez, C. L.; Arias Fernandez, M. E.; Perez Leblic, M. I.; Zapatero Martin, I.; Leton Garcia, P.; Garcia Calvo, E. [Universidad de Alcala de Henares. Madrid (Spain); Aznar Munoz, R.; Rodriguez Medina, P. [Departamento Tecnico y de Calidad de Seragua, S.A. Madrid (Spain)
1998-12-31
The activated sludge used in the wastewater depuration in treatment plants could be considered as an artificial microbial ecosystem in balance. In this community which is constituted by free and flocculated bacteria, protozoa, rotifers, nematodes and a few other invertebrates, the stability of the system is maintained by the continuous food competition. The breakdown of this stability due to a high proliferation of filametous bacteria drive to the phenomenon called bulking. Nowadays, to avoid bulking is one of the main objectives in research because is the main cause of the malfunction of wastewater depuration interfering with compaction, settling, thickening and, concentration of activated sludge. In the present work, a taxonomical and physiological study of the microbial community which carries out the cleaning of wastewater in an activated sludge system has been performed by using an airlift bioreactor working in continuous. Activated sludge coming from a conventional wastewater plant was used as inoculum (starter culture). The nutritional conditions and bioreactor system parameters in which the filamentous bacteria grow in excess have been established. Several of filamentous bacteria responsible for bulking have been identified: Sphaerotilus natans, type 021N, Nocardia spp., Microthrix parvicella, Thiotrix I, Thiotrix II, type 0803, type 0581, Nostocoida limicola I and III and, type 1863. In addition, protozoa of groups involved in the depuration process (free-swimming ciliates, attached ciliates, crawling ciliates, carnivorous ciliates, flagellates and amoebae) were observed as well as rotifer and nematode populations. (Author) 13 refs.
Think big--giant genes in bacteria.
Reva, Oleg; Tümmler, Burkhard
2008-03-01
Long genes should be rare in archaea and eubacteria because of the demanding costs of time and resources for protein production. The search in 580 sequenced prokaryotic genomes, however, revealed 0.2% of all genes to be longer than 5 kb (absolute number: 3732 genes). Eighty giant bacterial genes of more than 20 kb in length were identified in 47 taxa that belong to the phyla Thermotogae (1), Chlorobi (3), Planctomycetes (1), Cyanobacteria (2), Firmicutes (7), Actinobacteria (9), Proteobacteria (23) or Euryarchaeota (1) (number of taxa in brackets). Giant genes are strain-specific, differ in their tetranucleotide usage from the bulk genome and occur preferentially in non-pathogenic environmental bacteria. The two longest bacterial genes known to date were detected in the green sulfur bacterium Chlorobium chlorochromatii CaD3 encoding proteins of 36 806 and 20 647 amino acids, being surpassed in length only by the human titin coding sequence. More than 90% of bacterial giant genes either encode a surface protein or a polyketide/non-ribosomal peptide synthetase. Most surface proteins are acidic, threonine-rich, lack cystein and harbour multiple amino acid repeats. Giant proteins increase bacterial fitness by the production of either weapons towards or shields against animate competitors or hostile environments.
Ferrando, Lucía; Fernández Scavino, Ana
2015-09-01
Flooding impacts soil microbial communities, but its effect on endophytic communities has rarely been explored. This work addresses the effect of flooding on the abundance and diversity of endophytic diazotrophic communities on rice plants established in a greenhouse experiment. The nifH gene was significantly more abundant in roots after flooding, whereas the nifH gene copy numbers in leaves were unaffected and remained low. The PCA (principal component analysis) of T-RFLP (terminal restriction fragment length polymorphism) profiles indicated that root communities of replicate plots were more similar and diverse after flooding than before flooding. The nifH libraries obtained by cloning and 454 pyrosequencing consistently showed a remarkable shift in the diazotrophic community composition after flooding. Gammaproteobacteria (66-98%), mainly of the genus Stenotrophomonas, prevailed in roots before flooding, whereas Betaproteobacteria was the dominant class (26-34%) after flooding. A wide variety of aerotolerant and anaerobic diazotrophic bacteria (e.g. Dechloromonas, Rhodopseudomonas, Desulfovibrio, Geobacter, Chlorobium, Spirochaeta, Selenomonas and Dehalobacter) with diverse metabolic traits were retrieved from flooded rice roots. These findings suggest that endophytic communities could be significantly impacted by changes in plant-soil conditions derived from flooding during rice cropping. © FEMS 2015. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Indian Academy of Sciences (India)
The sex-determining system differs considerably among organisms. Even among insect species, the genetic system for sex-determination is highly diversified. In Drosophila melanogaster, somatic sexual differentiation is regulated by a well characterized genetic hierarchy X : A > Sxl > tra/tra2 > dsx and fru. This cascade ...
Breeding ecology and nesting habitat associations of five marsh bird species in western New York
Lor, S.; Malecki, R.A.
2006-01-01
Nesting habitats and nest success of five species of marsh birds were studied during 1997 and 1998 at the Iroquois National Wildlife Refuge (NWR) and the adjacent Oak Orchard and Tonawanda State Wildlife Management Areas (WMA) located in western New York. Nest searches located 18 American Bittern (Botaurus lentiginosus), 117 Least Bittern (Ixobrychus exilis), 189 Pied-billed Grebe (Podilymbus podiceps), 23 Sora (Porzana carolina), and 72 Virginia Rail (Rallus limicola) nests. Average nest densities in 1998, our best nest searching year, ranged from 0.01/ha for Soras (N = 8) to 0.28/ha for Pied-billed Grebes (N = 160). Mayfield nest success estimates for Least Bittern were 80% (N = 16) in 1997 and 46% (N = 37) in 1998. Nest success estimates were 72% (N = 55) for Pied-billed Grebe, 43% (N = 6) for Sora, and 38% (N = 20) for Virginia Rail. Nests of all five species were located in ???70% emergent vegetation with a mean water depth of 24-56 cm and an average vegetation height that ranged from 69-133 cm. Logistic regression models were developed for each species using habitat variables at nest and random site locations. Each model was ranked with Akaike's Information Criterion for small sample size (AICc). In general, our best models indicated that increased emergent vegetation and horizontal cover with shallow water depths improved the odds of encountering marsh bird nests in the wetlands of western New York. We suggest that managing wetlands as a complex, at different stages of succession, would best benefit marsh bird species.
DEFF Research Database (Denmark)
Ikonen, T P; Li, H; Psencík, J
2007-01-01
effect on chlorosome biogenesis and structure. The results indicate that carotenoids with a sufficiently long conjugated system are important for the biogenesis of the chlorosome baseplate. Defects in the baseplate structure affected the shape of the chlorosomes and were correlated with differences...... studied by means of x-ray scattering and electron cryomicroscopy. The chlorosomes from each mutant strain exhibited a lamellar arrangement of the bacteriochlorophyll c aggregates, which are the major constituents of the chlorosome interior. However, the carotenoid content and composition had a pronounced...... in the arrangement of lamellae and spacing between the lamellar planes of bacteriochlorophyll aggregates. In addition, comparisons among the various mutants enabled refinement of the assignments of the x-ray scattering peaks. While the main scattering peaks come from the lamellar structure of bacteriochlorophyll c...
Position automatic determination technology
International Nuclear Information System (INIS)
1985-10-01
This book tells of method of position determination and characteristic, control method of position determination and point of design, point of sensor choice for position detector, position determination of digital control system, application of clutch break in high frequency position determination, automation technique of position determination, position determination by electromagnetic clutch and break, air cylinder, cam and solenoid, stop position control of automatic guide vehicle, stacker crane and automatic transfer control.
International Nuclear Information System (INIS)
Stepin, V.V.; Kurbatova, V.I.; Fedorova, N.D.
1980-01-01
Techniques of cerium determination in steels and alloys are developed. Amperometric method of determination which is based on Ce(4) titration by a solution of double salt of sulfuric Fe(2) and ammonium when cerium amount exceeds 0.01% is suggested. Cerium is oxidated to tetravalent state by KMnO 4 . The elements interfering with the determination (Cr, Ni etc.) are separated by means of deposition. When cerium content exceeds 0.005% in steels and alloys the determination is carried out using photometric method with arsenazo 3 in hydrochloric medium (pH 1.8-2.3). Optimum concentration is 5-50 μg [ru
Edberg, Frida; Andersson, Anders F; Holmström, Sara J M
2012-11-01
Mining of pyrite minerals is a major environmental issue involving both biological and geochemical processes. Here we present a study of an artificial lake of a former uranium open pit mine with the aim to connect the chemistry and bacterial community composition (454-pyrosequencing of 16S rRNA genes) in the stratified water column. A shift in the water chemistry from oxic conditions in the epilimnion to anoxic, alkaline, and metal and sulfide-rich conditions in the hypolimnion was corresponded by a strong shift in the bacterial community, with few shared operational taxonomic units (OTU) between the water layers. The epilimnetic bacterial community of the lake (~20 years old) showed similarities to other temperate freshwater lakes, while the hypolimnetic bacterial community showed similarity to extreme chemical environments. The epilimnetic bacterial community had dominance of Actinobacteria and Betaproteobacteria. The hypolimnion displayed a higher bacterial diversity and was dominated by the phototrophic green sulphur bacterium of the genus Chlorobium (ca. 40 % of the total community). Deltaproteobacteria were only represented in the hypolimnion and the most abundant OTUs were affiliated with ferric iron and sulfate reducers of the genus Geobacter and Desulfobulbus, respectively. The chemistry is clearly controlling, especially the hypolimnetic, bacterial community but the community composition also indicates that the bacteria are involved in metal cycling in the lake.
International Nuclear Information System (INIS)
Anon.
1998-01-01
To determine the age of a cave we have to determine the age of elements which were created at the same moment when the cave was. Usually a cave is dug out by infiltration of acid waters. During this alteration process rocks free some aluminium and potassium ions. In Carlsbad and Lechuguilla caves, scientists have found alunite, this aluminium and potassium sulfate can be dated by using the carbon method of age determination. (A.C.)
ATR confinement leakage determination
International Nuclear Information System (INIS)
Kuan, P.; Buescher, B.J.
1998-01-01
The air leakage rate from the Advanced Test Reactor (ATR) confinement is an important parameter in estimating hypothesized accidental releases of radiation to the environment. The leakage rate must be determined periodically to assure that the confinement has not degraded with time and such determination is one of the technical safety requirements of ATR operation. This paper reviews the methods of confinement leakage determination and presents an analysis of leakage determination under windy conditions, which can complicate the interpretation of the determined leakage rates. The paper also presents results of analyses of building air exchange under windy conditions. High wind can enhance air exchange and this could increase the release rates of radioisotopes following an accident
Statistical Attitude Determination
Markley, F. Landis
2010-01-01
All spacecraft require attitude determination at some level of accuracy. This can be a very coarse requirement of tens of degrees, in order to point solar arrays at the sun, or a very fine requirement in the milliarcsecond range, as required by Hubble Space Telescope. A toolbox of attitude determination methods, applicable across this wide range, has been developed over the years. There have been many advances in the thirty years since the publication of Reference, but the fundamentals remain the same. One significant change is that onboard attitude determination has largely superseded ground-based attitude determination, due to the greatly increased power of onboard computers. The availability of relatively inexpensive radiation-hardened microprocessors has led to the development of "smart" sensors, with autonomous star trackers being the first spacecraft application. Another new development is attitude determination using interferometry of radio signals from the Global Positioning System (GPS) constellation. This article reviews both the classic material and these newer developments at approximately the level of, with emphasis on. methods suitable for use onboard a spacecraft. We discuss both "single frame" methods that are based on measurements taken at a single point in time, and sequential methods that use information about spacecraft dynamics to combine the information from a time series of measurements.
49 CFR 107.209 - Determination.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Determination. 107.209 Section 107.209... PROGRAM PROCEDURES Preemption Preemption Determinations § 107.209 Determination. (a) Upon consideration of the application and other relevant information received, the Chief Counsel issues a determination. (b...
International Nuclear Information System (INIS)
Hoffmann, M.
1989-01-01
Basic methods for asteroid mass determinations and their errors are discussed. New results and some current developments in the astrometric method are reviewed. New methods and techniques, such as electronic imaging, radar ranging and space probes are becoming important for asteroid mass determinations. Mass and density estimations on rotational properties and possible satelites are also discussed
Subcriticality determination of nuclear reactor
International Nuclear Information System (INIS)
Borisenko, V.I.; Goranchuk, V.V.; Sidoruk, N.M.; Volokh, A.F.
2014-01-01
In this article the subcriticality determination of nuclear reactor is considered. Emphasized that, despite the requirements of regulatory documents on the subcriticality determination of WWER from the beginning of their operation, so far, this problem has not been solved. The results of subcriticality determination of Rossi-α method of the WWER-M is presented. The possibility of subcriticality determination of WWER is considered. The possibility of subcriticality determination of Rossi-α method with time resolution is of about 100 microseconds is also considered. The possible reasons for the error in subcriticality determination of the reactor are indicated
49 CFR 107.221 - Determination.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Determination. 107.221 Section 107.221... PROGRAM PROCEDURES Preemption Waiver of Preemption Determinations § 107.221 Determination. (a) After... Chief Counsel issues a determination. (b) The Chief Counsel may issue a waiver of preemption only on...
Emergency operation determination system
International Nuclear Information System (INIS)
Miki, Tetsushi.
1993-01-01
The system of the present invention can determine an emergency operation coping with abnormal events occurring during nuclear plant operation without replying on an operator's judgement. That is, the system of the present invention comprises an intelligence base which divides and classifies the aims of the plant operation for the function, structure and operation manual and puts them into network. Degree of attainment for the extend of the status normality is determined on every aim of operation based on various kinds of measured data during plant operation. For a degree of attainment within a predetermined range, it is judged that an emergency operation is possible although this is in an abnormal state. Degree of emergency is determined by a fuzzy theory based on the degree of attainment, variation coefficient for the degree of attainment and the sensitivity to external disturbance as parameters. Priority for the degree of emergency on every operation aims is determined by comparison. Normality is successively checked for the determined operation aims. As a result, equipments as objects of abnormality suppressing operation are specified, and the operation amount of the equipments as objects are determined so that the measuring data are within a predetermined range. (I.S.)
Spacecraft Attitude Determination
DEFF Research Database (Denmark)
Bak, Thomas
This thesis describes the development of an attitude determination system for spacecraft based only on magnetic field measurements. The need for such system is motivated by the increased demands for inexpensive, lightweight solutions for small spacecraft. These spacecraft demands full attitude...... determination based on simple, reliable sensors. Meeting these objectives with a single vector magnetometer is difficult and requires temporal fusion of data in order to avoid local observability problems. In order to guaranteed globally nonsingular solutions, quaternions are generally the preferred attitude...... is a detailed study of the influence of approximations in the modeling of the system. The quantitative effects of errors in the process and noise statistics are discussed in detail. The third contribution is the introduction of these methods to the attitude determination on-board the Ørsted satellite...
Boundary determinations for trivariate solids
International Nuclear Information System (INIS)
Duchaineau, M; Joy, K I
1999-01-01
The trivariate tensor-product B-spline solid is a direct extension of the B-spline patch and has been shown to be useful in the creation and visualization of free-form geometric solids. Visualizing these solid objects requires the determination of the boundary surface of the solid, which is a combination of parametric and implicit surfaces. This paper presents a method that determines the implicit boundary surface by examination of the Jacobian determinant of the defining B-spline function. Using an approximation to this determinant, the domain space is adaptively subdivided until a mesh can be determined such that the boundary surface is close to linear in the cells of the mesh. A variation of the marching cubes algorithm is then used to draw the surface. Interval approximation techniques are used to approximate the Jacobian determinant and to approximate the Jacobian determinant gradient for use in the adaptive subdivision methods. This technique can be used to create free-form solid objects, useful in geometric modeling applications
International Nuclear Information System (INIS)
Gaikwad, Revati; Sonar, V.R.; Pandey, R.K.; Karekar, C.D.; Raul, Seema; Mahanty, B.; Kelkar, A.; Bhatt, R.B.; Behere, P.G.
2017-01-01
It is required to determine accurately the percentage composition of hydrogen in the blended gas of N 2 and H 2 prior to deliver to the sintering furnace. A feasibility study has been carried out to determine the percentage composition of hydrogen in the blended gas by using an indigenously developed hydrogen determinator. The instrument uses gas chromatograph-thermal conductivity (GC-TCD) technique to determine hydrogen. The flow of carrier gas was kept at 100 mL min -1 during the analysis. A very close agreement between the determined value and the reported value of hydrogen content in the commercially available N 2 -H 2 mixed cylinder was found by using the indigenous hydrogen determinator. (author)
DEFF Research Database (Denmark)
Forsberg, René; Olesen, Arne Vestergaard; Bastos, L.
2000-01-01
Airborne geoid mapping techniques may provide the opportunity to improve the geoid over vast areas of the Earth, such as polar areas, tropical jungles and mountainous areas, and provide an accurate "seam-less" geoid model across most coastal regions. Determination of the geoid by airborne methods...... relies on the development of airborne gravimetry, which in turn is dependent on developments in kinematic GPS. Routine accuracy of airborne gravimetry are now at the 2 mGal level, which may translate into 5-10 cm geoid accuracy on regional scales. The error behaviour of airborne gravimetry is well......-suited for geoid determination, with high-frequency survey and downward continuation noise being offset by the low-pass gravity to geoid filtering operation. In the paper the basic principles of airborne geoid determination are outlined, and examples of results of recent airborne gravity and geoid surveys...
Doppelhofer, Gernot; Weeks, Melvyn
2011-01-01
This paper investigates the robustness of determinants of economic growth in the presence of model uncertainty, parameter heterogeneity and outliers. The robust model averaging approach introduced in the paper uses a flexible and parsi- monious mixture modeling that allows for fat-tailed errors compared to the normal benchmark case. Applying robust model averaging to growth determinants, the paper finds that eight out of eighteen variables found to be significantly related to economic growth ...
CATALYTIC KINETIC SPECTROPHOTOMETRIC DETERMINATION ...
African Journals Online (AJOL)
Preferred Customer
acetylchlorophosphonazo(CPApA) by hydrogen peroxide in 0.10 M phosphoric acid. A novel catalytic kinetic-spectrophotometric method is proposed for the determination of copper based on this principle. Copper(II) can be determined spectrophotometrically ...
Determinants of Actor Rationality
DEFF Research Database (Denmark)
Ellegaard, Chris
Industrial companies must exercise influence on their suppliers (or supplier actors). Actor rationality is a central theme connected to this management task. In this article, relevant literature is studied with the purpose of shedding light on determinants of actor rationality. Two buyer-supplier...... relations are investigated in a multiple case study, leading to the proposal of various additional factors that determine and shape actor rationality. Moreover a conceptual model of rationality determinants in the buyer-supplier relation is proposed, a model that may help supply managers analyse...
Wilson, Michael D.
2012-01-01
This paper examines the way the term "self-determination" is used in the Indian Self-Determination and Education Assistance Act of 1975. Its main thesis is that the Act does not in fact offer tribal governments self-determination, but instead reaffirms old power configurations that go back to the Indian Reorganization Act of 1934.…
Garcia, Graziella Patrício Pereira; Diniz, Renata Côrtes Oliveira; Bicalho, Sarah Kinaip; Franco, Vitor Araujo de Souza; Gontijo, Eider Max de Oliveira; Toscano, Rodrigo Argolo; Canhestro, Kenia Oliveira; Santos, Merly Rita Dos; Carmo, Ana Luiza Rodrigues Dias; Lobato, Livia Cristina S; Brandt, Emanuel Manfred F; Chernicharo, Carlos A L; Calabria de Araujo, Juliana
2015-01-01
We developed a biological sulphide oxidation system and evaluated two reactors (shaped similar to the settler compartment of an up-flow anaerobic sludge blanket [UASB] reactor) with different support materials for biomass retention: polypropylene rings and polyurethane foam. The start-up reaction was achieved using microorganisms naturally occurring on the open surface of UASB reactors treating domestic wastewater. Sulphide removal efficiencies of 65% and 90% were achieved with hydraulic retention times (HRTs) of 24 and 12 h, respectively, in both reactors. However, a higher amount of elemental sulphur was formed and accumulated in the biomass from reactor 1 (20 mg S(0) g(-1) VTS) than in that from reactor 2 (2.9 mg S(0) g(-1) VTS) with an HRT of 24 h. Denaturing gradient gel electrophoresis (DGGE) results revealed that the the pink and green biomass that developed in both reactors comprised a diverse bacterial community and had sequences related to phototrophic green and purple-sulphur bacteria such as Chlorobium sp., Chloronema giganteum, and Chromatiaceae. DGGE band patterns also demonstrated that bacterial community was dynamic over time within the same reactor and that different support materials selected for distinct bacterial communities. Taken together, these results indicated that sulphide concentrations of 1-6 mg L(-1) could be efficiently removed from the effluent of a pilot-scale UASB reactor in two sulphide biological oxidation reactors at HRTs of 12 and 24 h, showing the potential for sulphur recovery from anaerobically treated domestic wastewater.
Diversity and Functional Analysis of the FeMo-Cofactor Maturase NifB
Directory of Open Access Journals (Sweden)
Simon Arragain
2017-11-01
Full Text Available One of the main hurdles to engineer nitrogenase in a non-diazotrophic host is achieving NifB activity. NifB is an extremely unstable and oxygen sensitive protein that catalyzes a low-potential SAM-radical dependent reaction. The product of NifB activity is called NifB-co, a complex [8Fe-9S-C] cluster that serves as obligate intermediate in the biosyntheses of the active-site cofactors of all known nitrogenases. Here we study the diversity and phylogeny of naturally occurring NifB proteins, their protein architecture and the functions of the distinct NifB domains in order to understand what defines a catalytically active NifB. Focus is on NifB from the thermophile Chlorobium tepidum (two-domain architecture, the hyperthermophile Methanocaldococcus infernus (single-domain architecture and the mesophile Klebsiella oxytoca (two-domain architecture, showing in silico characterization of their nitrogen fixation (nif gene clusters, conserved NifB motifs, and functionality. C. tepidum and M. infernus NifB were able to complement an Azotobacter vinelandii (ΔnifB mutant restoring the Nif+ phenotype and thus demonstrating their functionality in vivo. In addition, purified C. tepidum NifB exhibited activity in the in vitro NifB-dependent nitrogenase reconstitution assay. Intriguingly, changing the two-domain K. oxytoca NifB to single-domain by removal of the C-terminal NifX-like extension resulted in higher in vivo nitrogenase activity, demonstrating that this domain is not required for nitrogen fixation in mesophiles.
Reduction and determination of dixanthogens.
Prasad, M S
1971-06-01
A convenient method for the reduction and determination of dixaathogen has been developed. It is based on the quantitative reaction of dixanthogen with zinc amalgam to form xanthate; the latter can be determined by iodine titration, potentiometric titration with silver nitrate or by spectrophotometry at 310 mmu. Dixanthogen can be determined in mixtures containing xanthate, by titration of aliquots with and without reduction. Higher dixanthogens can also be determined, and flotation liquors analysed.
42 CFR 405.803 - Initial determination.
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false Initial determination. 405.803 Section 405.803....803 Initial determination. (a) Carriers make initial determinations regarding claims for benefits under Medicare Part B. (b) An initial determination for purposes of this subpart includes determinations...
42 CFR 405.715 - Reconsidered determination.
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false Reconsidered determination. 405.715 Section 405.715... Part A § 405.715 Reconsidered determination. (a) In reconsidering an initial determination, the CMS shall review such initial determination, the evidence and findings upon which such determination was...
Impact significance determination-Back to basics
International Nuclear Information System (INIS)
Lawrence, David P.
2007-01-01
Impact significance determination is widely recognized as a vital and critical EIA activity. But impact significance related concepts are poorly understood. And the quality of approaches for impact significance determination in EIA practice remains highly variable. This article seeks to help establish a sound and practical conceptual foundation for formulating and evaluating impact significance determination approaches. It addresses the nature (what is impact significance?), the core characteristics (what are the major properties of significance determination?), the rationale (why are impact significance determinations necessary?), the procedural and substantive objectives (what do impact significance determinations seek to achieve?), and the process for making impact significance judgments (how is impact significance determination conducted?). By identifying fundamental attributes and key distinctions associated with impact significance determinations, a basis is provided for designing and evaluating impact significance determination procedures at both the regulatory and applied levels
Fluorescence uranium determination
International Nuclear Information System (INIS)
Fernandez Cellini, R.; Crus Castillo, F. de la; Barrera Pinero, R.
1960-01-01
An equipment for analysis of uranium by fluorescence was developed in order to determine it at such a low concentration that it can not be determined by the most sensible analytical methods. this new fluorimeter was adapted to measure the fluorescence emitted by the phosphorus sodium fluoride-sodium carbonate-potasium carbonate-uranyl, being excited by ultraviolet light of 3,650 A the intensity of the light emitted was measure with a photomultiplicator RCA 5819 and the adequate electronic equipment. (Author) 19 refs
International Nuclear Information System (INIS)
Clayton, C.G.; Wormald, M.R.
1981-01-01
A method for determining the gold content of a material, comprises irradiating a body of the material with neutrons and determining the intensity of γ-rays having an energy of 279 keV arising from the reaction 179 Au(nn') 179 Au → 279 keV. The apparatus has means for conveying the materials past an assembly, which has a neutron source, which does not produce neutrons having sufficient energy to excite fast neutron reactions in non-auriferous constituents. (author)
Determining postural stability
Lieberman, Erez (Inventor); Forth, Katharine E. (Inventor); Paloski, William H. (Inventor)
2011-01-01
A method for determining postural stability of a person can include acquiring a plurality of pressure data points over a period of time from at least one pressure sensor. The method can also include the step of identifying a postural state for each pressure data point to generate a plurality of postural states. The method can include the step of determining a postural state of the person at a point in time based on at least the plurality of postural states.
14 CFR 314.16 - Final determination.
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Final determination. 314.16 Section 314.16... REGULATIONS EMPLOYEE PROTECTION PROGRAM Determination of Qualifying Dislocation § 314.16 Final determination... determination and, within 3 business days after the determination, serve a copy of the order on the persons...
Small, but Determined: Technological Determinism in Nanoscience
Cyrus C.M. Mody
2004-01-01
Analysis of technological determinism by historians, sociologists, and philosophers has declined in recent years. Yet understanding this topic is necessary, particularly in examining the dynamics of emerging technologies and their associated research areas. This is especially true of nanotechnology, which, because of its roots in futurist traditions, employs unusual variants on classical determinist arguments. In particular, nanotechnology orients much more strongly to the past and future tha...
International Nuclear Information System (INIS)
Stepin, V.V.; Kurbatova, V.I.; Fedorova, N.D.
1980-01-01
Techniques of vanadium determination in steels and alloys are developed. Extraction-photometric method with N-phenyl-benzohydroxamic acid when V content is 0.005-0.5% is suggested. Molar coefficient of the complex quenching at lambdasub(max)=530 nm constitutes 5750. Optimum concentration is 15-150 μg per 25 ml of the solution, determination limit is 0.05 μg/ml. Chloroform is an extracting agent. A photometric method with acetohydrazide of anthranilic acid is suggested for the analysis of alloyed steels at V content 0.03-1%. The lower limit of V determination constitutes 0.64 μg/ml. Effect of Fe is removed using phosphoric acid. Amperometric method for steels and alloys at V content from 0.05 to 5% and for steels and alloys containing more than 3% W and Cr is also developed. The method is based on amperometric titration with solution of double sulfuric salt of Fe(2) and ammonium [ru
Hierarchy Formation and Self-Determination
Directory of Open Access Journals (Sweden)
Stefano I. Di Domenico
2014-12-01
Full Text Available We examined how self-determination, the subjective experience of one’s behavior as internally initiated and personally endorsed, depends on one’s standing in real-world social hierarchies. We predicted that those with the traits most relevant to status attainment would be those afforded the most opportunities to be self-determining. We examined the trait of physical attractiveness, given its documented association with social status and no known association with self-determination. First-year undergraduates living in same-sex residences rated their housemates’ social status, while an independent set of observers rated the participants’ physical attractiveness. Consistent with prediction, physically attractive individuals attained the highest levels of social status; in turn, those who attained the highest levels of social status experienced the highest levels of self-determination. These findings provide new insights into self-determination as an inherently relational phenomenon and specifically highlight the formative influence of social status on people’s capacities for self-determination.
19 CFR 212.26 - Determination.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Determination. 212.26 Section 212.26 Customs... IMPLEMENTATION OF THE EQUAL ACCESS TO JUSTICE ACT Procedures for Considering Applications § 212.26 Determination. The presiding officer shall issue a recommended determination on the application within 90 days after...
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Determination. 68.11 Section... § 68.11 Determination. The board shall render its written decision within 45 days after the conclusion... Administrator for review and approval. The Administrator shall make the final base flood elevation determination...
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Determination. 158.6 Section 158.6 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT....6 Determination. If no formal hearing is had the matter in issue will be determined by the...
Self-Determination after Kosovo
DEFF Research Database (Denmark)
Wolff, Stefan; Rodt, Annemarie Peen
2013-01-01
This article discusses the meaning of self-determination in its historical and contemporary contexts and examines the different options available for the accommodation of contested self-determination claims. Among these, the creation of a new state, arguably, is the most radical of options and on...
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Determination. 41.6 Section 41.6 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT OF....6 Determination. If no formal hearing is had the matter in issue will be determined by the...
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Determination. 349.6 Section 349.6 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT... PROPOSED REMEDIES § 349.6 Determination. If no formal hearing is had the matter in issue will be determined...
28 CFR 44.303 - Determination.
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Determination. 44.303 Section 44.303... Enforcement Procedures § 44.303 Determination. (a) Within 120 days of the receipt of a charge, the Special... the end of the 120-day period, the Special Counsel shall issue letters of determination by certified...
Determination of plutonium in environment
International Nuclear Information System (INIS)
Sakanoue, Masanobu
1978-01-01
Past and present methods of determining the amount of plutonium in the environment are summarized. Determination of the amount of plutonium in uranium ore began in 1941. Plutonium present in polluted environments due to nuclear explosions, nuclear power stations, etc. was measured in soil and sand in Nagasaki in 1951 and in ash in Bikini in 1954. Analytical methods of measuring the least amount of plutonium in the environment were developed twenty years later. Many studies on and reviews of these methods have been reported all over the world, and a standard analytical procedure has been adopted. A basic analytical method of measurement was drafted in Japan in 1976. The yield, treatment of samples, dissolution, separation, control of measurable ray sources determination by α spectrometry, cross-check determination, and treatment of samples containing hardly soluble plutonium were examined. At present, the amount of plutonium can be determined by all of these methods. The presence of plutonium was studied further, and the usefulness of determination of the plutonium isotope ratio is discussed. (Kumagai, S.)
International Nuclear Information System (INIS)
1993-01-01
The issue gives a survey of the legal, theological, statistical and health aspects of risk determination. It includes the opinions of physicians, epidemiologists, mathematicians, toxicologists, biologists, theologists and physicists who explain and illustrate the term of risk from their perspective. (orig./DG) [de
40 CFR 231.5 - Recommended determination.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Recommended determination. 231.5... 404(c) PROCEDURES § 231.5 Recommended determination. (a) The Regional Administrator or his designee... public notice of the proposed determination, either withdraw the proposed determination or prepare a...
International Nuclear Information System (INIS)
Jianhua, W.; Ronghuan, H.
1993-01-01
A kinetic method for simultaneous determination of a binary mixture is proposed, and a procedure for simultaneous determination of uranium (IV) and vanadium (IV) is established based on their inductive effect on chromium (VI)-iodide redox reaction in a weak acidic medium. The reaction was monitored by FIA-spectrophotometry using the I 3 - -starch complex as indicator. The calibration graphs are linear for uranium (IV) and vanadium (IV) within the range of 0 ∼ 3.6 μg/ml and 0 ∼ 2.5 μg/ml respectively. Most foreign ions, except for iron (II) and antimony (III), do not interfere with the determination. The uranium and vanadium content in different samples was determined, and the results were satisfactory. (author). 2 tabs., 2 figs., 9 refs
Buiren, K.; Brouwer, E.
2010-01-01
From economic theory we derive a set of hypotheses on the determination of state aid. Econometric analysis on EU state aid panel data is carried out to test whether the determinants we expect on the basis of theory, correspond to the occurrence of state aid in practice in the EU. We find that
Energy Technology Data Exchange (ETDEWEB)
Shaburova, V P; Yudelevich, I G [AN SSSR, Novosibirsk (USSR). Inst. Neorganicheskoj Khimii
1989-01-01
The extraction-spectrophotometric method for silicon determination in tellurium based on extraction isolation of the base by tributyl phosphate from hydrochloride solutions and with addition of HNO/sub 3/ and spectrophotometric silicon determination using malachite green is developed. The method permits to determine 2x10/sup -1/-3x10/sup -4/ % Si.
36 CFR 223.36 - Volume determination.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Volume determination. 223.36... Volume determination. (a) Timber sale contracts may provide for volume determination by scaling... the contract or permit provides for the determination of volume by tree measurement and the timber has...
36 CFR 902.60 - Initial determination.
2010-07-01
... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Initial determination. 902.60... INFORMATION ACT Time Limitations § 902.60 Initial determination. (a) An initial determination whether or not... workdays in accordance with § 902.62. (b) Upon making initial determination, the Administrative Officer...
49 CFR 397.211 - Preemption determination.
2010-10-01
... 49 Transportation 5 2010-10-01 2010-10-01 false Preemption determination. 397.211 Section 397.211... MATERIALS; DRIVING AND PARKING RULES Preemption Procedures § 397.211 Preemption determination. (a) Upon... determination. (b) Notwithstanding that an application for a determination has not been filed under § 397.205...
14 CFR 415.7 - Payload determination.
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Payload determination. 415.7 Section 415.7... TRANSPORTATION LICENSING LAUNCH LICENSE General § 415.7 Payload determination. A payload determination is... determination. Either a launch license applicant or a payload owner or operator may request a review of its...
Determination method of radiostrontium
International Nuclear Information System (INIS)
1984-01-01
This manual provides determination methods of strontium-90 and strontium-89 in the environment released from nuclear facilities, and it is a revised edition of the previous manual published in 1974. As for the preparation method of radiation counting sample, ion exchange method, oxalate separation method and solvent extraction method were adopted in addition to the method of fuming nitric acid separation adopted in the previous edition. Strontium-90 is determined by the separation and radioactivity determination of yttrium-90 in radioequilibrium with strontium-90. Strontium-89 is determined by subtraction of radioactivity of strontium-90 plus yttrium-90 from gross radioactivity of isolated strontium carbonate. Radioactivity determination should be carried out with a low-background 2 π-gas-flow counting system for the mounted sample on a filter having a chemical form of ferric hydroxide, yttrium oxalate or strontium carbonate. This manual describes sample preparation procedures as well as radioactivity counting procedures for environmental samples of precipitates as rain or snow, airborne dust, fresh water, sea water and soil, and also for ash sample made from biological or food samples such as grains, vegetables, tea leaves, pine needle, milk, marine organisms, and total diet, by employing a method of fuming nitric acid separation, ion exchange separation, oxalate precipitate separation or solvent extraction separation (only for an ash sample). Procedures for reagent chemicals preparation is also attached to this manual. (Takagi, S.)
Verkuil, Yvonne; Koolhaas, Anita; Van Der Winden, Jan
Large numbers of waders migrating northward in spring use the Sivash, a large system of shallow, brackish and hypersaline lagoons in the Black Sea and Azov Sea region (Ukraine). The bottoms of these lagoons are often uncovered by the wind. Hence, for waders the time and space available for feeding depend on wind conditions. In hypersaline lagoons the benthic and pelagic fauna was very poor, consisting mainly of chironomid larvae (0.19 g AFDM·m -2) and brine shrimps Artemia salina, respectively. Brine shrimp abundance was correlated with salinity, wind force, wind direction and water depth. Dunlin Calidris alpina and curlew sandpiper Calidris ferruginea were the only species feeding on brine shrimp. As brine shrimp densities are higher in deeper water, smaller waders such as broad-billed sandpipers Limicola falcinellus are too short-legged to reach exploitable densities of brine shrimp. In brackish lagoons the benthic and pelagic fauna was rich, consisting of polychaetes, bivalves, gastropods, chironomid larvae, isopods and amphipods (8.9 to 30.5 g AFDM·m -2), but there were no brine shrimps. Prey biomass increased with the distance from the coast, being highest on the site that was most frequently inundated. Dunlin, broad-billed sandpiper and grey plover Pluvialis squatarola were the most abundant birds in the brackish lagoon. Due to the effects of wind-tides only a small area was usually available as a feeding site. Gammarus insensibilis was the alternative prey resource in the water layer, and their density varied with wind direction in the same way as brine shrimp. Curlew sandpipers and dunlins in the hypersaline lagoons and broad-billed sandpipers in the brackish lagoons often changed feeding sites, probably following the variation in prey availability. Only because of the large size and variety of lagoons are waders in the Sivash always able to find good feeding sites.
