
Sample records for chi resonances

  1. Anomalous effect in Schumann resonance phenomena observed in Japan, possibly associated with the Chi-chi earthquake in Taiwan

    Directory of Open Access Journals (Sweden)

    M. Hayakawa


    Full Text Available The Schumann resonance phenomenon has been monitored at Nakatsugawa (near Nagoya in Japan since the beginning of 1999, and due to the occurance of a severe earthquake (so-called Chi-chi earthquake on 21 September 1999 in Taiwan we have examined our Schumann resonance data at Nakatsugawa during the entire year of 1999. We have found a very anomalous effect in the Schumann resonance, possibly associated with two large land earthquakes (one is the Chi-chi earthquake and another one on 2 November 1999 (Chia-yi earthquake with a magnitude again greater than 6.0. Conspicuous effects are observed for the larger Chi-chi earthquake, so that we summarize the characteristics for this event. The anomaly is characterized mainly by the unusual increase in amplitude of the fourth Schumann resonance mode and a significant frequency shift of its peak frequency (~1.0Hz from the conventional value on the By magnetic field component which is sensitive to the waves propagating in the NS meridian plane. Anomalous Schumann resonance signals appeared from about one week to a few days before the main shock. Secondly, the goniometric estimation of the arrival angle of the anomalous signal is found to coincide with the Taiwan azimuth (the unresolved dual direction indicates toward South America. Also, the pulsed signals, such as the Q-bursts, were simultaneously observed with the "carrier" frequency around the peak frequency of the fourth Schumann resonance mode. The anomaly for the second event for the Chia-yi earthquake on 2 November had much in common. But, most likely due to a small magnitude, the anomaly appears one day before and lasts until one day after the main shock, with the enhancement at the fourth Schumann resonance mode being smaller in amplitude than the case of the Chi-chi earthquake. Yet, the other characteristics, including the goniometric direction finding result, frequency shift, etc., are nearly the same. Although the emphasis of

  2. Study of the decay $B^0 \\to \\chi_{c1} K^+ \\pi^-$ and search of exotic resonances at LHCb

    CERN Document Server

    Sbordone, Francesco; Alves Junior, Antonio Augusto

    In 2008 the Belle Collaboration reported the observation of two charged resonance-like structures in the ${\\chi_c}_1 \\pi^-$ mass spectrum produced in the decay $B^0 \\to {\\chi_c}_1 K^+ \\pi^-$. These were labelled as $Z_1(4050)^-$ and $Z_2(4250)^-$. Alternatively, a single wider resonance hypothesis was also pursued by Belle, and labelled as $Z(4150)^-$. The fact that these are charged states would be a clear sample, if they really exist, of four quark bound systems; for this reason this observation has given rise to a great deal of interest. In 2012 the BABAR Collaboration has searched for these resonances in the channels $B^{0,+} \\to {\\chi_c}_1 K^{+,0} \\pi^-$ and did not find any evidence of them. In this thesis a search for these claimed exotic charmonium-like states $Z_1(4050)^-$ and $Z_2(4250)^-$ is presented, in the decay $B^0 \\to {\\chi_c}_1 K^+ \\pi^-$, where ${\\chi_c}_1 \\to J/\\psi \\gamma$ and $J/\\psi \\to \\mu^+ \\mu^-$. Charged conjugate are implied throughout the whole thesis. The analysis is performed us...

  3. $\\chi_{c1}$ and $\\chi_{c2}$ production at $e^+e^-$ colliders

    CERN Document Server

    Czyz, Henryk; Tracz, Szymon


    Direct, resonant production of the charmonium states $\\chi_{c1}$ and $\\chi_{c2}$ in electron-positron annihilation is investigated. Depending on details of the model, a sizeable variation of the prediction for the production cross section is anticipated. It is demonstrated that resonant production could be observed under favorable circumstances.

  4. CHY formula and MHV amplitudes

    CERN Document Server

    Du, Yi-jian; Wu, Yong-shi


    In this paper, we study the relation between the Cachazo-He-Yuan (CHY) formula and the maximal-helicity-violating (MHV) amplitudes of Yang-Mills and gravity in four dimensions. We prove that only one special rational solution of the scattering equations found by Weinzierl support the MHV amplitudes. Namely, localized at this solution, the integrated CHY formula reproduces the Parke-Taylor formula for Yang-Mills amplitudes as well as the Hodges formula for gravitational amplitudes. This is achieved by developing techniques, in a manifestly M\\"obius covariant formalism, to explicitly compute relevant reduced Pfaffians/determinants. We observe and prove two interesting properties (or identities), which facilitate the computations. We also check that all the other $(n-3)!-1$ solutions to the scattering equations do not support the MHV amplitudes, and prove analytically that this is indeed true for the other special rational solution proposed by Weinzierl, that actually supports the anti-MHV amplitudes.

  5. The CHI 2013 interactive schedule

    DEFF Research Database (Denmark)

    Satyanarayan, Arvind; Strazzulla, Daniel; Klokmose, Clemens Nylandsted;


    available. The CHI'13 Interactive Schedule helps attendees navigate this wealth of video content in order to identify events they would like to attend. It consists of a number of large display screens throughout the conference venue which cycle through a video playlist of events. Attendees can interact with...... these displays using their mobile devices by either constructing custom video playlists or adding on-screen content to their personal schedule....

  6. CHY formula and MHV amplitudes (United States)

    Du, Yi-Jian; Teng, Fei; Wu, Yong-Shi


    In this paper, we study the relation between the Cachazo-He-Yuan (CHY) formula and the maximal-helicity-violating (MHV) amplitudes of Yang-Mills and gravity in four dimensions. We prove that only one special rational solution of the scattering equations found by Weinzierl supports the MHV amplitudes. Namely, localized at this solution, the integrated CHY formula produces the Parke-Taylor formula for MHV Yang-Mills amplitudes as well as the Hodges formula for MHV gravitational amplitudes, with an arbitrary number of external gluons/gravitons. This is achieved by developing techniques, in a manifestly Möbius covariant formalism, to explicitly compute relevant reduced Pfaffians/determinants. We observe and prove two interesting properties (or identities), which facilitate the computations. We also check that all the other ( n - 3)! - 1 solutions to the scattering equations do not support the MHV amplitudes, and prove analytically that this is indeed true for the other special rational solution proposed by Weinzierl, that actually supports the anti-MHV amplitudes. Our results reveal a mysterious feature of the CHY formalism that in Yang-Mills and gravity theory, solutions of scattering equations, involving only external momenta, somehow know about the configuration of external polarizations of the scattering amplitudes.

  7. First Observation of Exclusive chi_cJ Decays to Two Charged and Two Neutral Hadrons


    Q. He


    We study exclusive chi_c0, chi_c1 and chi_c2 decays to four-hadron final states involving two charged and two neutral mesons: pi^+pi^-pi^0pi^0, K^+K^-pi^0pi^0, pppi^0pi^0, K^+K^-etapi^0, and K^+-pi^-+K^0pi^0o. The chi_c states are produced in radiative decays of 3.08 million psi-prime resonance decays and observed in the CLEO detector. We also measure the largest substructure contributions to the modes pi^+pi^-pi^0pi^0 and K^+-pi^-+K^0pi^0.

  8. Tai Chi: Rx for Arthritic Knees (United States)

    ... that tai chi can be effective in helping sleep, while reducing stress, anxiety and depression. "The mind component [of tai chi] promotes psychological well-being, life satisfaction, and improved perceptions of health," said Wang. Dr. Matthew Hepinstall, an ...

  9. Biomedical wellness by tai chi and sports (United States)

    Chin, Daniel C.; Chin, Amita G.


    Tai-chi chuan is popular worldwide especially in China. People practice tai-chi chuan daily with faith believing that they will be rewarded with health and varieties of other rewords. The Tai Chi Chuan Theory by Master Chang and the Tai Chi Chuan Theory by Master Wang are translated to be the baseline of the tai-chi chuan. The theory described in these two papers clearly shows that the tai-chi power source is the combination of the two antigravity forces distinction by each foot. The ying, yang and hollowed, solid discussed in the papers are the properties and body relationship of the two antigravity forces. The antigravity forces presented inside of body are as air to the balloon termed chi. However chi could be generated by any muscle pressing; only the antigravity forces from feet are called nature chi that has the maximum strength of the person. When a person is soft, as an infant the nature chi will fulfill entire body with no time and effort. The sequence forms were designed for deploying the nature chi in speed and power. The combination of chi and tai-chi form make tai chi chuan supreme than other kinds of martial art. In the training process chi massages whole body many time for a sequence form practice that stimulate all organs and could lead to cure body diseases, lose weight, postpone aging process, and remove the aging symptoms. For the people practicing in the park daily with proper guidance they will fulfill their wishes. Tai chi exercise could also apply to other sports as in dancing and golfing they are discussed at the end of the paper.

  10. Chi activity during transduction-associated recombination.


    Dower, N. A.; Stahl, F. W.


    Chi is a genetic element that stimulates phage lambda recombination by the Escherichia coli recBC pathway during lytic infection [Stahl, F. W. (1979) Annu. Rev. Genet. 13, 7--24]. Herein we show that chi in lambda prophage influences exchange distribution in P1 phage-mediated transduction and in conjugation. This demonstration encourages the view that chi may influence genetic exchange in E. coli in the total absence of lambda.

  11. Tai Chi philosophy and nursing epistemology. (United States)

    Alperson, Sunny Yim


    This article analyzes the philosophy underpinning Tai Chi practice in light of nursing epistemology. The first half of the article reviews the general characteristics of major Chinese philosophical traditions that have been merged in Tai Chi: Confucianism, Daoism, and Buddhism. In the second half, themes of integration and praxis in Tai Chi are linked with Carper's fundamental patterns of knowing in nursing. Tai Chi is a practical fusion of humanistic philosophy with an experiential dimension of movement in a nondualistic foundation. The author argues that TC philosophy can be applied to integrated knowledge development and nursing praxis. PMID:20531257

  12. $\\chi_{c2}$ formation in two-photon collisions at LEP

    CERN Document Server

    Acciarri, M; Adriani, O; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Balandras, A; Ball, R C; Banerjee, S; Banerjee, Sw; Banicz, K; Barczyk, A; Barillère, R; Barone, L; Bartalini, P; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brigljevic, V; Brochu, F; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Button, A M; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chéreau, X J; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Coignet, G; Colijn, A P; Colino, N; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; van Dalen, J A; D'Alessandro, R; De Asmundis, R; Déglon, P L; Degré, A; Deiters, K; Della Volpe, D; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Dufournaud, D; Duinker, P; Durán, I; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Extermann, Pierre; Fabre, M; Faccini, R; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Goldfarb, S; Gong, Z F; Grünewald, M W; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hartmann, B; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hidas, P; Hirschfelder, J; Hofer, H; Holzner, G; Hoorani, H; Hou, S R; Iashvili, I; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Khan, R A; Kamrad, D; Kapustinsky, J S; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, D H; Kim, J K; Kim, S C; Kinnison, W W; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopp, A; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Lacentre, P E; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lavorato, A; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee, H J; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Marchesini, P A; Marian, G; Martin, J P; Marzano, F; Massaro, G G G; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Migani, D; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moulik, T; Muanza, G S; Muheim, F; Muijs, A J M; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nippe, A; Nisati, A; Nowak, H; Oh, Yu D; Organtini, G; Ostonen, R; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Park, I H; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pedace, M; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Piccolo, D; Pieri, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Pothier, J; Produit, N; Prokofev, D; Prokofiev, D O; Quartieri, J; Rahal-Callot, G; Raja, N; Rancoita, P G; Raven, G; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Robohm, A; Rodin, J; Roe, B P; Romero, L; Rosier-Lees, S; Roth, S; Rubio, Juan Antonio; Ruschmeier, D; Rykaczewski, H; Sakar, S; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stone, H; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Suter, H; Swain, J D; Szillási, Z; Tang, X W; Tauscher, Ludwig; Taylor, L; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Uchida, Y; Ulbricht, J; Valente, E; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Z M; Weber, A; Wilkens, H; Wu, S X; Wynhoff, S; Xia, L; Xu, Z Z; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zeng, Y; Zhang, Z P; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F; Zilizi, G


    Two-photon formation of the charmonium resonance $\\chi_{{\\rm c}2}$ has been studied with the L3 detector at LEP. The $\\chi_{{\\rm c}2}$ is identified through its decay $\\chi_{{\\rm c}2} \\rightarrow \\gamma {\\rm J}$, with a subsequent decay ${\\rm J} \\rightarrow {\\mathrm{e^+ e^-}}$ or ${\\rm J} \\rightarrow {\\mathrm{\\mu^+ \\mu^-}}$. With an integrated luminosity of 140 pb$^{-1}$ at $\\sqrt{s} \\simeq$ 91~\\textrm{Ge\\kern -0.1em V} and 52 pb$^{-1}$ at $\\sqrt{s} \\simeq$ {Ge\\kern -0.1em V}, we measure the two-photon width of the $\\chi_{{\\rm c}2}$ to be \\begin{center} $\\Gamma_{\\gamma\\gamma}(\\chi_{{\\rm c}2})=1.02 \\pm 0.40 \\mbox{$\\;$(stat.)} \\pm 0.15 \\mbox{$\\;$(sys.)} \\pm 0.09(\\rm{BR.}) {\\mathrm{\\ ke\\kern -0.1em V}}$.

  13. Healing of subsurface damage after the 1999 Chi-Chi earthquake (United States)

    Chen, K. H.; Rau, R.; Dreger, D. S.


    Observation of six M 4.6 repeating earthquakes in eastern Taiwan from 1991 to 2007 reveals a unique temporal and spatial variation in seismic wave character associated with the 1999 Mw 7.6 Chi-Chi earthquakes that occurred ~90 km away. Post-Chi-Chi events have reduced waveform similarity, suggesting a sudden change of seismic wave propagation properties after the Chi-Chi event. The changes in seismic character are widely distributed over Taiwan and remain significant in 5 years after Chi-Chi. Since 2004, the waveform similarity gradually recovered to the pre-Chi-Chi level. The most recent repeating event occurred on 15 November 2007 reveals only a subtle variation in seismic character compared to the pre-Chi-Chi event. This indicates that the damaged rock has been regaining the strength with time. The healing of subsurface damage zone, however, is not fully complete even 8 yr after the Chi-Chi earthquake. Using cross correlation function derived time-lag between the pre- and post- Chi-Chi events, we also identify a ~1 sec delay for the 2001 repeating event at a number of stations. Such a large delay shown in different parts of seismograms for different stations may indicate a broad range of fluid-filled scatterers along the travel path. For the station with the longest distance from the M 4.6 event (~200 km), PNG station on Penghu island off the western coast of Taiwan, the 1sec delay appears on early P wave coda. This suggests that the scatterers are likely located down to a depth of at least 20 km.

  14. CHI: A General Agent Communication Framework

    Energy Technology Data Exchange (ETDEWEB)

    Goldsmith, S.Y.; Phillips, L.R.; Spires, S.V.


    We have completed and exercised a communication framework called CHI (CLOS to HTML Interface) by which agents can communicate with humans. CHI follows HTTP (HyperText Transfer Protocol) and produces HTML (HyperText Markup Language) for use by WWW (World-Wide Web) browsers. CHI enables the rapid and dynamic construction of interface mechanisms. The essence of CHI is automatic registration of dynamically generated interface elements to named objects in the agent's internal environment. The agent can access information in these objects at will. State is preserved, so an agent can pursue branching interaction sequences, activate failure recovery behaviors, and otherwise act opportunistically to maintain a conversation. The CHI mechanism remains transparent in multi-agent, multi-user environments because of automatically generated unique identifiers built into the CHI mechanism. In this paper we discuss design, language, implementation, and extension issues, and, by way of illustration, examine the use of the general CHI/HCHI mechanism in a specific international electronic commerce system. We conclude that the CHI mechanism is an effective, efficient, and extensible means of the agent/human communication.

  15. Observation of chi(cJ) decaying into the p(p)over-barK(+)K(-) final state

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Alberto, D.; An, L.; An, Q.; An, Z. H.; Bai, J. Z.; Baldini, R.; Ban, Y.; Becker, J.; Berger, N.; Bertani, M.; Bian, J. M.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Bytev, V.; Cai, X.; Cao, G. F.; Cao, X. X.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, Y.; Chen, Y. B.; Cheng, H. P.; Chu, Y. P.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dedovich, D.; Deng, Z. Y.; Denysenko, I.; Destefanis, M.; Ding, Y.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Fan, R. R.; Fang, J.; Fang, S. S.; Feng, C. Q.; Fu, C. D.; Fu, J. L.; Gao, Y.; Geng, C.; Goetzen, K.; Gong, W. X.; Greco, M.; Grishin, S.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y. P.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, M.; He, Z. Y.; Heng, Y. K.; Hou, Z. L.; Hu, H. M.; Hu, J. F.; Hu, T.; Huang, B.; Huang, G. M.; Huang, J. S.; Huang, X. T.; Huang, Y. P.; Hussain, T.; Ji, C. S.; Ji, Q.; Ji, X. B.; Ji, X. L.; Jia, L. K.; Jiang, L. L.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jing, F. F.; Kalantar-Nayestanaki, N.; Kavatsyuk, M.; Komamiya, S.; Kuehn, W.; Lange, J. S.; Leung, J. K. C.; Li, Cheng; Li, Cui; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, Lei; Li, N. B.; Li, Q. J.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, X. R.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Liao, X. T.; Liu, B. J.; Liu, B. J.; Liu, C. L.; Liu, C. X.; Liu, C. Y.; Liu, F. H.; Liu, Fang; Liu, G. C.; Liu, H.; Liu, H. B.; Liu, H. M.; Liu, H. W.; Liu, J. P.; Liu, K.; Liu, K. Y.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. H.; Liu, Y. B.; Liu, Y. W.; Liu, Yong; Liu, Z. A.; Liu, Z. Q.; Loehner, H.; Lu, G. R.; Lu, H. J.; Lu, J. G.; Lu, Q. W.; Lu, X. R.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Ma, C. L.; Ma, F. C.; Ma, H. L.; Ma, Q. M.; Ma, T.; Ma, X.; Ma, X. Y.; Maggiora, M.; Malik, Q. A.; Mao, H.; Mao, Y. J.; Mao, Z. P.; Messchendorp, J. G.; Min, J.; Mitchell, R. E.; Mo, X. H.; Muchnoi, N. Yu.; Nefedov, Y.; Ning, Z.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Pelizaeus, M.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Pun, C. S. J.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, X. S.; Qiu, J. F.; Rashid, K. H.; Rong, G.; Ruan, X. D.; Sarantsev, A.; Schulze, J.; Shao, M.; Shen, C. P.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, X. Y.; Sonoda, S.; Spataro, S.; Spruck, B.; Sun, D. H.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, X. D.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tang, X. F.; Tian, H. L.; Toth, D.; Varner, G. S.; Wan, X.; Wang, B. Q.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q.; Wang, S. G.; Wang, X. L.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. Y.; Wei, D. H.; Wen, Q. G.; Wen, S. P.; Wiedner, U.; Wu, L. H.; Wu, N.; Wu, W.; Wu, Z.; Xiao, Z. J.; Xie, Y. G.; Xu, G. F.; Xu, G. M.; Xu, H.; Xu, Y.; Xu, Z. R.; Xu, Z. Z.; Xue, Z.; Yan, L.; Yan, W. B.; Yan, Y. H.; Yang, H. X.; Yang, M.; Yang, T.; Yang, Y.; Yang, Y. X.; Ye, M.; Ye, M. H.; Yu, B. X.; Yu, C. X.; Yu, L.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, L.; Zhang, S. H.; Zhang, T. R.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, H. S.; Zhao, Jiawei; Zhao, Jingwei; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, X. H.; Zhao, Y. B.; Zhao, Z. G.; Zhao, Z. L.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, Y. H.; Zheng, Z. P.; Zhong, B.; Zhong, J.; Zhong, L.; Zhou, L.; Zhou, X. K.; Zhou, X. R.; Zhu, C.; Zhu, K.; Zhu, K. J.; Zhu, S. H.; Zhu, X. L.; Zhu, X. W.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Zuo, J. X.; Zweber, P.


    First measurements of the decays of the three chi(cJ) states to p (p) over barK(+)K(-) final states are presented. Intermediate phi -> K+K- and Lambda(1520) -> pK(-) resonance states are observed, and branching fractions for chi(cJ) -> (p) over barK(+) Lambda(1520), Lambda(1520)(Lambda) over bar (15

  16. Amplitude analyses of the decays chi_c1 -> eta pi+ pi- and chi_c1 -> eta' pi+ pi-

    CERN Document Server

    Adams, G S; Ecklund, K M; Insler, J; Muramatsu, H; Park, C S; Pearson, L J; Thorndike, E H; Ricciardi, S; Thomas, C; Artuso, M; Blusk, S; Mountain, R; Skwarnicki, T; Stone, S; Zhang, L M; Bonvicini, G; Cinabro, D; Lincoln, A; Smith, M J; Zhou, P; Zhu, J; Naik, P; Rademacker, J; Asner, D M; Edwards, K W; Randrianarivony, K; Tatishvili, G; Briere, R A; Vogel, H; Onyisi, P U E; Rosner, J L; Alexander, J P; Cassel, D G; Das, S; Ehrlich, R; Gibbons, L; Gray, S W; Hartill, D L; Heltsley, B K; Kreinick, D L; Kuznetsov, V E; Patterson, J R; Peterson, D; Riley, D; Ryd, A; Sadoff, A J; Shi, X; Sun, W M; Yelton, J; Rubin, P; Lowrey, N; Mehrabyan, S; Selen, M; Wiss, J; Libby, J; Kornicer, M; Mitchell, R E; Shepherd, M R; Szczepaniak, A; Besson, D; Pedlar, T K; Cronin-Hennessy, D; Hietala, J; Dobbs, S; Metreveli, Z; Seth, K K; Tomaradze, A; Xiao, T; Martin, L; Powell, A; Wilkinson, G; Ge, J Y; Miller, D H; Shipsey, I P J; Xin, B


    Using a data sample of 2.59 x 10^7 psi(2S) decays obtained with the CLEO-c detector, we perform amplitude analyses of the complementary decay chains chi_c1 -> eta pi+ pi- and chi_c1 -> eta' pi+ pi-. We find evidence for a P-wave eta' pi scattering amplitude, which, if interpreted as a resonance, would have exotic J^PC = 1^-+ and parameters consistent with the pi_1(1600) state reported in other production mechanisms. We also make the first observation of the decay a_0(980) -> eta' pi and measure the ratio of branching fractions B(a_0(980) -> eta' pi)/B(a_0(980) -> eta pi) = 0.064 +- 0.014 +- 0.014. The pi pi spectrum produced with a recoiling eta is compared to that with eta' recoil.

  17. Chi-Nu Level 2 Review

    Energy Technology Data Exchange (ETDEWEB)

    Haight, Robert Cameron [Los Alamos National Laboratory; Lee, Hye Young [Los Alamos National Laboratory; Mosby, Shea Morgan [Los Alamos National Laboratory; O' Donnell, John M. [Los Alamos National Laboratory; Solomon, Clell Jeffrey Jr. [Los Alamos National Laboratory; Taddeucci, Terry Nicholas [Los Alamos National Laboratory; Fotiadis, Nikolaos [Los Alamos National Laboratory; Devlin, Matthew James [Los Alamos National Laboratory; Ullmann, John Leonard [Los Alamos National Laboratory; Bredeweg, Todd Allen [Los Alamos National Laboratory; Jandel, Marian [Los Alamos National Laboratory; Nelson, Ronald Owen [Los Alamos National Laboratory; Wender, Stephen Arthur [Los Alamos National Laboratory; Neudecker, Denise [Los Alamos National Laboratory; Rising, Michael Evan [Los Alamos National Laboratory; White, Morgan Curtis [Los Alamos National Laboratory; Wu, Ching-Yen [Los Alamos National Laboratory; Bucher, Brian Michael [Los Alamos National Laboratory; Buckner, Matthew Quinn [Los Alamos National Laboratory; Henderson, Roger Alan [Los Alamos National Laboratory


    This series of slides presents information on Chi-Nu measurements and analysis of prompt fission neutron spectra (PFNS) for neutron energy below 1 MeV for 235U. A key focus of the Chi-Nu measurement is to address the energy dependence of the low-energy emissions. The 235U PFNS evaluation is in progress. Chi-Nu delivered preliminary experimental data and input for part of the old experimental data base. The 239Pu PFNS evaluation is finalized and submitted for testing. Data from 252Cf spontaneous fission will also be obtained.

  18. Resonances

    DEFF Research Database (Denmark)

    an impetus or drive to that account: change, innovation, rupture, or discontinuity. Resonances: Historical Essays on Continuity and Change explores the historiographical question of the modes of interrelation between these motifs in historical narratives. The essays in the collection attempt to...... realize theoretical consciousness through historical narrative ‘in practice’, by discussing selected historical topics from Western cultural history, within the disciplines of history, literature, visual arts, musicology, archaeology, philosophy, and theology. The title Resonances indicates the overall...