42 CFR 405.810 - Review determination.
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false Review determination. 405.810 Section 405.810....810 Review determination. Subject to the provisions of §§ 405.807 through 405.809, the carrier shall... determination affirming or revising in whole or in part the findings and determination in question. [39 FR 12097...
Sodium sampling and impurities determination
International Nuclear Information System (INIS)
Docekal, J.; Kovar, C.; Stuchlik, S.
1980-01-01
Samples may be obtained from tubes in-built in the sodium facility and further processed or they are taken into crucibles, stored and processed later. Another sampling method is a method involving vacuum distillation of sodium, thus concentrating impurities. Oxygen is determined by malgamation, distillation or vanadium balance methods. Hydrogen is determined by the metal diaphragm extraction, direct extraction or amalgamation methods. Carbon is determined using dry techniques involving burning a sodium sample at 1100 degC or using wet techniques by dissolving the sample with an acid. Trace amounts of metal impurities are determined after dissolving sodium in ethanol. The trace metals are concentrated and sodium excess is removed. (M.S.)
Star trackers for attitude determination
DEFF Research Database (Denmark)
Liebe, Carl Christian
1995-01-01
One problem comes to all spacecrafts using vector information. That is the problem of determining the attitude. This paper describes how the area of attitude determination instruments has evolved from simple pointing devices into the latest technology, which determines the attitude by utilizing...... a CCD camera and a powerful microcomputer. The instruments are called star trackers and they are capable of determining the attitude with an accuracy better than 1 arcsecond. The concept of the star tracker is explained. The obtainable accuracy is calculated, the numbers of stars to be included...... in the star catalogue are discussed and the acquisition of the initial attitude is explained. Finally the commercial market for star trackers is discussed...
Impact significance determination-Pushing the boundaries
International Nuclear Information System (INIS)
Lawrence, David P.
2007-01-01
Impact significance determination practice tends to be highly variable. Too often insufficient consideration is given to good practice insights. Also, impact significance determinations are frequently narrowly defined addressing, for example, only individual, negative impacts, focusing on bio-physical impacts, and not seeking to integrate either the Precautionary Principle or sustainability. This article seeks to extend the boundaries of impact significance determination practice by providing an overview of good general impact significance practices, together with stakeholder roles and potential methods for addressing significance determination challenges. Relevant thresholds, criteria, contextual considerations and support methods are also highlighted. The analysis is then extended to address how impact significance determination practices change for positive as compared with negative impacts, for cumulative as compared with individual impacts, for socio-economic as compared with bio-physical impacts, when the Precautionary Principle is integrated into the process, and when sustainability contributions drive the EIA process and related impact significance determinations. These refinements can assist EIA practitioners in ensuring that the scope and nature of impact significance determinations reflect the broadened scope of emerging EIA requirements and practices. Suggestions are included for further refining and testing of the proposed changes to impact significance determination practice
43 CFR 11.63 - Injury determination phase-pathway determination.
2010-10-01
... substance. Indirect exposure can result from food chain processes. (3) If the oil or hazardous substance... organisms in the assessment area; (2) Potential for exposure to the oil or hazardous substance through...) General. (1) To determine the exposure pathways of the oil or hazardous substance, the following shall be...
Determinants of adolescent fertility in Ethiopia
African Journals Online (AJOL)
Bernt Lindtjorn
demographic and economic determinants whereas Bongaarts model was used to determine proximate determinants fertility. ... Organization defines the age group of 10-19 and 15-24 ..... In urban areas, 24% of marital fertility was prevented.
Determination of cadmium selenide nonstoichiometry
International Nuclear Information System (INIS)
Brezhnev, V.Yu.; Kharif, Ya.L.; Kovtunenko, P.V.
1986-01-01
Physicochemical method of determination of cadmium selenide nonstoichiometry is developed. The method nature consists in the fact, that under definite conditions dissolved cadmium is extracted from crystals to a vapor phase and then is determined in it using the photocolorimetric method. Cadmium solubility in CdSe crystal is calculated from known CdSe mass and amount of separated cadmium. The lower boundary of determined contents constitutes 1x10 -5 % mol at sample of cadmium selenide 10 g
Self-powered detectors sensitivity determination
International Nuclear Information System (INIS)
Surkov, V.; Soares, A.J.
1994-01-01
The determination of the initial sensitivity of Self Powered Detectors (SPDs) was performed. Measurements of thermal, epithermal and to gamma flux sensitivities were made with Vanadium, Cobalt, Rhodium, Silver and Platinum SPDs and, when possible, the values are compared with the ones from the existing literature. The determination of neutron sensitivity was realized using the IEA-R1 Reactor from IPEN. The thermal and epithermal neutron flux were determined with bare and Cadmium covered activation foils. (GOLD). (author)
The Determining Finite Automata Process
Directory of Open Access Journals (Sweden)
M. S. Vinogradova
2017-01-01
Full Text Available The theory of formal languages widely uses finite state automata both in implementation of automata-based approach to programming, and in synthesis of logical control algorithms.To ensure unambiguous operation of the algorithms, the synthesized finite state automata must be deterministic. Within the approach to the synthesis of the mobile robot controls, for example, based on the theory of formal languages, there are problems concerning the construction of various finite automata, but such finite automata, as a rule, will not be deterministic. The algorithm of determinization can be applied to the finite automata, as specified, in various ways. The basic ideas of the algorithm of determinization can be most simply explained using the representations of a finite automaton in the form of a weighted directed graph.The paper deals with finite automata represented as weighted directed graphs, and discusses in detail the procedure for determining the finite automata represented in this way. Gives a detailed description of the algorithm for determining finite automata. A large number of examples illustrate a capability of the determinization algorithm.
Determinant of Poverty in Ethiopia
African Journals Online (AJOL)
preferred customer
a logistic regression model to identify determinants of wellbeing of the household ... interest of researchers, public authorities and international organizations. The ... have to understand the determinants of poverty in rural and urban Ethiopia.
A Predictive Framework for Determining How Journalists Determine News.
Gaudino, James L.
To determine how to articulate a concrete definition of the substance of the journalist's occupation, this paper offers a propositional framework of news value based on Kurt Lewin's gatekeeper model. First, the paper follows the established suggestion that news decisions are best studied from a gatekeeping perspective or that "news is…
Blood flow determinations utilizing digital densitometry
International Nuclear Information System (INIS)
Lois, F.; Mankovich, N.J.; Gomes, A.S.
1987-01-01
A method of obtaining relative and absolute blood flow measurements from digital densitometry was evaluated with a simulated vessel phantom and a hydrodynamic model. A digital vascular imaging system capable of acquisition in 512 2 and 1024 2 mode was used. Relative and absolute blood flow were measured using parameters derived from the densitometric curve. Since application of densitometric data to absolute flow measurements requires the vessel diameter, an algorithm for vessel size determination was created. Gray scale changes were demonstrated to be linearly related to contrast concentration. The variance of vessel size determination was significantly different in all combinations of 1024 2 and 512 2 imaging with 15 cm or 35 cm field size. The error in vessel size determination was significantly less using the larger 1024 2 matrix and the smaller 15 cm image intensifier field size, as shown by the smaller variance. In relative flow determinations, there was good correlation between the flow and four parameters of the densitometric curve with no significant differences between 512 2 and 1024 2 imaging. Absolute flow determinations had slightly lower correlation to actual flow but were not significantly different from relative flow determinations. Relative and absolute blood flow determinations can be performed adequately with either 512 2 or 1024 2 imaging. The increased accuracy in vessel size determination with 1024 2 imaging makes this high resolution system potentially perferable to determine absolute blood flow. (orig.)
VOLTAMMETRIC DETERMINATION OF TINIDAZOLE IN ...
African Journals Online (AJOL)
tablet samples showed the potential applicability of the developed method for the determination of tinidazole in ... determination of TNZ in real samples like tablets, injection, urine and biological fluids [24-27]. Almost all ..... during the storage.
National Oceanic and Atmospheric Administration, Department of Commerce — The Status Determination dataset within the Species Information System (SIS) contains information related to overfishing, overfished, and approaching overfished...
Determinants of Homeownership in Denmark
DEFF Research Database (Denmark)
Lauridsen, Jørgen T.; Skak, Morten
. The paper adds to earlier papers by the same authors where determinants of the homeownership rate were found using (average) data for 270 Danish municipalities. By using data directly related to individual households whose inhabitants have chosen to be or not to be homeowners, the analysis reveals...... characteristics and restrictions that influence the choice between renting and ownership. Among the determinants investigated is civil and social status of the breadwinner and various household characteristics including income. The empirical results generally suggest that the impact of the determinants...
10 CFR 26.189 - Determination of fitness.
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Determination of fitness. 26.189 Section 26.189 Energy NUCLEAR REGULATORY COMMISSION FITNESS FOR DUTY PROGRAMS Determining Fitness-for-Duty Policy Violations and Determining Fitness § 26.189 Determination of fitness. (a) A determination of fitness is the process entered...
42 CFR 422.566 - Organization determinations.
2010-10-01
... 42 Public Health 3 2010-10-01 2010-10-01 false Organization determinations. 422.566 Section 422... (CONTINUED) MEDICARE PROGRAM MEDICARE ADVANTAGE PROGRAM Grievances, Organization Determinations and Appeals § 422.566 Organization determinations. (a) Responsibilities of the MA organization. Each MA organization...
Health determinants and podiatry.
Brodie, B S
2001-09-01
Public health and podiatry have a natural union both through historical development and a shared interest in prevention. Podiatry is considered in terms of health determinants such as income, social support, education and environment. The author considers that podiatry has a constructive role to play in the improvement of health and well-being in terms of the previously unrecognised relationship of the profession to the determinants of health and population health promotion.
Determination of boron in amorphous alloys
Energy Technology Data Exchange (ETDEWEB)
Grazhulene, S.S.; Grossman, O.V.; Kuntscher, K.K.; Malygina, L.I.; Muller, E.N.; Telegin, G.F.
1985-10-01
In the determination of boron in amorphous alloys containingFe, Co, B, Si, Ni, and P having unusal magnetic and electrical properties, precise analysis and rapid analysis are necessary. To improve the metrological properties of the existing procedure, to find a rapid determination of boron in amorphous alloys, and to verify the accuracy of the results, in the present work the optimization of the photometric determination after extraction of the BF/sup -//sub 4/ ion pair with methylene blue has been studied, and a boron determination by flame photometry using selective methylation has been developed. The determination of boron by the flame photometric and spectrophotometric methods is shown. When a highly precise determination is needed, the spectrophotometric procedure can be used. This procedure is distinguished by its labor intensity and duration. When the need for reproducibility is less severe, the rapid flame photometric procedure is best.
28 CFR 301.305 - Initial determination.
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Initial determination. 301.305 Section... COMPENSATION Compensation for Work-Related Physical Impairment or Death § 301.305 Initial determination. A... determination, including the reasons therefore, together with notification of the right to appeal the...
33 CFR 136.309 - Advertisement determinations.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Advertisement determinations. 136... PROCEDURES; DESIGNATION OF SOURCE; AND ADVERTISEMENT Designation of Source and Advertisement § 136.309 Advertisement determinations. (a) The Director, NPFC, determines for each incident the type, geographic scope...
Radioimmunological determination of 25-hydroxycholecalciferol
International Nuclear Information System (INIS)
Gmeiner, M.
1976-01-01
The antibody to vitamin D 3 as hapten proved useful in determination of 25-hydroxycalciferol (25-OH-CC). The attempt also to determine vitamin D 3 directly with the aid of this radioimmunological procedure failed because of the poor solubility of the vitamin in aqueous systems. Because of the linkage to the C3 the D-ring and C17 side chain would be expected to be the immunodeterminant sites. Although the antibody can be used to determine 25-OH-CC, there is no cross-reaction with cholesterol. This indicates the importance of the open B-ring of this vitamin. Scruting of the method showed good reproducibility and accuracy. The most favorable evaluation region is 0.1-2 ng/250μl sample. The procedure described enables 25-hydroxy vitamin D 3 to be determined without previous purification of the sample extract. (author)
Waste Determination Equivalency - 12172
Energy Technology Data Exchange (ETDEWEB)
Freeman, Rebecca D. [Savannah River Remediation (United States)
2012-07-01
The Savannah River Site (SRS) is a Department of Energy (DOE) facility encompassing approximately 800 square kilometers near Aiken, South Carolina which began operations in the 1950's with the mission to produce nuclear materials. The SRS contains fifty-one tanks (2 stabilized, 49 yet to be closed) distributed between two liquid radioactive waste storage facilities at SRS containing carbon steel underground tanks with storage capacities ranging from 2,800,000 to 4,900,000 liters. Treatment of the liquid waste from these tanks is essential both to closing older tanks and to maintaining space needed to treat the waste that is eventually vitrified or disposed of onsite. Section 3116 of the Ronald W. Reagan National Defense Authorization Act of Fiscal Year 2005 (NDAA) provides the Secretary of Energy, in consultation with the Nuclear Regulatory Commission (NRC), a methodology to determine that certain waste resulting from prior reprocessing of spent nuclear fuel are not high-level radioactive waste if it can be demonstrated that the waste meets the criteria set forth in Section 3116(a) of the NDAA. The Secretary of Energy, in consultation with the NRC, signed a determination in January 2006, pursuant to Section 3116(a) of the NDAA, for salt waste disposal at the SRS Saltstone Disposal Facility. This determination is based, in part, on the Basis for Section 3116 Determination for Salt Waste Disposal at the Savannah River Site and supporting references, a document that describes the planned methods of liquid waste treatment and the resulting waste streams. The document provides descriptions of the proposed methods for processing salt waste, dividing them into 'Interim Salt Processing' and later processing through the Salt Waste Processing Facility (SWPF). Interim Salt Processing is separated into Deliquification, Dissolution, and Adjustment (DDA) and Actinide Removal Process/Caustic Side Solvent Extraction Unit (ARP/MCU). The Waste Determination was signed
DEFF Research Database (Denmark)
Bryant, Donald A; Vassilieva, Elena V; Frigaard, Niels-Ulrik
2002-01-01
and location of this BChl a are not yet clearly understood. Chlorosomes were treated with sodium dodecyl sulfate (SDS), Lubrol PX, or Triton X-100, separately or in combination with 1-hexanol, and the extracted components were separated from the residual chlorosomes by ultrafiltration on centrifugal filters....... When chlorosomes were treated with low concentrations of SDS, all proteins except CsmA were extracted. However, this treatment did not significantly alter the size and shape of the chlorosomes, did not extract the BChl a, and caused only minor changes in the absorption spectrum of the chlorosomes....... Cross-linking studies with SDS-treated chlorosomes revealed the presence of multimers of the major chlorosome protein, CsmA, up to homooctamers. Extraction of chlorosomes with SDS and 1-hexanol solubilized all ten chlorosome envelope proteins as well as BChl a. Although the size and shape...
Immunological methods for gentamicin determination
International Nuclear Information System (INIS)
Krugers Dagneauz, P.G.L.C.; Olthuis, F.M.F.G.
1979-01-01
For immunoassay, an antibody against the substance to the determined, the pure substance itself, and a labelled form or derivative of the substance are required. The principles and problems of the preparation of antibodies are discussed, some methods for the preparation of derivatives labelled with radioactive tracers or enzymes are reviewed, and homologous enzyme-immunological determination of gentamicin is discussed in detail. A comparison is mae of three radio-immunological determination methods, and the most suitable radio-immunological method is compared with two microbiological techniques. The results are found to be comparable. (Auth.)
45 CFR 150.217 - Preliminary determination.
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Preliminary determination. 150.217 Section 150.217... Are Failing To Substantially Enforce HIPAA Requirements § 150.217 Preliminary determination. If, at... designees). (b) Notifies the State of CMS's preliminary determination that the State has failed to...
5 CFR 1216.206 - Final determination.
2010-01-01
... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Final determination. 1216.206 Section... PROCEEDINGS Demands or Requests for Testimony and Production of Documents § 1216.206 Final determination. The General Counsel makes the final determination on demands to requests to employees for production of...
45 CFR 150.219 - Final determination.
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Final determination. 150.219 Section 150.219... Are Failing To Substantially Enforce HIPAA Requirements § 150.219 Final determination. If, after... the State a written notice of its final determination. The notice includes the following: (a...
21 CFR 26.9 - Equivalence determination.
2010-04-01
... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Equivalence determination. 26.9 Section 26.9 Food... Specific Sector Provisions for Pharmaceutical Good Manufacturing Practices § 26.9 Equivalence determination... document insufficient evidence of equivalence, lack of opportunity to assess equivalence or a determination...
7 CFR 1499.3 - Eligibility determination.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Eligibility determination. 1499.3 Section 1499.3 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT... determination. (a) An entity will be eligible to become a participant only after FAS determines that the entity...
Formula-derived prostate volume determination
Aarnink, R. G.; de la Rosette, J. J.; Debruyne, F. M.; Wijkstra, H.
1996-01-01
OBJECTIVES: Despite disadvantages such as time-consuming and tedious to the user, planimetric volumetry is considered to be the most accurate method for prostate volume determination. This study investigates the possibilities of formula-derived volume determination and reveals the best alternative
Technique for determining training staff size
International Nuclear Information System (INIS)
Frye, S.R.
1985-01-01
Determining an adequate training staff size is a vital function of a training manager. Today's training requirements and standards have dictated a more stringent work load than ever before. A trainer's role is more than just providing classroom lectures. In most organizations the instructor must develop programs, lesson plans, exercise guides, objectives, test questions, etc. The tasks of a training organization are never ending and the appropriate resources must be determined and allotted to do the total job. A simple method exists for determining an adequate staff. Although not perfect, this method will provide a realistic approach for determining the needed training staff size. This method considers three major factors: instructional man-hours; non-instructional man-hours; and instructor availability. By determining and adding instructional man-hours and non-instructional man-hours a total man-hour distribution can be obtained. By dividing this by instructor availability a staff size can be determined
37 CFR 501.7 - Agency determination.
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Agency determination. 501.7... UNIFORM PATENT POLICY FOR RIGHTS IN INVENTIONS MADE BY GOVERNMENT EMPLOYEES § 501.7 Agency determination... left with the employee, the agency shall notify the employee of this determination. In cases pursuant...
40 CFR 1042.825 - Baseline determination.
2010-07-01
... 40 Protection of Environment 32 2010-07-01 2010-07-01 false Baseline determination. 1042.825... Provisions for Remanufactured Marine Engines § 1042.825 Baseline determination. (a) For the purpose of this... not valid. (f) Use good engineering judgment for all aspects of the baseline determination. We may...
7 CFR 766.55 - Eligibility determination.
2010-01-01
... 7 Agriculture 7 2010-01-01 2010-01-01 false Eligibility determination. 766.55 Section 766.55 Agriculture Regulations of the Department of Agriculture (Continued) FARM SERVICE AGENCY, DEPARTMENT OF... determination. Within 30 days of a complete DSA application, the Agency will determine if the borrower meets the...
45 CFR 96.41 - General determination.
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false General determination. 96.41 Section 96.41 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION BLOCK GRANTS Direct Funding of Indian Tribes and Tribal Organizations § 96.41 General determination. (a) The Department has determined...
36 CFR 902.61 - Final determination.
2010-07-01
... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Final determination. 902.61 Section 902.61 Parks, Forests, and Public Property PENNSYLVANIA AVENUE DEVELOPMENT CORPORATION FREEDOM OF INFORMATION ACT Time Limitations § 902.61 Final determination. A determination with respect to any appeal made...
Determination production costs using PBC method
Directory of Open Access Journals (Sweden)
Todić Vladimir V.
2014-01-01
Full Text Available Basic characteristics of modern markets make requirements in quality increasing, decreasing prices and shortening delivery of products. In the middle of this requirements are production costs for whose determination are developed many traditional and alternative methods including PBC method (Process Based Costing. This method enables precisely locating and calculating indirect production costs, and with determined direct costs enables determination of total production costs. This paper shows usage of PBC method for determination production costs for three forms of processing cutting tools.
Discovering determinants influencing faith community nursing practice.
Ziebarth, Deborah Jean
2014-01-01
Faith community nursing (FCN) is an important healthcare delivery system for individuals, families, and communities. Determinants are factors that might influence FCN care. A literature review isolated eight determinants that influence practice; however, there are no clear causal relationships linking specific determinants to specific practice changes. Research is needed to assess how determinants influence practice and outcomes, and provide evidence-based solutions to isolate and manage determinants. A Conceptual Model of FCN, Theoretical Definitions and a Diagram of Determinants of FCN Practice are provided.
16 CFR 901.7 - Adverse determination.
2010-01-01
... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Adverse determination. 901.7 Section 901.7... APPLICATION FOR EXEMPTION FROM THE PROVISIONS OF THE ACT § 901.7 Adverse determination. (a) If, after... of the information before it that it cannot make a favorable determination in connection with the...
49 CFR 89.45 - Department determination.
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false Department determination. 89.45 Section 89.45... Referral of Debts to IRS for Tax Refund Offset § 89.45 Department determination. (a) Following review of... supporting rationale. (b) If the Department either sustains or amends its determination, it shall notify the...
11 CFR 9409.9 - Final determination.
2010-01-01
... 11 Federal Elections 1 2010-01-01 2010-01-01 false Final determination. 9409.9 Section 9409.9... INFORMATION AND PRODUCTION OF OFFICIAL RECORDS IN LEGAL PROCEEDINGS § 9409.9 Final determination. The General Counsel will make the final determination on demands and requests to employees for production of official...
Indian Academy of Sciences (India)
PRAKASH KUMAR G
2008-01-31
ZW is reserved for female heterogamety.) The Radder et al study used lab incubation regimes that mimic temperature profiles of cool natural nests, so temperature probably determines sex at least occasionally in nature.
Photometric determination of traces of metals
International Nuclear Information System (INIS)
Onishi, H.
1986-01-01
The first three editions of this widely used classic were published under the title Colorimetric Determination of Traces of Metals, with E.B. Sandell as author. Part I (General Aspects) of the fourth edition was co-authored by E.B. Sandell and H. Onishi and published in 1978. After Sandell's death in 1984, Onishi assumed the monumental task of revising Part II. This book (Part IIA) consists of 21 chapters in which the photometric determinations of the individual metals, aluminium to lithium (including the lanthanoids), are described. Each chapter is divided into three sections: Separations, Methods of Determination, and Applications. The sections on Separations are of general interest and include methods based on precipitation, ion-exchange, chromatography, and liquid-liquid extraction. Molecular absorption and fluorescence techniques are described in the sections on determinations, and the emphasis is on the use of well-established reagents. Several reagents that have been recently introduced for the determination of trace levels of metals are also critically reviewed at the end of each section on methods of determination. Important applications of these methods to the determination of trace metals in complex organic and inorganic materials are described in detail at the end of each chapter
12 CFR 614.4950 - Determination fees.
2010-01-01
... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Determination fees. 614.4950 Section 614.4950... Insurance Requirements § 614.4950 Determination fees. (a) General. Notwithstanding any Federal or State law... or will be located in a special flood hazard area. A determination fee may also include, but is not...
38 CFR 36.4707 - Determination fees.
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Determination fees. 36...) LOAN GUARANTY Sale of Loans, Guarantee of Payment, and Flood Insurance § 36.4707 Determination fees. (a... will be located in a special flood hazard area. A determination fee may also include, but is not...
Femtogram determination of ACTH by bioradioimmunoassay
International Nuclear Information System (INIS)
Bruni, G.; Dal Pra, P.; Segre, G.
1979-01-01
A bioradioimmunoassay is described for determining adrenocorticotropic hormone (ACTH) levels in biological fluids. Slices of guinea pig's adrenal gland surviving in vitro and depleted of their cortisol content were used. When challenged with ACTH, the slices release newly synthesised cortisol into the medium which is then determined by radioimmunoasssay. A log-linear relationship was evident between added ACTH and the cortisol measured in the medium. Unlike previous methods, the sensitivity of this assay allows the determination of 0.5 femtogram (10 -15 g) of ACTH. A good correlation was observed when rat plasma ACTH levels were determined by the present bioassay method and by an ACTH radioimmunoassay. Mean values of plasma ACTH determined by the present method are shown for man, child, guinea pig, rabbit, rat, and hamster. (UK)
Femtogram determination of ACTH by bioradioimmunoassay
Energy Technology Data Exchange (ETDEWEB)
Bruni, G; Dal Pra, P; Segre, G [Siena Univ. (Italy). Inst. Pharmacology
1979-11-01
A bioradioimmunoassay is described for determining adrenocorticotropic hormone (ACTH) levels in biological fluids. Slices of guinea pig's adrenal gland surviving in vitro and depleted of their cortisol content were used. When challenged with ACTH, the slices release newly synthesised cortisol into the medium which is then determined by radioimmunoasssay. A log-linear relationship was evident between added ACTH and the cortisol measured in the medium. Unlike previous methods, the sensitivity of this assay allows the determination of 0.5 femtogram (10/sup -15/g) of ACTH. A good correlation was observed when rat plasma ACTH levels were determined by the present bioassay method and by an ACTH radioimmunoassay. Mean values of plasma ACTH determined by the present method are shown for man, child, guinea pig, rabbit, rat, and hamster.
Determinants of marriage dissolution
Rahim, Mohd Amirul Rafiq Abu; Shafie, Siti Aishah Mohd; Hadi, Az'lina Abdul; Razali, Nornadiah Mohd; Azid @ Maarof, Nur Niswah Naslina
2015-10-01
Nowadays, the number of divorce cases among Muslim couples is very worrisome whereby the total cases reported in 2013 increased by half of the total cases reported in the previous year. The questions on the true key factors of dissolution of marriage continue to arise. Thus, the objective of this study is to reveal the factors that contribute to the dissolution of marriage. A total of 181 cases and ten potential determinants were included in this study. The potential determinants considered were age at marriage of husband and wife, educational level of husband and wife, employment status of husband and wife, income of husband and wife, the number of children and the presence at a counseling session. Logistic regression analysis was used to analyze the data. The findings revealed that four determinants, namely the income of husband and wife, number of children and the presence at a counselling session were significant in predicting the likelihood of divorce among Muslim couples.
12 CFR 760.8 - Determination fees.
2010-01-01
... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Determination fees. 760.8 Section 760.8 Banks... HAVING SPECIAL FLOOD HAZARDS § 760.8 Determination fees. (a) General. Notwithstanding any Federal or... flood hazard area. A determination fee may also include, but is not limited to, a fee for life-of-loan...
49 CFR 1018.95 - Board determination.
2010-10-01
... 49 Transportation 8 2010-10-01 2010-10-01 false Board determination. 1018.95 Section 1018.95... determination. (a) Following review of the evidence, the Board will issue a written decision which will include... determination, it shall notify the debtor of its intent to refer the debt to the IRS for offset against the...
40 CFR 13.39 - Agency determination.
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Agency determination. 13.39 Section 13... Referral of Debts to IRS for Tax Refund Offset § 13.39 Agency determination. (a) Following review of the evidence, EPA will issue a written decision. (b) If EPA either sustains or amends its determination, it...
12 CFR 339.8 - Determination fees.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Determination fees. 339.8 Section 339.8 Banks... IN AREAS HAVING SPECIAL FLOOD HAZARDS § 339.8 Determination fees. (a) General. Notwithstanding any... hazard area. A determination fee may also include, but is not limited to, a fee for life-of-loan...
36 CFR 908.33 - Final determination.
2010-07-01
... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Final determination. 908.33... DEVELOPMENT AREA Review Procedure § 908.33 Final determination. (a) The Chairman or designee(s) shall make a final determination on the claim within 45 days of receipt of the file from the Director of Real Estate...
The Determinants of Food Choice
DEFF Research Database (Denmark)
Leng, Gareth; Adan, Roger A. H.; Belot, Michele
2017-01-01
, we need to be able to make valid predictions about the consequences of proposed interventions, and for this, we need a better understanding of the determinants of food choice. These determinants include dietary components (e.g. highly palatable foods and alcohol), but also diverse cultural and social...
Diagnostic agent for radioimmunological determinations
International Nuclear Information System (INIS)
Updike, S.J.
1978-01-01
The invention concerns a diagnostic agent for radioimmunological determinations. According to the invention, a binding protein (protein globulins, antibodies) of an aqueous solution specific for the substance to be determined is incorporated in gel particles of a strongly hydrophilic insoluble gel of controlled pore size. After subsequent drying of the system, a radioactively labelled form of the substance to be determined from a non-aqueous medium is included. The mixture is dried again. The diagnostic agent forred can be well stored and is very stable. There is no loss of activity of the specific bonding protein when drying according to the invented method. The described reagent can be effectively applied to the determination of many antigens and haptens: The gel is rehydrated by the sample to be investigated; as a result of this, the non-bonded tracer is set free and competes with the non-labelled substance for the bonding position. (VJ) [de
12 CFR 572.8 - Determination fees.
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Determination fees. 572.8 Section 572.8 Banks... FLOOD HAZARDS § 572.8 Determination fees. (a) General. Notwithstanding any Federal or State law other... flood hazard area. A determination fee may also include, but is not limited to, a fee for life-of-loan...
12 CFR 22.8 - Determination fees.
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Determination fees. 22.8 Section 22.8 Banks and... HAZARDS § 22.8 Determination fees. (a) General. Notwithstanding any Federal or State law other than the... home securing the loan is located or will be located in a special flood hazard area. A determination...
18 CFR 286.108 - Determination.
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Determination. 286.108 Section 286.108 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT... Contested Audit Findings and Proposed Remedies § 286.108 Determination. If no formal hearing is had the...
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Determination. 297.5 Section 297.5 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE WILD AND SCENIC RIVERS Water Resources Projects § 297.5 Determination. (a) The Secretary of Agriculture will consent to...
Teaching Determinants Using Rook Arrangements
Hendrickson, Anders O. F.
2018-01-01
Teaching determinants poses significant challenges to the instructor of a proof-based undergraduate linear algebra course. The standard definition by cofactor expansion is ugly, lacks symmetry, and is hard for students to use in proofs. We introduce a visual definition of the determinant that interprets permutations as arrangements of…
Determination of sulfur content in fuels
International Nuclear Information System (INIS)
Daucik, P.; Zidek, Z.; Kalab, P.
1998-01-01
The sulfur content in fuels, Diesel fuels, and in the solutions of dibutylsulfide in a white oil was determined by various methods. The results obtained by elemental analysis have shown that the method is not advisable for the determination of sulfur in fuels. A good agreement was found by comparing the results in the determination of the sulfur by Grote-Krekeler's and Hermann-Moritz's methods and by the energy-dispersive X-ray fluorescence analysis. The last method is the modern, comfortable, and timesaving method enabling the fast and precise determination of sulfur contents in the various types of samples. (authors)
Polarographic determination of uranium dioxide stoichiometry
International Nuclear Information System (INIS)
Viguie, J.; Uny, G.
1966-10-01
The method described allows the determination of small deviations from stoichiometry for uranium dioxide. It was applied to the study of surface oxidation of bulk samples. The sample is dissolved in phosphoric acid under an argon atmosphere; U(VI) is determined by polarography in PO 4 H 3 4.5 N - H 2 SO 4 4 N. U(IV) is determined by potentiometry. The detection limit is UO 2,0002 . The accuracy for a single determination at the 95% confidence level is ±20 per cent for samples with composition included between UO 2,001 and UO 2,01 . (authors) [fr
Lessons for Inductive Germline Determination
Seervai, Riyad N.H.; Wessel, Gary M.
2015-01-01
SUMMARY Formation of the germline in an embryo marks a fresh round of reproductive potential, yet the developmental stage and location within the embryo where the primordial germ cells (PGCs) form differs wildly among species. In most animals, the germline is formed either by an inherited mechanism, in which maternal provisions within the oocyte drive localized germ-cell fate once acquired in the embryo, or an inductive mechanism that involves signaling between cells that directs germ-cell fate. The inherited mechanism has been widely studied in model organisms such as Drosophila melanogaster, Caenorhabditis elegans, Xenopus laevis, and Danio rerio. Given the rapid generation time and the effective adaptation for laboratory research of these organisms, it is not coincidental that research on these organisms has led the field in elucidating mechanisms for germline specification. The inductive mechanism, however, is less well understood and is studied primarily in the mouse (Mus musculus). In this review, we compare and contrast these two fundamental mechanisms for germline determination, beginning with the key molecular determinants that play a role in the formation of germ cells across all animal taxa. We next explore the current understanding of the inductive mechanism of germ-cell determination in mice, and evaluate the hypotheses for selective pressures on these contrasting mechanisms. We then discuss the hypothesis that the transition between these determination mechanisms, which has happened many times in phylogeny, is more of a continuum than a binary change. Finally, we propose an analogy between germline determination and sex determination in vertebrates—two of the milestones of reproduction and development—in which animals use contrasting strategies to activate similar pathways. PMID:23450642
How Darwinian reductionism refutes genetic determinism.
Rosoff, Philip M; Rosenberg, Alex
2006-03-01
Genetic determinism labels the morally problematical claim that some socially significant traits, traits we care about, such as sexual orientation, gender roles, violence, alcoholism, mental illness, intelligence, are largely the results of the operation of genes and not much alterable by environment, learning or other human intervention. Genetic determinism does not require that genes literally fix these socially significant traits, but rather that they constrain them within narrow channels beyond human intervention. In this essay we analyze genetic determinism in light of what is now known about the inborn error of metabolism phenylketonuria (PKU), which has for so long been the poster child 'simple' argument in favor of some form of genetic determinism. We demonstrate that this case proves the exact opposite of what it has been proposed to support and provides a strong refutation of genetic determinism in all its guises.
Gender determination in populus
Energy Technology Data Exchange (ETDEWEB)
McLetchie, D.N. [Univ. of Kentucky, Lexington, KY (United States). Dept. of Biological Sciences; Tuskan, G.A. [Oak Ridge National Lab., TN (United States)
1994-12-31
Gender, the expression of maleness or femaleness, in dioecious plants has been associated with changes in morphology, physiology, ecological position, and commercial importance of several species, including members of the Salicaceae family. Various mechanisms have been proposed to explain the expression of gender in Salicaceae, including sex chromosomes, simple Mendelian genes, quantitative genes, environment, and genotype-by-environment interactions. Published reports would favor a genetic basis for gender. The objective of this study was to identify molecular markers associated with gender in a segregating family of hybrid poplars. Bulked segregant analysis and chi-squared analysis were used to test for the occurrence of sex chromosomes, individual loci, and chromosome ratios (i.e., ploidy levels) as the mechanisms for gender determination. Examination of 2488 PCR based RAPD markers from 1219 primers revealed nine polymorphic bands between male and female bulked samples. However, linkage analysis indicated that none of these markers were significantly associated with gender. Chisquared results for difference in male-to-female ratios between diploid and triploid genotypes also revealed no significant differences. These findings suggest gender is not controlled via sex chromosomes, simple Mendelian loci or ratios of autosome to gender-determining loci. It is possible that gender is determined genetically by regions of the genome not sampled by the tested markers or by a complex of loci operating in an additive threshold manner or in an epistatic manner. It is also possible that gender is determined environmentally at an early zygote stage, canalizing gender expression.
Age determination and geological studies
International Nuclear Information System (INIS)
Stevens, R.D.; Delabio, R.N.; Lachance, G.R.
1982-01-01
Two hundred and eight potassium-argon age determinations carried out on Canadian rocks and minerals are reported. Each age determination is accompanied by a description of the rock and mineral concentrate used; brief interpretative comments regarding the geological significance of each age are also provided where possible. The experimental procedures employed are described in brief outline and the constants used in the calculation of ages are listed. Two geological time-scales are reproduced in tabular form for ready reference and an index of all Geological Survey of Canada K-Ar age determinations published in this format has been prepared using NTS quadrangles as the primary reference
Framing the Future: Self-Determination
Wehmeyer, Michael L.
2015-01-01
There is an established and still-growing evidence base that promoting self-determination has positive school and post-school benefits for students with disabilities, and yet efforts to do so remain sporadic, at best. This article examines the evidence that promoting self-determination is critically important for students with disabilities,…
42 CFR 436.531 - Determination of blindness.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Determination of blindness. 436.531 Section 436.531... Requirements for Medicaid Eligibility Blindness § 436.531 Determination of blindness. In determining blindness... determine on behalf of the agency— (1) Whether the individual meets the definition of blindness; and (2...
[Social determinants of health and disability: updating the model for determination].