  19. Effective Field Theory and $\\chi$pt


    Holstein, Barry R.


    A brief introduction to the subject of chiral perturbation theory ($\\chi$pt) is given, including a discussion of effective field theory and application to the upcoming Bates virtual Compton scattering measurement.

  20. Gain Shift Corrections at Chi-Nu

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Tristan Brooks [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Univ. of Massachusetts, Lowell, MA (United States). Dept. of Physics and Applied Physics; Devlin, Matthew James [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)


    Ambient conditions have the potential to cause changes in liquid scintillator detector gain that vary with time and temperature. These gain shifts can lead to poor resolution in both energy as well as pulse shape discrimination. In order to correct for these shifts in the Chi-Nu high energy array, a laser system has been developed for calibration of the pulse height signals.

  1. Tai Chi, Qi Gong and Reiki. (United States)

    Chu, Dennis A


    Tai Chi, Qi Gong, and Reiki are complementary therapies that are gaining popularity with patients. Although these therapies seem simple and attractive in their philosophy and are easy to apply,more objective, well-designed research is needed to prove their efficacy and to gain acceptance from the medical community. PMID:15458751

  2. Tai Chi Chuan in Medicine and Health Promotion


    Ching Lan; Ssu-Yuan Chen; Jin-Shin Lai; Alice May-Kuen Wong


    Tai Chi Chuan (Tai Chi) is a Chinese traditional mind-body exercise and recently, it becomes popular worldwide. During the practice of Tai Chi, deep diaphragmatic breathing is integrated into body motions to achieve a harmonious balance between body and mind and to facilitate the flow of internal energy (Qi). Participants can choose to perform a complete set of Tai Chi or selected movements according to their needs. Previous research substantiates that Tai Chi has significant benefits to heal...

  3. Effect of near-fault earthquake on bridges: lessons learned from Chi-Chi earthquake

    Institute of Scientific and Technical Information of China (English)


    The objective of this paper is to describe the lessons learned and actions that have been taken related to the seismicdesign of bridge structures after the Chi-Chi, Taiwan earthquake. Much variable near-fault ground motion data was collected fromthe rupture of Chelungpu fault during the Chi-Chi earthquake, allowing the seismic response of bridge structures subjected to thesenear-fault ground motions to be carefully examined. To study the near-fault ground motion effect on bridge seismic design codes, atwo-level seismic design of bridge structures was developed and implemented. This design code reflects the near-fault factors in theseismic design forces. Finally, a risk assessment methodology, based on bridge vulnerability, is also developed to assist in decisionsfor reducing seismic risk due to failure of bridges.

  4. A precursory ULF signature for the Chi-Chi earthquake in Taiwan

    Directory of Open Access Journals (Sweden)

    Y. Akinaga


    Full Text Available ULF emission data at Lunping (epicentral distance, 120 km have been analysed for the Chi-Chi earthquake (with magnitude 7.6 and depth of 11 km in Taiwan which occurred on 21 September 1999. Simple intensity analyses have not yielded any significant results but we have found, based on the analysis of polarization (the ratio of vertical magnetic field component Z to the horizontal component G, that the polarization (Z/G showed a significant enhancement for two months before the earthquake. This kind of temporal evolution of polarization seems to be very similar to previous results, so that it is highly likely that this phenomenon may be associated with the Chi-Chi earthquake. Also, the comparison of the results of polarization analyses, by changing the signal threshold, has given us an approximate intensity of the seismogenic emission of the order of the monthly mean value.

  5. chi_{c1} and chi_{c2} decay angular distributions at the Fermilab Tevatron

    CERN Document Server

    Kniehl, Bernd A; Palisoc, C P


    We consider the hadroproduction of chi_{c1} and chi_{c2} mesons and their subsequent radiative decays to J/psi mesons and photons in the factorization formalism of nonrelativistic quantum chromodynamics, and study the decay angular distributions, by means of helicity density matrices, in view of their sensitivity to color-octet processes. We present numerical results appropriate for the Fermilab Tevatron.

  6. Barbed congruence of the asymmetric chi calculus

    Institute of Scientific and Technical Information of China (English)

    DONG Xiao-ju; FU Yu-xi


    The chi calculus is a model of mobile processes. It has evolved from the pi-calculus with motivations from simplification and communication-as-cut-elimination. This paper studies the chi calculus in the framework incorporating asymmetric communication. The major feature of the calculus is the identification of two actions:x/x and τ. The investigation on the barbed bisimilarity shows how the property affects the observational theory.Based on the definition of the barbed bisimilarity, the simulation properties of the barbed bisimilarity are studied. It shows that the algebraic properties of the barbed bisimilarity have changed greatly compared with the chi calculus. Although the definition of the barbed bisimilarity is very simple, the property of closeness under contexts makes it difficult to understand the barbed bisimilarity directly. Therefore an open style definition of the barbed bisimilarity is given, which is a context free description of barbed bisimilarity. Its definition is complex,but it is a well-behaved relation for it coincides with the barbed bisimilarity. It also helps to build an axiomatization system for the barbed congruence. Besides the axioms for the strong barbed bisimilarity, the paper proposes a new tau law and four new update laws for the barbed congruence. Both the operational and algebraic properties of the enriched calculus improve the understanding of the bisimulation behaviors of the model.

  7. Dicty_cDB: CHI518 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI518 (Link to dictyBase) - - - Contig-U11768-1 CHI518P (Link to Original ... CVRY YFKALVYSGKINKANLGMTKLPPPTKKMTKAAREALGSE--- ---skw *rnh*yqtnr*ckr*yfngscsfeccne*rskt*hcls*swscfgssnd*s ...

  8. Dicty_cDB: CHI394 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI394 (Link to dictyBase) - - - Contig-U16405-1 CHI394P (Link to Original ... sntvedctfdasglvyypkvynlkyskktkniw*ryshywlif kiiwws*fpy *fh*ck*tfcc--- ---TTFIGVRSGPSTTLTYIKPMISEIPTIENKIEK ...

  9. Search for the Z_1(4050)^+ and Z_2(4250)^+ States in bar B^0 to chi_{c1} K^- pi^+ and B^+ to chi_{c1} K^0_S pi^+

    Energy Technology Data Exchange (ETDEWEB)

    Lees, J.P.; Poireau, V.; Tisserand, V.; /Annecy, LAPP; Garra Tico, J.; Grauges, E.; /Barcelona U., ECM; Martinelli, M.; /INFN, Bari /Bari U.; Milanes, D.A.; /INFN, Bari; Palano, A.; Pappagallo, M.; /INFN, Bari /Bari U.; Eigen, G.; Stugu, B.; /Bergen U.; Brown, D.N.; Kerth, L.T.; Kolomensky, Yu.G.; Lynch, G.; /UC, Berkeley; Koch, H.; Schroeder, T.; /Ruhr U., Bochum; Asgeirsson, D.J.; Hearty, C.; Mattison, T.S.; McKenna, J.A.; /British Columbia U. /Brunel U. /Novosibirsk, IYF /UC, Irvine /UC, Riverside /UC, Santa Barbara /UC, Santa Cruz /Caltech /Cincinnati U. /Colorado U. /Colorado State U. /Dortmund U. /Dresden, Tech. U. /Ecole Polytechnique /Edinburgh U. /INFN, Ferrara /Ferrara U. /INFN, Ferrara /Ferrara U. /INFN, Ferrara /Frascati /INFN, Genoa /Genoa U. /INFN, Genoa /INFN, Genoa /Genoa U. /INFN, Genoa /Indian Inst. Tech., Guwahati /Harvard U. /Harvey Mudd Coll. /Heidelberg U. /Humboldt U., Berlin /Imperial Coll., London /Iowa State U. /Iowa State U. /Johns Hopkins U. /Paris U., VI-VII /LLNL, Livermore /Liverpool U. /Queen Mary, U. of London /Royal Holloway, U. of London /Royal Holloway, U. of London /Louisville U. /Mainz U., Inst. Kernphys. /Manchester U. /Maryland U. /Massachusetts U., Amherst /MIT /McGill U. /INFN, Milan /Milan U. /Mississippi U. /Montreal U. /INFN, Naples /Naples U. /NIKHEF, Amsterdam /NIKHEF, Amsterdam /Notre Dame U. /Ohio State U. /Oregon U. /INFN, Padua /Padua U. /INFN, Padua /INFN, Padua /Padua U. /Paris U., VI-VII /INFN, Perugia /Perugia U. /INFN, Pisa /Pisa U. /INFN, Pisa /Pisa, Scuola Normale Superiore /INFN, Pisa /Pisa U. /INFN, Pisa /INFN, Pisa /Pisa U. /INFN, Pisa /Princeton U. /INFN, Rome /INFN, Rome /Rome U. /INFN, Rome /INFN, Rome /Rome U. /INFN, Rome /Rostock U. /Rutherford /DAPNIA, Saclay /SLAC /South Carolina U. /Southern Methodist U. /Stanford U., Phys. Dept. /SUNY, Albany /Tel Aviv U. /Tennessee U. /Texas Nuclear Corp., Austin /Texas U., Dallas /INFN, Turin /Turin U. /INFN, Trieste /Trieste U. /Valencia U. /Victoria U. /Warwick U. /Wisconsin U., Madison


    We search for the Z{sub 1}(4050){sup +} and Z{sub 2}(4250){sup +} states, reported by the Belle Collaboration, decaying to {chi}{sub c1}{pi}{sup +} in the decays {bar B}{sup 0} {yields} {chi}{sub c1}K{sup -}{pi}{sup +} and B{sup +} {yields} {chi}{sub c1}K{sub S}{sup 0}{pi}{sup +} where {chi}{sub c1} {yields} J/{psi}{gamma}. The data were collected with the BABAR detector at the SLAC PEP-II asymmetric-energy e{sup +}e{sup -} collider operating at center-of-mass energy 10.58 GeV, and correspond to an integrated luminosity of 429 fb{sup -1}. In this analysis, we model the background-subtracted, efficiency-corrected {chi}{sub c1}{pi}{sup +} mass distribution using the K{pi} mass distribution and the corresponding normalized K{pi} Legendre polynomial moments, and then test the need for the inclusion of resonant structures in the description of the {chi}{sub c1}{pi}{sup +} mass distribution. No evidence is found for the Z{sub 1}(4050){sup +} and Z{sub 2}(4250){sup +} resonances, and 90% confidence level upper limits on the branching fractions are reported for the corresponding B-meson decay modes.

  10. Measurement of chi(3510) and chi(3555) production in 190 GeV/c piminus-beryllium interactions

    International Nuclear Information System (INIS)

    Charmonium production in 190 GeV/c π--Be interactions has been observed. The states chi(3510) and chi(3555) are seen through their radiative decay into J/Psi, and are found to correspond to 0.29 +- 0.09 of total J/Psi production for J/Psi's with x/sub f/ > 0.2. The rate of production for the two chi states appears as Bsigma(chi(3555))/Bsigma(chi(3510) = 0.60 +- 0.35. The fraction of J/Psi's produced through chi decay appears to rise with higher x/sub f/. For J/Psi's with x/sub f/ > 0.42, chi decay is responsible for 0.345 +- 0.09 of the total J/Psi sample, with the two states produced at the rate Bsigma(chi(3555))/Bsigma(3510) = 0.82 +- 0.45

  11. CHY-Graphs on a Torus

    CERN Document Server

    Cardona, Carlos


    Recently, we proposed a new approach using a punctured Elliptic curve in the CHY framework in order to compute one-loop scattering amplitudes. In this note, we further develop this approach by introducing a set of connectors, which become the main ingredient to build integrands on $\\mathfrak{M}_{1,n}$, the moduli space of n-punctured Elliptic curves. As a particular application, we study the $\\Phi^3$ bi-adjoint scalar theory. We propose a set of rules to construct integrands on $\\mathfrak{M}_{1,n}$ from $\\Phi^ 3$ integrands on $\\mathfrak{M}_{0,n}$, the moduli space of n-punctured spheres. We illustrate these rules by computing a variety of $\\Phi^3$ one-loop Feynman diagrams. Conversely, we also provide another set of rules to compute the corresponding CHY-integrand on $\\mathfrak{M}_{1,n}$ by starting instead from a given $\\Phi^ 3$ one-loop Feynman diagram. In addition, our results can easily be extended to higher loops.

  12. Tai Chi Chuan Optimizes the Functional Organization of the Intrinsic Human Brain Architecture in Older Adults


    Jing Luo; Xi-Nian Zuo


    Whether Tai Chi Chuan (TCC) can influence the intrinsic functional architecture of the human brain remains unclear. To examine TCC-associated changes in functional connectomes, resting-state functional magnetic resonance images were acquired from 40 older individuals including 22 experienced TCC practitioners (experts) and 18 demographically matched TCC-naïve healthy controls, and their local functional homogeneities across the cortical mantle were compared. Compared to the controls, the TCC ...

  13. Tai Chi Chuan optimizes the functional organization of the intrinsic human brain architecture in older adults


    Wei, Gao-Xia; Dong, Hao-Ming; Yang, Zhi; Luo, Jing; Zuo, Xi-Nian


    Whether Tai Chi Chuan (TCC) can influence the intrinsic functional architecture of the human brain remains unclear. To examine TCC-associated changes in functional connectomes, resting-state functional magnetic resonance images were acquired from 40 older individuals including 22 experienced TCC practitioners (experts) and 18 demographically matched TCC-naïve healthy controls, and their local functional homogeneities across the cortical mantle were compared. Compared to the controls, the TCC ...

  14. A Study on Near-Fault Mortality from the 1999 Chi-Chi, Taiwan Earthquake (United States)

    Pai, C.; Tien, Y.; Teng, T.


    A new approach for estimating the relations between mortality and strong shaking from the 1999 Chi-Chi, Taiwan earthquake is introduced. We have finished the database giving the attributes of victims through a compilation of various after-earthquake survey documents. This survey was a comprehensive filed visit confirming exact locations of victims and their possible cause of death. Among the total 2492 victims of the Chi-Chi earthquake, 2039 victims (81.8% of the total) were located by using GPS. Through the attributive database of victims, digital maps and Geographic Information Systems, we can easily map the spatial distribution and the cause of death data of victims with accuracy of the smallest administrative districts in Taiwan. Moreover, a regression analysis gives correlated equations for the mortality as functions of the distance to the Chelungpu fault. We find that the percentage of the mortality M can be expressed as:\\[M=\\frac{(1.626+0.0007\\timesd)} {(1+0.0125\\timesd)}\\] Here d is the closest distance to the fault in meter. As expected, the shorter distance to the Chelungpu fault causes the higher mortality. We device three disastrous levels and then suggest the orders and scopes of the earthquake disaster rescue according to the regression curve of the mortality and the closest distance to the fault. The difference in mortality between hanging-wall and footwall areas is also discussed and different regression curves of hanging-wall and footwall areas are suggested. In near-fault regions, the mortality for the residents lived in hanging-wall block (1348) is significantly higher than that in the footwall block (557). The death ratio of hanging-wall vs. footwall block is approximately 2.4:1. Finally, we gathered the data of the peak ground acceleration (PGA) data for the mainshock of Chi-Chi earthquake at the 63 seismic stations on both sides of the causal fault. The regression curve of the PGA and mortality as functions of the closest distance to the

  15. Bi-normalized response spectral characteristics of the 1999 Chi-Chi earthquake

    Institute of Scientific and Technical Information of China (English)

    徐龙军; 谢礼立


    To develop uniform and seismic environment-dependent design spectrum, common acceleration response spectral characteristics need to be identified. In this paper, a bi-normalized response spectrum (BNRS) is proposed, which is defined as a spectrum of peak response acceleration normalized with respect to peak acceleration of the excitation plotted vs. the natural period of the system normalized with respect to the spectrum predominant period, Tp. Based on a statistical analysis of records from the 1999 Chi-Chi earthquake, the conventionally normalized response spectrum(NRS) and the BNRS are examined to account for the effects of soil conditions, epicentral distance, hanging wall and damping. It is found that compared to the NRS, the BNRS is much less dependent on these factors. Finally, some simple relationships between the BNRS tor a specified damping ratio and that for a damping ratio of 5%, and between the spectra predominant period and epicentral distance for different soil types are provided.

  16. A $\\chi^2$ veto for continuous wave searches

    CERN Document Server

    de la Jordana, Llucia Sancho


    $\\chi^2$ vetoes are commonly used in searching for gravitational waves, in particular for broad-band signals, but they can also be applied to narrow-band continuous wave signals, such as those expected from rapidly rotating neutron stars. In this paper we present a $\\chi^2$ veto adapted to the Hough transform searches for continuous gravitational wave signals; we characterize the $\\chi^2$-significance plane for different frequency bands; and discuss the expected performance of this veto in LIGO analysis.

  17. O Tai Chi Chuan na percussão


    Teixeira, Mário Jorge Peixoto


    A good motricity and a strong psyche that allow for excellence in performance are essential in musical execution. Since Tai Chi Chuan is an activity that implies a considerable psychomotor and psychological development, it is the aim of this thesis to assess whether the practice of Tai Chi Chuan can be an optimising factor in a percussionist’s performance. Based on the outstanding physical and psychological effects that result from the practice of Tai Chi Chuan and the ce...

  18. Tai Chi Chuan in Medicine and Health Promotion

    Directory of Open Access Journals (Sweden)

    Ching Lan


    Full Text Available Tai Chi Chuan (Tai Chi is a Chinese traditional mind-body exercise and recently, it becomes popular worldwide. During the practice of Tai Chi, deep diaphragmatic breathing is integrated into body motions to achieve a harmonious balance between body and mind and to facilitate the flow of internal energy (Qi. Participants can choose to perform a complete set of Tai Chi or selected movements according to their needs. Previous research substantiates that Tai Chi has significant benefits to health promotion, and regularly practicing Tai Chi improves aerobic capacity, muscular strength, balance, health-related quality of life, and psychological well-being. Recent studies also prove that Tai Chi is safe and effective for patients with neurological diseases (e.g., stroke, Parkinson's disease, traumatic brain injury, multiple sclerosis, cognitive dysfunction, rheumatological disease (e.g., rheumatoid arthritis, ankylosing spondylitis, and fibromyalgia, orthopedic diseases (e.g., osteoarthritis, osteoporosis, low-back pain, and musculoskeletal disorder, cardiovascular diseases (e.g., acute myocardial infarction, coronary artery bypass grafting surgery, and heart failure, chronic obstructive pulmonary diseases, and breast cancers. Tai Chi is an aerobic exercise with mild-to-moderate intensity and is appropriate for implementation in the community. This paper reviews the existing literature on Tai Chi and introduces its health-promotion effect and the potential clinical applications.

  19. Dicty_cDB: CHI194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 58.1 V112D8 mTn-3xHA/lacZ Insertion Library, strain Y2278 Saccharomyces cerevisiae genomic 5', genomic survey se...) Frame A: ksnfi*ii*knk*ynikndiisnylmy*gn*ndlktstrsi*kkyknsnkeiisinwfsd nwyifsictsmvfvtnwmdiygysmlwiilcwvcmw...uolar 4.0 %: nuclear 4.0 %: vesicles of secretory system >> prediction for CHI194 is end 5' end seq. ID CHI194F 5' end se...CTTT TAATGGTTTAGTTTATAATCATTCATTTGCTGCTAGAAATTATTTGGATCTTTATAGAGT TGCTTTATTATCAAANNAATAAAATTAAATCATT Length of 3' end se...q. 754 Connected seq. ID CHI194P Connected seq. >CHI194P.Seq AAATCAAA

  20. Graphs with $\\chi=\\Delta$ have big cliques


    Cranston, Daniel W.; Rabern, Landon


    Brooks' Theorem states that if a graph has $\\Delta\\ge 3$ and $\\omega \\le \\Delta$, then $\\chi \\le \\Delta$. Borodin and Kostochka conjectured that if $\\Delta\\ge 9$ and $\\omega\\le \\Delta-1$, then $\\chi\\le \\Delta-1$. We show that if $\\Delta\\ge 13$ and $\\omega \\le \\Delta-4$, then $\\chi\\le \\Delta-1$. For a graph $G$, let $\\mathcal{H}$ denote the subgraph of $G$ induced by vertices of degree $\\Delta$. We also show that if $\\omega\\le \\Delta-1$ and $\\omega(\\mathcal{H})\\le \\Delta-6$, then $\\chi\\le \\Del...