Tamayo, Mauro; Besoaín, Álvaro; Rebolledo, Jaime
Social determinants of health (SDH) are conditions in which people live. These conditions impact their lives, health status and social inclusion level. In line with the conceptual and comprehensive progression of disability, it is important to update SDH due to their broad implications in implementing health interventions in society. This proposal supports incorporating disability in the model as a structural determinant, as it would lead to the same social inclusion/exclusion of people described in other structural SDH. This proposal encourages giving importance to designing and implementing public policies to improve societal conditions and contribute to social equity. This will be an act of reparation, justice and fulfilment with the Convention on the Rights of Persons with Disabilities. Copyright © 2017 SESPAS. Publicado por Elsevier España, S.L.U. All rights reserved.
Are risks quantitatively determinable
International Nuclear Information System (INIS)
Buetzer, P.
1985-01-01
''Chemical risks'' can only be determined with accurate figures in a few extraordinary cases. The difficulties lie, as has been shown by the example of the Flixborough catastrophe, mostly in the determination of the probabilities of occurrence. With a rough semiquantitative estimate of the potential hazards and the corresponding probabilities we can predict the risks with astonishing accuracy. Statistical data from incidents in the chemical industry are very useful, and they also show that ''chemical catastrophes'' are only to a very small extent initiated by uncontrolled chemical reactions. (orig.) [de
2016-01-01
Purpose: This study aimed at conducting a systematic review in health professions education of determinants, mediators and outcomes of students’ motivation to engage in academic activities based on the self-determination theory’s perspective. Methods: A search was conducted across databases (MEDLINE, CINHAL, EMBASE, PsycINFO, and ERIC databases), hand-search of relevant journals, grey literature, and published research profile of key authors. Quantitative and qualitative studies were included if they reported research in health professions education focused on determinants, mediators, and/or outcomes of motivation from the self-determination and if meeting the quality criteria. Results: A total of 17 studies met the inclusion and quality criteria. Articles retrieved came from diverse locations and mainly from medical education and to a lesser extent from psychology and dental education. Intrapersonal (gender and personality traits) and interpersonal determinants (academic conditions and lifestyle, qualitative method of selection, feedback, and an autonomy supportive learning climate) have been reported to have a positive influence on students’ motivation to engage in academic activities. No studies were found that tested mediation effects between determinants and students’ motivation. In turn, students’ self-determined motivation has been found to be positively associated with different cognitive, affective, and behavioural outcomes. Conclusion: This study has found that generally, motivation could be enhanced by changes in the educational environment and by an early detection of students’ characteristics. Doing so may support future health practitioners’ self-determined motivation and positively influence how they process information and their emotions and how they approach their learning activities. PMID:27134006
Directory of Open Access Journals (Sweden)
Cesar Orsini
2016-05-01
Full Text Available Purpose: This study aimed at conducting a systematic review in health professions education of determinants, mediators and outcomes of students’ motivation to engage in academic activities based on the self-determination theory’s perspective. Methods: A search was conducted across databases (MEDLINE, CINHAL, EMBASE, PsycINFO, and ERIC databases, hand-search of relevant journals, grey literature, and published research profile of key authors. Quantitative and qualitative studies were included if they reported research in health professions education focused on determinants, mediators, and/or outcomes of motivation from the self-determination and if meeting the quality criteria. Results: A total of 17 studies met the inclusion and quality criteria. Articles retrieved came from diverse locations and mainly from medical education and to a lesser extent from psychology and dental education. Intrapersonal (gender and personality traits and interpersonal determinants (academic conditions and lifestyle, qualitative method of selection, feedback, and an autonomy supportive learning climate have been reported to have a positive influence on students’ motivation to engage in academic activities. No studies were found that tested mediation effects between determinants and students’ motivation. In turn, students’ self-determined motivation has been found to be positively associated with different cognitive, affective, and behavioural outcomes. Conclusion: This study has found that generally, motivation could be enhanced by changes in the educational environment and by an early detection of students’ characteristics. Doing so may support future health practitioners’ self-determined motivation and positively influence how they process information and their emotions and how they approach their learning activities.
Orsini, Cesar; Binnie, Vivian I; Wilson, Sarah L
2016-01-01
This study aimed at conducting a systematic review in health professions education of determinants, mediators and outcomes of students' motivation to engage in academic activities based on the self-determination theory's perspective. A search was conducted across databases (MEDLINE, CINHAL, EMBASE, PsycINFO, and ERIC databases), hand-search of relevant journals, grey literature, and published research profile of key authors. Quantitative and qualitative studies were included if they reported research in health professions education focused on determinants, mediators, and/or outcomes of motivation from the self-determination and if meeting the quality criteria. A total of 17 studies met the inclusion and quality criteria. Articles retrieved came from diverse locations and mainly from medical education and to a lesser extent from psychology and dental education. Intrapersonal (gender and personality traits) and interpersonal determinants (academic conditions and lifestyle, qualitative method of selection, feedback, and an autonomy supportive learning climate) have been reported to have a positive influence on students' motivation to engage in academic activities. No studies were found that tested mediation effects between determinants and students' motivation. In turn, students' self-determined motivation has been found to be positively associated with different cognitive, affective, and behavioural outcomes. This study has found that generally, motivation could be enhanced by changes in the educational environment and by an early detection of students' characteristics. Doing so may support future health practitioners' self-determined motivation and positively influence how they process information and their emotions and how they approach their learning activities.
Koka, Andre; Hagger, Martin S
2010-03-01
In the present study, we tested the effects of specific dimensions of perceived teaching behaviors on students' self-determined motivation in physical education. In accordance with the tenets of self-determination theory (Deci & Ryan, 1985, 2000), we expected the psychological needs for competence, autonomy, and relatedness would mediate these effects. Secondary school students (N=498) ages 12-17 years completed measures of perceived teaching behaviors for seven dimensions: (a) democratic behavior, (b) autocratic behavior (c) teaching and instruction, (d) situation consideration, (e) positive general feedback, (f) positive nonverbal feedback, and (h) negative nonverbal feedback. They also completed measures of perceived satisfaction for competence, autonomy, relatedness, and self-determined motivation. A path-analytic model revealed a positive, indirect effect of perceived positive general feedback on self-determined motivation. The effects of perceived autocratic behavior and negative nonverbal feedback were direct and negative, whereas the effects of teaching and instruction and situation consideration were direct and positive. Results suggest that feedback, situation consideration, and teaching and instruction are essential antecedents to self-determined motivation.
Brown, Robin Gordon
2017-06-01
A confusion persists in the psychoanalytic literature regarding the concept of psychic determinism. Two authors are cited in whose works the concept is identified as foundational to psychoanalysis, in the one case as a "fundamental hypothesis" (Charles Brenner) and in the other as an "underlying presupposition" or assumption (Linda A.W. Brakel). Both claims are based on a conflation of the concept Freud had in mind with a philosophical doctrine going by the same name but meaning something quite different. The philosophical doctrine has no place in psychoanalysis at all, and Freud's concept does not play a foundational role there. In a second section a restricted concept of psychic determinism is critically examined. A third section deals with the impact of that restricted concept on clinical theory and contemporary controversies about clinical practice. Finally, some possible reasons for this confusion are suggested.
Uranium hexafluoride. Bromine spectrophotometric determination
International Nuclear Information System (INIS)
Anon.
Bromine determination in hydrolized uranium hexafluoride by reduction of bromates by ferrous sulfate, oxidation of bromides by potassium permanganate to give bromine which is extracted into carbon tetrachloride and transformed in eosine for spectrophotometry at 510 nm. The method is suitable for determining 5 to 150 ppm with respect to uranium [fr
Neutron activation determination of impurities in molybdenum
International Nuclear Information System (INIS)
Usmanova, M.M.; Mukhamedshina, N.M.; Obraztsova, T.V.; Saidakhmedov, K.Kh.
1984-01-01
Instrumental neutron-activation techniques of impurity element determination in molybdenum and MoO 3 (solid and powdered samples) have been developed. When determining impurities of Na, K, Mn, Cu, W, Re molybdenum has been irradiated by thermal neutrons in reactor for 20 min, the sample mass constituted 200-300 mg, sample cooling time after irradiation - 2.5-3.5 h. It is shown that in the process of Cr, Fe, Co, Zn determination the samples should be irradiated with thermal neutrons, and in the process of Sb, Ta and Ni determination - with resonance and fast neutrons. Simultaneous determination of the elements during irradiation with neutrons with reactor spectrum is possible. When determining P and S the samples are irradiated with thermal and epithermal neutrons and β-activity of samples and comparison samples are measured using β-spectrometer with anthracene crystal. The techniques developed permit to determine impurities in Mo with a relative standard deviation 0.07-0.15 and lower boundaries of contents determined - 10 -4 - 10 -7 %
Methods of humidity determination Part II: Determination of material humidity
Rübner, Katrin; Balköse, Devrim; Robens, E.
2008-01-01
Part II covers the most common methods of measuring the humidity of solid material. State of water near solid surfaces, gravimetric measurement of material humidity, measurement of water sorption isotherms, chemical methods for determination of water content, measurement of material humidity via the gas phase, standardisation, cosmonautical observations are reviewed.
Total Body Water Determination: Have We To Adapt Its Determination To The Patient Clinical Status?
Directory of Open Access Journals (Sweden)
Almudena Pérez Torres
2012-06-01
Conclusion: There is a good concordance between both methods in the determination of the TBW. The Watson formula overestimates the TBW in patients with high %FM and underestimates in those with high FFM. In the clinical practice, it is necessary to adapt the determination of TBW to the patient situation.
Method of molybdenum kinetic determination
International Nuclear Information System (INIS)
Krejngol'd, S.U.; Dzotsenidze, N.E.; Ruseishviyai, T.G.; Nelen', I.M.
1980-01-01
The method molybdenum kinetic determination according to oxidation of pyrogallol with bromate in the medium of 0.05-0.15 M perchloric or sulphuric acids is presented. 1 mg of Ni, Co, Mn, Mg, Zn, Cr(3); 100 μg of Ca, Al, Cu, 10 μg of Cr(4), W; 10 μg of Fe in the presence of 22x10 - 4 M solution of EDTA, as well as 10 - 4 M solutions of chlorides and fluorides, 10 - 5 M solutions of bromides do not interfere with molybdenum determination using the given method. The method is rather simple, it takes 30 min to carry out the analysis. Determination limit of molybdenum constitutes 0.01 μg/ml
Calculation methods for determining dose equivalent
International Nuclear Information System (INIS)
Endres, G.W.R.; Tanner, J.E.; Scherpelz, R.I.; Hadlock, D.E.
1987-11-01
A series of calculations of neutron fluence as a function of energy in an anthropomorphic phantom was performed to develop a system for determining effective dose equivalent for external radiation sources. Critical organ dose equivalents are calculated and effective dose equivalents are determined using ICRP-26 [1] methods. Quality factors based on both present definitions and ICRP-40 definitions are used in the analysis. The results of these calculations are presented and discussed. The effective dose equivalent determined using ICRP-26 methods is significantly smaller than the dose equivalent determined by traditional methods. No existing personnel dosimeter or health physics instrument can determine effective dose equivalent. At the present time, the conversion of dosimeter response to dose equivalent is based on calculations for maximal or ''cap'' values using homogeneous spherical or cylindrical phantoms. The evaluated dose equivalent is, therefore, a poor approximation of the effective dose equivalent as defined by ICRP Publication 26. 3 refs., 2 figs., 1 tab
Gravimetric gas determinations for volume calibration
International Nuclear Information System (INIS)
Gibbs, P.W.
1991-01-01
Gravimetric measurements of gases is one of the methods available for calibrating gas volumes. By inputting a known quantity of gas and measuring the resulting pressure and temperature, the system volume can be calculated using gas law principles. Historically, this method has been less accurate due to the difficulty in the mass determination. This difficulty comes from several sources. Two examples are the large tare weight of the gas container relative to the weight of gas and the external volume of the gas container relative to the standards. The application of a gravimetric gas determination to tank volume calibrations at the savannah River Site is discussed. Mass determinations on a 25,00 gram gas container were such that a 1500 gram quantity of gas was routinely determined to within ±0.2 gram at the 99% confidence level. In this paper the weighting design and the methods used to address the difficulties of the mass determination are detailed
Determination Of Ph Including Hemoglobin Correction
Maynard, John D.; Hendee, Shonn P.; Rohrscheib, Mark R.; Nunez, David; Alam, M. Kathleen; Franke, James E.; Kemeny, Gabor J.
2005-09-13
Methods and apparatuses of determining the pH of a sample. A method can comprise determining an infrared spectrum of the sample, and determining the hemoglobin concentration of the sample. The hemoglobin concentration and the infrared spectrum can then be used to determine the pH of the sample. In some embodiments, the hemoglobin concentration can be used to select an model relating infrared spectra to pH that is applicable at the determined hemoglobin concentration. In other embodiments, a model relating hemoglobin concentration and infrared spectra to pH can be used. An apparatus according to the present invention can comprise an illumination system, adapted to supply radiation to a sample; a collection system, adapted to collect radiation expressed from the sample responsive to the incident radiation; and an analysis system, adapted to relate information about the incident radiation, the expressed radiation, and the hemoglobin concentration of the sample to pH.
Determination of Formula for Vickers Hardness Measurements Uncertainty
International Nuclear Information System (INIS)
Purba, Asli
2007-01-01
The purpose of formula determination is to obtain the formula of Vickers hardness measurements uncertainty. The approach to determine the formula: influenced parameters identification, creating a cause and effect diagram, determination of sensitivity, determination of standard uncertainty and determination of formula for Vickers hardness measurements uncertainty. The results is a formula for determination of Vickers hardness measurements uncertainty. (author)
Determination of radium in water
International Nuclear Information System (INIS)
Hohorst, F.A.; Huntley, M.W.; Hartenstein, S.D.
1995-10-01
These detailed work instructions (DWIs) are tailored for the analysis of radium-226 and radium-228 in drinking water supplies from ground water and surface water sources and composites derived from them. The instructions have been adapted from several sources, including a draft EPA method. One objective was to minimize the generation of mixed wastes. Quantitative determinations of actinium-228 are made at 911 keV. The minimum detection level (MDL) for the gamma spectrometric measurements at this energy vary with matrix, volume, geometry, detector, background, and counting statistics. The range of MDL's for current detectors is 0.07 to 0.5 Bq/sample. Quantitative determinations of radium-226 are made by counting the high energy alpha particles which radium-226 progeny emit using liquid scintillation counting (LSC). The minimum detectable activity (MDA) is 3.8 E-3 Bq/sample. The maximum concentration which may be counted on available instruments without dilution is about 2 E + 5 Bq/sample. Typically, this determination of radium in a 2 L sample has a yield of 80%. If radium-228 is determined using a 16 h count after 50 h grow-in, the typical MDL is 1 E-9 to 8 E-9 μCi/mL (1 to 8 pCi/L). If radium-226 is determined using a 2.5 h count after 150 h grow-in, the typical MDA is about 1 E-10 μCi/mL (0. 1 pCi/L)
Determination of radium in water
Energy Technology Data Exchange (ETDEWEB)
Hohorst, F.A.; Huntley, M.W.; Hartenstein, S.D.
1995-10-01
These detailed work instructions (DWIs) are tailored for the analysis of radium-226 and radium-228 in drinking water supplies from ground water and surface water sources and composites derived from them. The instructions have been adapted from several sources, including a draft EPA method. One objective was to minimize the generation of mixed wastes. Quantitative determinations of actinium-228 are made at 911 keV. The minimum detection level (MDL) for the gamma spectrometric measurements at this energy vary with matrix, volume, geometry, detector, background, and counting statistics. The range of MDL`s for current detectors is 0.07 to 0.5 Bq/sample. Quantitative determinations of radium-226 are made by counting the high energy alpha particles which radium-226 progeny emit using liquid scintillation counting (LSC). The minimum detectable activity (MDA) is 3.8 E-3 Bq/sample. The maximum concentration which may be counted on available instruments without dilution is about 2 E + 5 Bq/sample. Typically, this determination of radium in a 2 L sample has a yield of 80%. If radium-228 is determined using a 16 h count after 50 h grow-in, the typical MDL is 1 E-9 to 8 E-9 {mu}Ci/mL (1 to 8 pCi/L). If radium-226 is determined using a 2.5 h count after 150 h grow-in, the typical MDA is about 1 E-10 {mu}Ci/mL (0. 1 pCi/L).
Polarographic determination of selenium in indium
International Nuclear Information System (INIS)
Kaplan, B.Ya.; Mikheeva, V.A.; Priz, N.B.
1978-01-01
The procedure of determining nx10 -6 % Se in indium after concentrating in an elemental form on arsenic and sulphur has been developed. The selenium content is determined by inversion a.c. polarography on a sulphuric-acid background in the presence of Cu(2), potassium bichromate, and sodium pyrophosphate. 5.7x10 -6 % Se in metal indium has been determined by this procedure, the mean standard deviation being Sr=0.26
Liquidity Determinants of Moroccan Banking Industry
FERROUHI, El Mehdi; LEHADIRI, Abderrassoul
2013-01-01
This paper analyzes the behavior of Moroccan bank’s liquidity during the period 2001 – 2012. The research aims to identify the determinants of Moroccan bank’s liquidity. We first evaluate Moroccan banks’ liquidity positions through different liquidity ratios to determine the effects of financial crisis on bank’s liquidity. We then highlight the effect of banks’ size on banks’ liquidity. Finally, we identify determinants of Moroccan bank’s liquidity using panel data regression. ...
Fluorimetric determination of uranium in water
International Nuclear Information System (INIS)
Acosta L, E.
1992-02-01
The fluorimetric method for the determination of microquantities of uranium in water is described. This method covers the determination of uranium in water in the interval from 0.2 to 50 ppm on 50 ml. of radioactive base sample. These limits can be variable if the volume of the aliquot one of the base sample is changed, as well as the volume of the used aliquot one for to the final determination of uranium. (Author)
Determining distances using asteroseismic methods
DEFF Research Database (Denmark)
Aguirre, Victor Silva; Casagrande, L.; Basu, Sarbina
2013-01-01
Asteroseismology has been extremely successful in determining the properties of stars in different evolutionary stages with a remarkable level of precision. However, to fully exploit its potential, robust methods for estimating stellar parameters are required and independent verification of the r......Asteroseismology has been extremely successful in determining the properties of stars in different evolutionary stages with a remarkable level of precision. However, to fully exploit its potential, robust methods for estimating stellar parameters are required and independent verification...... fluxes, and thus distances for field stars in a self-consistent manner. Applying our method to a sample of solar-like oscillators in the {\\it Kepler} field that have accurate {\\it Hipparcos} parallaxes, we find agreement in our distance determinations to better than 5%. Comparison with measurements...
New determinants for gallstone disease?
DEFF Research Database (Denmark)
Shabanzadeh, Daniel Mønsted
2018-01-01
screened for gallstone disease with multiple ultrasound examinations, it was possible to both confirm previously identified determinants and to identify new determinants for gallstone disease. Temporal associations for incident gallstone disease and female sex, BMI, non-HDL cholesterol, and inverse...... is the self-reported exposures which may cause misclassification bias. If explored in future studies, assessment of lifestyle habits should include objective measures in order to contribute any further to existing evidence on determinants for gallstone disease. Associations for biomarkers of insulin...... formation have a long history and the most established include bile cholesterol saturation, gallbladder motor function, and the enterohepatic circulation of secondary bile salts produced by fecal microbiota. A small number of determinants that are believed to affect these mechanisms have been identified...
24 CFR 581.4 - Suitability determination.
2010-04-01
... earlier than six months prior to the expected date when the property will become unutilized or... determination for a particular piece of property, and the reasons for that determination; and (2) The...
Solution NMR structure determination of proteins revisited
International Nuclear Information System (INIS)
Billeter, Martin; Wagner, Gerhard; Wuethrich, Kurt
2008-01-01
This 'Perspective' bears on the present state of protein structure determination by NMR in solution. The focus is on a comparison of the infrastructure available for NMR structure determination when compared to protein crystal structure determination by X-ray diffraction. The main conclusion emerges that the unique potential of NMR to generate high resolution data also on dynamics, interactions and conformational equilibria has contributed to a lack of standard procedures for structure determination which would be readily amenable to improved efficiency by automation. To spark renewed discussion on the topic of NMR structure determination of proteins, procedural steps with high potential for improvement are identified
Selenium determination by fluorimetric method
International Nuclear Information System (INIS)
Lavorenti, A.
1981-01-01
A fluorimetric method to determine selenium both in vegetable samples and blood serum is developed. The method consists of a radioisotope 75 Se initially in order to optimize the determination of analytical conditions. Three samples digestion processes and also some factors related to methodology is studied. The nitric-percloric digestion process for 40 samples and the analytical process is shown. (M.J.C.) [pt
International Nuclear Information System (INIS)
Amaral, L.B.D.; Pinto, J.C.M.; Linhares, E.; Linhares, Estevao
1981-01-01
There are three important indications for the early diagnosis of pregnancy through the determination of the beta sub-unit of chorionic gonadotrophin using radioimmunoassay: 1) some patient's or doctor's anxiety to discover the problem; 2) when it will be necessary to employ diagnostic or treatment procedures susceptible to affect the ovum; and 3) in the differential diagnosis of amenorrhoea, uterine hemorrhage and abdominal tumors. Other user's are the diagnosis of missed absortion, and the diagnosis and follow-up of chrorioncarcinoma. The AA. studied 200 determinations of plasma beta-HCG, considering the main difficulties occuring in the clinical use of this relevant laboratory tool in actual Obstetrics. (author) [pt
40 CFR 94.218 - Deterioration factor determination.
2010-07-01
... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Deterioration factor determination. 94... Deterioration factor determination. Manufacturers shall determine exhaust emission deterioration factors using good engineering judgement according to the provisions of this section. Every deterioration factor must...
Protein determination in single corns
International Nuclear Information System (INIS)
Knorr, J.; Schiekel, M.; Franke, W.; Focke, F.
1994-01-01
Determination of protein content in food materials is usually done by analyzing the nitrogen amount by wet chemical Kjeldahl method. An improved accuracy accompanied by smaller analyzing intervals can be achieved using nondestructive neutron activation. Analyses have been performed using 14 MeV neutrons to determine the content of N and P in single wheat corns. Irradiation parameters have been optimized to prevent serious radiation damage in grains. About 200 single corns have been investigated with total net weights ranging from 30 to 70 mg. The tested arrangement allows determination of nitrogen amount in a single corn down to 0.3 mg with an accuracy of better than 4 %. Mean nitrogen concentrations in the range from 9 to 19% per corn have been detected. (author) 5 refs.; 6 figs
Directory of Open Access Journals (Sweden)
Bahram Andarzian
2015-06-01
Full Text Available Wheat production in the south of Khuzestan, Iran is constrained by heat stress for late sowing dates. For optimization of yield, sowing at the appropriate time to fit the cultivar maturity length and growing season is critical. Crop models could be used to determine optimum sowing window for a locality. The objectives of this study were to evaluate the Cropping System Model (CSM-CERES-Wheat for its ability to simulate growth, development, grain yield of wheat in the tropical regions of Iran, and to study the impact of different sowing dates on wheat performance. The genetic coefficients of cultivar Chamran were calibrated for the CSM-CERES-Wheat model and crop model performance was evaluated with experimental data. Wheat cultivar Chamran was sown on different dates, ranging from 5 November to 9 January during 5 years of field experiments that were conducted in the Khuzestan province, Iran, under full and deficit irrigation conditions. The model was run for 8 sowing dates starting on 25 October and repeated every 10 days until 5 January using long-term historical weather data from the Ahvaz, Behbehan, Dezful and Izeh locations. The seasonal analysis program of DSSAT was used to determine the optimum sowing window for different locations as well. Evaluation with the experimental data showed that performance of the model was reasonable as indicated by fairly accurate simulation of crop phenology, biomass accumulation and grain yield against measured data. The normalized RMSE were 3%, 2%, 11.8%, and 3.4% for anthesis date, maturity date, grain yield and biomass, respectively. Optimum sowing window was different among locations. It was opened and closed on 5 November and 5 December for Ahvaz; 5 November and 15 December for Behbehan and Dezful;and 1 November and 15 December for Izeh, respectively. CERES-Wheat model could be used as a tool to evaluate the effect of sowing date on wheat performance in Khuzestan conditions. Further model evaluations
Zirconium determination in refractories (gravimetric method)
International Nuclear Information System (INIS)
Capiotto, N.; Narahashi, Y.; Perish, C.G.; Souza, J.R.
1991-01-01
The zirconium determination in refractories is described, consisting in two separation methods for eliminating the interferences. The formatted product is calcined at 1100 0 C and determined gravimetrically as Zr P z 07. (author)
36 CFR 242.15 - Rural determination process.
2010-07-01
... SUBSISTENCE MANAGEMENT REGULATIONS FOR PUBLIC LANDS IN ALASKA Program Structure § 242.15 Rural determination...) Development and diversity of the economy; (iii) Community infrastructure; (iv) Transportation; and (v... years shall be required before the non-rural determination becomes effective. (c) Current determinations...
Determination of the scattering amplitude
International Nuclear Information System (INIS)
Gangal, A.D.; Kupsch, J.
1984-01-01
The problem to determine the elastic scattering amplitude from the differential cross-section by the unitarity equation is reexamined. We prove that the solution is unique and can be determined by a convergent iteration if the parameter lambda=sin μ of Newton and Martin is bounded by lambda 2 approx.=0.86. The method is based on a fixed point theorem for holomorphic mappings in a complex Banach space. (orig.)
The determinants of the antibiotic resistance process.
Franco, Beatriz Espinosa; Altagracia Martínez, Marina; Sánchez Rodríguez, Martha A; Wertheimer, Albert I
2009-01-01
The use of antibiotic drugs triggers a complex interaction involving many biological, sociological, and psychological determinants. Resistance to antibiotics is a serious worldwide problem which is increasing and has implications for morbidity, mortality, and health care both in hospitals and in the community. To analyze current research on the determinants of antibiotic resistance and comprehensively review the main factors in the process of resistance in order to aid our understanding and assessment of this problem. We conducted a MedLine search using the key words "determinants", "antibiotic", and "antibiotic resistance" to identify publications between 1995 and 2007 on the determinants of antibiotic resistance. Publications that did not address the determinants of antibiotic resistance were excluded. The process and determinants of antibiotic resistance are described, beginning with the development of antibiotics, resistance and the mechanisms of resistance, sociocultural determinants of resistance, the consequences of antibiotic resistance, and alternative measures proposed to combat antibiotic resistance. Analysis of the published literature identified the main determinants of antibiotic resistance as irrational use of antibiotics in humans and animal species, insufficient patient education when antibiotics are prescribed, lack of guidelines for treatment and control of infections, lack of scientific information for physicians on the rational use of antibiotics, and lack of official government policy on the rational use of antibiotics in public and private hospitals.
Koka, Andre; Hagger, Martin S.
2010-01-01
In the present study, we tested the effects of specific dimensions of perceived teaching behaviors on students' self-determined motivation in physical education. In accordance with the tenets of self-determination theory (Deci & Ryan, 1985, 2000), we expected the psychological needs for competence, autonomy, and relatedness would mediate these…
Fermion determinants in lattice QCD
International Nuclear Information System (INIS)
Johnson, Christopher Andrew
2001-01-01
The main topic of this thesis concerns efficient algorithms for the calculation of determinants of the kind of matrix typically encountered in lattice QCD. In particular an efficient method for calculating the fermion determinant is described. Such a calculation is useful to illustrate the effects of light dynamical (virtual) quarks. The methods employed in this thesis are stochastic methods, based on the Lanczos algorithm, which is used for the solution of large, sparse matrix problems via a partial tridiagonalisation of the matrix. Here an implementation is explored which requires less exhaustive treatment of the matrix than previous Lanczos methods. This technique exploits the analogy between the Lanczos tridiagonalisation algorithm and Gaussian quadrature in order to calculate the fermion determinant. A technique for determining a number of the eigenvalues of the matrix is also presented. A demonstration is then given of how one can improve upon this estimate considerably using variance reduction techniques, reducing the variance by a factor of order 100 with a further, equal amount of work. The variance reduction method is a two-stage process, involving a Chebyshev approximation to the quantity in question and then the subtraction of traceless operators. The method is applied to the fermion determinant for non-perturbatively improved Wilson fermions on a 16 3 x 32 lattice. It is also applicable to a wider class of matrix operators. Finally we discuss how dynamical quark effects may be simulated in a Monte Carlo process with an effective partitioning of low and high eigenmodes. This may be done via selective updating of a trial configuration which highlights the physically relevant effects of light quark modes. (author)
Structural determination of organic compounds
International Nuclear Information System (INIS)
Kintzinger, J.P.
1991-01-01
This paper reports that the current methods available in high-field NMR spectroscopy are such that the tridimensional structure determination of any rigid molecule containing only carbon and hydrogen atoms may be achieved. The connectivities between carbon-carbon, carbon-hydrogen, and hydrogen-hydrogen atoms are determined by multipulse and two-dimensional (2D) experiments. These connectivity patterns or maps allow a step-by-step reconstruction of the molecular structures. From the carbon-carbon connectivity map, the carbon framework of the molecule is obtained, whereas the carbon-hydrogen pattern allows determination of the positions of the hydrogen atoms on their corresponding carbon atoms. High-field spectrometers are then necessary to remove fortuitous degeneracy and to reduce the proton spectra to a nearly first-order one, allowing an easy measurement of the chemical shifts and the coupling constants
Determining Polarities Of Distant Lightning Strokes
Blakeslee, Richard J.; Brook, Marx
1990-01-01
Method for determining polarities of lightning strokes more than 400 km away. Two features of signal from each stroke correlated. New method based on fact each stroke observed thus far for which polarity determined unambiguously, initial polarity of tail same as polarity of initial deflection before initial-deflection signal altered by propagation effects. Receiving station equipped with electric-field-change antenna coupled to charge amplifier having time constant of order of 1 to 10 seconds. Output of amplifier fed to signal-processing circuitry, which determines initial polarity of tail.
42 CFR 435.531 - Determinations of blindness.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Determinations of blindness. 435.531 Section 435... ISLANDS, AND AMERICAN SAMOA Categorical Requirements for Eligibility Blindness § 435.531 Determinations of blindness. (a) Except as specified in paragraph (b) of this section, in determining blindness— (1) A...
42 CFR 456.609 - Determinations by team.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Determinations by team. 456.609 Section 456.609 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Facilities and Institutions for Mental Diseases § 456.609 Determinations by team. The team must determine in...
Determining Optimal Decision Version
Directory of Open Access Journals (Sweden)
Olga Ioana Amariei
2014-06-01
Full Text Available In this paper we start from the calculation of the product cost, applying the method of calculating the cost of hour- machine (THM, on each of the three cutting machines, namely: the cutting machine with plasma, the combined cutting machine (plasma and water jet and the cutting machine with a water jet. Following the calculation of cost and taking into account the precision of manufacturing of each machine, as well as the quality of the processed surface, the optimal decisional version needs to be determined regarding the product manufacturing. To determine the optimal decisional version, we resort firstly to calculating the optimal version on each criterion, and then overall using multiattribute decision methods.
Determinants of Aggressive Tax Avoidance
Herbert, Tanja
2015-01-01
This thesis consists of three essays examining determinants of aggressive tax avoidance. The first essay “Measuring the Aggressive Part of International Tax Avoidance”, co-authored with Prof. Dr. Michael Overesch, proposes a new measure that isolates the additional or even aggressive part in international tax avoidance and analyzes the determinants of aggressive tax avoidance of multinational enterprises. The second essay “Capital Injections and Aggressive Tax Planning - Can Banks Have It All...
Football performance and its determinants
Macháček, Martin
2017-01-01
This thesis focuses on enumeration of the essential psychosocial determinants affecting performance of the footballers. These determinants are divided into three sections. Personality of athlete as a key factor influencing his performance is discussed in the chapter one. Social and cultural environment are the subjects of the second chapter. Specifics and partial aspects of sports environments are presented in the third chapter. Definition of performance in football and the possibility of its...
[Determination or determinants? A debate based on the Theory on the Social Production of Health].
Rocha, Patrícia Rodrigues da; David, Helena Maria Scherlowski Leal
2015-02-01
This article aims to discuss the concepts of Social Determination of Health and Social Determinants of Health, by establishing a comparison between each of their guiding perspectives and investigating their implications on the development of health policies and health actions. We propose a historical and conceptual reflection, highlighting the Theory on the Social Production of Health, followed by a debate on the concepts, with a comparative approach among them.
College Student Retention: A Self-Determination Perspective
Tetreault, Jules
2013-01-01
This study sought to identify the relationship between a student's level of self-determination towards aspiring to receive a college degree and student retention from the first to second year. Deci & Ryan's (2000) self-determination theory served as the conceptual framework for this study. The fundamental assumption of self-determination is…
29 CFR 4.52 - Fringe benefit determinations.
2010-07-01
... 29 Labor 1 2010-07-01 2010-07-01 true Fringe benefit determinations. 4.52 Section 4.52 Labor... Procedures § 4.52 Fringe benefit determinations. (a) Wage determinations issued pursuant to the Service... differential, which are considered wages rather than fringe benefits under SCA). Pursuant to Section 4(b) of...
29 CFR 578.4 - Determination of penalty.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Determination of penalty. 578.4 Section 578.4 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR REGULATIONS MINIMUM WAGE AND OVERTIME VIOLATIONS-CIVIL MONEY PENALTIES § 578.4 Determination of penalty. (a) In determining the...
Sex-determination systems and their evolution: Mammals
International Nuclear Information System (INIS)
Colorado Garzon, Fredy A; Matta Camacho, Nubia E; Sanchez, Antonio
2012-01-01
Sex-determination methods are very diverse as they have become an enduring research field, understanding the causes of gonadal development and elucidating the main factors involved in sex-determination of offspring required relating information from far-ranging areas such as cytology, embryology, morphology, molecular biology and even ecology and evolution. This article presents an overview of sex-determination in placental mammals, encompassing several levels of biological organization. The importance of the underlying molecular tools in the context of sex-determination assays and their implications in conservation genetics is also discussed.
Energy Technology Data Exchange (ETDEWEB)
Viguie, J.; Uny, G. [Commissariat a l' Energie Atomique, Centre d' Etudes Nucleaires de Grenoble, 38 (France)
1966-10-01
The method described allows the determination of small deviations from stoichiometry for uranium dioxide. It was applied to the study of surface oxidation of bulk samples. The sample is dissolved in phosphoric acid under an argon atmosphere; U(VI) is determined by polarography in PO{sub 4}H{sub 3} 4.5 N - H{sub 2}SO{sub 4} 4 N. U(IV) is determined by potentiometry. The detection limit is UO{sub 2,0002}. The accuracy for a single determination at the 95% confidence level is {+-}20 per cent for samples with composition included between UO{sub 2,001} and UO{sub 2,01}. (authors) [French] La methode decrite permet de determiner les faibles ecarts a la stoechiometrie du dioxyde d'uranium. Elle a ete appliquee a l'etude de l'oxydation superficielle des echantillons. La mise en solution s'effectue dans l'acide phosphorique concentre sous atmosphere d'argon; U(VI) est dose par polarographie dans le milieu PO{sub 4}H{sub 3} 4,5 N et H{sub 2}SO{sub 4} 4 N; U(IV) est dose par potentiometrie. La limite de detection est UO{sub 2,0002}. La precision obtenue pour une determination au taux de certitude 0,95 est de l'ordre de 20 pour cent pour des echantillons dont la teneur est comprise entre UO{sub 2,001} et UO{sub 2,01}. (auteurs)
44 CFR 206.38 - Presidential determination.
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Presidential determination. 206.38 Section 206.38 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY....38 Presidential determination. (a) The Governor's request for a major disaster declaration may result...
19 CFR 210.42 - Initial determinations.
2010-04-01
... Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION INVESTIGATIONS OF UNFAIR PRACTICES IN IMPORT TRADE ADJUDICATION AND ENFORCEMENT Determinations and Actions Taken § 210.42 Initial determinations. (a... Justice, the Federal Trade Commission, the U.S. Customs Service, and such other departments and agencies...
5 CFR 610.202 - Determining the holiday.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Determining the holiday. 610.202 Section... DUTY Holidays § 610.202 Determining the holiday. For purposes of pay and leave, the day to be treated as a holiday is determined as follows: (a) Except when employees are entitled to a different holiday...
Modern methods for radiostrontium determination
International Nuclear Information System (INIS)
Grahek, Z.; Kosutic, K.; Lulic, S.
1998-01-01
The basic principles of the ion exchange chromatographic determination of radioactive strontium in liquid wastes and natural samples are presented. The sample is inserted into the chromatographic column through the injection system connected to a pump. Strontium is separated by column elution. A flow scintillation beta detector is positioned at the column outlet. Prior to entering the column, strontium is mixed with a scintillator. The apparatus for semi-automatic radiostrontium determination is also described. (M.D.)