  1. Search for B --> chi_c K(*) decays

    CERN Document Server

    Aubert, B; Abrams, G S; Adye, T; Ahmed, S; Alam, M S; Albert, J; Aleksan, Roy; Allison, J; Allmendinger, T; Altenburg, D; Andreotti, M; Angelini, C; Anulli, F; Aston, D; Azzolini, V; Baak, M; Back, J J; Bailey, S; Baldini-Ferroli, R; Band, H R; Banerjee, Sw; Barate, R; Bard, D J; Barlow, N R; Barlow, R J; Barrett, M; Bartoldus, R; Batignani, G; Bauer, J M; Beck, T W; Bellini, F; Benayoun, M; Berger, N; Bernard, D; Berryhill, J W; Best, D; Bettarini, S; Bettoni, D; Bevan, A J; Bhimji, W; Bianchi, F; Biasini, M; Blanc, F; Blaylock, G; Blinov, A E; Blinov, V E; Bloom, P; Bóna, M; Bondioli, M; Bonneaud, G R; Borgland, A W; Bosisio, L; Boutigny, D; Bowerman, D A; Boyarski, A M; Boyd, J T; Bozzi, C; Brandenburg, G; Brandt, T; Brau, J E; Breon, A B; Briand, H; Brochard, F; Brose, J; Brown, C L; Brown, C M; Brown, D; Brown, D N; Bruinsma, M; Brunet, S; Bucci, F; Buchanan, C; Buchmüller, O L; Bulten, H; Burchat, Patricia R; Button-Shafer, J; Buzzo, A; Côté, D; Cahn, R N; Calabrese, R; Calcaterra, A; Calderini, G; Campagnari, C; Capra, R; Carpinelli, M; Cartaro, C; Cavallo, N; Cavoto, G; Chaisanguanthum, K S; Chao, M; Charles, E; Charles, M J; Chauveau, J; Chavez, C A; Chen, A; Chen, E; Chen, J C; Chen, S; Cheng, B; Cheng, C H; Chevalier, N; Christ, S; Cibinetto, G; Clark, P J; Claus, R; Cochran, J; Colecchia, F; Coleman, J P; Contri, R; Convery, M R; Cormack, C M; Cossutti, F; Cottingham, W N; Couderc, F; Covarelli, R; Cowan, G; Crawley, H B; Cremaldi, L M; Cristinziani, M; Crosetti, G; Çuhadar-Dönszelmann, T; Dahmes, B; Dallapiccola, C; Danielson, N; Dasu, S; Datta, M; Dauncey, P D; David, P; Davier, M; Davis, C L; Day, C T; De Groot, N; De Nardo, Gallieno; Del Buono, L; Della Ricca, G; Di Lodovico, F; Dickopp, M; Dittongo, S; Dong, D; Dorfan, J; Dorigo, A; Druzhinin, V P; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W M; Dvoretskii, A; Eckmann, R; Edwards, A J; Egede, U; Eichenbaum, A M; Eigen, G; Eisner, A M; Elmer, P; Elsen, E E; Emery, S; Ernst, J A; Eschenburg, V; Eschrich, I; Fabozzi, F; Faccini, R; Fan, S; Farbin, A; Feltresi, E; Ferrarotto, F; Ferroni, F; Field, R C; Finocchiaro, G; Flack, R L; Flächer, H U; Flood, K T; Ford, K E; Ford, W T; Forster, I J; Forti, F; Fortin, D; Foulkes, S D; Franek, B J; Frey, R; Fritsch, M; Fry, J R; Gabathuler, Erwin; Gaidot, A; Gaillard, J M; Gaillard, J R; Galeazzi, F; Gallo, F; Gamba, D; Gamet, R; Gan, K K; Ganzhur, S F; Gary, J W; Gaspero, M; Gatto, C; Geddes, N I; Gill, M S; Giorgi, M A; Giraud, P F; Giroux, X; Gladney, L; Glanzman, T; Godang, R; Goetzen, K; Golubev, V B; Gopal, G P; Gowdy, S J; Graham, M; Grancagnolo, S; Green, M G; Greene, M G; Grenier, G J; Grenier, P; Gritsan, A V; Grosdidier, G; Groysman, Y; Guo, Q H; Hadavand, H K; Hadig, T; Haire, M; Halyo, V; Hamel de Monchenault, G; Hamon, O; Harrison, P F; Harrison, T J; Hart, A J; Hart, P A; Hartfiel, B L; Harton, J L; Hast, C; Hauke, A; Hawkes, C M; Hearty, C; Held, T; Hertzbach, S S; Heusch, C A; Hicheur, A; Hill, E J; Hitlin, D G; Höcker, A; Hodgkinson, M C; Hollar, J J; Honscheid, K; Hrynóva, T; Hufnagel, D; Hulsbergen, W D; Hutchcroft, D E; Igonkina, O; Innes, W R; Ivanchenko, V N; Izen, J M; Jackson, P D; Jackson, P S; Jacobsen, R G; Jawahery, A; Jayatilleke, S M; Jessop, C P; John, M J J; Johnson, J R; Judd, D; Kadel, R W; Kadyk, J; Kagan, H; Karyotakis, Yu; Kass, R; Kelly, M P; Kelsey, M H; Kerth, L T; Khan, A; Kim, H; Kim, P; Kirkby, D; Kitayama, I; Knecht, N S; Koch, H; Kocian, M L; Kofler, R; Kolomensky, Yu G; Koptchev, V B; Kovalskyi, D; Kowalewski, R V; Kozanecki, Witold; Kravchenko, E A; Krishnamurthy, M; Kroeger, R; Kroseberg, J; Kukartsev, G; Kutter, P E; Kyberd, P; Lacker, H M; Lae, C K; Lafferty, G D; Lamsa, J; Lanceri, L; Lange, D J; Langenegger, U; Lankford, A J; Laplace, S; Latham, T E; Lau, Y P; Lavin, D; Lazzaro, A; Le Diberder, F R; Lees, J P; Legendre, M; Leith, D W G S; Lepeltier, V; Leruste, P; Lewandowski, B; Li Gioi, L; Li, H; Libby, J; Lillard, V; Lista, L; Liu, R; LoSecco, J M; Lo Vetere, M; Lockman, W S; Lombardo, V; London, G W; Long, O; Lou, X C; Lu, A; Lü, C; Luitz, S; Luppi, E; Lusiani, A; Lüth, V; Lutz, A M; Lynch, G; Lynch, H L; Lyon, A J; MacFarlane, D B; Macri, M; Malcles, J; Mallik, U; Mancinelli, G; Mandelkern, M A; Manfredi, P F; Mangeol, D J J; Marchiori, G; Margoni, M; Marsiske, H; Martínez-Vidal, F; Mattison, T S; Mayer, B; Mazur, M A; Mazzoni, M A; McKenna, J A; McMahon, T R; Meadows, B T; Messner, R; Meyer, T I; Meyer, W T; Miftakov, V; Mihályi, A; Mir, L M; Mohanty, G B; Mohapatra, A K; Mommsen, R K; Monge, M R; Monorchio, D; Moore, T B; Morandin, M; Morgan, S E; Morganti, M; Morganti, S; Morii, M; Morton, G W; Muheim, F; Müller, D R; Müller-Pfefferkorn, R; Narsky, I; Nash, J A; Nauenberg, U; Neal, H; Negrini, M; Neri, N; Nesom, G; Nicholson, H; Nikolich, M B; Nogowski, R; O'Grady, C P; Ocariz, J; Oddone, P J; Ofte, I; Olaiya, E O; Olivas, A; Olsen, J; Onuchin, A P; Orimoto, T J; Otto, S; Ozcan, V E; Paar, H P; Paick, K; Palano, A; Palombo, F; Pan, Y; Panetta, J; Panvini, R S; Paoloni, E; Paolucci, P; Parry, R J; Passaggio, S; Patel, P M; Patrignani, C; Patteri, P; Payne, D J; Pelizaeus, M; Perazzo, A; Perl, M; Peruzzi, I M; Petersen, B A; Petersen, T C; Petrak, S; Petzold, A; Piatenko, T; Piccolo, D; Piccolo, M; Piemontese, L; Pierini, M; Pioppi, M; Piredda, G; Pivk, M; Plaszczynski, S; Playfer, S; Pompili, A; Poropat, P; Porter, F C; Posocco, M; Potter, C T; Prell, S; Prepost, R; Pripstein, M; Pulliam, T; Purohit, M V; Qi, N D; Rahatlou, S; Rahimi, A M; Rama, M; Rankin, P; Ratcliff, B N; Raven, G; Re, V; Reidy, J; Ricciardi, S; Richman, J D; Ritchie, J L; Rizzo, G; Roat, C; Roberts, D A; Robertson, S H; Robutti, E; Roe, N A; Röthel, W; Ronan, Michael T; Roney, J M; Rong, G; Roodman, A; Roos, L; Rosenberg, E I; Rotondo, M; Rubin, A E; Ryd, A; Saeed, M A; Safai-Tehrani, F; Saleem, M; Salnikov, A A; Salvatore, F; Samuel, A; Sanders, D A; Sandrelli, F; Santroni, A; Saremi, S; Sarti, A; Satpathy, A; Schalk, T; Schindler, R H; Schott, G; Schrenk, S; Schubert, J; Schubert, Klaus R; Schumm, B A; Schune, M H; Schwiening, J; Schwierz, R; Schwitters, R F; Sciacca, C; Sciolla, G; Seiden, A; Sekula, S J; Serednyakov, S I; Sharma, V; Shelkov, V G; Shen, B C; Simani, M C; Simi, G; Simonetto, F; Sinev, N B; Skovpen, Yu I; Sloane, R J; Smith, A J S; Smith, J G; Snoek, H L; Snyder, A; Sobie, R J; Soffer, A; Soha, A; Sokoloff, M D; Solodov, E P; Spaan, B; Spanier, S M; Spradlin, P; Stängle, H; Steinke, M; Stelzer, J; Stoker, D P; Stroili, R; Strom, D; Stugu, B; Su, D; Sullivan, M K; Summers, D J; Sundermann, J E; T'Jampens, S; Tan, P; Tantot, L; Taras, P; Taylor, F; Taylor, G P; Telnov, A V; Teodorescu, L; Ter-Antonian, R; Therin, G; Thiebaux, C; Thiessen, D; Tiozzo, G; Tisserand, V; Toki, W H; Torrence, E; Tosi, S; Touramanis, C; Treadwell, E; Vasileiadis, G; Vasseur, G; Vavra, J; Verderi, M; Verkerke, W; Vitale, L; Voci, C; Voena, C; Vuagnin, G; Wagner, G; Wagner, S R; Wagoner, D E; Waldi, R; Walsh, J; Wang, K; Wang, P; Wappler, F R; Watson, A T; Weaver, M; Weidemann, A W; Weinstein, A J R; Wenzel, W A; Wilden, L; Williams, D C; Williams, J C; Willocq, S; Wilson, F F; Wilson, J R; Wilson, M G; Wilson, R J; Winter, M A; Wisniewski, W J; Wittgen, M; Won, E; Wong, Q K; Wormser, G; Wright, D H; Wright, D M; Wu, J; Wu, S L; Xie, Y; Yamamoto, R K; Yang, S; Yarritu, A K; Ye, S; Yéche, C; Yi, J; Young, C C; Yu, Z; Yumiceva, F X; Yushkov, A N; Zallo, A; Zeng, Q; Zghiche, A; Zhang, J; Zhang, L; Zhao, H W; Zhu, Y S; Zito, M; De Sangro, R; La Vaissière, C de


    We report on the search for the factorization suppressed decays B -> chi_c0 K(*) and B -> chi_c2 K(*), with chi_c0 and chi_c2 decaying into J/psi gamma. We use a sample of 124 million BBbar events collected with the BABAR detector at the PEP-II storage ring at the Stanford Linear Accelerator Center. No significant signal is found and upper bounds for the branching fractions are obtained. All results are preliminary.

  2. chi_c0 and chi_c2 Decays into eta eta, eta eta', and eta' eta' Final States

    CERN Document Server

    Adams, G S; Cummings, J P; Danko, I; Napolitano, J; He, Q; Insler, J; Muramatsu, H; Park, C S; Thorndike, E H; Yang, F; Coan, T E; Gao, Y S; Artuso, M; Blusk, S; Butt, J; Li, J; Menaa, N; Mountain, R; Nisar, S; Randrianarivony, K; Sia, R; Skwarnicki, T; Stone, S; Wang, J C; Zhang, K; Csorna, S E; Bonvicini, G; Cinabro, D; Dubrovin, M; Lincoln, A; Asner, D M; Edwards, K W; Briere, R A; Chen, J; Ferguson, T; Tatishvili, G T; Vogel, H; Watkins, M E; Rosner, J L; Adam, N E; Alexander, J P; Berkelman, K; Cassel, D G; Duboscq, J E; Ecklund, K M; Ehrlich, R; Fields, L; Galik, R S; Gibbons, L; Gray, R; Gray, S W; Hartill, D L; Heltsley, B K; Hertz, D; Jones, C D; Kandaswamy, J; Kreinick, D L; Kuznetsov, V E; Mahlke-Krüger, H; Onyisi, P U E; Patterson, J R; Peterson, D; Pivarski, J; Riley, D; Ryd, A; Sadoff, A J; Schwarthoff, H; Shi, X; Stroiney, S; Sun, W M; Wilksen, T; Weinberger, M; Athar, S B; Patel, R; Potlia, V; Yelton, J; Rubin, P; Cawlfield, C; Eisenstein, B I; Karliner, I; Kim, D; Lowrey, N; Naik, P; Sedlack, C; Selen, M; White, E J; Wiss, J; Mitchell, R E; Shepherd, M R; Besson, D; Pedlar, T K; Cronin-Hennessy, D; Gao, K Y; Hietala, J; Kubota, Y; Klein, T; Lang, B W; Poling, R; Scott, A W; Smith, A; Zweber, P; Dobbs, S; Metreveli, Z V; Seth, K K; Tomaradze, A G; Ernst, J; Severini, H; Dytman, S A; Love, W; Savinov, V; Aquines, O; Li, Z; López, A; Mehrabyan, S S; Méndez, H; Ramírez, J; Huang, G S; Miller, D H; Pavlunin, V; Sanghi, B; Shipsey, I P J; Xin, B; al, et


    Using a sample of 3 x 10^6 psi(2S) decays collected by the CLEO III and CLEO_c detector configurations, we present results of a study of \\chi_{c0} and \\chi_{c2} decays into eta-eta, eta-etaprime, and etaprime-etaprime final states. We find B(chi_{c0} -> eta-eta)= (0.31+-0.05+-0.04+-0.02)%, B(chi_{c0} -> eta-etaprime) etaprime-etaprime) = (0.17 +- 0.04 +-0.02 +-0.01)%. We also present upper limits for the decays of \\chi_{c2} into these final states. These results give information on the decay mechanism of \\chi_c states into pseudoscalars.

  3. Community Recovery and Sustainable Development in the Region of Seismic Center in Taiwan after the 1999 CHI-CHI Earthquake


    Hsiu-Jen Jennifer, Yeh


    International audience The major purpose of this study is to evaluate the progress of community recovery and sustainable development of the region of seismic centre in Taiwan after the 1999 Chi-Chi Earthquake. Data analyzed in this study were collected from a face-to-face interview survey conducted in the research site of Tzu-Shan Town, Nan-Tau County, an area close to the epicentre of Chi-Chi Town, Nan-Tau County. The analysis of this study indicates that before the earthquake the residen...

  4. Global Climate Change and Solutions for Urban Sustainability of Ho Chi Minh City, Vietnam

    Directory of Open Access Journals (Sweden)

    Dao Phan


    Full Text Available Ho Chi Minh City (HCMC, the largest city in Vietnam, is steadily growing, certainly towards a mega city in the near future. Like other mega cities at the boom stage, it has to face with serious environmental matters insolvable for many years. The situation may be worse under the effects of global climate change, geological subsidence due to non-standard construction and sea level rise. The situation of HCMC can be damaged or even broken by resonant effects of unsolved environmental matters and latent impacts of climate change. This article shows the challenges to the urban sustainable development under the duo effect of urban environmental matters and climate change in Ho Chi Minh City. Opportunities and strategic directions to overcome the challenges are also analyzed and recommended.

  5. Study of \\chi_{bJ}(1P) Properties in the Radiative \\Upsilon(2S) Decays

    CERN Document Server

    Abdesselam, A; Adamczyk, K; Aihara, H; Said, S Al; Arinstein, K; Arita, Y; Asner, D M; Aso, T; Atmacan, H; Aulchenko, V; Aushev, T; Ayad, R; Aziz, T; Babu, V; Badhrees, I; Bahinipati, S; Bakich, A M; Bala, A; Ban, Y; Bansal, V; Barberio, E; Barrett, M; Bartel, W; Bay, A; Bedny, I; Behera, P; Belhorn, M; Belous, K; Berger, M; Besson, D; Bhardwaj, V; Bhuyan, B; Biswal, J; Bloomfield, T; Blyth, S; Bobrov, A; Bondar, A; Bonvicini, G; Bookwalter, C; Boulahouache, C; Bozek, A; Bračko, M; Breibeck, F; Brodzicka, J; Browder, T E; Waheed, E; Červenkov, D; Chang, M -C; Chang, P; Chao, Y; Chekelian, V; Chen, A; Chen, K -F; Chen, P; Cheon, B G; Chilikin, K; Chistov, R; Cho, K; Chobanova, V; Choi, S -K; Choi, Y; Cinabro, D; Crnkovic, J; Dalseno, J; Danilov, M; Dash, N; Di Carlo, S; Dingfelder, J; Doležal, Z; Dossett, D; Drásal, Z; Drutskoy, A; Dubey, S; Dutta, D; Dutta, K; Eidelman, S; Epifanov, D; Esen, S; Farhat, H; Fast, J E; Feindt, M; Ferber, T; Frey, A; Frost, O; Fulsom, B G; Gaur, V; Gabyshev, N; Ganguly, S; Garmash, A; Getzkow, D; Gillard, R; Giordano, F; Glattauer, R; Goh, Y M; Goldenzweig, P; Golob, B; Greenwald, D; Perdekamp, M Grosse; Grygier, J; Grzymkowska, O; Guo, H; Haba, J; Hamer, P; Han, Y L; Hara, K; Hara, T; Hasegawa, Y; Hasenbusch, J; Hayasaka, K; Hayashii, H; He, X H; Heck, M; Hedges, M T; Heffernan, D; Heider, M; Heller, A; Higuchi, T; Himori, S; Hirose, S; Horiguchi, T; Hoshi, Y; Hoshina, K; Hou, W -S; Hsiung, Y B; Hsu, C -L; Huschle, M; Hyun, H J; Igarashi, Y; Iijima, T; Imamura, M; Inami, K; Inguglia, G; Ishikawa, A; Itagaki, K; Itoh, R; Iwabuchi, M; Iwasaki, M; Iwasaki, Y; Iwata, S; Jacobs, W W; Jaegle, I; Jeon, H B; Joffe, D; Jones, M; Joo, K K; Julius, T; Kakuno, H; Kang, J H; Kang, K H; Kapusta, P; Kataoka, S U; Kato, E; Kato, Y; Katrenko, P; Kawai, H; Kawasaki, T; Keck, T; Kichimi, H; Kiesling, C; Kim, B H; Kim, D Y; Kim, H J; Kim, H -J; Kim, J B; Kim, J H; Kim, K T; Kim, M J; Kim, S H; Kim, S K; Kim, Y J; Kinoshita, K; Kleinwort, C; Klucar, J; Ko, B R; Kobayashi, N; Koblitz, S; Kodyš, P; Koga, Y; Korpar, S; Kotchetkov, D; Kouzes, R T; Križan, P; Krokovny, P; Kronenbitter, B; Kuhr, T; Kulasiri, L; Kumar, R; Kumita, T; Kurihara, E; Kuroki, Y; Kuzmin, A; Kvasnička, P; Kwon, Y -J; Lai, Y -T; Lange, J S; Lee, D H; Lee, I S; Lee, S -H; Leitgab, M; Leitner, R; Levit, D; Lewis, P; Li, C H; Li, H; Li, J; Li, L; Li, X; Li, Y; Gioi, L Li; Libby, J; Limosani, A; Liu, C; Liu, Y; Liu, Z Q; Liventsev, D; Loos, A; Louvot, R; Lubej, M; Lukin, P; Luo, T; MacNaughton, J; Masuda, M; Matsuda, T; Matvienko, D; Matyja, A; McOnie, S; Mikami, Y; Miyabayashi, K; Miyachi, Y; Miyake, H; Miyata, H; Miyazaki, Y; Mizuk, R; Mohanty, G B; Mohanty, S; Mohapatra, D; Moll, A; Moon, H K; Mori, T; Morii, T; Moser, H -G; Müller, T; Muramatsu, N; Mussa, R; Nagamine, T; Nagasaka, Y; Nakahama, Y; Nakamura, I; Nakamura, K R; Nakano, E; Nakano, H; Nakano, T; Nakao, M; Nakayama, H; Nakazawa, H; Nanut, T; Nath, K J; Natkaniec, Z; Nayak, M; Nedelkovska, E; Negishi, K; Neichi, K; Ng, C; Niebuhr, C; Niiyama, M; Nisar, N K; Nishida, S; Nishimura, K; Nitoh, O; Nozaki, T; Ogawa, A; Ogawa, S; Ohshima, T; Okuno, S; Olsen, S L; Ono, Y; Onuki, Y; Ostrowicz, W; Oswald, C; Ozaki, H; Pakhlov, P; Pakhlova, G; Pal, B; Palka, H; Panzenböck, E; Park, C -S; Park, C W; Park, H; Park, K S; Paul, S; Peak, L S; Pedlar, T K; Peng, T; Pesántez, L; Pestotnik, R; Peters, M; Petrič, M; Piilonen, L E; Poluektov, A; Prasanth, K; Prim, M; Prothmann, K; Pulvermacher, C; Purohit, M V; Rauch, J; Reisert, B; Ribežl, E; Ritter, M; Röhrken, M; Rorie, J; Rostomyan, A; Rozanska, M; Rummel, S; Ryu, S; Sahoo, H; Saito, T; Sakai, K; Sakai, Y; Sandilya, S; Santel, D; Santelj, L; Sanuki, T; Sasao, N; Sato, Y; Savinov, V; Schlüter, T; Schneider, O; Schnell, G; Schönmeier, P; Schram, M; Schwanda, C; Schwartz, A J; Schwenker, B; Seidl, R; Seino, Y; Semmler, D; Senyo, K; Seon, O; Seong, I S; Sevior, M E; Shang, L; Shapkin, M; Shebalin, V; Shen, C P; Shibata, T -A; Shibuya, H; Shinomiya, S; Shiu, J -G; Shwartz, B; Sibidanov, A; Simon, F; Singh, J B; Sinha, R; Smerkol, P; Sohn, Y -S; Sokolov, A; Soloviev, Y; Solovieva, E; Stanič, S; Starič, M; Steder, M; Strube, J F; Stypula, J; Sugihara, S; Sugiyama, A; Sumihama, M; Sumisawa, K; Sumiyoshi, T; Suzuki, K; Suzuki, K; Suzuki, S; Suzuki, S Y; Suzuki, Z; Takeichi, H; Takizawa, M; Tamponi, U; Tanaka, M; Tanaka, S; Tanida, K; Taniguchi, N; Taylor, G N; Tenchini, F; Teramoto, Y; Tikhomirov, I; Trabelsi, K; Trusov, V; Tse, Y F; Tsuboyama, T; Uchida, M; Uchida, T; Uehara, S; Ueno, K; Uglov, T; Unno, Y; Uno, S; Uozumi, S; Urquijo, P; Ushiroda, Y; Usov, Y; Vahsen, S E; Van Hulse, C; Vanhoefer, P; Varner, G; Varvell, K E; Vervink, K; Vinokurova, A; Vorobyev, V; Vossen, A; Wagner, M N; Waheed, E; Wang, C H; Wang, J; Wang, M -Z; Wang, P; Wang, X L; Watanabe, M; Watanabe, Y; Wedd, R; Wehle, S; White, E; Widmann, E; Wiechczynski, J; Williams, K M; Won, E; Yabsley, B D; Yamada, S; Yamamoto, H; Yamaoka, J; Yamashita, Y; Yamauchi, M; Yashchenko, S; Ye, H; Yelton, J; Yook, Y; Yuan, C Z; Yusa, Y; Zhang, C C; Zhang, L M; Zhang, Z P; Zhao, L; Zhilich, V; Zhukova, V; Zhulanov, V; Ziegler, M; Zivko, T; Zupanc, A; Zwahlen, N; Zyukova, O


    We report a study of radiative decays of \\chi_{bJ}(1P)(J=0,1,2) mesons into 74 hadronic final states comprising charged and neutral pions, kaons, protons; out of these, 41 modes are observed with at least 5 standard deviation significance. Our measurements not only improve the previous measurements by the CLEO Collaboration but also lead to first observations in many new modes. The large sample allows us to probe the total decay width of the \\chi_{b0}(1P). In the absence of a statistically significant result, a 90% confidence-level upper limit is set on the width at \\Gamma_{total}< 2.4 MeV. Our results are based on 24.7 fb^{-1} of e+e- collision data recorded by the Belle detector at the \\Upsilon(2S) resonance, corresponding to (157.8\\pm3.6)\\times10^6 \\Upsilon(2S) decays.

  6. Evidence for $B^0 \\to \\chi_{c1} \\pi ^0$ at Belle

    CERN Document Server

    Kumar, R; Adachi, I; Aihara, H; Arinstein, K; Aushev, T; Aziz, T; Bakich, A M; Balagura, V; Bay, A; Bhardwaj, V; Bitenc, U; Bozek, A; Bracko, M; Browder, T E; Chen, A; Cheon, B G; Chistov, R; Cho, I S; Choi, Y; Dalseno, J; Dash, M; Drutskoy, A; Dungel, W; Eidelman, S; Gabyshev, N; Goldenzweig, P; Golob, B; Ha, H; Haba, J; Hayasaka, K; Hayashii, H; Hazumi, M; Horii, Y; Hoshi, Y; Hou, W S; Hsiung, Y B; Hyun, H J; Iijima, T; Inami, K; Ishikawa, A; Ishino, H; Itoh, R; Iwasaki, M; Kah, D H; Kang, J H; Katayama, N; Kawai, H; Kawasaki, T; Kichimi, H; Kim, S K; Kim, Y I; Kim, Y J; Kinoshita, K; Korpar, S; Krizan, P; Krokovny, P; Kuzmin, A; Kwon, Y J; Kyeong, S H; Lange, J S; Lee, J S; Lee, M J; Limosani, A; Lin, S W; Liventsev, D; Louvot, R; Mandl, F; Matyja, A; McOnie, S; Medvedeva, T; Miyabayashi, K; Miyake, H; Miyata, H; Miyazaki, Y; Mizuk, R; Mori, T; Nakamura, I; Nakano, E; Nakazawa, H; Nishida, S; Nitoh, O; Ogawa, S; Ohshima, T; Okuno, S; Ozaki, H; Pakhlov, P; Pakhlova, G; Park, C W; Park, H; Park, H K; Pestotnik, R; Piilonen, L E; Sahoo, H; Sakai, Y; Schneider, O; Sekiya, A; Senyo, K; Shapkin, M; Shiu, J G; Shwartz, B; Somov, A; Stanic, S; Staric, M; Sumiyoshi, T; Suzuki, S; Tanaka, M; Taylor, G N; Teramoto, Y; Trabelsi, K; Uehara, S; Unno, Y; Uno, S; Usov, Yu; Varner, G; Vervink, K; Wang, C C; Wang, C H; Wang, M Z; Wang, P; Watanabe, Y; Wedd, R; Won, E; Yamashita, Y; Zhang, C C; Zhang, Z P; Zhulanov, V; Zivko, T; Zupanc, A; Zyukova, O


    We present a measurement of the branching fraction for the Cabibbo- and color-suppressed $B^0 \\to \\chi_{c1}\\pi^0$ decay based on a data sample of $657\\times 10^6$ $B\\bar B$ events collected at the $\\Upsilon(4S)$ resonance with the Belle detector at the KEKB asymmetric-energy $e^+e^-$ collider. We observe a signal of $40\\pm9$ events with a significance of $4.7\\sigma$ including systematic uncertainties. The measured branching fraction is $\\mathcal {B}(B^0 \\to \\chi_{c1} \\pi^0) = (1.12\\pm 0.25(\\rm {stat.})\\pm 0.12({\\rm syst.}))\\times 10^{-5}$.

  7. Dicty_cDB: CHI458 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI458 (Link to dictyBase) - - - Contig-U15607-1 CHI458P (Link to Original ... n*il nnnnynknnhqkhtlkkhkn*nkkkke*nn*kkiekimfqkv*lk*mis *qnlnh*ikll nlfhqmvivyikqlqtny*likilmkkrvkvmqrn*eq* ...