The Determinants of Debt Financing
Zhao, Chenkai
2013-01-01
Debt financing is an important part in capital structure. Over the fifty years, most scholars and researchers focus primarily on the balance between debt financing and equity financing. And only few research involve in types of debt financing, as well as the determinant of debt financing. This study is aim to analyse the determinate of debt financing, which examine that the influence by eight different elements. This dissertation examined by quantitative techniques with 591 UK listed comp...
Self-determination and Communism in Czechoslovakia 1921-1936
Directory of Open Access Journals (Sweden)
Igor Jašurek
2005-08-01
Full Text Available The author explores the idea of self-determination among communists trough the considerable period of the existence of Czechoslovakia. Its existence significantly influenced communist views on the concept of self-determination. The author identifies several crucial determinants of the development of the principle of self-determination in the communist environment though he chiefly focuses on its dynamics during internal Party struggles for which self-determination appears to be more salient than elsewhere.
Self-Determination: A Critical Component of Education
Denney, Stephen C.; Daviso, Alfred W.
2012-01-01
Self-Determination is a central concept in special education practice and policy. Research indicates that students who possess specific self-determination skills have better outcomes and enhanced quality of life. Self-determination is a broad term and can be looked at in a variety of ways with differing values of importance. The concept of…
Determination or determinants? A debate based on the Theory on the Social Production of Health
Directory of Open Access Journals (Sweden)
Patrícia Rodrigues da Rocha
2015-02-01
Full Text Available This article aims to discuss the concepts of Social Determination of Health and Social Determinants of Health, by establishing a comparison between each of their guiding perspectives and investigating their implications on the development of health policies and health actions. We propose a historical and conceptual reflection, highlighting the Theory on the Social Production of Health, followed by a debate on the concepts, with a comparative approach among them.
Can body volume be determined by PET?
International Nuclear Information System (INIS)
Hentschel, Michael; Paul, Dominik; Mix, Michael; Moser, Ernst; Brink, Ingo; Korsten-Reck, Ulrike; Mueller, Frank; Merk, Stefan
2005-01-01
To avoid dependence on body weight, the standardised uptake value (SUV) in positron emission tomography (PET) can instead be normalised to the lean body mass (LBM), which can be determined from body volume and mass. This study was designed to answer the following questions: Firstly, can the total body volume in principle be determined using PET? Secondly, is the precision of this measurement comparable to that achieved using an established standard method. Ten patients were examined during oncological whole-body PET examinations. The whole-body volume of the patients was determined from the transmission scan in PET. Air displacement plethysmography with BOD POD was used for comparison as the standard method of volume determination. In all patients, the whole-body volumes could be determined using PET and the standard method. Bland and Altman [23] analysis for agreement between the volumes determined by the two methods (presentation of differences vs means) revealed a very small difference of -0.14 l. With a mean patient volume of 71.81±15.93 l, the relative systematic error is only LBM ). (orig.)
Determination of aluminum by four analytical methods
International Nuclear Information System (INIS)
Hanson, T.J.; Smetana, K.M.
1975-11-01
Four procedures have been developed for determining the aluminum concentration in basic matrices. Atomic Absorption Spectroscopy (AAS) was the routine method of analysis. Citrate was required to complex the aluminum and eliminate matrix effects. AAS was the least accurate of the four methods studied and was adversely affected by high aluminum concentrations. The Fluoride Electrode Method was the most accurate and precise of the four methods. A Gran's Plot determination was used to determine the end point and average standard recovery was 100% +- 2%. The Thermometric Titration Method was the fastest method for determining aluminum and could also determine hydroxide concentration at the same time. Standard recoveries were 100% +- 5%. The pH Electrode Method also measures aluminum and hydroxide content simultaneously, but is less accurate and more time consuming that the thermal titration. Samples were analyzed using all four methods and results were compared to determine the strengths and weaknesses of each. On the basis of these comparisons, conclusions were drawn concerning the application of each method to our laboratory needs
International Nuclear Information System (INIS)
Burr, K.J.
1979-01-01
A specification is given for an apparatus to provide a completely automatic testing cycle to determine the proportion of particles of less than a predetermined size in one of a number of fluid suspensions. Monitoring of the particle concentration during part of the process can be carried out by an x-ray source and detector. (U.K.)
40 CFR 35.2103 - Priority determination.
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Priority determination. 35.2103 Section 35.2103 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GRANTS AND OTHER FEDERAL ASSISTANCE STATE AND LOCAL ASSISTANCE Grants for Construction of Treatment Works § 35.2103 Priority determination...
38 CFR 75.116 - Secretary determination.
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Secretary determination. 75.116 Section 75.116 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED) INFORMATION SECURITY MATTERS Data Breaches § 75.116 Secretary determination. (a) Upon receipt of...
42 CFR 417.838 - Organization determinations.
2010-10-01
... 42 Public Health 3 2010-10-01 2010-10-01 false Organization determinations. 417.838 Section 417... (CONTINUED) MEDICARE PROGRAM HEALTH MAINTENANCE ORGANIZATIONS, COMPETITIVE MEDICAL PLANS, AND HEALTH CARE PREPAYMENT PLANS Health Care Prepayment Plans § 417.838 Organization determinations. (a) Actions that are...
19 CFR 210.18 - Summary determinations.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Summary determinations. 210.18 Section 210.18 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION INVESTIGATIONS OF UNFAIR PRACTICES IN IMPORT TRADE ADJUDICATION AND ENFORCEMENT Motions § 210.18 Summary determinations. (a) Motions for summary...
41 CFR 101-39.102 - Determinations.
2010-07-01
...-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.1-Establishment, Modification, and Discontinuance of Interagency Fleet Management Systems § 101-39.102 Determinations. Each determination to establish a fleet management system... name of the executive agency designated to be responsible for operating the fleet management system and...
Determinants for gallstone formation
DEFF Research Database (Denmark)
Shabanzadeh, Daniel Monsted; Sorensen, Lars Tue; Jørgensen, Torben
2016-01-01
. Gallstone incidence was assessed through repeated ultrasound examinations. Body mass index (BMI), blood pressure, self-rated health, lifestyle variables, blood lipids, and use of female sex hormones were measured at the baseline examination. Statistical analyses included logistic regression. Based...... re-examination were followed-up completely (mean 11.6 years, N = 2848). The overall cumulative incidence of gallstones was 0.60% per year. Independent positive determinants for incident gallstones were age, female sex, non-high density lipoprotein (non-HDL) cholesterol, and gallbladder polyps...... associations were found for blood pressure, smoking, alcohol consumption, HDL cholesterol, or triglycerides in meta-analyses. Conclusions: Age, female sex, BMI, non-HDL cholesterol, and polyps are independent determinants for gallstone formation. Incident gallstones and the metabolic syndrome share common risk...
48 CFR 25.205 - Postaward determinations.
2010-10-01
... negotiate adequate consideration and modify the contract to allow use of the foreign construction material... Act after contract award, the contractor must explain why it could not request the determination before contract award or why the need for such determination otherwise was not reasonably foreseeable. If...
36 CFR 223.220 - Quantity determination.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Quantity determination. 223.220 Section 223.220 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Special Forest Products § 223.220 Quantity determination...
Domination, self-determination and circular organizing
Romme, A.G.L.
2002-01-01
The emergence of self-organizing forms of control, based on the idea of self-determination, have challenged traditional forms of control based on the concept of domination. As such, self-determination has been put forward as an alternative rather than as a complement to domination. This paper
Determination of trace impurities in materials
International Nuclear Information System (INIS)
Parashar, D.C.
1991-01-01
Research work done at the National Physical Laboratory to develop new methods which are more specific and/or more sensitive has been reviewed. These methods are based on the use of existing facilities viz. atomic absorption spectrophotometry, uv-visible spectrophotometry, gas chromatography and conventional chemical methods. It is possible to determine impurities like boron at 5ppb level, phosphorus at 100 ppb and oxygen non-stoichiometry in 1:2:3 compounds with higher accuracy. Boron is determined spectrophotometrically by forming a complex with curcumin and phosphorus is determined indirectly by atomic absorption spectrophotometry by forming phosphomolybdate complex with antimony or bismuth which have 1:1 ratio with phosphorus in the complex. Gas chromatographic technique has been used to evaluate the oxygen non-stoichiometry in high temperature superconductors (1:2:3 compound) where the HTc sample is dissolved in dilute nitric acid in helium environment and the oxygen released is determined using thermal conductivity detector. (author). 19 refs., 3 figs., 4 tabs
DETERMINANT FACTORS OF STUDENTS ENTREPRENEURSHIP INTENTION
Directory of Open Access Journals (Sweden)
Renny Dwijayanti
2018-04-01
Full Text Available The purpose of this study is to determine and analyze the dominant factor as a determinant of the entrepreneurship intent of the students of the Department of Economic Education of the State University of Surabaya.This research uses explanatory research method, the sample used is 166 students from the total population of 286 students with purposiverandom sampling technique. The results showed that locus of control, subjective norms, and entrepreneurial attitudes affect the intention of student entrepreneurship. From the three determining variables of the entrepreneurship intentions, there is one dominant variable as determinant of student entrepreneurship intention, it is locus of control. The locus of control of students related to entrepreneurship is a personal belief in the success gained from the business and learning process. The implication of this research is students need to strengthen the formation ofentrepreneurial mindset to be able to grow their self-confidence on their own potentials.
Social determinants and sexually transmitted disease disparities.
Hogben, Matthew; Leichliter, Jami S
2008-12-01
Social determinants of health play an important role in sexually transmitted disease (STD) transmission and acquisition; consequently, racial and ethnic disparities among social determinants are influences upon disparities in STD rates. In this narrative review, we outline a general model showing the relationship between social determinants and STD outcomes, mediated by epidemiologic context. We then review 4 specific social determinants relevant to STD disparities: segregation, health care, socioeconomics and correctional experiences, followed by 2 facets of the resultant epidemiologic context: core areas and sexual networks. This review shows that disparities exist among the social determinants and that they are related to each other, as well as to core areas, sexual networks, and STD rates. Finally, we discuss the implications of our review for STD prevention and control with particular attention to STD program collaboration and service integration.
Mathematical determination of image quality
Energy Technology Data Exchange (ETDEWEB)
Barrett, H H
1982-01-01
The subjective term ''image quality'' is generally not easy to define and to measure. If, however, we limit ourselves, to determine certain anomalies in blurred images, then the task can be done more easily. The efficiency can in fact be measured and the results can be presented as ROC-characteristics (receiver operating characteristics). One can determine a relation between the characteristic and the noise distance of the imaging system, and this way the efficiency of an hypothetical ideal observer can be predicted. Furthermore one can compute noise distance and other statistical parameters of X-ray images distorted by quantum interference by special techniques that are founded on the so-called ''blur core''. The technique proved to be very successful in nuclear medicine, but is also valid in computerized tomography and X-ray diagnostics. The technique is explained without mathematical details. The question will be answered concerning the role mathematical analysis will play in the determination and optimization of the quality of diagnostic exposures.
Uranium fluorides analysis. Titanium spectrophotometric determination
International Nuclear Information System (INIS)
Anon.
Titanium determination in uranium hexafluoride in the range 0.7 to 100 microgrammes after transformation of uranium fluoride in sulfate. Titanium is separated by extraction with N-benzoylphenylhydroxylamine, reextracted by hydrochloric-hydrofluoric acid. The complex titanium-N-benzoylphenylhydroxylamine is extracted by chloroform. Spectrophotometric determination at 400 nm [fr
14 CFR 157.7 - FAA determinations.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false FAA determinations. 157.7 Section 157.7... NOTICE OF CONSTRUCTION, ALTERATION, ACTIVATION, AND DEACTIVATION OF AIRPORTS § 157.7 FAA determinations. (a) The FAA will conduct an aeronautical study of an airport proposal and, after consultations with...
Directory of Open Access Journals (Sweden)
Kathleen McVay
2012-06-01
Full Text Available The international movement of people as a result of conflict, natural disaster, and famine is increasingly challenging for States. The Refugee Convention and its additional protocols have proven to be inadequate for protecting many people from human rights abuses. Accordingly this paper seeks to ascertain whether self-determination may operate to protect permanent refugee and forced migrant communities. Self-determination is a human right that has attracted considerable controversy. However, its universal applicability and the strength of the right make it an attractive means of limiting the power of a State in respect of refugee and forced migrant communities. Drawing from historical analogy this article concludes that in limited circumstances self-determination may be available for permanent refugee or forced migrant communities.
chemical determination of burnup ratio in nuclear fuels
International Nuclear Information System (INIS)
Guereli, L.
1997-01-01
Measurements of the extent of fission are important to determine the irradiation performance of a nuclear fuel. The energy released per unit mass of uranium (burnup) can be determined from measurement of the percent of heavy atoms that have fissioned during irradiation.The preferred method for this determination is choosing a suitable fission monitor (usually ''1''4''8Nd) and its determination after separation from the fuel matrix. In thermal reactor fuels where the only heavy element in the starting material is uranium, uranium depletion can be used for burnup determination. ''2''3''5U depletion method requires measurement of uranium isotopic ratios of both irradiated and unirradiated fuel. Isotopic ratios can be determined by thermal ionization mass spectrometer following separation of uranium from the fuel matrix. Separation procedures include solvent extraction, ion exchange and anion exchange chromatography. Another fission monitor used is ''1''3''9La determination by HPLC. Because La is monoisotopic (''1''3''9La) in the fuel, it can be determined by chemical analysis techniques
A new automatic analyzer for uranium determination
International Nuclear Information System (INIS)
Xia Buyun; Zhu Yaokun; Wang Bin; Cong Peiyan; Zhang Lan
1992-08-01
An intellectual automatic analyzer for uranium based on the principle of flow injection analysis (FIA) has been developed. It can directly determine the uranium solution in range of 0.02 to 500 mg/L without any pre-process. A chromatographic column with extractant, in which the trace uranium is concentrated and separated, has special ability to enrich uranium, is connected to the manifold of the analyzer. The analyzer is suited for trace uranium determination in varies samples. The 2-(5-bromo-2-pyridylazo)-5-diethyl-aminophenol (Br-PADAP) is used as color reagent. Uranium is determined in aqueous solution by adding cation surfactant, cetyl-pyridinium bromide (PCB). The rate of analysis is 30 to 90 samples per hour. The relative standard deviation of determination is 1% ∼ 2%. The analyzer has been used in factories and laboratory, and the results are satisfied. The determination range can easily be changed by using a multi-function auto-injection valve that changes the injection volume of the sample and channels. So, it could adopt varies FIA operation modes to meet the needs of FIA determination for other substance. The analyzer has universal functions
12 CFR 404.8 - Initial determination.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Initial determination. 404.8 Section 404.8 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES INFORMATION DISCLOSURE Procedures for Disclosure of Records Under the Freedom of Information Act. § 404.8 Initial determination. (a) Authority to...
Structure of catalase determined by MicroED
Nannenga, Brent L; Shi, Dan; Hattne, Johan; Reyes, Francis E; Gonen, Tamir
2014-01-01
MicroED is a recently developed method that uses electron diffraction for structure determination from very small three-dimensional crystals of biological material. Previously we used a series of still diffraction patterns to determine the structure of lysozyme at 2.9 Å resolution with MicroED (Shi et al., 2013). Here we present the structure of bovine liver catalase determined from a single crystal at 3.2 Å resolution by MicroED. The data were collected by continuous rotation of the sample under constant exposure and were processed and refined using standard programs for X-ray crystallography. The ability of MicroED to determine the structure of bovine liver catalase, a protein that has long resisted atomic analysis by traditional electron crystallography, demonstrates the potential of this method for structure determination. DOI: http://dx.doi.org/10.7554/eLife.03600.001 PMID:25303172
Calcium and magnesium determination
International Nuclear Information System (INIS)
Bhattacharya, S.K.
1982-01-01
The roles of calcium and magnesium in human health and disease have been extensively studied. Calcium and magnesium have been determined in biological specimens by atomic absorption spectroscopy using stiochiometric nitrous oxide-acetylene flame
Phosphorus determination by various substoichiometric methods
International Nuclear Information System (INIS)
Shigematsu, Toshio; Kudo, Kiyoshi
1981-01-01
Various substoichiometric methods have been classified from a view point of the substoichiometric separation. Based upon the substoichiometric separation, phosphorus was determined substoichiometrically by a direct method, a method of carrier amount variation and a comparison method for the irradiated sample. The direct method was applied to the determination of phosphorus in orchard leaves (SRM-1571). The analytical value was 0.23 +- 0.01%. Phosphorus in orchard leaves and spinach (SRM-1570) was determined by an ordinary method which devided the sample into equal parts in the method of carrier amount variation. Analytical values of orchard leaves and spinach were 0.22 +- 0.02% and 0.56 +- 0.04%, respectively. Moreover, a new modification of the method of carrier amount variation was studied by the use of various standard samples such as red phosphorus, spinach and orchard leaves. These standard samples were also employed for the determination of phosphorus in orchard leaves and 0.21 +- 0.01% was obtained. All these results are in good agreement with the value reported by NBS. The comparison method was applied to the determination of phosphorus in a semiconductor silicon single crystal. As a result of the correction of 32 P activity induced by the secondary nuclear reaction of 30 Si, 7.9 ppb and 3.1 ppb were obtained for the phosphorus concentrations in the single crystal silicon. (author)
12 CFR 404.15 - Initial determination.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Initial determination. 404.15 Section 404.15 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES INFORMATION DISCLOSURE Access to Records Under the Privacy Act of 1974 § 404.15 Initial determination. (a) Time for processing. The Freedom of...
Potentiometric determination of iodides in urine
International Nuclear Information System (INIS)
Gikolaev, B.A.; Primakova, L.N.; Rakhman'ko, E.M.
1996-01-01
Variants of potentiometric method: determination using a calibrations plot, the Gran method, and the double addition method are considered. The method of double additions of the test solution to the reference one is suggested as the most favorable method of determining iodides in urine under clinical laboratory conditions. Refs. 5, tabs. 2
The value of α-fetoprotein determination in infants and a method of determination by RIA
International Nuclear Information System (INIS)
Roeser, A.
1982-01-01
AFP determinations during pregnancy and for the diagnosis of malignant liver cell carcinomas and teratogenous tumors are usual practice in today's diagnostics. The ready-to-use AFP test kits which are commercially available proved quite easy to handle under practical laboratory conditions and hardly disturbance-prone. However, their users should keep certain error possibilities in mind that are reported in this paper. A small quantity of AFP remains detectable also in the blood of healthy children are older than 2 years. Up to that age, increased concentrations above the later basal value can be normally seen and are mainly age-dependent. Besides the known fields where AFP determination is used, new spheres of indication did not turn up from the investigations on different collectives of patients. However, the determination of AFP levels in children receiving cytostatic treatment showed some interesting aspects. The authors' suggestion to use AFP measurements in the diagnosis of mucoviscidosis were not justified by their results. (orig./MG) [de
Determination of cognitive development: postnonclassical theoretical model
Directory of Open Access Journals (Sweden)
Irina N. Pogozhina
2015-09-01
Full Text Available The aim of this research is to develop a postnonclassical cognitive processes content determination model in which mental processes are considered as open selfdeveloping, self-organizing systems. Three types of systems (dynamic, statistical, developing were analysed and compared on the basis of the description of the external and internal characteristics of causation, types of causal chains (dependent, independent and their interactions, as well as the nature of the relationship between the elements of the system (hard, probabilistic, mixed. Mechanisms of open non-equilibrium nonlinear systems (dissipative and four dissipative structures emergence conditions are described. Determination models of mental and behaviour formation and development that were developed under various theoretical approaches (associationism, behaviorism, gestaltism, psychology of intelligence by Piaget, Vygotsky culture historical approach, activity approach and others are mapped on each other as the models that describe behaviour of the three system types mentioned above. The development models of the mental sphere are shown to be different by the following criteria: 1 allocated determinants amount; 2 presence or absence of the system own activity that results in selecting the model not only external, but also internal determinants; 3 types of causal chains (dependent-independent-blended; 4 types of relationships between the causal chain that ultimately determines the subsequent system determination type as decisive (a tough dynamic pattern or stochastic (statistical regularity. The continuity of postnonclassical, classical and non-classical models of mental development determination are described. The process of gradual refinement, complexity, «absorption» of the mental determination by the latter models is characterized. The human mental can be deemed as the functioning of the open developing non-equilibrium nonlinear system (dissipative. The mental sphere is
20 CFR 418.3605 - What is an initial determination?
2010-04-01
... Subsidies Determinations and the Administrative Review Process § 418.3605 What is an initial determination? Initial determinations are the determinations we make that are subject to administrative and judicial... conclusions. Examples of initial determinations that are subject to administrative and judicial review include...
What Determines Joint Venture Termination?
DEFF Research Database (Denmark)
Nielsen, Bo Bernhard
2012-01-01
Joint venture (JV) research continues to flourish as researchers seek to advance our understanding of why so many JVs fail. Cui and Kumar (this issue) take a contingency approach to explain how and why business relatedness may provide new insights as to what determines JV termination. This commen......Joint venture (JV) research continues to flourish as researchers seek to advance our understanding of why so many JVs fail. Cui and Kumar (this issue) take a contingency approach to explain how and why business relatedness may provide new insights as to what determines JV termination...
Determination of hydrogen in metals and alloys
International Nuclear Information System (INIS)
Sayi, Y.S.; Ramanjaneyulu, P.S.; Ramakumar, K.L.
2008-01-01
Hydrogen will be invariably present in all materials. Its presence in excess is harmful and sometimes calamitous. Hydrogen embrittlement can occur quite readily in most high strength materials, irrespective of their composition or structure. It is therefore essential to maintain low levels of hydrogen. To know the amount of hydrogen present in the materials, it is essential to determine it with high degree of precision and accuracy. It is required to give the uncertainty associated with the measurement to increase the confidence on measurements. Several methodologies are available for the determination of hydrogen. It its isotope, deuterium, also co-exists it becomes all the more difficult to determine these individually. Hot vacuum extraction cum quadrupole mass spectrometry (HVE-QMS) developed in our laboratory to determine hydrogen and deuterium is routinely employed for the determination of hydrogen and deuterium in metals and alloys. The present paper deals in detail about our experiences with HVE-QMS and estimation of uncertainty associated in this methodology. (author)
Sex determination in mythology and history.
Mittwoch, Ursula
2005-02-01
The history of ideas on how the sexes became divided spans at least three thousand years. The biblical account of the origin of Eve, and the opinions of the philosophers of classical Greece, have unexpected bearings on present-day ideas. The scientific study of sex determination can be said to have begun in the 17th century with the discovery of spermatozoa, but the origin and function of the "spermatic animalcules" eluded investigators until 1841. The mammalian egg was discovered in 1827, and in the last quarter of the century fertilization was observed. The view current at that time, that sex determination was under environmental control, gave way to the idea of chromosomal determination in the first quarter of the 20th century. The study of human and other mammalian chromosomes during the third quarter of the century, and the discovery of sex-chromosome abnormalities, emphasized the importance of the Y chromosome for male sex determination. The last quarter of the century witnessed a hunt for the "testis-determining" gene, thought to be responsible for the differentiation of Sertoli cells, and culminating in the isolation of SRY (Sry in the mouse). However, an increasing number of additional genes and growth factors were found to be required for the establishment of male sex. During the same period evidence emerged that male development was accompanied by enhanced growth, both of gonads and whole embryos. An unexpected finding was the demonstration of temperature-dependent sex determination in reptiles. With the advent of the 21st century, it was shown that Sry induces cell proliferation in fetal mouse gonads, and it has been suggested that male sex differentiation in mammals requires a higher metabolic rate. These insights could lead to a better understanding and improved treatment of abnormalities of sexual development.
The determinants of the antibiotic resistance process
Directory of Open Access Journals (Sweden)
Beatriz Espinosa Franco
2009-04-01
Full Text Available Beatriz Espinosa Franco1, Marina Altagracia Martínez2, Martha A Sánchez Rodríguez1, Albert I Wertheimer31Facultad de Estudios Superiores Zaragoza (UNAM, Mexico; 2Universidad Autónoma Metropolitana Unidad Xochimilco, Mexico; 3Temple University, Philadelphia, Pennsylvania, USABackground: The use of antibiotic drugs triggers a complex interaction involving many biological, sociological, and psychological determinants. Resistance to antibiotics is a serious worldwide problem which is increasing and has implications for morbidity, mortality, and health care both in hospitals and in the community.Objectives: To analyze current research on the determinants of antibiotic resistance and comprehensively review the main factors in the process of resistance in order to aid our understanding and assessment of this problem.Methods: We conducted a MedLine search using the key words “determinants”, “antibiotic”, and “antibiotic resistance” to identify publications between 1995 and 2007 on the determinants of antibiotic resistance. Publications that did not address the determinants of antibiotic resistance were excluded.Results: The process and determinants of antibiotic resistance are described, beginning with the development of antibiotics, resistance and the mechanisms of resistance, sociocultural determinants of resistance, the consequences of antibiotic resistance, and alternative measures proposed to combat antibiotic resistance.Conclusions: Analysis of the published literature identified the main determinants of antibiotic resistance as irrational use of antibiotics in humans and animal species, insufficient patient education when antibiotics are prescribed, lack of guidelines for treatment and control of infections, lack of scientific information for physicians on the rational use of antibiotics, and lack of official government policy on the rational use of antibiotics in public and private hospitals.Keywords: antibiotic drug resistance
The determinants of excellent health: different from the determinants of ill-health?
Mackenbach, J. P.; van den Bos, J.; Joung, I. M.; van de Mheen, H.; Stronks, K.
1994-01-01
In the famous definition of the World Health Organization, health is 'a state of complete physical, mental and social well-being, not merely the absence of disease or infirmity'. Until now, the distribution and determinants of the positive end of the health spectrum have not been studied
Determination of phosphorus using derivative neutron activation
International Nuclear Information System (INIS)
Scindia, Y.M.; Nair, A.G.C.; Reddy, A.V.R.; Manohar, S.B.
2002-01-01
For the determination of phosphorus in different matrices, the derivative neutron activation analysis is especially applicable to aqueous samples, since the conventional neutron activation analysis is not useful for the determination of phosphorus. Phosphorus when reacted with ammonium molybdate 4 hydrate and ammonium metavanadate forms molybdo vanado phosphoric acid. This complex is preconcentrated by extracting into methyl isobutyl ketone. The organic phase containing the molybdo vanado phosphoric acid is neutron activated and the phosphorus is determined through the activation product of 52 V. Preparation of this complex, its stoichiometry, application to trace level determination of phosphorus and improved detection limit are discussed. This method was applied for the analysis of industrial effluent samples. (author)
Spectrographic determination of chlorine and fluorine
International Nuclear Information System (INIS)
Contamin, G.
1965-04-01
Experimental conditions have been investigated in order to obtain the highest sensitivity in spectrographic determination of chlorine and fluorine using the Fassel method of excitation in an inert atmosphere. The influence of the nature of the atmosphere, of the discharge conditions and of the matrix material has been investigated. The following results have been established: 1. chlorine determination is definitely possible: a working curve has been drawn between 10 μg and 100 μg, the detection limit being around 5 μg; 2. fluorine determination is not satisfactory: the detection limit is still of the order of 80 μg. The best operating conditions have been defined for both elements. (author) [fr
Spectrofluorimetric determination of cerium by flow injection analysis
International Nuclear Information System (INIS)
Liu Shaorong; Meng Jian; Liu Wenhua
1990-01-01
A spectrofluorimetric method for the determination of cerium (λ ex/em:251/365 nm) in hydrochloric acid solution by flow injection analysis is presented. It has well developed the normal spectrofluorimetric method for determination of cerium and has made: 1, the determination procedure shortened; 2, the determination speed increased to about 180 samples per hour; 3, the determination range widened to 0.05-100.0 ppm CeO 2 , abouot two times as wide as the normal spectrofluorimetric method; and 4, the relative standard deviation lessened (about 0.47% for 0.1 ppm CeO 2 , n = 13)
Energy Technology Data Exchange (ETDEWEB)
Lu, S [Friedrich Schiller University Jena, Jena Germany; Chourey, Karuna [ORNL; REICHE, M [Friedrich Schiller University Jena, Jena Germany; Nietzsche, S [Friedrich Schiller University Jena, Jena Germany; Shah, Manesh B [ORNL; Hettich, Robert {Bob} L [ORNL; Kusel, K [Friedrich Schiller University Jena, Jena Germany
2013-01-01
Metaproteomics combined with total nucleic acid-based methods aided in deciphering the roles of microorganisms in the formation and transformation of iron-rich macroscopic aggregates (iron snow) formed in the redoxcline of an acidic lignite mine lake. Iron snow had high total bacterial 16S rRNA gene copies, with 2 x 109 copies g (dry wt)-1 in the acidic (pH 3.5) central lake basin and 4 x 1010 copies g (dry wt)-1 in the less acidic (pH 5.5) northern lake basin. Active microbial communities in the central basin were dominated by Alphaproteobacteria (36.6%) and Actinobacteria (21.4%), and by Betaproteobacteria (36.2%) in the northern basin. Microbial Fe-cycling appeared to be the dominant metabolism in the schwertmannite-rich iron snow, because cloning and qPCR assigned up to 61% of active bacteria as Fe-cycling bacteria (FeB). Metaproteomics revealed 70 unique proteins from central basin iron snow and 283 unique proteins from 43 genera from northern basin. Protein identification provided a glimpse into in situ processes, such as primary production, motility, metabolism of acidophilic FeB, and survival strategies of neutrophilic FeB. Expression of carboxysome shell proteins and RubisCO indicated active CO2 fixation by Fe(II) oxidizers. Flagellar proteins from heterotrophs indicated their activity to reach and attach surfaces. Gas vesicle proteins related to CO2-fixing Chlorobium suggested that microbes could influence iron snow sinking. We suggest that iron snow formed by autotrophs in the redoxcline acts as a microbial parachute, since it is colonized by motile heterotrophs during sinking which start to dissolve schwertmannite.
Linear determining equations for differential constraints
International Nuclear Information System (INIS)
Kaptsov, O V
1998-01-01
A construction of differential constraints compatible with partial differential equations is considered. Certain linear determining equations with parameters are used to find such differential constraints. They generalize the classical determining equations used in the search for admissible Lie operators. As applications of this approach equations of an ideal incompressible fluid and non-linear heat equations are discussed
40 CFR 2.207 - Class determinations.
2010-07-01
... Confidentiality of Business Information § 2.207 Class determinations. (a) The General Counsel may make and issue a... items of business information; (2) One or more characteristics common to all such items of information... § 2.204(b)(1), § 2.204(d), § 2.205(d), or § 2.206. However, the existence of a class determination...
Haß, Julia; Hartmann, Monika
2018-01-01
The high prevalence of childhood obesity is a major concern in developed and developing countries. An increase in fruit and vegetable (F&V) intake is perceived as one of the numerous strategies to prevent and reduce the risk of adiposity. The purpose of this study was to investigate the relevance of personal and social determinants in explaining children's F&V intake. Written questionnaire data were collected from 702 parent-child pairs that included 3rd and 4th graders (aged 7 to 10) and their parents. Children's F&V intake was recorded over three food records. Hierarchical linear regression models were applied to assess the impact of personal and social determinants on children's F&V intake. Regression models focusing on personal and social determinants revealed that the most promising personal determinants pertained to the knowledge of different types of F&V and preferences for F&V. Moreover, an exclusive focus on social determinants indicated that parental modeling and peer influence had significant and positive relationships with children's F&V intake, whereas verbal directives to eat F&V exhibited a significant and negative relationship. In combination, the following four personal and social determinants were demonstrated to be significant: knowledge of different types of F&V, preferences for F&V and parental modeling, all of which had positive relationships, and verbal directives to eat F&V, which had a negative impact. The results identify important associative determinants of children's F&V intake. These are in part personal and in part social and are shown by our analysis to be of equal and perhaps mutual importance. Therefore, we suggest that interventions aimed at improving children's F&V intake should address children's preferences for F&V, impart knowledge concerning the variety of F&V and encourage parents to act as role models. Copyright © 2017 Elsevier Ltd. All rights reserved.
DETERMINANTS OF CUSTOMER LOYALTY. A THEORETICAL APPROACH
Claudia Bobâlcă
2014-01-01
The purpose of the research is to investigate the determinants of customer loyalty. The research objectives are: (1) to identify the factors that affect customer loyalty; (2) to identify the relations between the determinants of loyalty and loyalty construct. We used an exploratory research based on a documentary study. The main determinants of customer loyalty that are identified and studied in past researchers are: satisfaction, trust, commitment, involvement, perceived risk, switching cost...
Ultramicromethod of immunreactive insulin determination
International Nuclear Information System (INIS)
Tyrkolev, N.
1979-01-01
A radioimmunologic method of immunoreactive insulin (IRI) determination, requiring 0,02 ml biologic fluid for a single determination, is described. The basic method used in this study, is the thoroughly investigated and for many years applied by the author coal dextran method of IRI determination. The reagents, the scheme of practical performance of the test and calculation of the results are described, and an exemplary standard curve presented. A trial of the method was attempted by comparing the results by the standard and the ultramicromethod. The differences were statistically insignificant. The data of the standard curves of these experiments were also statistically processed. Fifty two sera with different insulin levels (9-275μU/ml) were subjected to comparative IRI assay by either method. They were spanned according to their IRI content, with calculations of the differences between the two methods in the different age groups. A diagram of a single glucose leading (n equals 4) by the two methods is presented. The practical identity of the results obtained by the two methods and the advantages of the ultramicromethod are emphasized. (author)
SHORT COMMUNICATION POTENTIOMETRIC DETERMINATION ...
African Journals Online (AJOL)
a
SHORT COMMUNICATION. POTENTIOMETRIC DETERMINATION OF K+ IONS USING A K+-SELECTIVE. ELECTRODE WITH MACROCYCLIC LIQUID MEMBRANE. Cezar Spinu*, Marian Isvoranu, Maria Pleniceanu and Cristian Tigae. Faculty of Chemistry, University of Craiova, A.I. Cuza 13, Craiova, Romania. (Received ...
Determination of main components in lanthanum titanates blend
International Nuclear Information System (INIS)
Sizonenko, T.N.; Timchenko, A.K.
1981-01-01
Conditions for complexonometric determination of lanthanum in the presence of titanium using the disguising of the latter are studied. A method is suggested for lanthanum and titanium determination in a blend of lanthanum titanate which is used to grow monocrystals. Sulfosalicylic acid is chosen as a disguising agent. La has been determined by complexonometric titration using EDTA with xylenol orange in urotropin. The total contents of La and Ti have been determined by titration of EDTA excess with standard solution of zinc sulfate. Ti content has been calculated from the difference between the first two determinations. Reproducibility of Ti and La determination in the blend (n=21) is characterized by the following: at 19.73% La and 57.21% Ti there are (19.72+-0.16)% La and (57.10+-0.22)% Ti, Sr equals 0.0071 and 0.0034, respectively
Determination of manganese content in aqueous solutions
International Nuclear Information System (INIS)
Reeder, S.D.; Smith, J.R.
1977-01-01
The three analytical methods used in the hydrogen-to-manganese cross-section ratio measurement were: volumetric determination of manganese, gravimetric analysis of manganous sulfate; and densimetric determination of manganous sulfate
DEFF Research Database (Denmark)
2010-01-01
An apparatus (100) is described for determining the mass of ions, the apparatus configured to hold a plasma (101 ) having a plasma potential. The apparatus (100) comprises an electrode (102) having a surface extending in a surface plane and an insulator (104) interfacing with the electrode (102......, and a processing unit (108) configured to interpret the detected impact locations in terms of the mass of the impacting ions....
Determination of the noun in Biblical Hebrew
DEFF Research Database (Denmark)
Ehrensvärd, Martin Gustaf
2000-01-01
The article investigates the claim that the definite article in biblical Hebrew can be unrelated to determination. This claim is found in the standard grammars of Joüon/Muraoka and Gesenius/Kautzsch and in an article by James Barr. Barr argues that it is a diachronic feature, the biblical texts...... showing the use of the article in a process of change during the biblical period, so that only in later times it acquires a close connection with determination. The article argues that this interpretation of the use of the article is based on a misunderstanding, and the instances of article use that might...... seem to be unrelated to determination in fact are perfectly related to determination when analysed carefully....
Activity determination of radionuclides for diagnostic and therapy
International Nuclear Information System (INIS)
Kossert, Karsten
2013-01-01
The application of radionuclides plays in medicine an important role and requires reliable activity determination. The PTB provides for this activity normals and determines the activity of the presented sources. The article describes, how activity determinations in the PTB occur, and by which ways this can be used for nuclear medicine. Research and development works in the PTB are just so illuminated as the determination of nuclide data of some isotopes relevant for medicine.