  8. Model Waveform Accuracy Requirements for the $\\chi^2$ Discriminator

    CERN Document Server

    Lindblom, Lee


    This paper derives accuracy standards for model gravitational waveforms required to ensure proper use of the $\\chi^2$ discriminator test in gravitational wave (GW) data analysis. These standards are different from previously established requirements for detection and waveform parameter measurement based on signal-to-noise optimization. We present convenient formulae both for evaluating and interpreting the contribution of model errors to measured $\\chi^2$ values. Motivated by these formula, we also present an enhanced, complexified variant of the standard $\\chi^2$ statistic used in GW searches. While our results are not directly relevant to current searches (which use the $\\chi^2$ test only to veto signal candidates with extremely high $\\chi^2$ values), they could be useful in future GW searches and as figures of merit for model gravitational waveforms.

  9. Site responses in the Taipei basin during the 1999 Chi-Chi, Taiwan earthquake sequence

    International Nuclear Information System (INIS)

    On September 20, 1999 a magnitude ML 7.3 earthquake struck Taichung and Nantou in central Taiwan. Taipei basin located more than 100 km from the epicenter but also had many buildings damaged during the earthquake. In this study we use the main shock and aftershocks data of Chi-Chi earthquake to analyze the site effect of Taipei basin. The results show that the dominant low frequency band response is located in the western part of Taipei basin and Songshan area; the main high frequency band response areas are near the edge of basin. Another hand, comparing the results of amplification pattern with the location of damaged buildings found that the tall damaged buildings are located at the high response areas of low frequency band and the low-rise damaged structures are located at the high response areas of higher frequency band. From these results we can find the relationship between the site amplification and damaged structure distribution in the Taipei basin area during earthquakes. (authors)

  10. Tai Chi Chuan Exercise for Patients with Cardiovascular Disease

    Directory of Open Access Journals (Sweden)

    Ching Lan


    Full Text Available Exercise training is the cornerstone of rehabilitation for patients with cardiovascular disease (CVD. Although high-intensity exercise has significant cardiovascular benefits, light-to-moderate intensity aerobic exercise also offers health benefits. With lower-intensity workouts, patients may be able to exercise for longer periods of time and increase the acceptance of exercise, particularly in unfit and elderly patients. Tai Chi Chuan (Tai Chi is a traditional Chinese mind-body exercise. The exercise intensity of Tai Chi is light to moderate, depending on its training style, posture, and duration. Previous research has shown that Tai Chi enhances aerobic capacity, muscular strength, balance, and psychological well-being. Additionally, Tai Chi training has significant benefits for common cardiovascular risk factors, such as hypertension, diabetes mellitus, dyslipidemia, poor exercise capacity, endothelial dysfunction, and depression. Tai Chi is safe and effective in patients with acute myocardial infarction (AMI, coronary artery bypass grafting (CABG surgery, congestive heart failure (HF, and stroke. In conclusion, Tai Chi has significant benefits to patients with cardiovascular disease, and it may be prescribed as an alternative exercise program for selected patients with CVD.

  11. Dos and don'ts of reduced chi-squared

    CERN Document Server

    Andrae, Rene; Melchior, Peter


    Reduced chi-squared is a very popular method for model assessment, model comparison, convergence diagnostic, and error estimation in astronomy. In this manuscript, we discuss the pitfalls involved in using reduced chi-squared. There are two independent problems: (a) The number of degrees of freedom can only be estimated for linear models. Concerning nonlinear models, the number of degrees of freedom is unknown, i.e., it is not possible to compute the value of reduced chi-squared. (b) Due to random noise in the data, also the value of reduced chi-squared itself is subject to noise, i.e., the value is uncertain. This uncertainty impairs the usefulness of reduced chi-squared for differentiating between models or assessing convergence of a minimisation procedure. The impact of noise on the value of reduced chi-squared is surprisingly large, in particular for small data sets, which are very common in astrophysical problems. We conclude that reduced chi-squared can only be used with due caution for linear models, w...

  12. Dicty_cDB: CHI575 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI575 (Link to dictyBase) - - - Contig-U16427-1 - (Link to Original site) ... yfg*ytlyiyiiq*nviffrtdfrkdgfhr*ry*ihgns*sck*irkryf*ngs ... nl*k*ncykiisins*fsk*csrkcc*mfrfin*ks*rftsnrny*yiik ... n--- Homology vs CSM-cDNA Score E Sequences producing s ignificant alignments: (bits) Value CHI575 (CHI575 ... 003.10. 2 Homology vs DNA Score E Sequences producing s ignificant alignments: (bits) Value N AC116956 |AC ... 12. 7 Homology vs Protein Score E Sequences producing s ignificant alignments: (bits) Value (Q86KD1) RecNa ...

  13. Use of dipole sum rules to estimate upper and lower bounds for radiative and total widths of chi (3414), chi (3508), and chi (3552)

    International Nuclear Information System (INIS)

    Upper and lower bounds on the widths for chi/sub J/→γpsi (3095) can be estimated by assuming E1 transitions and approximate Russell-Saunders coupling for the cc-bar system. Experimental widths for psi (3684) →γchi/sub J/ the lower bound more restrictive, giving radiative widths of 160→240, 230→400, and 280→480 keV for 3414-, 3508-, and 3552-MeV states, respectively. Cascade branching ratio data permit estimation of the total widths as >1.6, 0.3-1.5, and 0.6-4 MeV, respectively

  14. Tai chi: physiological characteristics and beneficial effects on health


    Li, J.; Hong, Y.; Chan, K.


    Objectives—To assess the characteristic effects of Tai Chi Chuan (TCC) exercise on metabolism and cardiorespiratory response, and to measure its effect on cardiorespiratory function, mental control, immune capacity, and the prevention of falls in elderly people.

  15. Dicty_cDB: CHI228 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI228 (Link to dictyBase) - - - Contig-U16517-1 - (Link to Original site) ... *edmqvqv* ekviy*elkiffhlqevllnvvykvfqifilninhyymif*ivf *rtn*kkplihtyqql nqerdhkm*lylwlvvslmkrh*pftllil*ilv ...

  16. Tai Chi Chuan Exercise for Patients with Cardiovascular Disease


    Ching Lan; Ssu-Yuan Chen; May-Kuen Wong; Jin Shin Lai


    Exercise training is the cornerstone of rehabilitation for patients with cardiovascular disease (CVD). Although high-intensity exercise has significant cardiovascular benefits, light-to-moderate intensity aerobic exercise also offers health benefits. With lower-intensity workouts, patients may be able to exercise for longer periods of time and increase the acceptance of exercise, particularly in unfit and elderly patients. Tai Chi Chuan (Tai Chi) is a traditional Chinese mind-body exercise. T...

  17. Tai Chi Quan and Stroke Prevention and Rehabilitation


    Yoshinaga, Shuri; Cai, Dingfang


    Stroke is a major cause of mortality and disability across the globe and remains the third leading cause of death in China, with the total stroke incidence increasing 6.7% annually from 1984 to 2004. The prevention of strokes is more important than their treatment. Tai Chi Quan is a slow and graceful Chinese exercise that includes a form of mindful meditation known for its health benefits. Many studies have shown that Tai Chi Quan not only improves gait, balance cap...

  18. Dicty_cDB: CHI718 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI718 (Link to dictyBase) - G20569 DDB0188420 Contig-U11787-1 CHI718P (Lin ... 4 (Q9QZ71) RecName: Full=Xenotropic and polytropic retrovirus ... rece... 82 2e-14 (Q9R031) RecName: Full=Xenotropic ... and polytropic retrovirus ... rece... 82 2e-14 AF131096_1( AF131096 |pid:none) M ...

  19. CHI '13 Extended Abstracts on Human Factors in Computing Systems

    DEFF Research Database (Denmark)

    The CHI Papers and Notes program is continuing to grow along with many of our sister conferences. We are pleased that CHI is still the leading venue for research in human-computer interaction. CHI 2013 continued the use of subcommittees to manage the review process. Authors selected the subcommit......The CHI Papers and Notes program is continuing to grow along with many of our sister conferences. We are pleased that CHI is still the leading venue for research in human-computer interaction. CHI 2013 continued the use of subcommittees to manage the review process. Authors selected the...... tremendous amount of work from all areas of the human-computer interaction community. As co-chairs of the process, we are amazed at the ability of the community to organize itself to accomplish this task. We would like to thank the 2680 individual reviewers for their careful consideration of these papers. We...... that you enjoy these papers and notes, which represent the best research in human-computer interaction....

  20. Effects of the hanging wall and footwall on peak acceleration during the Jiji (Chi-Chi), Taiwan Province, earthquake

    Institute of Scientific and Technical Information of China (English)


    The M=7.6 Jiji (Chi-Chi) earthquake, Taiwan Province, on September 21, 1999 (local time) is a thrust fault style earthquake. The empirical attenuation relations of the horizontal and vertical peak ground accelerations (PGA) for the Jiji (Chi-Chi) earthquake are developed by regression method. By examining the residuals from the Jiji (Chi-Chi) earthquake-specific peak acceleration attenuation relations, it is found that there are systematic differences between PGA on the hanging-wall and footwall. The recorded peak accelerations are higher on the hanging-wall and lower on the footwall. The clear asymmetry of PGA distribution to the surface rupture trace can also be seen from the PGA contour map. These evidences indicate that the PGA attenuates faster on the hanging-wall than on the footwall. In the study of near-source strong motion, seismic hazard assessment, scenario earthquake and seis-mic disaster prediction, the style-of-faulting must be considered in order that the attenuation model can reflect the characteristic of ground motion in various seismic environmental regions.

  1. Physiological responses to Tai Chi in stable patients with COPD. (United States)

    Qiu, Zhi-Hui; Guo, Hong-Xi; Lu, Gan; Zhang, Ning; He, Bai-Ting; Zhou, Lian; Luo, Y M; Polkey, M I


    We compared the physiological work, judged by oxygen uptake, esophageal pressure swing and diaphragm electromyography, elicited by Tai Chi compared with that elicited by constant rate treadmill walking at 60% of maximal load in eleven patients with COPD (Mean FEV1 61% predicted, FEV1/FVC 47%). Dynamic hyperinflation was assessed by inspiratory capacity and twitch quadriceps tension (TwQ) elicited by supramaximal magnetic stimulation of the femoral nerve was also measured before and after both exercises. The EMGdi and esophageal pressure at the end of exercise were similar for both treadmill exercise and Tai Chi (0.109±0.047 mV vs 0.118±0.061 mV for EMGdi and 22.3±7.1 cmH2O vs 21.9±8.1 cmH2O for esophageal pressure). Moreover the mean values of oxygen uptake during Tai Chi and treadmill exercise did not differ significantly: 11.3 ml/kg/min (51.1% of maximal oxygen uptake derived from incremental exercise) and 13.4 ml/kg/min (52.5%) respectively, p>0.05. Respiratory rate during Tai Chi was significantly lower than that during treadmill exercise. Both Tai Chi and treadmill exercise elicited a fall in IC at end exercise, indicating dynamic hyperinflation, but this was statistically significant only after treadmill exercise. TwQ decreased significantly after Tai Chi but not after treadmill. We conclude that Tai Chi constitutes a physiologically similar stimulus to treadmill exercise and may therefore be an acceptable modality for pulmonary rehabilitation which may be culturally more acceptable in some parts of the world. PMID:26549554

  2. Consumer Acceptance of Functional Foods in Ho Chi Minh City

    Directory of Open Access Journals (Sweden)

    Duy Tung BUI


    Full Text Available The aim of this paper is to identify and evaluate the underlying factors affecting consumer acceptance of functional foods. The contribution of this study is to better understand customer willingness to buy such products in Ho Chi Minh City by shedding light on how socio-demographic, cognitive and attitudinal determinants affect consumer's choices of foods. We conducted a survey using 217 respondents from Ho Chi Minh City. Next, we develop a binary-probit model to quantify the impact of each factor on consumer acceptance. The results show that having a sick relative, beliefs in health benefits positively affect acceptance level. Other than that, old people in Ho Chi Minh City tend to reject the use of functional foods. However, when they are provided with enough knowledge, they are the most intensive buyers of these products. Implications and further researches are also discussed.