Determination of generator losses and efficiency
Directory of Open Access Journals (Sweden)
Klasnić Ilija
2015-01-01
Full Text Available The paper presents the results of deriving by calculation the local and total losses of the generator as well as efficiency determination of the revitalised hydro-generator unit A4 in HPP 'Djerdap 1'. In order to determine the generator losses and generator efficiency, measurements are performed during the acceptance tests of revitalised aggregate A4 in HPP 'Djerdap 1'.
Cooling-time determination of spent fuel
International Nuclear Information System (INIS)
Hsue, S.T.; Hatcher, C.R.; Kaieda, K.
1979-01-01
Two methods to determine the cooling time using data from high-resolution gamma-ray measurements are discussed; one is useful when the irradiation history information is available, the other when the irradiation history is not available. We have applied both methods and found that the cooling time can be determined to within an average of 3% and 4.1%, respectively
CHANNELS AND DETERMINANTS OF TECHNOLOGY DIFFUSION
Directory of Open Access Journals (Sweden)
Jakub M. Kwiatkowski
2015-09-01
Full Text Available Potential for development of all countries of modern World is highly dependent on the ability to create and absorb technology. The following paper constitutes review of the literature focused on channels and factors that determine speed of this process between countries. The first part of the paper analyses three basic channels of technology diffu-sion: international trade, Foreign Direct Investments and networking. In the second part methology proposed by UNCTAD is utilized in order to systematize determinants of technology diffusion. Examined factors are divided into four groups: related to the nature of technology, seller of technology, buyer of technology and determinants associated with economic policy and society. The analysis allows to draw a number of conclusions and highlights need for further research.
Uranium determination in dental ceramics
International Nuclear Information System (INIS)
Jacobson, I.; Gamboa, I.; Espinosa, G.; Moreno, A.
1984-01-01
There are many reports of high uranium concentration in dental ceramics, so they require to be controlled. The SSNTD is an optional method to determine the uranium concentration. In this work the analysis of several commercial dental ceramics used regularly in Mexico by dentists is presented. The chemical and electrochemical processes are used and the optimal conditions for high sensitivity are determined. CR-39 (allyl diglycol polycarbonate) was used as detector. The preliminary results show some materials with high uranium concentrations. Next step will be the analysis of equivalent dose and the effects in the public health. (author)
Planimetric determination of lung volume
International Nuclear Information System (INIS)
Bieber, M.; Maurer, H.J.
1984-01-01
The total volume of the lungs was determined by digital planimetry in 102 patients with emphysema and 33 normal controls aged between 30 and 79 years. The results were compared with the findings obtained from spirometric measurements. Mean values showed a significant relationship to age, body size and body surface. Planimetrically determined lung volume did not show a linear relationship with age, but increased after 60 years. Beyong 60 years, spirometric findings were lower because of an increase in the number of patients with emphysema. The results have shown that digital planimetry is a useful addition to spirometry. (orig.) [de
Decoherence, determinism and chaos revisited
International Nuclear Information System (INIS)
Noyes, H.P.
1994-01-01
We suggest that the derivation of the free space Maxwell Equations for classical electromagnetism, using a discrete ordered calculus developed by L.H. Kauffman and T. Etter, necessarily pushes the discussion of determinism in natural science down to the level of relativistic quantum mechanics and hence renders the mathematical phenomena studied in deterministic chaos research irrelevant to the question of whether the world investigated by physics is deterministic. We believe that this argument reinforces Suppes' contention that the issue of determinism versus indeterminism should be viewed as a Kantian antinomy incapable of investigation using currently available scientific tools
Decoherence, determinism and chaos revisited
Energy Technology Data Exchange (ETDEWEB)
Noyes, H.P.
1994-11-15
We suggest that the derivation of the free space Maxwell Equations for classical electromagnetism, using a discrete ordered calculus developed by L.H. Kauffman and T. Etter, necessarily pushes the discussion of determinism in natural science down to the level of relativistic quantum mechanics and hence renders the mathematical phenomena studied in deterministic chaos research irrelevant to the question of whether the world investigated by physics is deterministic. We believe that this argument reinforces Suppes` contention that the issue of determinism versus indeterminism should be viewed as a Kantian antinomy incapable of investigation using currently available scientific tools.
A simplified technique for shakedown load determination
International Nuclear Information System (INIS)
Abdalla, H.F.; Younan, M.Y.A.; Megahed, M.M.
2005-01-01
In this paper a simple technique is presented to determine the limit shakedown load of a structure or a component using the finite element method. Through the proposed technique, the limit shakedown load is determined without performing time consuming cyclic loading simulations or iterative elastic techniques. Instead, it is determined by performing only two analyses namely, an elastic analysis and an elastic-plastic analysis. By extracting the results of the two analyses, the limit shakedown load of the structure is determined through the calculation of the residual stresses. The technique is applied and verified using two bench mark shakedown problems namely: the two-bar structure subjected to constant axial force and cyclic thermal loading, and the Bree cylinder subjected to constant internal pressure and cyclic high heat fluxes across its wall. The results of the proposed technique showed very good correlation with the, analytically determined, Bree diagrams of both structures. Moreover, the outcomes of the proposed technique showed very good results in comparison to full cyclic loading elasto-plastic finite element simulations of both structures. (authors)
42 CFR 405.1202 - Expedited determination procedures.
2010-10-01
... Reconsiderations of Provider Service Terminations, and Procedures for Inpatient Hospital Discharges § 405.1202... exercise the right to an expedited determination must submit a request for a determination to the QIO in...
Experimental half-life determination of 176Lu
International Nuclear Information System (INIS)
Kossert, Karsten; Jörg, Gerhard; Gostomski, Christoph Lierse v.
2013-01-01
The half-life of the naturally occurring long-lived rare earth isotope 176 Lu was determined by a combination of highly sophisticated experimental procedures in order to further improve the reliability and the precision of literature data. The amount of lutetium in the samples was determined by inductively coupled plasma optical emission spectrometry (ICP-OES) using a NIST reference standard. The isotopic ratio N( 176 Lu)/N(Lu) in the samples was measured by means of inductively coupled plasma high resolution mass spectrometry (ICP-HRMS). The activity divided by the mass of Lu was determined by applying liquid scintillation (LS) counting. The LS counting efficiency of the beta/gamma emitter 176 Lu was determined with the CIEMAT/NIST efficiency tracing technique with low uncertainty. The influences of colour quenching and background effects are discussed in this paper. The half-life was found to be 3.640(35)×10 10 y. The result is in good agreement with other evaluations and the relative standard uncertainty of 0.95% is among the lowest of previously published data. - Highlights: • The half-life of 176 Lu was determined by ICP-OES, ICP-HRMS and LSC. • The LSC efficiency was determined with the CIEMAT/NIST method. • The half-life was found to be 3.640(35)×10 10 y
Determinants of Dividend Policy: evidence from Portugal
Directory of Open Access Journals (Sweden)
Luís António Gomes Almeida
2015-08-01
Full Text Available Objective – The objective of this article is to identify the determinants of non-financial companies' dividend policy of the Portuguese capital market and contribute to resolve the divergence of determinants of the dividend policy existent in previous studies. Design/methodology/approach – To solve the problematic under study were tested several financial determinants, through the application of the method of multiple linear regressions to the non-financial listed companies on the Euronext Lisbon, between 1997 and 2011. Findings – The results suggest as main indicators for the Portuguese dividend policy the stability, the value of the market, the previous pay-out and the business dimension; which influence positively the amount of dividends distribute through the company. Therefore, the opportunities of growing and investment influence negatively the distribution of dividends. Practical implications –Identify the principal determinants of the dividend policy of the non-financial companies listed on the Portuguese capital markets - Euronext Lisbon and allow sustaining and improving the corporations and investors’ decisions. Originality/value – This study opens up an opportunity to contribute to the understanding of the determinants of dividend policy of the listed corporations in the Lisbon Stock Exchange, aiming permeates greater scientific knowledge in the context of understanding the determinants of dividend puzzle policy and the existing divergences of several previous empirical studies.
Quantitative determination of heavy nitrogen by spectroscopy
International Nuclear Information System (INIS)
Kumazawa, Kikuo
1974-01-01
Explanation is made on the merits of the determination with heavy nitrogen, the principle and apparatus used for the determination, the method of production of discharge tubes, and the application of the method to several special cases. The spectra belonging to the 2nd positive system are used for the analysis of heavy nitrogen by emission spectroscopy. The spectra near 2980 A are used most often. The bandheads utilizable for the determination are 2976.8 for 14 N 2 , 2982.9 for 14 N 15 N, and 2988.6 A for 15 N 2 , respectively. The sample must be sealed in a discharge tube as nitrogen gas, at first. Mixing of impurities lowers the sensitivity of the determination. The gas pressure is adjusted 10 1-6 Torr. The preparation of gaseous nitrogen is made by either the Rittenberg or the Dumas method. When the amount of a given sample is more than 50 mg, and nitrogen is present as ammonium salt, NH 3 is converted to nitrogen by the reaction with sodium hypobromite. When nitrogen is not present as ammonium salt, Dumas' method is adopted. The amount of heavy nitrogen in the aminoacid separated by thin layer chromatography with silica gel was successfully determined by this method. Simultaneous determination of heavy nitrogen and total nitrogen was also possible by this method. (Fukutomi, T.)
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Request to determine when the Government of a FTA... determine when the Government of a FTA country received notice of a scope determination. (a) Pursuant to... writing from the Department the date on which the Government of a FTA country received notice of a scope...
International Nuclear Information System (INIS)
Poletiko, C.
1988-01-01
The research of activation products in the environment is often centered on cobalt-60 or other gamma emitters, since pure beta emitters require time consuming separations to be counted. However, some beta emitters must be checked because they have a build up in the environment, leading to potential hazards. Among these nuclides, there is nickel-63 which is a pure, soft beta emitter (67 keV) with a long half-life (100 years). A chemical separation, providing good results, was developed. Such a separation is based upon nickel carrier addition in the sample than DMG complex formation and isolation; after elimination of solvent. DMG complex is destroyed. Chemical yield is determined by flame atomic absorption measurement and nickel-63 counted by liquid scintillation. The described procedure allows the determination of low-level activities in different samples (soils, effluents, etc.). Detection limits are close to 0.1 Bq per sample
Energy Technology Data Exchange (ETDEWEB)
Frey, A; Hoppe, W
1957-01-01
A laboratory method is reported for the determination of the alcohol yielding capacity of starch-containing distillery raw materials. The starch is inverted with dilute HCl under pressure, after which the material is fermented with yeast at pH 5.4. After distillation, the alcohol is determined pyknometrically. The influence of such factors as amount of yeast was determined experimentally. Analysis of the time curves for the hydrolysis of starch (by paper-chromatographic techniques) in relation to pH showed glucose to be the principal reaction product, with only slight amounts of maltose and higher sugars being formed.
Sonographic gender determination –experience in two private ...
African Journals Online (AJOL)
As a sole indication or an addition to other indications, many women presenting for ultrasonography often demand gender determination. Objective: To determine 1.the proportion of pregnant Nigerian women presenting for ultrasonography who request for gender determination 2. The accuracy of ultrasonography in ...
Spectrophotometric determination of fluoride with alizarin complexone
Energy Technology Data Exchange (ETDEWEB)
Marczenko, Z; Lenarczyk, L [Politechnika Warszawska (Poland)
1976-01-01
The modification of direct spectrophotometric method of fluoride determination by alizarin complexone has been developed. It was shown that the lanthanum alizarin complexone chelate is more convenient than that of cerium (3). The influence of acetone, dioxane and dimethyl sulphoxide in water solution on the increase of sensitivity of the method and the rate of colour reaction has been determined. The optimal pH ranges for the reaction with lanthanum and cerium (3) have been estimated. Some amines having a large molecule are useful for extraction of blue fluoride complex with isobutanol. Dioctylamine was applied in a new extraction spectrophotometric procedure of fluoride determination. Conditions in reagent have been established. Both variants of the method have been applied to the fluoride determination in several chemicals. The obtained results show a good precision and accuracy.
Substrates and method for determining enzymes
Smith, R.E.; Bissell, E.R.
1981-10-13
A method is disclosed for determining the presence of an enzyme in a biological fluid, which includes the steps of contacting the fluid with a synthetic chromogenic substrate, which is an amino acid derivative of 7-amino-4-trifluoromethylcoumarin; incubating the substrate-containing fluid to effect enzymatic hydrolysis; and fluorometrically determining the presence of the free 7-amino-4-trifluoromethylcoumarin chromophore in the hydrolyzate. No Drawings
International Nuclear Information System (INIS)
Stepin, V.V.; Kurbatova, V.I.; Fedorova, N.D.
1980-01-01
Titrimetric and potentiometric methods of vanadium determination in ferrovanadium are developed. The essence of the titrimetric method using phenylanthranilic acid as indicator is in the following. Ferrovanadium weighed amount is dissolved in H 2 SO 4 , vanadium is oxidated by potassium permanganate to V(5) and is titrated by a solution of double salt of sulfuric Fe(2) and ammonium in the presence of indicator. Potentiometric titration is carried out using the same indicator [ru
7 CFR 28.8 - Classification of cotton; determination.
2010-01-01
... Standards Act Administrative and General § 28.8 Classification of cotton; determination. For the purposes of the Act, the classification of any cotton shall be determined by the quality of a sample in accordance... employees will determine all fiber property measurements using High Volume Instruments. The classification...
Social Determinants of Health: Perspective of the ALAMES Social Determinants Working Group
Directory of Open Access Journals (Sweden)
José Carlos Escudero
2008-11-01
Full Text Available Introduction The recent discussion of the social determinants of health, which has been promoted by the WHO as a way to approach global health conditions is neither a new nor a foreign subject for Latin American social medicine or collective health. Indeed, this approach to health derives from the principles of 19th century European social medicine which accepted that the health of the population is a matter of social concern, that social and economic conditions have an important bearing on health and disease, and that these relationships should be subjected to scientific enquiry. (Rosen, 1985:81 The specific socio-historical conditions of Latin America in the 1970’s fostered the development of an innovative, critical, and socially-based based health analysis, which was seen in an evolving theoretical approach with deep social roots. (Cohn, 2003 This analysis calls for scientific work which is committed to changing living and working conditions and to improving the health of the popular classes. (Waitzkin y col. 2001; Iriart y col. 2002. From its beginning, this school of socio-medical thought recognized that collective health has two main areas of research: 1 the distribution and determinants of health and disease and 2 the interpretation, technical knowledge, and specialized practices concerning health, disease, and death. The goal is to understand health and disease as differentiated moments in the human lifecycle, subject to permanent change, and expressing the biological nature of the human body under specific forms of social organization, all this in such a way as to allow discussion of causality and determination. (Breilh y Granda,1982; Laurell, 1982. Latin American social medicine criticized biomedical and conventional epidemiological approaches for isolating health and disease from social context, misinterpreting social processes as biological, conceptualizing health phenomena in individualistic terms, and adopting the methodological
Orbit determination for ISRO satellite missions
Rao, Ch. Sreehari; Sinha, S. K.
Indian Space Research Organisation (ISRO) has been successful in using the in-house developed orbit determination and prediction software for satellite missions of Bhaskara, Rohini and APPLE. Considering the requirements of satellite missions, software packages are developed, tested and their accuracies are assessed. Orbit determination packages developed are SOIP, for low earth orbits of Bhaskara and Rohini missions, ORIGIN and ODPM, for orbits related to all phases of geo-stationary missions and SEGNIP, for drift and geo-stationary orbits. Software is tested and qualified using tracking data of SIGNE-3, D5-B, OTS, SYMPHONIE satellites with the help of software available with CNES, ESA and DFVLR. The results match well with those available from these agencies. These packages have supported orbit determination successfully throughout the mission life for all ISRO satellite missions. Member-Secretary
Spectrophotometric methods for determining noble metals
International Nuclear Information System (INIS)
Gur'eva, R.F.; Savvin, S.B.
2002-01-01
The main trends of the development of spectrophotometric methods for determining noble metals (NMs) including ruthenium are considered. One of these trends is the synthesis and study of new, highly sensitive and selective organic reagents for determining NMs in solutions and solid phase. Another trend is the search for and developing of new methodological approaches (techniques) and color reactions, including those that involve modified and immobilized reagents. The third trend includes the improvement of equipment and automation. It is shown that the present-day spectrophotometry can provide the determination of NMs in samples with concentrations from several to 10 -4 % (photometry and differential photometry) and down to 10 -7 % (test and sorption-spectroscopic methods based on photometry and diffuse-reflectance spectroscopy, including the use of chromaticity functions) [ru
[Mental Health: Concepts, Measures, Determinants].
Doré, Isabelle; Caron, Jean
Objectives This article aims to situate the concept of mental health in a historical perspective. This article presents the most commonly used measurement tools in Canada and elsewhere in the world to assess specific and multiple dimensions of mental health; when available, psychometric properties are discussed. Finally, research findings on quality of life and mental health determinants are presented.Methods A literature review of concepts, measurement and determinants of mental health is presented in this paper. The selection of measurement scales presented is based on the findings of the research reports conducted by the second author, an expert on mental health measures, for Health Canada and Statistics Canada.Results Mental health is more than the absence of mental illness; rather it is a state of complete well-being, which refers to our ability to enjoy life and deal with the challenges we face. Accordingly, mental health and mental illness are not extremes of the same continuum, but distinct yet correlated concepts. The traditional conceptualization suggesting that mental health represents simply the absence of mental illness has been replaced, in the last few decades, by a more holistic characterization, which directly concerns public health. The components of mental health include emotional well-being/quality of life (QOL) and psychological and social well-being. Mental health influences the personal and social functioning of individuals, justifying the importance of intervening upstream to promote mental health. Specific scales are relevant for obtaining a detailed measure of one aspect of well-being in particular (emotional/quality of life, psychological or social well-being); however, to account for the global mental health status, measurement tools that integrate all three forms of well-being (emotional, psychological and social) should be privileged. A diversity of determinants at the individual, social and neighbourhood levels influence quality of
Polycyclic hydrocarbons - occurrence and determination
International Nuclear Information System (INIS)
Drzewicz, P.
2007-01-01
Polycyclic aromatic hydrocarbons (PAHs) are a special group of atmospheric contaminants included in the persistent toxic substances (PTS) and also in the volatile organic compounds (VOC) groups. PAHs are present in the atmosphere and their origin can be due to anthropogenic activities. The main source of emission of PAH is the combustion of fossil fuels. Their specific characteristics, high volatility, mutagenic and carcinogenic power, easily transportable for long distances with the wind, make them important contaminants despite of the fact that they are present at very low concentrations. The report provides a review of main analytical methods applied in the determination of PAH in air. Special attention was devoted to heterocyclic PAH which contain one or more heteroatom (sulphur, oxygen, nitrogen) in the multiple-fused ring. The presence of heterocyclic PAH requires very complex, laborious and long lasting sample separation methods before analysis. In some cases, application of different temperature programs in gas chromatography allows to determine PAH and heterocyclic PAH in gaseous samples without sample pretreatment. Gas chromatography methods for the determination of PAH and heterocyclic PAH in the gas from combustion of light heating oil has been optimized. (author) [pl
Massa, Enrico; Nicolaus, Arnold
2011-04-01
This issue of Metrologia collects papers about the results of an international research project aimed at the determination of the Avogadro constant, NA, by counting the atoms in a silicon crystal highly enriched with the isotope 28Si. Fifty years ago, Egidi [1] thought about realizing an atomic mass standard. In 1965, Bonse and Hart [2] operated the first x-ray interferometer, thus paving the way to the achievement of Egidi's dream, and soon Deslattes et al [3] completed the first counting of the atoms in a natural silicon crystal. The present project, outlined by Zosi [4] in 1983, began in 2004 by combining the experiences and capabilities of the BIPM, INRIM, IRMM, NIST, NPL, NMIA, NMIJ and PTB. The start signal, ratified by a memorandum of understanding, was a contract for the production of a silicon crystal highly enriched with 28Si. The enrichment process was undertaken by the Central Design Bureau of Machine Building in St Petersburg. Subsequently, a polycrystal was grown in the Institute of Chemistry of High-Purity Substances of the Russian Academy of Sciences in Nizhny Novgorod and a 28Si boule was grown and purified by the Leibniz-Institut für Kristallzüchtung in Berlin. Isotope enrichment made it possible to apply isotope dilution mass spectroscopy, to determine the Avogadro constant with unprecedented accuracy, and to fulfil Egidi's dream. To convey Egidi's 'fantasy' into practice, two 28Si kilogram prototypes shaped as quasi-perfect spheres were manufactured by the Australian Centre for Precision Optics; their isotopic composition, molar mass, mass, volume, density and lattice parameter were accurately determined and their surfaces were chemically and physically characterized at the atomic scale. The paper by Andreas et al reviews the work carried out; it collates all the findings and illustrates how Avogadro's constant was obtained. Impurity concentration and gradients in the enriched crystal were measured by infrared spectroscopy and taken into
40 CFR 1065.660 - THC and NMHC determination.
2010-07-01
... 40 Protection of Environment 32 2010-07-01 2010-07-01 false THC and NMHC determination. 1065.660... CONTROLS ENGINE-TESTING PROCEDURES Calculations and Data Requirements § 1065.660 THC and NMHC determination. (a) THC determination and THC/CH 4 initial contamination corrections. (1) If we require you to...
7 CFR 786.106 - Determination of losses incurred.
2010-01-01
... 7 Agriculture 7 2010-01-01 2010-01-01 false Determination of losses incurred. 786.106 Section 786... Determination of losses incurred. (a) Eligible payable losses are calculated on a dairy operation by dairy..., dairy production losses incurred by producers under this part are determined on the established history...
Individual renal plasma flow determination in 2 minutes
International Nuclear Information System (INIS)
Schlegel, J.U.; Hamway, S.A.
1976-01-01
A method is described for determining effective renal plasma flow, using the renal counts 1 to 2 minutes after injection and applying background subtraction as a ratio to the total amount of radioactivity injected intravenously with appropriate correction for kidney depth. It appears that this simple approach for determination of effective renal plasma flow within a matter of 2 minutes is accurate and reliable, and should be useful for a number of applications when it is important to determine total and individual renal plasma flow. The approach is recommended as a screening procedure in lieu of the determination of blood urea nitrogen and serum creatinine, with the additional advantages of gross morphology and determination of individual renal plasma flow in an absolute as well as relative manner
Insect sex determination: it all evolves around transformer.
Verhulst, Eveline C; van de Zande, Louis; Beukeboom, Leo W
2010-08-01
Insects exhibit a variety of sex determining mechanisms including male or female heterogamety and haplodiploidy. The primary signal that starts sex determination is processed by a cascade of genes ending with the conserved switch doublesex that controls sexual differentiation. Transformer is the doublesex splicing regulator and has been found in all examined insects, indicating its ancestral function as a sex-determining gene. Despite this conserved function, the variation in transformer nucleotide sequence, amino acid composition and protein structure can accommodate a multitude of upstream sex determining signals. Transformer regulation of doublesex and its taxonomic distribution indicate that the doublesex-transformer axis is conserved among all insects and that transformer is the key gene around which variation in sex determining mechanisms has evolved.
AGROCLIMATIC DETERMINANTS OF IRRIGATION NEEDS
Directory of Open Access Journals (Sweden)
Leszek Łabędzki
2016-05-01
Full Text Available The paper is a review of the so far used in Poland methods and criteria for assessing the needs of irrigation for planning purposes, the assessment because of the agroclimatic conditions and taking into account the soil water retention. Irrigation needs of the most are determined taking into account crop water deficits. This is the factor that is characterized by a shortage of precipitation in relation to the water requirements of crops. Some methods use only the meteorological parameters that determine the state of the atmosphere-soil-plant system, and some also take into account soil water retention and its availability for plants.
MEANS FOR DETERMINING CENTRIFUGE ALIGNMENT
Smith, W.Q.
1958-08-26
An apparatus is presented for remotely determining the alignment of a centrifuge. The centrifage shaft is provided with a shoulder, upon which two followers ride, one for detecting radial movements, and one upon the shoulder face for determining the axial motion. The followers are attached to separate liquid filled bellows, and a tube connects each bellows to its respective indicating gage at a remote location. Vibrations produced by misalignment of the centrifuge shaft are transmitted to the bellows, and tbence through the tubing to the indicator gage. This apparatus is particularly useful for operation in a hot cell where the materials handled are dangerous to the operating personnel.
Determinants of patient satisfaction: a systematic review.
Batbaatar, Enkhjargal; Dorjdagva, Javkhlanbayar; Luvsannyam, Ariunbat; Savino, Matteo Mario; Amenta, Pietro
2017-03-01
A large number of studies have addressed the detection of patient satisfaction determinants, and the results are still inconclusive. Furthermore, it is known that contradicting evidence exists across patient satisfaction studies. This article is the second part of a two-part series of research with a goal to review a current conceptual framework of patient satisfaction for further operationalisation procedures. The aim of this work was to systematically identify and review evidence regarding determinants of patient satisfaction between 1980 and 2014, and to seek the reasons for contradicting results in relationships between determinants and patient satisfaction in the literature to design a further robust measurement system for patient satisfaction. This systematic review followed the guidelines of the Preferred Reporting Items for Systematic Reviews and Meta-Analysis (PRISMA) statement. The search was conducted in PubMed, CINAHL, and Scopus in October 2014. Studies published in full in peer reviewed journals between January 1980 and August 2014 and in the English language were included. We included 109 articles for the synthesis. We found several number of determinants of patient satisfaction investigated in a wide diversity of studies. However, study results were varied due to no globally accepted formulation of patient satisfaction and measurement system. Health care service quality indicators were the most influential determinants of patient satisfaction across the studies. Among them, health providers' interpersonal care quality was the essential determinant of patient satisfaction. Sociodemographic characteristics were the most varied in the review. The strength and directions of associations with patient satisfaction were found inconsistent. Therefore, person-related characteristics should be considered to be the potential determinants and confounders simultaneously. The selected studies were not able to show all potential characteristics which may have had
Vertebrate sex-determining genes play musical chairs.
Pan, Qiaowei; Anderson, Jennifer; Bertho, Sylvain; Herpin, Amaury; Wilson, Catherine; Postlethwait, John H; Schartl, Manfred; Guiguen, Yann
2016-01-01
Sexual reproduction is one of the most highly conserved processes in evolution. However, the genetic and cellular mechanisms making the decision of whether the undifferentiated gonad of animal embryos develops either towards male or female are manifold and quite diverse. In vertebrates, sex-determining mechanisms range from environmental to simple or complex genetic mechanisms and different mechanisms have evolved repeatedly and independently. In species with simple genetic sex-determination, master sex-determining genes lying on sex chromosomes drive the gonadal differentiation process by switching on a developmental program, which ultimately leads to testicular or ovarian differentiation. So far, very few sex-determining genes have been identified in vertebrates and apart from mammals and birds, these genes are apparently not conserved over a larger number of related orders, families, genera, or even species. To fill this knowledge gap and to better explore genetic sex-determination, we propose a strategy (RAD-Sex) that makes use of next-generation sequencing technology to identify genetic markers that define sex-specific segments of the male or female genome. Copyright © 2016 Académie des sciences. All rights reserved.
Simultaneous Determination of Amlodipine and Valsartan
Mohamed, Nashwah Gadallah
2011-01-01
A spectrophotometric method was developed for simultaneous determination of amlodipine (Aml) and valsartan (Val) without previous separation. In this method amlodipine in methanolic solution was determined using zero order UV spectrophotometry by measuring its absorbency at 360.5 nm without any interference from valsartan. Valsartan spectrum in zero order is totally overlapped with that of amlodipine. First, second and third derivative could not resolve the overlapped peaks. The first derivat...
36 CFR 223.60 - Determining fair market value.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Determining fair market value... Determining fair market value. The objective of Forest Service timber appraisals is to determine fair market value. Fair market value is estimated by such methods as are authorized by the Chief, Forest Service...
19 CFR 148.24 - Determination of dutiable value.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Determination of dutiable value. 148.24 Section... Collection of Duties and Taxes § 148.24 Determination of dutiable value. (a) Principles applied. In determining the dutiable value of articles examined under § 148.23, the Customs inspector shall apply the...
Determinants of food security among cocoa producing households ...
African Journals Online (AJOL)
The study was set out to analyse the determinants of food security among the cocoa producing households in Abia state, Nigeria. The specific objectives are to: determine the food security status of the households and estimate the determinants of food security among the cocoa producing households in the study area.
Some theoretical aspects of hormone receptor determination
International Nuclear Information System (INIS)
Sluiter, W.J.
1981-01-01
Suitable antisera for determination of hormone receptors are not available for the majority of hormone receptors. Therefore, the determination of hormone receptors is mostly performed in terms of binding capacity for the appropriate hormone, using radioactive hormone labels. Some theoretical aspects of such a receptor determination are discussed including the length of incubation (total or unoccupied receptor concentration), single point or multiple point (Scatchard) analysis (regarding the influence of other specific binders), the correction procedure for non-specific binding and the influence of the circulating hormone level. (Auth.)
Determination of polynuclear hydrocarbons
Energy Technology Data Exchange (ETDEWEB)
Lodge, Jr, J P
1963-01-01
At the present time, the method of choice for the determination of polynuclear hydrocarbons appears to be the following, (a) extraction of the benzene-soluble fraction from the gross collected particulate matter, (b) one pass through a chromatographic column of partially deactivated alumina, (c) spectral examination of the fractions and (d) the application of appropriate chemical tests as indicated by the previous step. Using this method, the presence of pyrene, fluoranthene, one of the benzofluorenes, chrysens, benz(a)anthracene, benzo(a)pyrene, benzo(e)pyrene, benzo(k)fluoranthene, anthanthrene, and coronene was demonstrated in the air of numerous American cities, and benzo(a)pyrene was measured at some 130 sites. Invaluable as such accurate determinations may be for research purposes, they are still too costly and time-consuming for routine survey purposes. While studies on the subject are by no means complete, they indicate the validity of piperonal chloride test as a general index of polycyclic hydrocarbons. This procedure is described in this paper. 7 references.
Determinants of translation ambiguity
Degani, Tamar; Prior, Anat; Eddington, Chelsea M.; Arêas da Luz Fontes, Ana B.; Tokowicz, Natasha
2016-01-01
Ambiguity in translation is highly prevalent, and has consequences for second-language learning and for bilingual lexical processing. To better understand this phenomenon, the current study compared the determinants of translation ambiguity across four sets of translation norms from English to Spanish, Dutch, German and Hebrew. The number of translations an English word received was correlated across these different languages, and was also correlated with the number of senses the word has in English, demonstrating that translation ambiguity is partially determined by within-language semantic ambiguity. For semantically-ambiguous English words, the probability of the different translations in Spanish and Hebrew was predicted by the meaning-dominance structure in English, beyond the influence of other lexical and semantic factors, for bilinguals translating from their L1, and translating from their L2. These findings are consistent with models postulating direct access to meaning from L2 words for moderately-proficient bilinguals. PMID:27882188
Self-determination and older people--a concept analysis.
Ekelund, Christina; Dahlin-Ivanoff, Synneve; Eklund, Kajsa
2014-03-01
Self-determination has emerged as an important concept within health care, used to emphasize clients' control and independence as they participate in rehabilitation. To strengthen clients' self-determination is a central aim in occupational therapy. However, there is a lack of a clear definition of self-determination concerning community-dwelling older people. The definition should be flexible in different contexts, such as cultural. To define and clarify the concept of self-determination in relation to community-dwelling frail older people. Walker & Avant's analysis procedure was carried out to identify textual attributes to the concept of self-determination, supplemented by a content analysis of 21 articles that were used to define and further justify the textual attributes. Self-determination was used in diverse contexts for community-dwelling older people, concerning: decision-making in everyday life, professionals' views, health, and legal/ethical rights. Different textual attributes were identified, to propose a conceptual definition of self-determination in relation to community-dwelling frail older people: A process in which a person has control and legal/ethical rights, and has the knowledge and ability to make a decision of his/her own free choice. This concept analysis has contributed to clarifying the concept for the convenience of research with community-dwelling frail older people.
Determination of hydrogen isotope composition in organic compounds
International Nuclear Information System (INIS)
Ordzhonikidze, K.G.; Parulava, L.P.; Vakhaniya, G.V.; Tarielashvili, V.O.
1989-01-01
method for determination of hydrogen isotope composition just in organic compounds using mass-spectrometer of the second class is suggested. The method enables to determine atomic fraction of hydrogen without multiplet separation. The accuracy of determination of deuterium atomic fraction in acetone in 1-99% range was equal to 3-0.2% respectively
20 CFR 725.221 - Determination of dependency; child.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Determination of dependency; child. 725.221... Determination of dependency; child. For the purposes of determining whether a child was dependent upon a... the eligibility of a child who is under a disability as defined in section 223(d) of the Social...
20 CFR 725.220 - Determination of relationship; child.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Determination of relationship; child. 725.220... Determination of relationship; child. For purposes of determining whether an individual may qualify for benefits as the child of a deceased miner, the provisions of § 725.208 shall be applicable. As used in this...
20 CFR 410.360 - Determination of dependency; widow.
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Determination of dependency; widow. 410.360... OF 1969, TITLE IV-BLACK LUNG BENEFITS (1969- ) Relationship and Dependency § 410.360 Determination of dependency; widow. (a) General. An individual who is the miner's widow (see § 410.320) will be determined to...
20 CFR 410.350 - Determination of dependency; wife.
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Determination of dependency; wife. 410.350... OF 1969, TITLE IV-BLACK LUNG BENEFITS (1969- ) Relationship and Dependency § 410.350 Determination of dependency; wife. An individual who is the miner's wife (see § 410.310) will be determined to be dependent...
Recommendations for plutonium colloid size determination
International Nuclear Information System (INIS)
Kosiewicz, S.T.
1984-02-01
This report presents recommendations for plutonium colloid size determination and summarizes a literature review, discussions with other researchers, and comments from equipment manufacturers. Four techniques suitable for plutonium colloid size characterization are filtration and ultrafiltration, gel permeation chromatography, diffusion methods, and high-pressure liquid chromatography (conditionally). Our findings include the following: (1) Filtration and ultrafiltration should be the first methods used for plutonium colloid size determination because they can provide the most rapid results with the least complicated experimental arrangement. (2) After expertise has been obtained with filtering, gel permeation chromatography should be incorporated into the colloid size determination program. (3) Diffusion methods can be used next. (4) High-pressure liquid chromatography will be suitable after appropriate columns are available. A plutonium colloid size characterization program with filtration/ultrafiltration and gel permeation chromatography has been initiated
Kac and new determinants for fractional superconformal algebras
International Nuclear Information System (INIS)
Kakushadze, Z.; Tye, S.H.
1994-01-01
We derive the Kac and new determinant formulas for an arbitrary (integer) level K fractional superconformal algebra using the BRST cohomology techniques developed in conformal field theory. In particular, we reproduce the Kac determinants for the Virasoro (K=1) and superconformal (K=2) algebras. For K≥3 there always exist modules where the Kac determinant factorizes into a product of more fundamental new determinants. Using our results for general K, we sketch the nonunitarity proof for the SU(2) minimal series; as expected, the only unitary models are those already known from the coset construction. We apply the Kac determinant formulas for the spin 4/3 parafermion current algebra (i.e., the K=4 fractional superconformal algebra) to the recently constructed three-dimensional flat Minkowski space-time representation of the spin-4/3 fractional superstring
Promoting Self-Determined Education.
Deci, Edvard L.; Ryan, Richard M.
1994-01-01
A theory of self-determination is presented in which concepts of intrinsic motivation and extrinsic motivation are explicated and the innate psychological needs for competence, autonomy, and relatedness are discussed. A review of laboratory and field studies indicates the importance of social contexts that facilitate satisfaction of these basic…
21 CFR 352.73 - Determination of SPF value.
2010-04-01
... 21 Food and Drugs 5 2010-04-01 2010-04-01 false Determination of SPF value. 352.73 Section 352.73... Procedures § 352.73 Determination of SPF value. (a)(1) The following erythema action spectrum shall be used... used in calculating the SPF. (c) Determination of individual SPF values. A series of UV radiation...
Calculation methods for determining dose equivalent
International Nuclear Information System (INIS)
Endres, G.W.R.; Tanner, J.E.; Scherpelz, R.I.; Hadlock, D.E.
1988-01-01
A series of calculations of neutron fluence as a function of energy in an anthropomorphic phantom was performed to develop a system for determining effective dose equivalent for external radiation sources. critical organ dose equivalents are calculated and effective dose equivalents are determined using ICRP-26 methods. Quality factors based on both present definitions and ICRP-40 definitions are used in the analysis. The results of these calculations are presented and discussed
[Development of free will and determinism scale in Japanese].
Goto, Takayuki; Ishibashi, Yuya; Kajimura, Shogo; Oka, Ryunosuke; Kusumi, Takashi
2015-04-01
We developed a free will and determinism scale in Japanese (FAD-J) to assess lay beliefs in free will, scientific determinism, fatalistic determinism, and unpredictability. In Study 1, we translated a free will and determinism scale (FAD-Plus) into Japanese and verified its reliability and validity. In Study 2, we examined the relationship between the FAD-J and eight other scales. Results suggested that lay beliefs in free will and determinism were related to self-regulation, critical thinking, other-oriented empathy, self-esteem, and regret and maximization in decision makings. We discuss the usefulness of the FAD-J for studying the psychological functions of lay beliefs in free will and determinism.
Mumbardó-Adam, C; Guàrdia-Olmos, J; Giné, C; Raley, S K; Shogren, K A
2018-04-01
A new measure of self-determination, the Self-Determination Inventory: Student Report (Spanish version), has recently been adapted and empirically validated in Spanish language. As it is the first instrument intended to measure self-determination in youth with and without disabilities, there is a need to further explore and strengthen its psychometric analysis based on item response patterns. Through item response theory approach, this study examined item observed distributions across the essential characteristics of self-determination. The results demonstrated satisfactory to excellent item functioning patterns across characteristics, particularly within agentic action domains. Increased variability across items was also found within action-control beliefs dimensions, specifically within the self-realisation subdomain. These findings further support the instrument's psychometric properties and outline future research directions. © 2017 MENCAP and International Association of the Scientific Study of Intellectual and Developmental Disabilities and John Wiley & Sons Ltd.
15 CFR 990.41 - Determination of jurisdiction.
2010-01-01
...) NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE OIL POLLUTION ACT REGULATIONS NATURAL RESOURCE DAMAGE ASSESSMENTS Preassessment Phase § 990.41 Determination of jurisdiction. (a... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Determination of jurisdiction. 990.41...
Immigration as a social determinant of health.
Castañeda, Heide; Holmes, Seth M; Madrigal, Daniel S; Young, Maria-Elena DeTrinidad; Beyeler, Naomi; Quesada, James
2015-03-18
Although immigration and immigrant populations have become increasingly important foci in public health research and practice, a social determinants of health approach has seldom been applied in this area. Global patterns of morbidity and mortality follow inequities rooted in societal, political, and economic conditions produced and reproduced by social structures, policies, and institutions. The lack of dialogue between these two profoundly related phenomena-social determinants of health and immigration-has resulted in missed opportunities for public health research, practice, and policy work. In this article, we discuss primary frameworks used in recent public health literature on the health of immigrant populations, note gaps in this literature, and argue for a broader examination of immigration as both socially determined and a social determinant of health. We discuss priorities for future research and policy to understand more fully and respond appropriately to the health of the populations affected by this global phenomenon.
Scintigraphic And Ultrasonic Determinations of Thyroid Volume
International Nuclear Information System (INIS)
Sarsono; Ismanto; Kunto, W; Hayati, N; Irma, S H
1996-01-01
A study has been done on the determination of thyroid volume by scintigraphic method in comparison to ultrasonographic technique, which involved a healthy woman volunteer, 5 women patients and a man patient with thyroid diseases. Scintigraphic examination upon the patient's thyroid was performed using a gamma camera 20 minutes following the injection of 55.5 Mbq (1.5 mCi) Tc-99m pertechnetate. A computer, with a dedicated program, coupled to the gamma camera was employed in the calculation of thyroid volume based on the scintigraphic data. Subsequent to the scintigraphic study, ultrasonographic determination of thyroid volume was then carried out. Correlation test that was applied to the outcome of the two methods of thyroid volume determination resulted in an excellent coefficient of correlation, R, which was 0.99. This showed a very good correlation between these two different techniques of thyroid volume determination
Power, Ideology, and Technological Determinism
Directory of Open Access Journals (Sweden)
David J. Hess
2015-12-01
Full Text Available A Commentary on Taylor Dotson’s “Technological Determinism and Permissionless Innovation as Technocratic Governing Mentalities: Psychocultural Barriers to the Democratization of Technology”
Dose determination in computed tomography
International Nuclear Information System (INIS)
Descamps, C.; Garrigo, E.; Venencia, D.; Gonzalez, M.; Germanier, A.
2011-10-01
In the last years the methodologies to determine the dose in computed tomography have been revised. In this work was realized a dosimetric study about the exploration protocols used for simulation of radiotherapy treatments. The methodology described in the Report No. 111 of the American Association of Medical Physiques on a computed tomograph of two cuts was applied. A cylindrical phantom of water was used with dimensions: 30 cm of diameter and 50 cm of longitude that simulates the absorption and dispersion conditions of a mature body of size average. The doses were determined with ionization chamber and thermoluminescent dosimetry. The results indicate that the dose information that provides the tomograph underestimates the dose between 32 and 35%.
Feed/meat transfer factor determination
International Nuclear Information System (INIS)
Hoepfner, U.
1981-01-01
The transfer of cesium from the feed to bovine meat is taken as an example to discuss natural environmental conditions and their effects on the determination of the transfer factor. Criteria for estimating the validity of experimentally determined transfer factors are given and used for a critical evaluation of significant literature data. The evaluation presented in this report is not a merely statistical evaluation of transfer data, indicating one single value as the correct one (sometimes within a certain margin), but rather scans the data available for incertainties and drawbacks of the experimental methods applied, finally stating a range of variation within which transfer factors can be considered to be correct. (orig./DG) [de
Wehmeyer, Michael L.; Abery, Brian H.
2013-01-01
Promoting self-determination and choice opportunities for people with intellectual and developmental disabilities has become best practice in the field. This article reviews the research and development activities conducted by the authors over the past several decades and provides a synthesis of the knowledge in the field pertaining to efforts to…
Kehoe, Thomas J.
1977-01-01
The instrumental method for detecting total organic carbon (TOC) in water samples is detailed. The method's limitations are discussed and certain precautions that must be taken are emphasized. The subject of TOC versus COD and BOD is investigated and TOC is determined to be a valid indication of biological demand. (BT)
Testing for intracycle determinism in pseudoperiodic time series.
Coelho, Mara C S; Mendes, Eduardo M A M; Aguirre, Luis A
2008-06-01
A determinism test is proposed based on the well-known method of the surrogate data. Assuming predictability to be a signature of determinism, the proposed method checks for intracycle (e.g., short-term) determinism in the pseudoperiodic time series for which standard methods of surrogate analysis do not apply. The approach presented is composed of two steps. First, the data are preprocessed to reduce the effects of seasonal and trend components. Second, standard tests of surrogate analysis can then be used. The determinism test is applied to simulated and experimental pseudoperiodic time series and the results show the applicability of the proposed test.
Functional Determinants for Radially Separable Partial Differential Operators
Directory of Open Access Journals (Sweden)
G. V. Dunne
2007-01-01
Full Text Available Functional determinants of differential operators play a prominent role in many fields of theoretical and mathematical physics, ranging from condensed matter physics, to atomic, molecular and particle physics. They are, however, difficult to compute reliably in non-trivial cases. In one dimensional problems (i.e. functional determinants of ordinary differential operators, a classic result of Gel’fand and Yaglom greatly simplifies the computation of functional determinants. Here I report some recent progress in extending this approach to higher dimensions (i.e., functional determinants of partial differential operators, with applications in quantum field theory.
Fatigue - determination of a more realistic usage factor
International Nuclear Information System (INIS)
Lang, H.
2001-01-01
The ability to use a suitable counting method for determining the stress range spectrum in elastic and simplified elastic-plastic fatigue analyses is of crucial importance for enabling determination of a realistic usage factor. Determination of elastic-plastic strain range using the K e factor from fictitious elastically calculated loads is also important in the event of elastic behaviour being exceeded. This paper thus examines both points in detail. A fatigue module with additional options, which functions on this basis is presented. The much more realistic determination of usage factor presented here offers various economic benefits depending on the application
19 CFR 207.69 - Publication of determinations.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Publication of determinations. 207.69 Section 207.69 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION NONADJUDICATIVE INVESTIGATIONS... SUBSIDIZED EXPORTS TO THE UNITED STATES Five-Year Reviews § 207.69 Publication of determinations. Whenever...
28 CFR 32.34 - PSOB Office determination.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false PSOB Office determination. 32.34 Section 32.34 Judicial Administration DEPARTMENT OF JUSTICE PUBLIC SAFETY OFFICERS' DEATH, DISABILITY, AND EDUCATIONAL ASSISTANCE BENEFIT CLAIMS Educational Assistance Benefit Claims § 32.34 PSOB Office determination...
28 CFR 94.24 - Determination of award.
2010-07-01
....24 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) CRIME VICTIM SERVICES International Terrorism Victim Expense Reimbursement Program Coverage § 94.24 Determination of award. After review of each... fact and conclusions of law supporting it. A copy of the determination shall be mailed to the claimant...
Determining efficient extraction procedure of phytochemicals from ...
African Journals Online (AJOL)
Determining efficient extraction procedure of phytochemicals from the fruit paste of Ziziphus abyssinica and Tamarindus indica . ... Methodology and results: The methods used included cold and soxhlet extraction using methanol as the solvent and hot extraction using distilled water. To determine the efficiency in which ...
38 CFR 10.33 - Determination of dependency.
2010-07-01
... dependency. 10.33 Section 10.33 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS ADJUSTED COMPENSATION Adjusted Compensation; General § 10.33 Determination of dependency. A determination of the existence of the alleged dependency will be made upon consideration of all facts relating to...
Socio-demographic determinants of malnutrition among primary ...
African Journals Online (AJOL)
Introduction: Several factors including the parental literacy, illness, socioeconomic status, poor sanitation and hygienic practices affect the physical growth of children. The aim of this study was to determine the socio-demographic determinants of malnutrition among primary school aged children in Enugu, Nigeria. Methods: ...
Laboratory Tests for Dispersive Soil Viscosity Determining
Ter-Martirosyan, Z. G.; Ter-Martirosyan, A. Z.; Sobolev, E. S.
2017-11-01
There are several widespread methods for soil viscosity determining now. The standard shear test device and torsion test apparatus are the most commonly used installations to do that. However, the application of them has a number of disadvantages. Therefore, the specialists of Moscow State University of Civil Engineering proposed a new device to determine the disperse soil viscosity on the basis of a stabilometer with the B-type camera (viscosimeter). The paper considers the construction of a viscosimeter and the technique for determining soil viscosity inside this tool as well as some experimental verification results of its work.
The determinants of financial inclusion in Africa
Directory of Open Access Journals (Sweden)
Alexandra Zins
2016-06-01
Full Text Available The objective of this paper is to examine the determinants of financial inclusion in Africa. We use the World Bank's Global Findex database on 37 African countries to perform probit estimations. We find that being a man, richer, more educated and older favor financial inclusion with a higher influence of education and income. Mobile banking is driven by the same determinants than traditional banking. We observe that the determinants of informal finance differ from those of formal finance. Our work therefore contains findings to design policies to foster financial inclusion in African countries.
Determination of actinides using ICP-SFMS
International Nuclear Information System (INIS)
Nygren, Ulrika
2006-01-01
Interest in the determination of the actinides using ICP-MS has steadily increased with the development of systems capable of more sensitive and precise measurements. However, the analysis of less abundant actinides such as Pu and Am is not straightforward due to the need for chemical separation of these elements prior to determination. In many applications of mass-spectrometric actinide analysis, isotope ratio measurements are important, either for the analysis of the isotopic composition of, e.g., U or Pu in the sample, or for quantitative determinations using isotope dilution mass spectrometry. In order to achieve high precision and accuracy in an isotope ratio measurement, corrections for instrumentally induced systematic errors, e.g., due to dead-time and mass bias, need to be considered. In this thesis, different aspects of actinide analysis using ICP-SFMS have been addressed. In Papers I and III, separation procedures based on solid phase extraction for Pu, Am and U were developed and evaluated with respect to chemical yield and separation from elements causing spectral interferences. Applications of the analytical procedures developed comprised measurement of the 240 Pu/ 2 3 9Pu ratio in environmental reference materials, and age determination of Pu based on the 241 Pu/ 241 Am and 240 Pu/ 236 U ratios. In the application of different separation procedures for Pu, previously unidentified spectral interferences were discovered. In Paper II, these interferences were identified as lanthanide phosphate ions and the composition and formation of these species with respect to different instrumental parameters were further examined. Due to the importance of precise and accurate isotope ratio determination, a thorough investigation of the instrumental dead time of an ICP-SFMS system was performed. The dead time was evaluated via both isotope ratio and electronic measurements of the output from the detector amplifier. It was found that the overall uncertainty in ratio
Protein energy landscapes determined by five-dimensional crystallography
International Nuclear Information System (INIS)
Schmidt, Marius; Srajer, Vukica; Henning, Robert; Ihee, Hyotcherl; Purwar, Namrta; Tenboer, Jason; Tripathi, Shailesh
2013-01-01
Barriers of activation within the photocycle of a photoactive protein were extracted from comprehensive time courses of time resolved crystallographic data collected at multiple temperature settings. Free-energy landscapes decisively determine the progress of enzymatically catalyzed reactions [Cornish-Bowden (2012 ▶), Fundamentals of Enzyme Kinetics, 4th ed.]. Time-resolved macromolecular crystallography unifies transient-state kinetics with structure determination [Moffat (2001 ▶), Chem. Rev.101, 1569–1581; Schmidt et al. (2005 ▶), Methods Mol. Biol.305, 115–154; Schmidt (2008 ▶), Ultrashort Laser Pulses in Medicine and Biology] because both can be determined from the same set of X-ray data. Here, it is demonstrated how barriers of activation can be determined solely from five-dimensional crystallography, where in addition to space and time, temperature is a variable as well [Schmidt et al. (2010 ▶), Acta Cryst. A66, 198–206]. Directly linking molecular structures with barriers of activation between them allows insight into the structural nature of the barrier to be gained. Comprehensive time series of crystallographic data at 14 different temperature settings were analyzed and the entropy and enthalpy contributions to the barriers of activation were determined. One hundred years after the discovery of X-ray scattering, these results advance X-ray structure determination to a new frontier: the determination of energy landscapes
[Monitoring social determinants of health].
Espelt, Albert; Continente, Xavier; Domingo-Salvany, Antonia; Domínguez-Berjón, M Felicitas; Fernández-Villa, Tania; Monge, Susana; Ruiz-Cantero, M Teresa; Perez, Glòria; Borrell, Carme
2016-11-01
Public health surveillance is the systematic and continuous collection, analysis, dissemination and interpretation of health-related data for planning, implementation and evaluation of public health initiatives. Apart from the health system, social determinants of health include the circumstances in which people are born, grow up, live, work and age, and they go a long way to explaining health inequalities. A surveillance system of the social determinants of health requires a comprehensive and social overview of health. This paper analyses the importance of monitoring social determinants of health and health inequalities, and describes some relevant aspects concerning the implementation of surveillance during the data collection, compilation and analysis phases, as well as dissemination of information and evaluation of the surveillance system. It is important to have indicators from sources designed for this purpose, such as continuous records or periodic surveys, explicitly describing its limitations and strengths. The results should be published periodically in a communicative format that both enhances the public's ability to understand the problems that affect them, whilst at the same time empowering the population, with the ultimate goal of guiding health-related initiatives at different levels of intervention. Copyright © 2016 SESPAS. Publicado por Elsevier España, S.L.U. All rights reserved.
Determination of alpha radionuclides in fish
International Nuclear Information System (INIS)
Pernicka, L.; Matel, L.; Rosskopfova, O.
2001-01-01
In atmospheric water, external water and undercurrent the occurrence of radionuclides is usual. It is an important factor of quality of the environment. Plants ingest radionuclides from water and with they everyone. And it arises radioactivity infest food-chain. Radiotoxicity of this radionuclides is very deer sometimes. The sensitive radiochemical procedures for their determination are necessarily important. The poster presents the combined procedure used at our laboratory for determination of alpha radionuclides in biological samples. (authors)
Strange sea determination from collider data
Alekhin, S.; Blümlein, J.; Moch, S.
2018-02-01
We consider determinations of the strange sea in the nucleon based on QCD analyses of data collected at the LHC with focus on the recent high-statistics ATLAS measurement of the W±- and Z-boson production. We study the effect of different functional forms for parameterization of the parton distribution functions and the combination of various data sets in the analysis. We compare to earlier strange sea determinations and discuss ways to improve them in the future.
Strange sea determination from collider data
International Nuclear Information System (INIS)
Alekhin, S.; Bluemlein, J.; Moch, S.
2017-08-01
We consider determinations of the strange sea in the nucleon based on QCD analyses of data collected at the LHC with focus on the recent high-statistics ATLAS measurement of the W ± - and Z-boson production. We study the effect of different functional forms for parameterization of the parton distribution functions and the combination of various data sets in the analysis. We compare to earlier strange sea determinations and discuss ways to improve them in the future.
Strange sea determination from collider data
Energy Technology Data Exchange (ETDEWEB)
Alekhin, S. [Hamburg Univ. (Germany). 2. Inst. fuer Theoretische Physik; Institut Fiziki Vysokikh Ehnergij, Protvino (Russian Federation); Bluemlein, J. [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany); Moch, S. [Hamburg Univ. (Germany). 2. Inst. fuer Theoretische Physik
2017-08-15
We consider determinations of the strange sea in the nucleon based on QCD analyses of data collected at the LHC with focus on the recent high-statistics ATLAS measurement of the W{sup ±}- and Z-boson production. We study the effect of different functional forms for parameterization of the parton distribution functions and the combination of various data sets in the analysis. We compare to earlier strange sea determinations and discuss ways to improve them in the future.
Trace elements determination in human hair
International Nuclear Information System (INIS)
Carrion, Jose
1995-01-01
Concentrations of Cu, Zn, Pb, Mg, Ca, Na, K, Mn, Cr, Ni, Co, V, Cd and Al, in human hair sampled from 23 young men during 24 months were determined by atomic absorption spectroscopy. Additional determination of mercury and volatile elements were made by using accessory MHS-10. Statistical treatment of data is presented for each person and element. The pre-treatment of hair carried out with an organic solvent to remove the superficial pollutants is explained. (The author)
Complexometric determination of scandium and aluminium
International Nuclear Information System (INIS)
Tikhonov, V.N.
1980-01-01
Described is the complexometric determination of scandium and aluminium by the method of reverse titration of EDTA excess by indium salt solution in the presence of the xylenol orange indicator. For the method selectivity increase fluorides are used as a camouflage substance at low pH values (2.5-3.0). The excess fluoride-ions preventing titration are bound by boric acid. Y, Tb, Ti, Zr, Cu, Zn, V, Mo, Co, Cr prevent the determination of Sc and Al
Determination of the LEP beam energy
Torrence, E
2000-01-01
This article describes the determination of the LEP beam energy above the production threshold for W boson pairs. A brief overview of the magnetic extrapolation method is presented which is currently used to determine the LEP beam energy to a relative precision of 2*10/sup -4 /. A new method for beam energy measurements based on an in-line energy spectrometer is presented, and current developments in the commissioning of this device are outlined. (2 refs).
Epigenetic Determinism in Science and Society.
Waggoner, Miranda R; Uller, Tobias
2015-04-03
The epigenetic "revolution" in science cuts across many disciplines, and it is now one of the fastest growing research areas in biology. Increasingly, claims are made that epigenetics research represents a move away from the genetic determinism that has been prominent both in biological research and in understandings of the impact of biology on society. We discuss to what extent an epigenetic framework actually supports these claims. We show that, in contrast to the received view, epigenetics research is often couched in language as deterministic as genetics research in both science and the popular press. We engage the rapidly emerging conversation about the impact of epigenetics on public discourse and scientific practice, and we contend that the notion of epigenetic determinism - or the belief that epigenetic mechanisms determine the expression of human traits and behaviors - matters for understandings of the influence of biology and society on population health.
Critical flux determination by flux-stepping
DEFF Research Database (Denmark)
Beier, Søren; Jonsson, Gunnar Eigil
2010-01-01
In membrane filtration related scientific literature, often step-by-step determined critical fluxes are reported. Using a dynamic microfiltration device, it is shown that critical fluxes determined from two different flux-stepping methods are dependent upon operational parameters such as step...... length, step height, and.flux start level. Filtrating 8 kg/m(3) yeast cell suspensions by a vibrating 0.45 x 10(-6) m pore size microfiltration hollow fiber module, critical fluxes from 5.6 x 10(-6) to 1.2 x 10(-5) m/s have been measured using various step lengths from 300 to 1200 seconds. Thus......, such values are more or less useless in itself as critical flux predictors, and constant flux verification experiments have to be conducted to check if the determined critical fluxes call predict sustainable flux regimes. However, it is shown that using the step-by-step predicted critical fluxes as start...
Müller-Matthesius, R
1975-05-01
The sensitivity of enzyme kinetic substrate determinations can be improved with the aid of competitive inhibitors. As an example, the determination of glucose dehydrogenase in the presence of potassium thiocyanate is described. The method has the advantage of rapid operation with satisfactory precision.
Amyloidogenic determinants are usually not buried
Directory of Open Access Journals (Sweden)
Karletidi Carolina-Maria
2009-07-01
Full Text Available Abstract Background Amyloidoses are a group of usually fatal diseases, probably caused by protein misfolding and subsequent aggregation into amyloid fibrillar deposits. The mechanisms involved in amyloid fibril formation are largely unknown and are the subject of current, intensive research. In an attempt to identify possible amyloidogenic regions in proteins for further experimental investigation, we have developed and present here a publicly available online tool that utilizes five different and independently published methods, to form a consensus prediction of amyloidogenic regions in proteins, using only protein primary structure data. Results It appears that the consensus prediction tool is slightly more objective than individual prediction methods alone and suggests several previously not identified amino acid stretches as potential amyloidogenic determinants, which (although several of them may be overpredictions require further experimental studies. The tool is available at: http://biophysics.biol.uoa.gr/AMYLPRED. Utilizing molecular graphics programs, like O and PyMOL, as well as the algorithm DSSP, it was found that nearly all experimentally verified amyloidogenic determinants (short peptide stretches favouring aggregation and subsequent amyloid formation, and several predicted, with the aid of the tool AMYLPRED, but not experimentally verified amyloidogenic determinants, are located on the surface of the relevant amyloidogenic proteins. This finding may be important in efforts directed towards inhibiting amyloid fibril formation. Conclusion The most significant result of this work is the observation that virtually all, to date, experimentally determined amyloidogenic determinants and the majority of predicted, but not yet experimentally verified short amyloidogenic stretches, lie 'exposed' on the surface of the relevant amyloidogenic proteins, and also several of them have the ability to act as conformational 'switches'. Experiments
Athlete burnout in elite sport: a self-determination perspective.
Lonsdale, Chris; Hodge, Ken; Rose, Elaine
2009-06-01
Using self-determination theory (Deci & Ryan, 1985) as the theoretical framework, we examined potential antecedents of athlete burnout in 201 elite Canadian athletes (121 females, 80 males; mean age 22.9 years). Employing a cross-sectional design, our primary aims were to investigate the relationships between behavioural regulations and athlete burnout and to examine whether self-determined motivation mediated relationships between basic needs satisfaction and athlete burnout. Our self-determination theory-derived hypotheses were largely supported. Relationships among athlete burnout and behavioural regulations mostly varied according to their rank on the self-determination continuum, with less self-determined motives showing positive associations and more self-determined motives showing negative correlations with burnout. The basic needs of competence and autonomy, plus self-determined motivation, accounted for significant amounts of variance in athlete burnout symptoms (exhaustion, R(2) = 0.31; devaluation, R(2) = 0.49; reduced accomplishment, R(2) = 0.61; global burnout, R(2) = 0.74). Self-determined motivation fully mediated the relationships that competence and autonomy had with exhaustion. Analyses showed indirect relationships between these two needs and devaluation, through their associations with self-determined motivation. Motivation partially mediated the needs-reduced sense of accomplishment relationships, but the direct effects were more prominent than the indirect effects.
Prevalence and determinants of cigarette smoking among ...
African Journals Online (AJOL)
Tobacco smoking is a major risk factor for non-communicable diseases such as ischaemic heart disease, stroke, chronic obstructive airways disease and several cancers. There is little data about the prevalence and determinants of smoking among adolescents in southern Africa. This study aimed to determine the ...
Using Mobile Learning: Determinates Impacting Behavioral Intention
Lowenthal, Jeffrey N.
2010-01-01
This study examined the factors or determinates that impact the behavioral intention of students to use mobile learning (m-learning) technology. These determinates include performance expectancy, effort expectancy, and self-management of learning, all mediated by age, gender, or both. Regression coefficients showed strong and significant…
Monte Carlo determination of heteroepitaxial misfit structures
DEFF Research Database (Denmark)
Baker, J.; Lindgård, Per-Anker
1996-01-01
We use Monte Carlo simulations to determine the structure of KBr overlayers on a NaCl(001) substrate, a system with large (17%) heteroepitaxial misfit. The equilibrium relaxation structure is determined for films of 2-6 ML, for which extensive helium-atom scattering data exist for comparison...
Spectrophotometric Methods for the Determination of Ketoconazole ...
African Journals Online (AJOL)
Spectrophotometric Methods for the Determination of Ketoconazole in Pharmaceutical Dosage Forms. ... Tropical Journal of Pharmaceutical Research ... Methods: The first method (A) was based on the oxidation of the studied drug by a known excess of cerium (IV) as an oxidizing agent and subsequent determination of ...
18 CFR 284.503 - Market-power determination.
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Market-power determination. 284.503 Section 284.503 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY... RELATED AUTHORITIES Applications for Market-Based Rates for Storage § 284.503 Market-power determination...
42 CFR 417.406 - Application and determination.
2010-10-01
... 42 Public Health 3 2010-10-01 2010-10-01 false Application and determination. 417.406 Section 417.406 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES... PREPAYMENT PLANS Qualifying Conditions for Medicare Contracts § 417.406 Application and determination. (a...
Facile Colorimetric Determination of Duloxetine in Formulations ...
African Journals Online (AJOL)
... the determination of duloxetine hydrochloride (DX). Methods: Ion-pair spectrophotometric method was employed for the determination of duloxetine hydrochloride (DX) in bulk and pharmaceutical formulations using acidic dye methyl orange (MO) as ion-pairing agent at pH 4 (phthalate buffer). The yellow ion-pair complex ...
49 CFR 37.153 - FTA waiver determination.
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false FTA waiver determination. 37.153 Section 37.153 Transportation Office of the Secretary of Transportation TRANSPORTATION SERVICES FOR INDIVIDUALS WITH DISABILITIES (ADA) Paratransit as a Complement to Fixed Route Service § 37.153 FTA waiver determination. (a...
7 CFR 400.117 - Determination of delinquency.
2010-01-01
... 7 Agriculture 6 2010-01-01 2010-01-01 false Determination of delinquency. 400.117 Section 400.117 Agriculture Regulations of the Department of Agriculture (Continued) FEDERAL CROP INSURANCE CORPORATION... Succeeding Crop Years § 400.117 Determination of delinquency. Prior to disclosing information about a debt to...
Determining the specific electric resistance of rock
Energy Technology Data Exchange (ETDEWEB)
Persad' ko, V.Ia.
1982-01-01
Data are presented on perfecting the method of laboratory determination of the specific electric resistance of a rock formation. The average error in determining the specific electric resistance of the core at various locations is no more than two percent with low resistance values (2-5 ohms).
42 CFR 436.510 - Determination of dependency.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Determination of dependency. 436.510 Section 436.510 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Requirements for Medicaid Eligibility Dependency § 436.510 Determination of dependency. For families with...
Dietary Determinants of Prostate Cancer
National Research Council Canada - National Science Library
Chu, Lisa W
2005-01-01
.... Epidemiologic studies suggest that dietary factors may be important in the etiology of PCa. The objective of our research is to determine how nutritional compounds genistein, betasitosterol (STT...
Determination of the Priority Aspect in Process of Determining Urban Residential Area
Bhekti Pribadi, Cherie; Hariyanto, Teguh
2017-12-01
Recently, the population growth is increasingly crowded in urban area and as a source of land supply for housing development into the needs of each individual becomes increasingly limited. the home is one of the basic rights of the people and therefore every citizen has the right to reside and got a good environment and healthy. Besides the house is also a basic human need to enhance the dignity, the dignity, quality of life and livelihood, as well as personal self-reflection in order to improve the standard of living, as well as the formation of character, character and personality of the nation. The construction of such housing should always take into consideration many aspects in order to create a balanced environment not only based on the suitability of land but also based on the aspects that exist in surrounding. Therefore, this study will be to analyze the priority aspect in process of determining urban residential area using Analytical Hierarchy Process Method. This method aims to determine priority aspect were used based on primary data collection form of questionnaires and interviews to respondents who expert in the field.
Social determinants or social determination of health? Two paradigms in conflict
Directory of Open Access Journals (Sweden)
Silvia Támez González
2015-01-01
Full Text Available The article discusses the recent Ebola epidemic, declared by the World Health Organization as “a Public Health Emergency of international concern”. From the unicausal explanation and biologicist point of view of the health-disease, epidemic would be explained by characteristics that determine the high pathogenicity of the virus; however, before this statement arises the question: why the epidemic originates in the poorest and/or most unequal and inequitable countries in Africa? For this reason, the main features of the theory of social determination of the health-disease process are shown, afterwards the last outbreak of Ebola is analysed and its appearance is explained as caused by the capitalist and neoliberal model that by means of private enterprise and its invasion of the territory of the poorest countries in the African continent, has displaced the native population to ecosystem uninhabited by humans where the transmitter vector has lived for years. A reection on the unfavourable conditions of the African population is performed (sanitary systems dismantled by structural reforms that do not allow priority assistance to those infected. It is concluded that both the current outbreak as previous ones, have as fundamental cause, the uncontrolled exploitation of natural resources of the region, which thoroughly accelerates poverty levels, the asymmetric distribution of property and power, giving rise to the occurrence of forms of oppression that deepen social inequality.
What Determines Lean Manufacturing Implementation? A CB-SEM Model
Directory of Open Access Journals (Sweden)
Tan Ching Ng
2018-02-01
Full Text Available This research aims to ascertain the determinants of effective Lean Manufacturing (LM. In this research, Covariance-based Structural Equation Modeling (CB-SEM analysis will be used in order to analyze the determinants. Through CB-SEM analysis, the significant key determinants can be determined and the direct relationships among determinants can be analyzed. Thus, the findings of this research can act as guidelines for achievement of LM effectiveness, not only providing necessary steps for successful implementation of lean, but also helping lean companies to achieve higher level of lean cost and time savings.
Determination of uranium in liquid samples
International Nuclear Information System (INIS)
Macefat, Martina R.; Grahek, Zeljko; Ivsic, Astrid G.
2008-01-01
Full text: Uranium is a natural occurring radionuclide and the first member of natural radioactive chains which makes its determination in natural materials interesting from geochemical and radioecological aspect. It can be quantitatively determined as element and/or its radioisotopes by different spectrometric methods (ICP-MS, spectrophotometry, alpha spectrometry). It is necessary to develop inexpensive, rapid and sensitive methods for the routine analysis. Therefore, in this paper, development of a new method for the isolation of uranium from liquid samples and subsequent determination by spectrophotometry and ICP-MS will be described. It is possible to isolate uranium from drinking and seawater using extraction chromatography or mixed solvent ion exchange. Uranium can be strongly bound on the TRU extraction chromatographic resin from nitric acid (chemical recovery is 100%) and can be separated from other interfering elements, while separation from thorium, which can be also strongly bound on this resin, is possible with hydrochloric acid. It is also possible to separate uranium from thorium on the anion exchanger Amberlite CG-400 (NO 3 - form) because uranium is much more weakly bound on this exchanger from alcoholic solutions of nitric acid. After the separation uranium is determined by ICP-MS and by spectrophotometric method with arsenazo III (λ max =652 nm). Developed method enables selection of the optimal mode of isolation for the given purposes. (author)
Vakili Azghandi, Masoume; Nasiri, Mohammadreza; Shamsa, Ali; Jalali, Mohsen; Shariati, Mohammad Mahdi
2016-04-01
The SRY gene (SRY) provides instructions for making a transcription factor called the sex-determining region Y protein. The sex-determining region Y protein causes a fetus to develop as a male. In this study, SRY of 15 spices included of human, chimpanzee, dog, pig, rat, cattle, buffalo, goat, sheep, horse, zebra, frog, urial, dolphin and killer whale were used for determine of bioinformatic differences. Nucleotide sequences of SRY were retrieved from the NCBI databank. Bioinformatic analysis of SRY is done by CLC Main Workbench version 5.5 and ClustalW (http:/www.ebi.ac.uk/clustalw/) and MEGA6 softwares. The multiple sequence alignment results indicated that SRY protein sequences from Orcinus orca (killer whale) and Tursiopsaduncus (dolphin) have least genetic distance of 0.33 in these 15 species and are 99.67% identical at the amino acid level. Homosapiens and Pantroglodytes (chimpanzee) have the next lowest genetic distance of 1.35 and are 98.65% identical at the amino acid level. These findings indicate that the SRY proteins are conserved in the 15 species, and their evolutionary relationships are similar.
40 CFR 35.925-3 - Priority determination.
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Priority determination. 35.925-3 Section 35.925-3 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GRANTS AND OTHER FEDERAL... Priority determination. That such works are entitled to priority in accordance with § 35.915, and that the...
Wear determination in braking systems by radioisotopes
International Nuclear Information System (INIS)
Spruch, W.
1979-01-01
Friction and wear behaviour of friction couples has been tested applying loads and sliding speeds. The determination was carried out by direct measurements of the lining material and by surface activation of the opposite material with protons. The application limits of several braking materials could be determined and compared
42 CFR 435.510 - Determination of dependency.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Determination of dependency. 435.510 Section 435... ISLANDS, AND AMERICAN SAMOA Categorical Requirements for Eligibility Dependency § 435.510 Determination of dependency. For families with dependent children who are not receiving AFDC, the agency must use the...
Radiochemical determination of methylmercury in fish
International Nuclear Information System (INIS)
Stary, J.; Prasilova, J.; Kratzer, K.
1978-01-01
A selective and sensitive method for the determination of methylmercury has been developed. This method is based on the extraction of methylmercury chloride into benzene and on the subsequent exchange reaction with potassium iodide-131 solution. The previously developed method has been adapted for the analysis of fish. The content of methylmercury in frozen cod (Tenegra chalcograma), frozen marena (Coregonus lavaretus) and in fresh carp (Cyprinus carpio) has been compared with the total content of mercury determined by cold vapor spectrometry. (T.I.)
Determination of digoxin by enzyme immunoassay and radioimmunoassay
International Nuclear Information System (INIS)
Mueller, H.; Braeuer, H.; Foerster, G.; Reinhardt, M.
1978-01-01
The results of parallel determinations of digoxin in the sera of non selected patients (n=104) by enzyme immunoassay (EMIT.EIA) and radioimmunoassay (J-125 labeled RIA) were compared with each other. The determinations revealed considerably different concentrations; the values determined by EIA were statistical lower (for EIA 1,09+'0,99ng/ml, for RIA 1,34+'1,01ng/ml, p [de
Directory of Open Access Journals (Sweden)
Timurkhan S. Aleroev
2013-12-01
Full Text Available We consider a linear heat equation involving a fractional derivative in time, with a nonlocal boundary condition. We determine a source term independent of the space variable, and the temperature distribution for a problem with an over-determining condition of integral type. We prove the existence and uniqueness of the solution, and its continuous dependence on the data.
Determination of turbine relative efficiency in SHPP
Directory of Open Access Journals (Sweden)
Džepčeski Dane
2017-01-01
Full Text Available To assess the fulfillment of contract conditions for the equipment delivery, determining the properties and capabilities of a generating unit or some part of it, the measurements carried out under real operating conditions were necessary. In this paper, the results of the test that was carried out in a small hydropower plant (SHPP, aimed at determining the relative efficiency of the hydraulic turbine and its comparison with the guaranteed values, are presented. The dependence of the turbine efficiency on the turbine discharge was determined based on the test results, using the index method. The test was performed at one net head.
Determination of carcinogenic polycyclic aromatic hydrocarbons in ...
African Journals Online (AJOL)
Determination of carcinogenic polycyclic aromatic hydrocarbons in air samples in Irbid, north Jordan. A Al-Gawadreh Sat, M.B. Gasim, A.R. Hassan, A Azid. Abstract. Air samples were collected at an urban site and a rural (BERQESH) site during February (2017) until March (2017) to determine concentrations of polycyclic ...
7 CFR 765.353 - Determining market value.
2010-01-01
... 7 Agriculture 7 2010-01-01 2010-01-01 false Determining market value. 765.353 Section 765.353... Determining market value. (a) Security proposed for disposition. (1) The Agency will obtain an appraisal of... estimated value is less than $25,000. (b) Security remaining after disposition. The Agency will obtain an...
Directory of Open Access Journals (Sweden)
Cristina Cortis
Full Text Available Low levels of physical activity (PA are reported to contribute to the occurrence of non-communicable diseases over the life course. Although psychological factors have been identified as an important category concerning PA behavior, knowledge on psychological determinants of PA is still inconclusive. Therefore, the aim of this umbrella systematic literature review (SLR was to summarize and synthesize the scientific evidence on psychological determinants of PA behavior across the life course. A systematic online search was conducted on MEDLINE, ISI Web of Science, Scopus, and SPORTDiscus databases. The search was limited to studies published in English from January 2004 to April 2016. SLRs and meta-analyses (MAs of observational studies investigating the association of psychological variables and PA were considered eligible. Extracted data were evaluated based on importance of determinants, strength of evidence, and methodological quality. The full protocol is available from PROSPERO (Record ID: CRD42015010616. Twenty reviews (14 SLRs and 6 MAs, mostly of moderate methodological quality, were found eligible. Convincing evidence was found for self-efficacy (positive association with PA in children and adolescents, and stress (negative association with PA regardless of age. Most of the evidence revealing an association between psychological determinants and PA is probable and limited, mainly due to differences in the definition of PA and of psychological determinants across reviews. Thus, scholars are urged to reach a consensus on clear definitions of relevant psychological determinants of PA, subsuming cultural biases and allowing the possibility to obtain clear interpretations and generalizability of findings. Finally, most psychological determinants should be considered within a larger framework of other multi-level determinants that may interact or mediate some of the effects.
Sample size determination and power
Ryan, Thomas P, Jr
2013-01-01
THOMAS P. RYAN, PhD, teaches online advanced statistics courses for Northwestern University and The Institute for Statistics Education in sample size determination, design of experiments, engineering statistics, and regression analysis.
Energy Technology Data Exchange (ETDEWEB)
Artaud, J; Cittanova, J [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1957-07-01
A method is described for the spectrographic determination of lithium in calcium. The samples are converted directly to CaCO{sub 3}. A method of fractional distillation in the arc, using KCl as carrier, makes it possible to detect and measure the Li content to 0,1 ppm. (author) [French] On decrit une methode de determination spectrographique de Li dans Ca. Les echantillons sont transformes d'une facon simple en CO{sub 3}Ca. Une methode de distillation fractionnee dans l'arc utilisant KCl comme entraineur permet la detection et le dosage de teneurs de Li jusqu'a 0,1 ppm. (auteur)
MOTIVATIONAL AND VALUE-SEMANTIC DETERMINANTS OF INDIVIDUAL ASSERTIVENESS
Directory of Open Access Journals (Sweden)
Lebedeva Inga Viktorovna
2013-04-01
Full Text Available The paper attempts to reveal the concept of "determinants of assertiveness" of a personality, which are determined by motivational characteristics and life value and meaning orientations of the individual. The immediate driving force of human action is the motive or the system of motives. The system of motives of human behavior in different situations of activities, communication and cognition is determined by the personal world view (set of ideas, interests, and beliefs. The value orientation, influencing the direction of human activity, determines a person's behavior and is a personality determinant in the manifestations of assertive behavior and assertiveness. Therefore, the significant psychological factors that contribute to the development of assertiveness are high motivation to success, positive attitudes, and such values as compassion, tolerance, mutual understanding, sympathy, concern that oppose to violence, domination, suppression and submission. The article also presents the results of an empirical study of motivational and value-semantic characteristics of the individual.
Determining average yarding distance.
Roger H. Twito; Charles N. Mann
1979-01-01
Emphasis on environmental and esthetic quality in timber harvesting has brought about increased use of complex boundaries of cutting units and a consequent need for a rapid and accurate method of determining the average yarding distance and area of these units. These values, needed for evaluation of road and landing locations in planning timber harvests, are easily and...
Method for the radioactive determination of the foliates
International Nuclear Information System (INIS)
Rosen, H.
1976-01-01
A method is described for the radioactive determination of the foliates, in which a determination is made of the uptake on a protein fraction of the milk taking up the foliates by competition between the foliate(s) to be determined and a folic acid by-product labelled with a radioactive isotope. The characteristics of this method is that it consists in using tyramide of iodinated folic acid 125 [fr
An Intelligent System for Determining Learning Style
Ozdemir, Ali; Alaybeyoglu, Aysegul; Mulayim, Naciye; Uysal, Muhammed
2018-01-01
In this study, an intelligent system which determines learning style of the students is developed to increase success in effective and easy learning. The importance of the proposed software system is to determine convenience degree of the student's learning style. Personal information form and Dunn Learning Style Preference Survey are used to…
42 CFR 447.504 - Determination of AMP.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Determination of AMP. 447.504 Section 447.504... AMP. (a) AMP means, with respect to a covered outpatient drug of a manufacturer (including those sold... wholesalers for drugs distributed to the retail pharmacy class of trade. AMP shall be determined without...
25 CFR 153.4 - Factors determining competency.
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Factors determining competency. 153.4 Section 153.4...: CROW INDIANS § 153.4 Factors determining competency. Among the matters to be considered by the... friends and relatives, or will become such a charge, by reason of being classed as competent; and whether...
Genetics of sex determination in the haplodiploid wasp Nasonia ...
Indian Academy of Sciences (India)
2010-09-06
Sep 6, 2010 ... How gender is determined under haplodiploidy in the ab- sence of heteromorphic sex ... determination (see below). Sex-determination mutants ... not others (Nöthiger and Steinmann-Zwicky 1985; Wilkins. 1995; Saccone et al.
Determinants of internal migration in Kazakhstan
Aldashev, Alisher; Dietz, Barbara
2011-01-01
In this paper we analyze the determinants of interregional migration in Kazakhstan using quarterly panel data on region to region migration in 2008–2010. To the best of our knowledge this is the first study on interregional population flows in Central Asia. We find that migration is determined by economic factors, first of all income: People are more likely to leave regions where incomes are low and more likely to move to regions with a higher income level. Furthermore, mobility is larger bet...
Determination of nuclear fuel burn-up
International Nuclear Information System (INIS)
Kristak, J.; Vobecky, M.
1973-01-01
Samples containing a known content of 235 U were irradiated with several different neutron doses and activities were determined of radionuclides including 125 Sb, 144 Ce, 134 Cs, 154 Eu, 103 Ru, 95 Zr. The values thus obtained were divided by the 137 Cs activity value. The resulting neutron dose-dependent value is plotted into a calibration graph. The degree of nuclear fuel burn-up is obtained from the graph using an experimentally determined ratio of the activities of the above radionuclides. (B.S.)
Determination of zinc contents in vegetables
International Nuclear Information System (INIS)
Salah-ud-Din; Salariya, A.M.; Yasin, M.
1996-01-01
Zinc content of three groups of vegetables (roots and tuber, leaves and fruits) collected from local markets was determined and are reported here. The determination was made by Atomic Absorption Spectrophotometer. The results obtained show that the zinc content of different vegetables ranged from 6.26-36.80 ppm, 8.80-70-70 ppm and 7.20-35.10 ppm for roots and tubers, fruits of vegetables respectively on dry weight basis. Generally, the values obtained in majority are not above, the maximum permissible limits. (author)
In situ stress determination research study
International Nuclear Information System (INIS)
Austin, W.G.; Thompson, P.M.
1994-01-01
The objectives of this study are to evaluate and implement rock stress determination instruments and techniques developed by Atomic Energy of Canada Limited (AECL) at its Underground Research Laboratory (URL) for use in jointed rock and to continue the development of analytical and interpretation methods for stress determination results including effects of scale, structure and anisotropy. Testing and evaluation of the instruments and methods developed at URL need to be done in a similar rock type prior to underground access at the Yucca Mountain Site Characterization Project
Determination of the transfer function of a reactor
International Nuclear Information System (INIS)
Dencs, B.
1976-01-01
The theoretical and experimental methods of the determination of reactor transfer functions are reviewed. Preliminary measurements were made on the experimental and final core of the training reactor of the Budapest Technical University. The rod-drop curves, the hole effect of the reactor and the control rod worths were determined. The effect of Cd ring and Cd profile was studied, too. The neutron flux distribution in the core was determined in several geometries. The oscillatory method is treated in detail. After the zero measurements of the core the oscillatory determination of the transfer function has been made on some frequency. The simplified model of the reactor transfer function was reconstructed from the measurement data. (R.J.)
Micromethod for determination of cortisol in peripheral blood
International Nuclear Information System (INIS)
Maleeva, A.; Mileva, Zh.; Kekhajova, M.
1982-01-01
The micromethod for determination of cortisol in peripheral blood is based on the classical radiommunologic method for its determination. A drop of peripheral blood is applied on filter paper, used for detection of phenyketonuria. A 7 mm disk of this paper is then cut with a perforator and placed in the tube instead of 50 microliters blood plasma. The classical radiommunoassay and the micromethod were used in parallel for determining peripheral blood cortisol concentrations in 26 sexually mature persons, in 12 children and in 40 patients with thyroid hyperfunction. In all tested 78 persons no statistically significant difference (P>0.5) was found in cortisol concentrations, determined by the two methods. (authors)
Determination of environmental radioactivity, 8
International Nuclear Information System (INIS)
Takagi, Shinji; Nakaoka, Akira; Fukushima, Masanori; Tsukamoto, Masaki
1984-01-01
According to the fundamental design proposed for the purpose of dose assessment of the general public around a nuclear facility corresponding to the guideline issued by the Atomic Energy Commission of Japan, 5 mrem/yr, the authors developed a rapid and simple determination method of radioactivity in food and related environmental samples by pretreating with a modified microwave dehydration apparatus followed by radiation counting. Equation to estimate heating condition by the apparatus was derived, and estimation by the equation was in good agreement with experimental data. It took less than 4.5 hours to dehydrate by the proposed method. This value was much smaller in comparison with the value of more than 10 hours by a conventional hot-air drying method, and radiation counting was able to be started in the same day of sampling and dehydration procedure. It was cralified that lower limits of detection for each radionuclide by the proposed method by using a Ge(Li) detector of 20 % relative efficiency was lower than half level of needed detection limits to determine and evaluate the 5 mrem/yr level. Radionuclide levels in food samples such as vegetables and crustaceans was determined by the proposed method and it was found that they were below the lower detection limit of the method except natural radionuclide 40 K and fallout originated 137 Cs. (author)
Plutonium determination by isotope dilution
International Nuclear Information System (INIS)
Lucas, M.
1980-01-01
The principle is to add to a known amount of the analysed solution a known amount of a spike solution consisting of plutonium 242. The isotopic composition of the resulting mixture is then determined by surface ionization mass spectrometry, and the plutonium concentration in the solution is deduced, from this measurement. For irradiated fuels neutronic studies or for fissile materials balance measurements, requiring the knowledge of the ratio U/Pu or of concentration both uranium and plutonium, it is better to use the double spike isotope dilution method, with a spike solution of known 233 U- 242 Pu ratio. Using this method, the ratio of uranium to plutonium concentration in the irradiated fuel solution can be determined without any accurate measurement of the mixed amounts of sample and spike solutions. For fissile material balance measurements, the uranium concentration is determined by using single isotope dilution, and the plutonium concentration is deduced from the ratio Pu/U and U concentration. The main advantages of isotope dilution are its selectivity, accuracy and very high sensitivity. The recent improvements made to surface ionization mass spectrometers have considerably increased the precision of the measurements; a relative precision of about 0.2% to 0.3% is obtained currently, but it could be reduced to 0.1%, in the future, with a careful control of the experimental procedures. The detection limite is around 0.1 ppb [fr
Determination of gestational age by ultrasound.
Butt, Kimberly; Lim, Ken
2014-02-01
To assist clinicians in assigning gestational age based on ultrasound biometry. To determine whether ultrasound dating provides more accurate gestational age assessment than menstrual dating with or without the use of ultrasound. To provide maternity health care providers and researchers with evidence-based guidelines for the assignment of gestational age. To determine which ultrasound biometric parameters are superior when gestational age is uncertain. To determine whether ultrasound gestational age assessment is cost effective. Published literature was retrieved through searches of PubMed or MEDLINE and The Cochrane Library in 2013 using appropriate controlled vocabulary and key words (gestational age, ultrasound biometry, ultrasound dating). Results were restricted to systematic reviews, randomized control trials/controlled clinical trials, and observational studies written in English. There were no date restrictions. Searches were updated on a regular basis and incorporated in the guideline to July 31, 2013. Grey (unpublished) literature was identified through searching the websites of health technology assessment and health technology-related agencies, clinical practice guideline collections, clinical trial registries, and national and international medical specialty societies. The quality of evidence in this document was rated using the criteria described in the Report of the Canadian Task Force on Preventive Health Care (Table 1). Accurate assignment of gestational age may reduce post-dates labour induction and may improve obstetric care through allowing the optimal timing of necessary interventions and the avoidance of unnecessary ones. More accurate dating allows for optimal performance of prenatal screening tests for aneuploidy. A national algorithm for the assignment of gestational age may reduce practice variations across Canada for clinicians and researchers. Potential harms include the possible reassignment of dates when significant fetal pathology
Determinants of MSK health and disability--social determinants of inequities in MSK health.
Guillemin, Francis; Carruthers, Erin; Li, Linda C
2014-06-01
Even in most egalitarian societies, disparities in care exist to the disadvantage of some people with chronic musculoskeletal (MSK) disorders and related disability. These situations translate into inequality in health and health outcomes. The goal of this chapter is to review concepts and determinants associated with health inequity, and the effect of interventions to minimize their impact. Health inequities are avoidable, unnecessary, unfair and unjust. Inequities can occur across the health care continuum, from primary and secondary prevention to diagnosis and treatment. There are many ways to define and identify inequities, according for instance to ethical, philosophical, epidemiological, sociological, economic, or public health points of view. These complementary views can be applied to set a framework of analysis, identify determinants and suggest targets of action against inequity. Most determinants of inequity in MSK disorders are similar to those in the general population and other chronic diseases. People may be exposed to inequity as a result of policies and rules set by the health care system, individuals' demographic characteristics (e.g., education level), or some behavior of health professionals and of patients. Osteoarthritis (OA) represents a typical chronic MSK condition. The PROGRESS-Plus framework is useful for identifying the important role that place of residence, race and ethnicity, occupation, gender, education, socioeconomic status, social capital and networks, age, disability and sexual orientation may have in creating or maintaining inequities in this disease. In rheumatoid arthritis (RA), a consideration of international data led to the conclusion that not all RA patients who needed biologic therapy had access to it. The disparity in care was due partly to policies of a country and a health care system, or economic conditions. We conclude this chapter by discussing examples of interventions designed for reducing health inequity
Spectrophotometric determination of some metal ions using hydrazones
International Nuclear Information System (INIS)
Mohammed, M. S.
2000-05-01
In this research many starting materials were prepared, like methyl salicylate and salicylic acid hydrazide from which different derivatives of hydrazones were synthesized by coupling with carbonyl compounds like benzil monoxime and benzil mono hydrazone which are prepared and others like salicylaldehyde and benzoin. The hydrazones that were synthesized are salicylaldehyde salicylic acid hydrazone, benzoin salicylic acid hydrazone, benzil mono hydrazone salicylic acid hydrazone and benzil monoxime salicylic acid hydrazone. These reagents were determined by different methods, IR spectrophotometric determination, the nitrogen content method and melting point determination. These hydrazones act as ligands for determination of some metal ions by making different coloured complexes that were prepared for eight hydrazones with eight metal ions U (VI), Fe (II), Fe (III), Co (II), V (II), Mo (VI), Ni (II) and Cu (II). These complexes were determined by ultraviolet and visible spectrophotometer (UV/VIS) to detect their absorbance and wavelengths (λ max). The two hydrazones salicylaldehyde salicylic acid-hydrazone and benzoin salicylic acid hydrazone, were selected for determination of five metal ions (Fe (II), Fe (III), U (VI), Ni (II) and Cu (II)), using two micelles sodium n-dodecyl sulphate and pyridinium hexa decyl bromide mono hydrate. Their absorbance and wavelengths were detected using UV/VIS spectrophotometer. (Author)
Minnesota Univ., Minneapolis. Inst. on Community Integration.
Two brief papers provide reasons to support self-determination for students with disabilities, with one paper written from the perspective of educators and one written from the parents' perspective. Each paper discusses 11 benefits of self-determination, including: (1) personal control, (2) motivation, (3) prosocial behaviors, (4) self-awareness,…
10 CFR 2.803 - Determination of petition.
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Determination of petition. 2.803 Section 2.803 Energy... Rulemaking § 2.803 Determination of petition. No hearing will be held on the petition unless the Commission... of proposed rulemaking. In any other case, it will deny the petition and will notify the petitioner...
5 CFR 880.205 - Determinations of death.
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Determinations of death. 880.205 Section... Determinations of death. OPM does not make findings of presumed death. A claimant for CSRS, FERS, or FEGLI death... § 880.207 must submit a death certificate or other legal certification of death issued by an authorized...
31 CFR 50.55 - Determination of Affiliations.
2010-07-01
... PROGRAM Claims Procedures § 50.55 Determination of Affiliations. For the purposes of subpart F, an insurer's affiliates for any Program Year shall be determined by the circumstances existing on the date of occurrence of the act of terrorism that is the first act of terrorism in a Program Year to be certified by...
50 CFR 679.43 - Determinations and appeals.
2010-10-01
... determinations made under § 679.30(d). (b) Who may appeal. Any person whose interest is directly and adversely affected by an initial administrative determination may file a written appeal. For purposes of this section..., Attention: Appeals (OAA), 709 W. 9th Street, Room 453, Juneau, AK 99801. (d) Timing of appeals. (1) If an...
Facilitating internalization: the self-determination theory perspective.
Deci, E L; Eghrari, H; Patrick, B C; Leone, D R
1994-03-01
Self-determination theory (Deci & Ryan, 1985) posits that (a) people are inherently motivated to internalize the regulation of uninteresting though important activities; (b) there are two different processes through which such internalization can occur, resulting in qualitatively different styles of self-regulation; and (c) the social context influences which internalization process and regulatory style occur. The two types of internalization are introjection, which entails taking in a value or regulatory process but not accepting it as one's own, and integration, through which the regulation is assimilated with one's core sense of self. Introjection results in internally controlling regulation, whereas integration results in self-determination. An experiment supported our hypothesis that three facilitating contextual factors--namely, providing a meaningful rationale, acknowledging the behaver's feelings, and conveying choice--promote internalization, as evidenced by the subsequent self-regulation of behavior. This experiment also supported our expectation that when the social context supports self-determination, integration tends to occur, whereas when the context does not support self-determination, introjection tends to occur.
[Determination of phenylethanoid glycosides in Orobanche coerulescens].
Han, Guo-qing; Li, Cai-feng; Wang, Xiao-qin; Li, Min-hui; Li, Jing
2015-11-01
Orobanche caerulescens is an important medicinal resource in Orobanchaceae. The present study aims to establish methods for determination of acteoside, crenatoside, and total phenylethanoid glycosides in O. caerulescens, and determine the content in 15 samples to evaluate the resource utilization of this medicinal plant. The content of acteoside and crenatoside were quantitatively determined by HPLC, while total phenylpropanoid glycosides was estimated by UV-VIS spectrophotometry. According to the results, the content of acteoside was the highest in O. caerulescens, followed by crenatoside. The contents of acteoside, crenatoside, and total phenylethanoid glycosides were between 1.15% - 15.60%, 0.83% - 4.47%, and 6.78% - 27.43%, respectively, which had significant differences. The acquisition time has great influence on the content of main components of O. caerulescens. The content of phenylethanoid glycosides is higher in the samples which were collected at the flowering stage. The two determination methods were proved to be simple, accurate and reliable, and can be used to evaluate the quality and resource utilization of O. caerulescens.
Social Determinants of LGBT Cancer Health Inequities.
Matthews, Alicia K; Breen, Elizabeth; Kittiteerasack, Priyoth
2018-02-01
To describe the extant literature on social determinants of health as they relate to the cancer disparities and to highlight the research findings relating to lesbian, gay, bisexual, and transgender (LGBT) populations. Published scientific literature and clinical literature, and published reports from the World Health Organization and US Department of Health and Human Services. The larger literature on health inequities is moving beyond individual-level predictors of risk to evaluate the influence of social determinants of health on the persistent health inequalities in a population. As it has for other groups, additional research into social determinants of health for LGBT persons of color may play an important role in identifying and reducing cancer inequities for this group. Increased awareness of the factors that contribute to health inequities for the LGBT population may provide insight into improving patient-provider relationships with LGBT patients. A large body of experiential and clinical knowledge positions nurses to conduct meaningful research to expand the current understanding of the social determinants of LGBT cancer health inequities. Copyright © 2017 Elsevier Inc. All rights reserved.
Evaluating the fermionic determinant of dynamical configurations
International Nuclear Information System (INIS)
Hasenfratz, Anna; Alexandru, Andrei
2002-01-01
We propose and study an improved method to calculate the fermionic determinant of dynamical configurations. The evaluation or at least stochastic estimation of the ratios of fermionic determinants is essential for a recently proposed updating method of smeared link dynamical fermions. This update creates a sequence of configurations by changing a subset of the gauge links by a pure gauge heat bath or over-relaxation step. The acceptance of the proposed configuration depends on the ratio of the fermionic determinants on the new and original configurations. We study this ratio as a function of the number of links that are changed in the heat bath update. We find that even when every link of a given direction and parity of a 10 fm 4 configuration is updated, the average of the determinant ratio is still close to one and with the improved stochastic estimator the proposed change is accepted with about 20% probability. This improvement suggests that the new updating technique can be efficient even on large lattices and could provide an updating method for dynamical overlap actions
Fluorimetric method for determination of Beryllium
International Nuclear Information System (INIS)
Sparacino, N.; Sabbioneda, S.
1996-10-01
The old fluorimetric method for the determination of Beryllium, based essentially on the fluorescence of the Beryllium-Morine complex in a strongly alkaline solution, is still competitive and stands the comparison with more modern methods or at least three reasons: in the presence of solid or gaseous samples (powders), the times necessary to finalize an analytic determination are comparable since the stage of the process which lasts the longest is the mineralization of the solid particles containing Beryllium, the cost of a good fluorimeter is by far Inferior to the cost, e. g., of an Emission Spectrophotometer provided with ICP torch and magnets for exploiting the Zeeman effect and of an Atomic absorption Spectrophotometer provided with Graphite furnace; it is possible to determine, fluorimetrically, rather small Beryllium levels (about 30 ng of Beryllium/sample), this potentiality is more than sufficient to guarantee the respect of all the work safety and hygiene rules now in force. The study which is the subject of this publication is designed to the analysis procedure which allows one to reach good results in the determination of Beryllium, chiefly through the control and measurement of the interference effect due to the presence of some metals which might accompany the environmental samples of workshops and laboratories where Beryllium is handled, either at the pure state or in its alloys. The results obtained satisfactorily point out the merits and limits of this analytic procedure
48 CFR 49.109-7 - Settlement by determination.
2010-10-01
... CONTRACT MANAGEMENT TERMINATION OF CONTRACTS General Principles 49.109-7 Settlement by determination. (a... determination of the amount due consistent with the termination clause, including any cost principles...
Gender specific determinants of goitre
International Nuclear Information System (INIS)
Jamshid, F.; Kerstin, C.; Elena, G.; Wilhelm, O.; Karl, W.; Hwe, M.
2004-01-01
Despite the strong implications of differences between females and males in the risk of goitre, gender-specific issues have not been extensively addressed in investigations of goitre prevalence. The Objective of our analysis was to investigate the gender-specific determinants of goitre. Methods: A total of 853 healthy employees from 4 institutions in western part of Germany aged between 18 and 68 years were examined by ultrasound of the neck to determine the thyroid volume between April 2001 and April 2002. Information on sex, age, daily use of iodised salt, the history of goitre in the first degree relatives, type and amount of' smoking, oral contraceptives and number of pregnancies were assessed by standardised questionnaires. Gender-specific predictors of goitre prevalence were assessed by multivariate logistic regression. Results: The overall prevalence of goitre among study subjects was (204/853) 23.9%. Goitre was present in 80 out of 370 females (21.6%) vs. 124/483 (25.7%) in males.In general smoking (<0.0001), increasing age (p<0.0001) and lack of daily intake of iodised salt (p=0.004) associated with goitre prevalence, but not sex (0.4) and family history of goitre (p=0.2). In 370 females, parity (p=0.004) and lack of daily intake of iodised salt (p=0.01) were the major determinants for goitre, whereas, age (p=0.2), oral contraceptives (p=0.8), family history of goitre (p=0.3), and smoking (p=0.1) did not affect the goitre prevalence. In 483 males, smoking (p<0.0001) and age (p<0.001) affected the goitre prevalence, but not family history of goitre (p=0.4) and the iodine status failed just to reach the significant level (p=0.08) in this analysis. Conclusions: Gender specific determinants of goitre are parity and iodine status in females and smoking and increasing age in males. (authors)
RBE determination of tumors by serum aldolase
Energy Technology Data Exchange (ETDEWEB)
Dalluege, K H [Akademie der Wissenschaften der DDR, Berlin. Zentralinstitut fuer Krebsforschung
1981-06-01
In patients with histologically ascertained bronchial carcinoma the tumor volume and the plasma volume was determined before therapy. Following the first irradiation of the tumor with a /sup 60/Co pendulum technique over the diseased side with 5 Gy for the 80% isodose determination of aldolase and creatin kinase was performed frequently during 24 h. A peak of serum aldolase was found 16 - 18 h after irradiation. The aldolase values of this peak were higher for undifferentiated carcinomas than for squamous cell carcinomas and proportional to the size of the tumor. The hypothesis is made that by means of this method using different radiation qualities their 'relative biological effectiveness' can be determined.
New determinants for gallstone disease? .
Shabanzadeh, Daniel Mønsted
2018-02-01
Gallstone disease is highly prevalent in Denmark and other countries of northern Europe, and cholecystectomy for the treatment of clinical gallstone disease is one the most frequently performed surgical procedures. Research efforts for the identification of mechanisms involved in gallstone formation have a long history and the most established include bile cholesterol saturation, gallbladder motor function, and the enterohepatic circulation of secondary bile salts produced by fecal microbiota. A small number of determinants that are believed to affect these mechanisms have been identified until now. However, much of this research on determinants for gallstone disease has been hampered by insufficient study designs and by insufficient assessment of gallstone disease by only assessing the selected minority of people with clinical gallstone disease. In a Danish general-population cohort screened for gallstone disease with multiple ultrasound examinations, it was possible to both confirm previously identified determinants and to identify new determinants for gallstone disease. Temporal associations for incident gallstone disease and female sex, BMI, non-HDL cholesterol, and inverse associations for increasing alcohol consumption and cessation of hormone replacement therapy in females were confirmed. New determinants included testosterone and increase in SHBG in males which had directly and inverse associations with incident gallstone disease, respectively. All of the identified determinants for incident gallstone disease found in this thesis can be linked to the three biological mechanisms of gallstone formation. Other modifiable factors such as tobacco smoking, coffee consumption, dietary habits, physical activity, and blood pressure were not identified as determinants of incident gallstone disease in this thesis. Previous findings from other studies may be hampered by study design without exploration of temporal associations or due to selective assessment of
Prochaska, John D.; Nolen, Alexandra B.; Kelley, Hilton; Sexton, Ken; Linder, Stephen H.; Sullivan, John
2014-01-01
Residents of environmental justice (EJ) communities may bear a disproportionate burden of environmental health risk, and often face additional burdens from social determinants of health. Accounting for cumulative risk should include measures of risk from both environmental sources and social determinants. This study sought to better understand cumulative health risk from both social and environmental sources in a disadvantaged community in Texas. Key outcomes were determining what data are cu...
Determination of carbon chlorine and fluorine in uranium dioxide
International Nuclear Information System (INIS)
Kijko, N.I.; Timofeev, G.A.
1983-01-01
Techniques of chlorine and fluorine determination and simultaneous determination of carbon and chlorine in electrolytic uranium dioxide are described. The method of chlorine and fluorine determination is based on their separation during oxide pyrohydrolysis with subsequent spectrophotometric analysis of condensate. Lower determination limits constitute 1 μg for chlorine, 0.5 μg for fluorine. Relative standard deviation when the content of impurities analyzed is 10 -3 % constitutes 0.05-0.07
Determination of multiple scattering effects
International Nuclear Information System (INIS)
Langevin, M.
1981-01-01
The integration of Sigmund and Winterbon numerical values is extended to the reduced thickness tau=2000. The diagram obtained allows a simple determination of the multiple scattering effect for different targets and projectiles [fr
International Nuclear Information System (INIS)
Smodis, B.; Planinsek, Z.; Stegnar, P.
1995-01-01
Sample preparation and radiochemical analysis for the determination of Strontium 89 and Strontium 90 in various food and environmental samples including sediments, fruit and vegetables, milk, meat and fish is elaborated in this paper
Fluorescent determination of neptunium in plutonium
International Nuclear Information System (INIS)
Alexandruk, V.M.; Babaev, A.S.; Dem'yanova, T.A.; Stepanov, A.V.
1991-01-01
This paper describes a new procedure for direct determination of Neptunium in Plutonium using laser induced time resolved fluorescence method. The procedure based on measurement of fluorescence intensity of Neptunium followed its concentration in effective layer of pellet of calcium fluoride. Detection limit of determination of Neptunium is 2 10 -12 g. At the level of Neptunium content in Plutonium more than 5 ppm relative standard deviation is equal 0.08-0.12. For carrying out of single measurement it is necessary neither more nor less 5 mkg Plutonium
Method for determining heterologous biosynthesis pathways
Gao, Xin
2017-08-10
The present invention relates to a method and system for dynamically analyzing, determining, predicting and displaying ranked suitable heterologous biosynthesis pathways for a specified host. The present invention addresses the problem of finding suitable pathways for the endogenous metabolism of a host organism because the efficacy of heterologous biosynthesis is affected by competing endogenous pathways. The present invention is called MRE (Metabolic Route Explorer), and it was conceived and developed to systematically and dynamically search for, determine, analyze, and display promising heterologous pathways while considering competing endogenous reactions in a given host organism.
Determination of detection equipment dead time
International Nuclear Information System (INIS)
Sacha, J.
1980-01-01
A method is described of determining dead time by short-lived source measurement. It is based on measuring the sample count rates in different time intervals when only dead time correction is changed with the changing count of recorded pulses. The dead time may be determined from the measured values by a numerical-graphical method. The method is described. The advantage of the method is the minimization of errors and inaccuracies; the disadvantage is that the half-life of the source used should very accurately be known. (J.P.)
Cell Elasticity Determines Macrophage Function
Patel, Naimish R.; Bole, Medhavi; Chen, Cheng; Hardin, Charles C.; Kho, Alvin T.; Mih, Justin; Deng, Linhong; Butler, James; Tschumperlin, Daniel; Fredberg, Jeffrey J.; Krishnan, Ramaswamy; Koziel, Henry
2012-01-01
Macrophages serve to maintain organ homeostasis in response to challenges from injury, inflammation, malignancy, particulate exposure, or infection. Until now, receptor ligation has been understood as being the central mechanism that regulates macrophage function. Using macrophages of different origins and species, we report that macrophage elasticity is a major determinant of innate macrophage function. Macrophage elasticity is modulated not only by classical biologic activators such as LPS and IFN-γ, but to an equal extent by substrate rigidity and substrate stretch. Macrophage elasticity is dependent upon actin polymerization and small rhoGTPase activation, but functional effects of elasticity are not predicted by examination of gene expression profiles alone. Taken together, these data demonstrate an unanticipated role for cell elasticity as a common pathway by which mechanical and biologic factors determine macrophage function. PMID:23028423
Cell elasticity determines macrophage function.
Directory of Open Access Journals (Sweden)
Naimish R Patel
Full Text Available Macrophages serve to maintain organ homeostasis in response to challenges from injury, inflammation, malignancy, particulate exposure, or infection. Until now, receptor ligation has been understood as being the central mechanism that regulates macrophage function. Using macrophages of different origins and species, we report that macrophage elasticity is a major determinant of innate macrophage function. Macrophage elasticity is modulated not only by classical biologic activators such as LPS and IFN-γ, but to an equal extent by substrate rigidity and substrate stretch. Macrophage elasticity is dependent upon actin polymerization and small rhoGTPase activation, but functional effects of elasticity are not predicted by examination of gene expression profiles alone. Taken together, these data demonstrate an unanticipated role for cell elasticity as a common pathway by which mechanical and biologic factors determine macrophage function.
Directory of Open Access Journals (Sweden)
Masoume Vakili Azghandi
2016-05-01
Full Text Available Background: The SRY gene (SRY provides instructions for making a transcription factor called the sex-determining region Y protein. The sex-determining region Y protein causes a fetus to develop as a male. In this study, SRY of 15 spices included of human, chimpanzee, dog, pig, rat, cattle, buffalo, goat, sheep, horse, zebra, frog, urial, dolphin and killer whale were used for determine of bioinformatic differences. Methods: Nucleotide sequences of SRY were retrieved from the NCBI databank. Bioinformatic analysis of SRY is done by CLC Main Workbench version 5.5 and ClustalW (http:/www.ebi.ac.uk/clustalw/ and MEGA6 softwares. Results: The multiple sequence alignment results indicated that SRY protein sequences from Orcinus orca (killer whale and Tursiopsaduncus (dolphin have least genetic distance of 0.33 in these 15 species and are 99.67% identical at the amino acid level. Homosapiens and Pantroglodytes (chimpanzee have the next lowest genetic distance of 1.35 and are 98.65% identical at the amino acid level. Conclusion: These findings indicate that the SRY proteins are conserved in the 15 species, and their evolutionary relationships are similar.
Self-determination after Kosovo
DEFF Research Database (Denmark)
. As such, the case of Kosovo has sharpened the focus and intensified the debate on the issue of self-determination conflicts and how they are managed by the international community. This volume contributes to this debate by examining Kosovo in historical and contemporary comparative perspective...... and by reflecting on the legal, ethical and political implications of its successful declaration of independence....
Refugee status determination: three challenges
Directory of Open Access Journals (Sweden)
Martin Jones
2009-04-01
Full Text Available Refugee status determination (RSD, which is vital to the protection of so many asylum seekers worldwide, is at best an imperfect, haphazard and challenging process. It merits greater attention and appropriate reform.
International Nuclear Information System (INIS)
Rien Ritawidya; Martalena Ramli; Cecep Taufik Rustendi
2014-01-01
Gd-DTPA is one of the contrast agent which is important in Magnetic Resonance Imaging (MRI) application. The presence of free Gd (III) ion and free DTPA ligand is extremely toxic in human body. Therefore, it needs a method in order to determine free ion Gd (III) and free DTPA ligand concentration which then MRI would be applicable for clinical purpose. The analytical method that selected for the research was complexometric titration. The research was carried out in order to make validation method of free ion Gd (III) and free DTPA ligand determination, then validation criteria such as % recovery, % coefisien of variance and linearity could be obtained. Some experiments that had been done on determination of free Gd (III) with DTPA resulted in % recovery between 30,33% - 183,59%, the precision from %CV between 2,34% - 35,25% and linearity showed with value of R = 0,9525. Meanwhile on determination of DTPA with Gd (III) resulted in % recovery between 105.15% - 139,12%, %CV between 6,78% - 10,96% and R = 0,9525. Validation result indicates that determination method can not be used as a method to determine free ion Gd(III) and free DTPA ligand in contrast agent. (author)
Determination of radium in water by α-counting
International Nuclear Information System (INIS)
Zhu Tianxia
1986-01-01
An analytical method is developed for the determination of Ra in water by means of alpha-counting after Ra has been coprecipitated first with PbSO 4 and then with BaSO 4 in EDTA-NH 4 OH with a recovery of ∼99%. Lower limit of the determination is 2.7 x 10 -4 Bq/l by the use of instruments having low Ra-background ≤ 1.3 x 10 -5 Bq. The determination takes 5 hours in the case of having known the ratio 226 Ra/ 224 Ra (B value). If the B value is unknown, another determination is necessary after the sample is allowed to decay for at least 40 hours to give the amounts of 226 Ra and 224 Ra
Identifying and Ranking the Determinants of Tourism Performance
DEFF Research Database (Denmark)
Assaf, A.George; Josiassen, Alexander
2012-01-01
, their tourism industries, and tourism businesses seek to improve the performance of the tourism industry and its constituents by vigorously promoting themselves to international tourists, cutting costs, and identifying synergies in their tourism endeavors. In seeking to improve the tourism industry......, the determinants that affect tourism performance are of key interest to the stakeholders. A key obstacle toward improving performance is the multitude of determinants that can affect tourism performance. The literature has yet to provide concrete insights into the determinants of tourism performance...... and their relative importance. The present study addresses this important gap. We identify and rank the determinants of tourism performance. We also provide performance measures of international tourism destinations. The results are derived using the Data Envelopment Analysis (DEA) and bootstrap truncated regression...
Colonialism as a Broader Social Determinant of Health
Directory of Open Access Journals (Sweden)
Karina Czyzewski
2011-05-01
Full Text Available A proposed broader or Indigenized social determinants of health framework includes "colonialism" along with other global processes. What does it mean to understand Canadian colonialism as a distal determinant of Indigenous health? This paper reviews pertinent discourses surrounding Indigenous mental health in Canada.With an emphasis on the notion of intergenerational trauma, there are real health effects of social, political, and economic marginalization embodied within individuals, which can collectively affect entire communities. Colonialism can also be enacted and reinforced within Indigenous mental health discourse, thus influencing scholarly and popular perceptions. Addressing this distal determinant through policy work necessitates that improving Indigenous health is inherently related to improving these relationships, i.e. eliminating colonial relations, and increasing self-determination.
Professional determination problems of modern senior pupils
Directory of Open Access Journals (Sweden)
G.N. Danylenko
2017-03-01
Full Text Available Background. Today, young people are more focused on getting education as such, without taking into account the profession. The relevance of this study is the identification of the level of professional self-determination of senior pupils, the mechanisms of formation of professional preferences. The article contains the concept and content of professional self-determination in adolescence; the results of the study on the formation of professional self-determination in senior pupils are presented. The study conducted among 9th grade pupils of secondary schools has revealed that the further gradual self-determination of the future specialty depends not only on psychological readiness for conscious choice. Materials and methods. The study involved 982 pupils of secondary schools in Ukraine. To study the level of formation of professional readiness, there was conducted a survey on the developed questionnaire. Statistical analysis was carried out using MS Excel and SPSS 17. Results. The results showed that professional intents of 9-graders are a key feature for solving the problem of high school selection and future careers. But for most students, these intentions are contradictory due to objective reasons. Radio, television, books don’t have a significant impact on the choice of professional self-determination. Conclusions. The conducted survey is self-sufficient for the analysis of professional orientation. But the choice of profession by the students is influenced by many factors. Therefore, carrying out the studies on vocational guidance requires an integrated approach.
Neuromuscular dose-response studies: determining sample size.
Kopman, A F; Lien, C A; Naguib, M
2011-02-01
Investigators planning dose-response studies of neuromuscular blockers have rarely used a priori power analysis to determine the minimal sample size their protocols require. Institutional Review Boards and peer-reviewed journals now generally ask for this information. This study outlines a proposed method for meeting these requirements. The slopes of the dose-response relationships of eight neuromuscular blocking agents were determined using regression analysis. These values were substituted for γ in the Hill equation. When this is done, the coefficient of variation (COV) around the mean value of the ED₅₀ for each drug is easily calculated. Using these values, we performed an a priori one-sample two-tailed t-test of the means to determine the required sample size when the allowable error in the ED₅₀ was varied from ±10-20%. The COV averaged 22% (range 15-27%). We used a COV value of 25% in determining the sample size. If the allowable error in finding the mean ED₅₀ is ±15%, a sample size of 24 is needed to achieve a power of 80%. Increasing 'accuracy' beyond this point requires increasing greater sample sizes (e.g. an 'n' of 37 for a ±12% error). On the basis of the results of this retrospective analysis, a total sample size of not less than 24 subjects should be adequate for determining a neuromuscular blocking drug's clinical potency with a reasonable degree of assurance.
Spectrofluorimetric determination of some water-soluble vitamins.
Mohamed, Abdel-Maaboud I; Mohamed, Horria A; Abdel-Latif, Niveen M; Mohamed, Marwa R
2011-01-01
Two simple and sensitive spectrofluorimetric methods were developed for determination of three water-soluble vitamins (B1, B2, and B6) in mixtures in the presence of cyanocobalamin. The first one was for thiamine determination, which depends on the oxidation of thiamine HCl to thiochrome by iodine in an alkaline medium. The method was applied accurately to determine thiamine in binary, ternary, and quaternary mixtures with pyridoxine HCl, riboflavin, and cyanocobalamin without interference. In the second method, riboflavin and pyridoxine HCl were determined fluorimetrically in acetate buffer, pH 6. The three water-soluble vitamins (B1, B2, and B6) were determined spectrofluorimetrically in binary, ternary, and quaternary mixtures in the presence of cyanocobalamin. All variables were studied in order to optimize the reaction conditions. Linear relationship was obeyed for all studied vitamins by the proposed methods at their corresponding lambda(exc) or lambda(em). The linear calibration curves were obtained from 10 to 500 ng/mL; the correlation ranged from 0.9991 to 0.9999. The suggested procedures were applied to the analysis of the investigated vitamins in their laboratory-prepared mixtures and pharmaceutical dosage forms from different manufacturers. The RSD range was 0.46-1.02%, which indicates good precision. No interference was observed from common pharmaceutical additives. Good recoveries (97.6 +/- 0.7-101.2 +/- 0.8%) were obtained. Statistical comparison of the results with reported methods shows excellent agreement and indicates no significant difference in accuracy and precision.
The evolution of sex ratios and sex-determining systems
Uller, Tobias; Pen, Ido; Wapstra, Erik; Beukeboom, Leo W.; Komdeur, Jan
Sex determination is a fundamental process governed by diverse mechanisms. Sex ratio selection is commonly implicated in the evolution of sex-determining systems, although formal models are rare. Here, we argue that, although sex ratio selection can induce shifts in sex determination, genomic
Spectrophotometric determination of silica in water. Low range
International Nuclear Information System (INIS)
Acosta L, E.
1992-07-01
The spectrophotometric method for the determination of the silica element in water, demineralized water, raw waters, laundry waters, waters treated with ion exchange resins and sea waters is described. This method covers the determination of the silica element in the interval from 20 to 1000 μg/l on 50 ml. of base sample. These limits its can be variable if the size of the used aliquot one is changed for the final determination of the silica element. (Author)
Pediatric Donation After Circulatory Determination of Death: A Scoping Review.
Weiss, Matthew J; Hornby, Laura; Witteman, William; Shemie, Sam D
2016-03-01
Although pediatric donation after circulatory determination of death is increasing in frequency, there are no national or international donation after circulatory determination of death guidelines specific to pediatrics. This scoping review was performed to map the pediatric donation after circulatory determination of death literature, identify pediatric donation after circulatory determination of death knowledge gaps, and inform the development of national or regional pediatric donation after circulatory determination of death guidelines. Terms related to pediatric donation after circulatory determination of death were searched in Embase and MEDLINE, as well as the non-MEDLINE sources in PubMed from 1980 to May 2014. Seven thousand five hundred ninety-seven references were discovered and 85 retained for analysis. All references addressing pediatric donation after circulatory determination of death were considered. Exclusion criteria were articles that did not address pediatric patients, animal or laboratory studies, surgical techniques, and local pediatric donation after circulatory determination of death protocols. Narrative reviews and opinion articles were the most frequently discovered reference (25/85) and the few discovered studies were observational or qualitative and almost exclusively retrospective. Retained references were divided into themes and analyzed using qualitative methodology. The main discovered themes were 1) studies estimating the number of potential pediatric donation after circulatory determination of death donors and their impact on donation; 2) ethical issues in pediatric donation after circulatory determination of death; 3) physiology of the dying process after withdrawal of life-sustaining therapy; 4) cardiac pediatric donation after circulatory determination of death; and 5) neonatal pediatric donation after circulatory determination of death. Donor estimates suggest that pediatric donation after circulatory determination of death will
Sex Determination: Why So Many Ways of Doing It?
Bachtrog, Doris; Mank, Judith E.; Peichel, Catherine L.; Kirkpatrick, Mark; Otto, Sarah P.; Ashman, Tia-Lynn; Hahn, Matthew W.; Kitano, Jun; Mayrose, Itay; Ming, Ray; Perrin, Nicolas; Ross, Laura; Valenzuela, Nicole; Vamosi, Jana C.
2014-01-01
Sexual reproduction is an ancient feature of life on earth, and the familiar X and Y chromosomes in humans and other model species have led to the impression that sex determination mechanisms are old and conserved. In fact, males and females are determined by diverse mechanisms that evolve rapidly in many taxa. Yet this diversity in primary sex-determining signals is coupled with conserved molecular pathways that trigger male or female development. Conflicting selection on different parts of the genome and on the two sexes may drive many of these transitions, but few systems with rapid turnover of sex determination mechanisms have been rigorously studied. Here we survey our current understanding of how and why sex determination evolves in animals and plants and identify important gaps in our knowledge that present exciting research opportunities to characterize the evolutionary forces and molecular pathways underlying the evolution of sex determination. PMID:24983465
MOTIVATIONAL AND VALUE-SEMANTIC DETERMINANTS OF INDIVIDUAL ASSERTIVENESS
Directory of Open Access Journals (Sweden)
Инга Викторовна Лебедева
2013-04-01
Full Text Available The paper attempts to reveal the concept of "determinants of assertiveness" of a personality, which are determined by motivational characteristics and life value and meaning orientations of the individual. The immediate driving force of human action is the motive or the system of motives. The system of motives of human behavior in different situations of activities, communication and cognition is determined by the personal world view (set of ideas, interests, and beliefs. The value orientation, influencing the direction of human activity, determines a person's behavior and is a personality determinant in the manifestations of assertive behavior and assertiveness. Therefore, the significant psychological factors that contribute to the development of assertiveness are high motivation to success, positive attitudes, and such values as compassion, tolerance, mutual understanding, sympathy, concern that oppose to violence, domination, suppression and submission.The article also presents the results of an empirical study of motivational and value-semantic characteristics of the individual.DOI: http://dx.doi.org/10.12731/2218-7405-2013-4-15
EDXRF and TXRF determination of gallium in gallium-uranium matrix
International Nuclear Information System (INIS)
Misra, N.L.; Sanjay Kumar, S.; Dhara, Sangita; Aggarwal, S.K.; Venugopal, V.
2009-01-01
Energy Dispersive X-Ray Fluorescence (EDXRF) and Total Reflection X-ray Fluorescence (TXRF) methods for determination of Gallium in Gallium-Uranium matrix have been developed. For EDXRF determinations, 200 μL of standards/samples mixed with internal standard copper were dispersed on 30 mm diameter absorbent sheet so that it behaves like a thin film of the sample. The Gallium amounts in samples were determined from their EDXRF spectra using a calibration plot. For TXRF determinations, samples were taken on flat polished quartz sample supports and Gallium was determined in conventional way. For EDXRF and TXRF determinations, the average precision and accuracy obtained for Ga determinations was better than 3% (1σ). (author)
Uranium hexafluoride and uranyl nitrate. Ionometric determination of bromine
International Nuclear Information System (INIS)
Anon.
Bromine was determined in uranium hexafluoride. The method is suitable for determining 2 to 20 ppm with respect to uranium. Bromides are oxidized by potassium permanganate to give bromine which is extracted into carbon tetrachloride, reduced by ascorbic acid and determined by ionometry [fr
Sex determination mechanisms in the Calliphoridae (blow flies).
Scott, M J; Pimsler, M L; Tarone, A M
2014-01-01
The Calliphoridae or blow flies are a family of insects that occupy diverse habitats and perform important ecological roles, particularly the decomposition of animal remains. Some Calliphoridae species are also important in the forensic sciences, in agriculture (e.g. as livestock pests) and in medicine (e.g. maggot therapy). Calliphoridae provide striking examples in support of the hypothesis that sex determination regulatory gene hierarchies evolve in the reverse order, with the gene at the top being the most recently added. Unlike the model fly Drosophila melanogaster, where sex is determined by the number of X chromosomes, in the Australian sheep blow fly (Lucilia cuprina) sex is determined by a Y-linked male-determining gene (M). A different regulatory system appears to operate in the hairy maggot blow fly (Chrysomya rufifacies) where the maternal genotype determines sex. It is hypothesized that females heterozygous for a dominant female-determining factor (F/f) produce only female offspring and homozygous f/f females produce only sons. The bottom of the regulatory hierarchy appears to be the same in D. melanogaster and L. cuprina, with sex-specific splicing of doublesex transcripts being controlled by the female-specific Transformer (TRA) protein. We discuss a model that has been proposed for how tra transcripts are sex-specifically spliced in calliphorids, which is very different from D. melanogaster. © 2013 S. Karger AG, Basel.
Determination of sex by armbone dimensions.
Aye, Victor Omakoji
2010-06-15
Sex determination is a vital part of the medico-legal system but can be difficult in cases where the body is damaged. The purpose of this study was to develop a technique for sex determination from three arm-bone dimensions (wrist circumference, arm length and arm span). This knowledge can be applied in cases of mass disaster, homicide and events such as sports. Data were collected for 95 Nigerian male students and 90 Nigerian female students using physical anthropometry. Discriminant function presented the wrist dimension as the dominant contributor in this study. Combination equations for both the wrist and arm-span dimensions correctly classified sex (male/female) with an accuracy rate of 84.9%. On cross-validation, sex was also established with the same 84.9% accuracy rate. Sex determination was higher in males. Sexual dimorphism was established in this study, although the wrist circumference was more distinct than arm span; a combination of both generated sex with an accuracy prediction rate of 84.9%. (c) 2010 Elsevier Ireland Ltd. All rights reserved.
Determination of zirconium by fluoride ion selective electrode
International Nuclear Information System (INIS)
Mahanty, B.N.; Sonar, V.R.; Gaikwad, R.; Raul, S.; Das, D.K.; Prakash, A.; Afzal, Md.; Panakkal, J.P.
2010-01-01
Full text: Zirconium is used in a wide range of applications including nuclear clad, catalytic converters, surgical appliances, metallurgical furnaces, superconductors, ceramics, lamp filaments, anti corrosive alloys and photographical purposes. Irradiation testing of U-Zr and U-Pu-Zr fuel pins has also demonstrated their feasibility as fuel in liquid metal reactors. Different methods that are employed for the determination of zirconium are spectrophotometry, potentiometry, neutron activation analysis and mass spectrometry. Ion-selective electrode (ISE), selective to zirconium ion has been studied for the direct potentiometric measurements of zirconium ions in various samples. In the present work, an indirect method has been employed for the determination of zirconium in zirconium nitrate sample using fluoride ion selective electrode. This method is based on the addition of known excess amount of fluoride ion to react with the zirconium ion to produce zirconium tetra fluoride at about pH 2-3, followed by determination of residual fluoride ion selective electrode. The residual fluoride ion concentrations were determined from the electrode potential data using calibration plot. Subsequently, zirconium ion concentrations were determined from the concentration of consumed fluoride ions. A precision of about 2% (RSD) with the mean recovery of more than 94% has been achieved for the determination of zirconium at the concentration of 4.40 X 10 -3 moles lit -1
Strain gage based determination of mixed mode SIFs
Murthy, K. S. R. K.; Sarangi, H.; Chakraborty, D.
2018-05-01
Accurate determination of mixed mode stress intensity factors (SIFs) is essential in understanding and analysis of mixed mode fracture of engineering components. Only a few strain gage determination of mixed mode SIFs are reported in literatures and those also do not provide any prescription for radial locations of strain gages to ensure accuracy of measurement. The present investigation experimentally demonstrates the efficacy of a proposed methodology for the accurate determination of mixed mode I/II SIFs using strain gages. The proposed approach is based on the modified Dally and Berger's mixed mode technique. Using the proposed methodology appropriate gage locations (optimal locations) for a given configuration have also been suggested ensuring accurate determination of mixed mode SIFs. Experiments have been conducted by locating the gages at optimal and non-optimal locations to study the efficacy of the proposed approach. The experimental results from the present investigation show that highly accurate SIFs (0.064%) can be determined using the proposed approach if the gages are located at the suggested optimal locations. On the other hand, results also show the very high errors (212.22%) in measured SIFs possible if the gages are located at non-optimal locations. The present work thus clearly substantiates the importance of knowing the optimal locations of the strain gages apriori in accurate determination of SIFs.
Amperometric Bioelectronic Tongue for glucose determination
Directory of Open Access Journals (Sweden)
Yazan Al-Issa
2015-03-01
Full Text Available An amperometric Bioelectronic Tongue is reported for glucose determination that contains eight sensor electrodes constructed using different metal electrodes (Pt, Au, oxidoreductase enzymes (glucose oxidase, ascorbate oxidase, uricase, and membrane coatings (Nafion, chitosan. The response to varying concentrations of glucose, ascorbic acid, uric acid, and acetaminophen was tested for two models, concentration determination by current density measurements at individual electrodes and concentration determination by a linear regression model for the entire electrode array. The reduced chi-squared for the full array model was found to be about one order of magnitude lower than that for the individual-electrode model. Discrimination of glucose from chemical interference by the other three species is accomplished through a combination of enzyme catalysis, metal electrocatalysis, and membrane surface charge. The benefit of incorporating enzyme electrodes into the sensor array is illustrated by the lower correlation coefficients between different enzyme electrodes relative to non-enzyme coated electrodes. This approach can be more generally applied to detection of other substrates of oxidoreductase enzymes.
Determining fissile content of nuclear fuel elements
International Nuclear Information System (INIS)
Arya, S.P.; Grossman, L.N.; Schoenig, F.C.
1980-01-01
This invention relates to the determination of the fissile fuel content of fuel for nuclear reactors. A nondestructive method is described for determining rapidly, accurately and simultaneously the fissile content, enrichment and location of fuel material which may also contain amounts of burnable poison, by detecting the γ-rays emitted from the fuel material due to natural radioactive decay. (U.K.)
2015 Annual Report on Security Clearance Determinations
2016-06-28
only have delegated investigative authority over their civilian employee population and therefore, can only report the overall timeliness for that...completed or pending security clearance determinations for government employees and contractors during the preceding fiscal year that have taken longer...Clearance Determinations to Congress. The IAA directs this report to include the number of United States Government (USG) employees who held a
Determination of low carbon content in uranium
International Nuclear Information System (INIS)
Champeix, L.; Chevilliard, H.; Ponty, J.
1960-01-01
The method of carbon determination previously used for low carbon steels has been applied to uranium. Carbon contents down to a few tens p.p.m. and probably to a few p.p.m., can be determined with satisfactory precision, sensibility and accuracy. Reprint of a paper published in 'Memoires Scientifiques Rev. Metallurg.', LVI, n. 7, 1959, p. 657-662 [fr
Institutional Determinants of International Production in Russia
Directory of Open Access Journals (Sweden)
N A Volgina
2009-06-01
Full Text Available The article analyses institutional determinants of foreign direct investment that substantially influences international production in Russia. Author pays special attention on the following determinants as legal infrastructure, protection property rights, including intellectual property, effectiveness of enforcement mechanisms, and corruption. Author comes to a conclusion that without development of proper institutions Russia would hardly expect dynamic development of international production.
Energy Technology Data Exchange (ETDEWEB)
Chambers, D. [Lawrence Livermore National Lab., CA (United States)
1994-11-15
The ultimate goal of the Current Meter Array (CMA) is to be able to compare the current patterns detected with the array with radar images of the water surface. The internal wave current patterns modulate the waves on the water surface giving a detectable modulation of the radar cross-section (RCS). The function relating the RCS modulations to the current patterns is the Modulation Transfer Function (MTF). By comparing radar images directly with co-located CMA measurements the MTF can be determined. In this talk radar images and CMA measurements from a recent experiment at Loch Linnhe, Scotland, will be used to make the first direct determination of MTF for an X and S band radar at low grazing angles. The technical problems associated with comparing radar images to CMA data will be explained and the solution method discussed. The results suggest the both current and strain rate contribute equally to the radar modulation for X band. For S band, the strain rate contributes more than the current. The magnitude of the MTF and the RCS modulations are consistent with previous estimates when the wind is blowing perpendicular to the radar look direction.
Determinants of Discretionary Investments
Directory of Open Access Journals (Sweden)
K. S. Sujit
2016-03-01
Full Text Available Theoretical and empirical studies have focused on discretionary investments such as research and development (R&D and advertisement as value-creating activities. This empirical research article examines the determinants of the discretionary investment policy of food sector firms in India. The study aims to analyze the impact of financial policies and firm characteristics on the discretionary investment strategy of the food industry firms. The article uses the partial least squares structural equation modeling (PLS-SEM to understand the drivers of discretionary investment policy of food sector firms. The study finds that investment policy of firms is a major determinant of profitability of food sector firms. Higher investments in capital expenditures and working capital result in higher profitability. Management efficiency significantly influences firm profitability. The results suggest that riskier firms in food sector might focus on R&D investments as a strategy to generate more cash flows. Size of firm is negatively related to R&D intensity. Smaller firms in food sector tend to invest more in R&D. The study does not provide evidence to suggest that profitable firms invest more in R&D activities.
Radiographic versus electronic root canal working length determination
Directory of Open Access Journals (Sweden)
Lumnije Kqiku
2011-01-01
Conclusions: The present ex vivo study showed that electronic root canal working length determination is not superior to radiographic methods. Both methods provided a good performance in determining the root canal working length.
Network mapping and usage determination
CSIR Research Space (South Africa)
Senekal, FP
2007-07-01
Full Text Available detection. Based on this information, topology determination techniques can be applied to infer network structure from the information. Techniques to visualise the information are discussed. IP geolocation (the ability to associate a geographical coordinate...
Determining probabilities of geologic events and processes
International Nuclear Information System (INIS)
Hunter, R.L.; Mann, C.J.; Cranwell, R.M.
1985-01-01
The Environmental Protection Agency has recently published a probabilistic standard for releases of high-level radioactive waste from a mined geologic repository. The standard sets limits for contaminant releases with more than one chance in 100 of occurring within 10,000 years, and less strict limits for releases of lower probability. The standard offers no methods for determining probabilities of geologic events and processes, and no consensus exists in the waste-management community on how to do this. Sandia National Laboratories is developing a general method for determining probabilities of a given set of geologic events and processes. In addition, we will develop a repeatable method for dealing with events and processes whose probability cannot be determined. 22 refs., 4 figs
Determining "small parameters" for quasi-steady state
Goeke, Alexandra; Walcher, Sebastian; Zerz, Eva
2015-08-01
For a parameter-dependent system of ordinary differential equations we present a systematic approach to the determination of parameter values near which singular perturbation scenarios (in the sense of Tikhonov and Fenichel) arise. We call these special values Tikhonov-Fenichel parameter values. The principal application we intend is to equations that describe chemical reactions, in the context of quasi-steady state (or partial equilibrium) settings. Such equations have rational (or even polynomial) right-hand side. We determine the structure of the set of Tikhonov-Fenichel parameter values as a semi-algebraic set, and present an algorithmic approach to their explicit determination, using Groebner bases. Examples and applications (which include the irreversible and reversible Michaelis-Menten systems) illustrate that the approach is rather easy to implement.
Polarographic determination of trace amounts of thorium
Energy Technology Data Exchange (ETDEWEB)
Zaofan Zhao; Xiaohua Cai; Peibiao Li; Handong Yang
1986-07-01
A sensitive linear-sweep polarographic method for the determination of thorium is described. It is based on the thorium complex with Xylidyl Blue I (XBI) in a medium containing ethylenediamine, 1, 10-phenanthroline, oxalic acid and ninhydrin, at pH 10.5-11.5. The complex has been proved to be Th(XBI)/sub 2/, with log ..beta..'=9.6. The method can be used to determine trace amounts of thorium over the range 3.5x10/sup -8/-3x10/sup -6/M. The detection limit is 1x10/sup -8/M. A solvent extraction procedure is necessary to eliminate interference from several cations. The method has been applied to determination of traces of thorium in minerals, with good results.
Rentzelas, Panagiotis
2009-01-01
The main aim of this thesis was to examine the role of individualism and collectivism as situational group norms on intrinsic motivation. A further aim was to examine the effect of individual differences in individualist and collectivist orientations on the effect of autonomous motivation on intention and behaviour. This research integrated the concept of self-determined and intrinsic motivation as postulated in Self-Determination Theory (Deci & Ryan, 1985a, 2000,2002), individualism and coll...
International Nuclear Information System (INIS)
Iha, C.; Sood, S.P.; Sato, I.M.
1985-01-01
The analysis of Zr and Hf by X-ray fluorescence was studied. The thin film technique for sample preparation by deposition of precipitate on the filter paper was used. The K sub(α) line of Zr and L sub(β) 1 line of Hf were considered for the analysis. The behaviour of fluorescence intensity ratio with the corresponding mass ratio was also studied. The direct determination of Hf in concentrations between 2 and 95% in samples without any separation was investigated. For Hf concentrations lower than 2%, a method for its enrichment was standardized. (Author) [pt
Substoichiometric determination of selenium with potassium ethyl xanthate
International Nuclear Information System (INIS)
Chandrasekhar Reddy, P.; Polaiah, B.; Rangamannar, B.
1989-01-01
A substoichiometric radiochemical method was developed for the determination of selenium with potassium ethyl xanthate. The selenium ethyl xanthate complex formed was extracted into chloroform from borate buffer at pH 5. The effect of foreign ions on the extraction was studied. Microgram quantities of selenium could be conveniently determined with a fair degree of accuracy. The method was successfully applied for the determination of selenium content in food stuffs such as 'Jaggery' and 'Wheat powder'. (author) 4 refs.; 3 figs
Burnup determination of mass spectrometry for nuclear fuels
International Nuclear Information System (INIS)
Zhang Chunhua.
1987-01-01
The various methods currently being used in burnup determination of nuclear fuels are studied and reviewed. The mass spectrometry method of destructive testing is discussed emphatically. The burnup determination of mass spectrometry includes heavy isotopic abundance ratio method and isotope dilution mass spectrometry used as burnup indicator for the fission products. The former is applied to high burnup level, but the later to various burnup level. According to experiences, some problems which should be noticed in burnup determination of mass spectrometry are presented
Gas chromatographic determination of impurities of inorganic compounds
International Nuclear Information System (INIS)
Drugov, Yu.S.
1985-01-01
Methods of concentration, separation, detection in gas chromatographic determination of impurities of inorganic compounds including low-boiling gases, reactive gases, organometallic compounds, free metals, anions, etc. are reviewed. Methods of reaction gas chromatography for determining reactive gases, water, anions, metal chelates are considered in detail as well as methods of reaction-sorption concentration and reaction gas extraction. The application of gas chromatograpny ior anaiysis of water and atmosphere contamination, for determination of impurities in highly pure solid substances and gases is described
Experimental determination of thermodynamic equilibrium in biocatalytic transamination
DEFF Research Database (Denmark)
Tufvesson, Pär; Jensen, Jacob Skibsted; Kroutil, Wolfgang
2012-01-01
The equilibrium constant is a critical parameter for making rational design choices in biocatalytic transamination for the synthesis of chiral amines. However, very few reports are available in the scientific literature determining the equilibrium constant (K) for the transamination of ketones....... Various methods for determining (or estimating) equilibrium have previously been suggested, both experimental as well as computational (based on group contribution methods). However, none of these were found suitable for determining the equilibrium constant for the transamination of ketones. Therefore...
42 CFR 124.511 - Investigation and determination of compliance.
2010-10-01
...) Determinations of financial inability. In determining whether a facility was or is financially able to meet its annual compliance level, the Secretary will consider any comments submitted by interested parties. In making this determination, the Secretary will consider factors such as: (1) The ratio of revenues to...
Socio-demographic determinants of stigma among patients with ...
African Journals Online (AJOL)
Administrator
2011-08-01
Aug 1, 2011 ... stigma and discrimination. ... Healthcare workers and policy makers need to pay closer attention to the identified determinants for ... Analysis was done using the Statistical ... determine whether or not patients obtained support.
Determinants of marketing efficiency for sweetpotato in Nasarawa ...
African Journals Online (AJOL)
Determinants of marketing efficiency for sweetpotato in Nasarawa State and ... The study was conducted to assess the determinants of sweet potato marketing efficiency in Nasarawa State and FCT. ... EMAIL FULL TEXT EMAIL FULL TEXT
Chemical methods for the determination of composition of cryolite
International Nuclear Information System (INIS)
Shivarudrappa, V.; Patil, B.N.; Marathe, S.G.; Jain, H.C.
1989-01-01
Preparation of uranium and plutonium alloys containing aluminium involves the use of cryolite and many times, cryolite which may be contaminated with alpha activity has to be analysed for its purity. In view of this, chemical methods for the determination of composition of commercial cryolite samples have been developed. Methods are standardised for the determination of individual constituents of cryolite viz., aluminium, sodium, fluoride and major impurities, calcium and magnesium. Studies on the dissolution of the sample, effect of one or more components on the determination of the other and their elimination are carried out. Aluminium and sodium are determined gravimetrically as oxinate and triple acetate respectively. Fluoride is determined by a volumetric procedure after cation exchange separtion of soluble fluoride. Calcium and magnesium are determined by a sequential pH-metri titration. This report describes the details of the procedures and the results of these studies for two commercial cryolite samples. (author). 7 tabs
A Review of Sex Determining Mechanisms in Geckos (Gekkota: Squamata)
Gamble, T.
2010-01-01
Geckos are a species-rich clade of reptiles possessing diverse sex determining mechanisms. Some species possess genetic sex determination, with both male and female heterogamety, while other species have temperature-dependent sex determination. I compiled information from the literature on the taxonomic distribution of these sex determining mechanisms in geckos. Using phylogenetic data from the literature, I reconstructed the minimum number of transitions among these sex determining mechanism...
Energy determination at BEPC-II
International Nuclear Information System (INIS)
Achasov, M.N.; Blinov, V.E.; Bogomyagkov, A.V.; Fu ChengDong; Harris, F.A.; Kaminsky, V.V.; Liu, Q.; Mo Xiaohu; Muchnoi, N.Yu.; Nikitin, S.A.; Nikolaev, I.B.; Qin Qing; Qu Huamin; Olsen, S.L.; Pyata, E.E.; Shamov, A.G.; Shen, C.P.; Varner, G.S.; Wang Yifang; Xu Jinqiang
2009-01-01
The BEPC-II collider beam energy calibration system is discussed. The system is based on the Compton backscattering method. The expected precision of the electron and positron beam energy ε determination is δε/ε∼3.10 -5 .
Differential spectrophotometric determination of plutonium
International Nuclear Information System (INIS)
Lecat, J.
1980-01-01
Differential spectrophotometric method is used for determination of plutonium reduced to oxydation state III+ by ascorbic acid, at 560 nm. Concentration of solutions is 4 g/l and accuracy of the method is better than 0,3% [fr
Efficient GPS Position Determination Algorithms
National Research Council Canada - National Science Library
Nguyen, Thao Q
2007-01-01
... differential GPS algorithm for a network of users. The stand-alone user GPS algorithm is a direct, closed-form, and efficient new position determination algorithm that exploits the closed-form solution of the GPS trilateration equations and works...
Experimental determination of thermodynamic equilibrium in biocatalytic transamination.
Tufvesson, Pär; Jensen, Jacob S; Kroutil, Wolfgang; Woodley, John M
2012-08-01
The equilibrium constant is a critical parameter for making rational design choices in biocatalytic transamination for the synthesis of chiral amines. However, very few reports are available in the scientific literature determining the equilibrium constant (K) for the transamination of ketones. Various methods for determining (or estimating) equilibrium have previously been suggested, both experimental as well as computational (based on group contribution methods). However, none of these were found suitable for determining the equilibrium constant for the transamination of ketones. Therefore, in this communication we suggest a simple experimental methodology which we hope will stimulate more accurate determination of thermodynamic equilibria when reporting the results of transaminase-catalyzed reactions in order to increase understanding of the relationship between substrate and product molecular structure on reaction thermodynamics. Copyright © 2012 Wiley Periodicals, Inc.
Determining the hydrolysis of cations: A short overview
International Nuclear Information System (INIS)
Ekberg, Christian; Brown, Paul L.
2006-01-01
Full text: The hydrolysis of metal ions is the most fundamental aqueous chemistry. As soon as the metal is introduced to water, dissolution may take place and if the water is pure only hydrolysis reactions will take place. There are several methods used in the literature to determine the stability constants of these reactions, e.g. solvent extraction, potentiometric titrations, ion exchange and solubility measurements. Which one to select is not straight forward. All of them have pros and cons and different regions of applicability with respect to whether they are good for determining the initial hydrolysis or the later stages. Once the constants are determined it is important to assess the uncertainty in the determination. We point out tools to make this straight forward and traceable which is most important in scientific studies. (authors)
Radiometric potassium determination in NPK and GVH fertilizers
International Nuclear Information System (INIS)
Piatrik, M.; Lesny, J.; Varga, S.
1979-01-01
With a view to determination accuracy, a large-volume scintillation detector was used placed in the middle of a large-volume sample. The calibration curve technique was used for the potassium determination. The dependence was determined of count rate on the scintillator volume and the sample weight. The variation was established of the relative count rate error in % with the scintillator detection volume for 8 kg of the GVH fertilizer. The relative error value for a 2200 cm 3 detector was extrapolated. The technological configuration is shown of 40 K gamma detection in granulated fertilizers. For a weight of 200 to 300 kg of the fertilizer in a container and for a measurement time of 10O s, the K 2 O determination accuracy was +-0.14%. (J.P.)
A Review of Sex Determining Mechanisms in Geckos (Gekkota: Squamata)
Gamble, T.
2010-01-01
Geckos are a species-rich clade of reptiles possessing diverse sex determining mechanisms. Some species possess genetic sex determination, with both male and female heterogamety, while other species have temperature-dependent sex determination. I compiled information from the literature on the taxonomic distribution of these sex determining mechanisms in geckos. Using phylogenetic data from the literature, I reconstructed the minimum number of transitions among these sex determining mechanisms with parsimony-based ancestral state reconstruction. While only a small number of gecko species have been characterized, numerous changes among sex determining mechanisms were inferred. This diversity, coupled with the high frequency of transitions, makes geckos excellent candidates as a model clade for the study of vertebrate sex determination and evolution. PMID:20234154
Satellite Photometric Error Determination
2015-10-18
Satellite Photometric Error Determination Tamara E. Payne, Philip J. Castro, Stephen A. Gregory Applied Optimization 714 East Monument Ave, Suite...advocate the adoption of new techniques based on in-frame photometric calibrations enabled by newly available all-sky star catalogs that contain highly...filter systems will likely be supplanted by the Sloan based filter systems. The Johnson photometric system is a set of filters in the optical
Determining Factors of Subsidiary Development
DEFF Research Database (Denmark)
Pedersen, Torben
(the depth of activities) and level of integration in the internal MNC-network. Birkinshaw and Hood (1998a) have in their seminal paper proposed a model where subsidiary development is determined by three factors: Headquarter assignment, dynamism of local business environment and subsidiary initiatives......Subsidiary development is a multi-dimensional construct that cannot be captured just by looking at subsidiary roles, activities, etc. Three distinct dimensions of subsidiary development are identified and these are: scope of subsidiary (the breadth of activities), level of subsidiary competence....... This paper is the first to conduct a statistical test of this model on a large-sample data set including data of more than 2.100 subsidiaries located in seven different countries in Europe. The effect of the three determining factors on subsidiary development is tested simultaneously in a LISREL model....
Ion chromatographic determination of sulfites in foods.
Anderson, C; Warner, C R; Daniels, D H; Padgett, K L
1986-01-01
Ion chromatography (IC) is shown to be a promising technique for the determination of sulfites (SO2, SO2/3-) in foods. Results of a 10 min flash distillation and 10 min IC determination compare favorably with the results from the conventional Monier-Williams method for total sulfite in a variety of food matrices. The IC technique also provides a wealth of additional information, such as (1) sulfite and sulfate (oxidized sulfite) content of the spiking or treatment solution, (2) residual sulfite applied to the food after oxidation losses in the treatment process, (3) free sulfite in foods, and (4) total sulfite in foods. As a further check on the Monier-Williams method, the sulfate content of the trapping solution can be determined by IC. Because the IC technique traps the liberated SO2 in a non-oxidizing rather than an oxidizing medium, it is considered free from interfering sulfides and organic sulfur-containing groups which can give false positives in the Monier-Williams method. IC thus offers a high speed, more sensitive, and cost-effective alternative to conventional techniques for the determination of sulfite in foods.
14 CFR 272.5 - Determination of essential air service.
2010-01-01
... (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS ESSENTIAL AIR SERVICE TO THE FREELY ASSOCIATED STATES § 272.5 Determination of essential air service. Procedures for the determination of essential air service under this... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Determination of essential air service. 272...