  3. A CHI wiggler ubitron amplifier experiment: Wiggler characterization

    Energy Technology Data Exchange (ETDEWEB)

    Taccetti, J.M.; Jackson, R.H.; Freund, H.P. [Naval Research Lab., Washington, DC (United States)] [and others


    A 35 GHz CHI (Coaxial Hybrid Iron) wiggler ubitron amplifier experiment is under construction at the Naval Research Laboratory. The CHI wiggler configuration has the potential of generating high wiggler magnetic fields at short periods with excellent beam focusing and transport properties. This makes it a desirable configuration for the generation of high power coherent radiation in relatively compact systems. The CHI wiggler consists of alternating rings of magnetic and non-magnetic materials concentric with a central rod of similar alternating design but shifted along the axis by half a period. Once inserted in a solenoidal magnetic field, the CHI structure deforms the axial field to create a radial field oscillating with the same periodicity as the rings. An annular electron beam is propagated through the coaxial gap where the oscillating radial field imparts an azimuthal wiggle motion. The principal goals of the experiment are to investigate the performance tradeoffs involved in the CHI configuration for high frequency amplifiers operating at low voltages with small wiggler periods. The nominal design parameters are a center frequency of 35 GHz, wiggler period of 0.75 cm, and beam voltage of approximately 150 kV. Calculations have shown an intrinsic (untapered) efficiency of {approximately} 7% when operating at 6.3 kG axial field (wiggler field, B{sub w}{approximately}1270 G). The calculated gain was 36 dB, saturating at a distance of 46 cm. These parameters yield an instantaneous amplifier bandwidth of {approximately} 25%. There appears to be room for further improvement in efficiency, a matter which will be scrutinized more closely in the final design. A prototype CHI wiggler is presently being fabricated for use in conjunction with an existing 30 kG superconducting solenoid. The performance properties of the prototype will be characterized and compared with linear and non-linear calculations.

  4. Observation of B0 -> chi_c0 K*0 and Evidence of B+ -> chi_c0 K*+

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, : B.


    The authors present the observation of the decay B{sup 0} {yields} {chi}{sub c0}K*{sup 0} as well as evidence of B{sup +} {yields} {chi}{sub c0}K*{sup +}, with an 8.9 and a 3.6 standard deviation significance, respectively, using a data sample of 454 million {Upsilon}(4S) {yields} B{bar B} decays collected with the BABAR detector at the PEP-II B meson factory located at the Standard Linear Accelerator Center (SLAC). The measured branching fractions are: {Beta}(B{sup 0} {yields} {chi}{sub c0}K*{sup 0}) = (1.7 {+-} 0.3 {+-} 0.2) x 10{sup -4} and {Beta}(B{sup +} {yields} {chi}{sub c0}K*{sup +}) = (1.4 {+-} 0.5 {+-} 0.2) x 10{sup -4}, where the first quoted errors are statistical and the second are systematic. They obtain a branching fraction upper limit of {Beta}(B{sup +} {yields} {chi}{sub c0}K*{sup +}) < 2.1 x 10{sup -4} at the 90% confidence level.

  5. Chi-squared goodness of fit tests with applications

    CERN Document Server

    Balakrishnan, N; Nikulin, MS


    Chi-Squared Goodness of Fit Tests with Applications provides a thorough and complete context for the theoretical basis and implementation of Pearson's monumental contribution and its wide applicability for chi-squared goodness of fit tests. The book is ideal for researchers and scientists conducting statistical analysis in processing of experimental data as well as to students and practitioners with a good mathematical background who use statistical methods. The historical context, especially Chapter 7, provides great insight into importance of this subject with an authoritative author team

  6. Dicty_cDB: CHI642 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI642 (Link to dictyBase) - - - Contig-U14351-1 CHI642E (Link to Original ... 37 (Q4G069) RecName: Full=Regulator of microtubule dynamics ... protein... 154 3e-36 AF151848_1( AF151848 |pid:non ... 36 (Q96DB5) RecName: Full=Regulator of microtubule dynamics ... protein... 153 5e-36 (Q5R8E4) RecName: Full=Regula ...

  7. The Shape of the Noncentral Chi-square Density

    CERN Document Server

    Yu, Yaming


    A noncentral chi-square density is log-concave if the degree of freedom is nu>=2. We complement this known result by showing that, for each 00 such that the chi-square with nu degrees of freedom and noncentrality parameter lambda has a decreasing density if lambda <= lambda_nu, and is bi-modal otherwise. The critical lambda_nu is characterized by an equation involving a ratio of modified Bessel functions. When an interior mode exists we derive precise bounds on its location.

  8. Chi-squared and Associations in Tabular Audiology Data


    Muhammad N. Anwar; Michael P. Oakes; Ken McGarry


    In this paper, we have used the chi-squared test and Yule’s Q measure to discover associations in tables of patient audiology data. These records are examples of heterogeneous medical records, since they contain audiograms, textual notes and typical relational fields. In our first experiment we used the chi-squared measure to discover associations between the different fields of audiology data such as patient gender and patient age with diagnosis. Then, in our second experiment we used Yule’s...

  9. Dicty_cDB: CHI478 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI478 (Link to dictyBase) - G01678 DDB0185605 Contig-U11784-1 CHI478P (Lin ... lis melanin b... 82 4e-14 ( P07524 ) RecName: Full=Tyrosinase ; EC=; AltNam... 81 9e-14 AP009493_2447( A ... us subsp. gri... 80 2e-13 ( P06845 ) RecName: Full=Tyrosinase ; EC=; AltNam... 79 4e-13 A24089( A24089 ) ...

  10. Measurement of hadronic production of the chi /sub 1//sup ++/(3507) and the chi /sub 2//sup ++/(3553) through their radiative decay to J/ psi

    CERN Document Server

    Lemoigne, Y; Barate, R; Bareyre, P; Bonamy, P; Borgeaud, P; Brabson, B B; Crittenden, R R; David, M; Duane, A; Gentit, F X; Heinz, R M; King, G J; Krider, J; Laurens, G; Marshall, T; McEwen, J G; Namjoshi, R; Nandi, B C; Pietrzyk, B; Villet, G; Websdale, D M; Wiejak, J; Zaninotti, S


    The chi /sub 1//sup ++/(3507) and the chi /sub 2//sup ++/(3553) states have been observed in the Goliath spectrometer at the CERN SPS in 185 GeV/c\\pi^{-}-Be collisions. Their radiative decays contribute 27.7% (for the chi /sub 1//sup ++/) and 12.8% (for the chi /sub 2//sup ++/) to J/ psi production. At this energy, their cross sections are 65+or-19 nb and 96+or-29 nb, respectively.

  11. Programme Note: Realities and Opportunities in Ho Chi Minh City. (United States)

    Franchet, Chi Nguyen


    The current status of street children in Ho Chi Minh City, Vietnam, is characterized by marginalization from society through street vending, begging, theft, and prostitution. Evaluation of a drop-in center serving children without family linkages indicates need for needs assessments, follow-up activities, measurement of individual child progress,…

  12. Modulational instability in the nonlocal chi(2)-model

    DEFF Research Database (Denmark)

    Wyller, John Andreas; Krolikowski, Wieslaw; Bang, Ole;


    are recovered as the asymptotic limit of one of the branches of the plane waves (i.e. the adiabatic branch or the acoustic branch) of the full chi((2))-model by means of a singular perturbational approach. It is also proven that the stability results for the adiabatic branch continuously approach...

  13. Escape angles in bulk chi((2)) soliton interactions

    DEFF Research Database (Denmark)

    Johansen, Steffen Kjær; Bang, Ole; Sørensen, Mads Peter


    We develop a theory for nonplanar interaction between two identical type I spatial solitons propagating at opposite, but arbitrary transverse angles in quadratic nonlinear (or so-called chi((2))) bulk, media. We predict quantitatively the outwards escape angle, below which the solitons turn aroun...

  14. Dicty_cDB: CHI113 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI113 (Link to dictyBase) - - - Contig-U14338-1 - (Link to Original site) ... 37591_59( DQ437591 |pid:none) Variola virus strain Sumatra ... 1970... 33 3.0 AL844504_205( AL844504 |pid:none) P ...

  15. Dicty_cDB: CHI816 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI816 (Link to dictyBase) - G20190 DDB0202068 Contig-U14357-1 - (Link to O ... BD080275 |BD080275.1 Transgenic plant with altered morphology ... and endo-1,4-beta-glucanase gene, promoter and pro ...

  16. Bisimulation Lattice of Asymmetric Chi Calculus with Mismatch

    Institute of Scientific and Technical Information of China (English)

    Dong Xiaoju(董笑菊); Zhong Farong; Fu Yuxi


    This paper carries out a systematic investigation into the bisimulation lattice of asymmetric chi calculus with a mismatch combinator. It is shown that all the sixty three L-bisimilarities collapse to twelve distinct relations and they form a bisimulation lattice with respect to set inclusion. The top of the lattice coincides with the barbed bisimilarity.

  17. Dicty_cDB: CHI610 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI610 (Link to dictyBase) - - - Contig-U14350-1 - (Link to Original site) ... CFFFFFWI*kk--- Translated Amino Acid sequence (All Frames ) Frame A: nsnthlthysqkkk**ink**in*ink*nfihi*lnfls* ...

  18. Measurement of $\\chi_{c1}$ and $\\chi_{c2}$ production with $\\sqrt{s}=7$ TeV $pp$ collisions at ATLAS

    CERN Document Server

    Aad, Georges; Abbott, Brad; Abdallah, Jalal; Abdel Khalek, Samah; Abdinov, Ovsat; Aben, Rosemarie; Abi, Babak; Abolins, Maris; AbouZeid, Ossama; Abramowicz, Halina; Abreu, Henso; Abulaiti, Yiming; Acharya, Bobby Samir; Adamczyk, Leszek; Adams, David; Addy, Tetteh; Adelman, Jahred; Adomeit, Stefanie; Adye, Tim; Aefsky, Scott; Agatonovic-Jovin, Tatjana; Aguilar-Saavedra, Juan Antonio; Agustoni, Marco; Ahlen, Steven; Ahmad, Ashfaq; Ahmadov, Faig; Aielli, Giulio; Åkesson, Torsten Paul Ake; Akimoto, Ginga; Akimov, Andrei; Alam, Muhammad Aftab; Albert, Justin; Albrand, Solveig; Alconada Verzini, Maria Josefina; Aleksa, Martin; Aleksandrov, Igor; Alessandria, Franco; Alexa, Calin; Alexander, Gideon; Alexandre, Gauthier; Alexopoulos, Theodoros; Alhroob, Muhammad; Aliev, Malik; Alimonti, Gianluca; Alio, Lion; Alison, John; Allbrooke, Benedict; Allison, Lee John; Allport, Phillip; Allwood-Spiers, Sarah; Almond, John; Aloisio, Alberto; Alon, Raz; Alonso, Alejandro; Alonso, Francisco; Altheimer, Andrew David; Alvarez Gonzalez, Barbara; Alviggi, Mariagrazia; Amako, Katsuya; Amaral Coutinho, Yara; Amelung, Christoph; Ammosov, Vladimir; Amor Dos Santos, Susana Patricia; Amorim, Antonio; Amoroso, Simone; Amram, Nir; Amundsen, Glenn; Anastopoulos, Christos; Ancu, Lucian Stefan; Andari, Nansi; Andeen, Timothy; Anders, Christoph Falk; Anders, Gabriel; Anderson, Kelby; Andreazza, Attilio; Andrei, George Victor; Anduaga, Xabier; Angelidakis, Stylianos; Anger, Philipp; Angerami, Aaron; Anghinolfi, Francis; Anisenkov, Alexey; Anjos, Nuno; Annovi, Alberto; Antonaki, Ariadni; Antonelli, Mario; Antonov, Alexey; Antos, Jaroslav; Anulli, Fabio; Aoki, Masato; Aperio Bella, Ludovica; Apolle, Rudi; Arabidze, Giorgi; Aracena, Ignacio; Arai, Yasuo; Arce, Ayana; Arfaoui, Samir; Arguin, Jean-Francois; Argyropoulos, Spyridon; Arik, Engin; Arik, Metin; Armbruster, Aaron James; Arnaez, Olivier; Arnal, Vanessa; Arslan, Ozan; Artamonov, Andrei; Artoni, Giacomo; Asai, Shoji; Asbah, Nedaa; Ask, Stefan; Åsman, Barbro; Asquith, Lily; Assamagan, Ketevi; Astalos, Robert; Astbury, Alan; Atkinson, Markus; Atlay, Naim Bora; Auerbach, Benjamin; Auge, Etienne; Augsten, Kamil; Aurousseau, Mathieu; Avolio, Giuseppe; Azuelos, Georges; Azuma, Yuya; Baak, Max; Bacci, Cesare; Bach, Andre; Bachacou, Henri; Bachas, Konstantinos; Backes, Moritz; Backhaus, Malte; Backus Mayes, John; Badescu, Elisabeta; Bagiacchi, Paolo; Bagnaia, Paolo; Bai, Yu; Bailey, David; Bain, Travis; Baines, John; Baker, Oliver Keith; Baker, Sarah; Balek, Petr; Balli, Fabrice; Banas, Elzbieta; Banerjee, Swagato; Banfi, Danilo; Bangert, Andrea Michelle; Bansal, Vikas; Bansil, Hardeep Singh; Barak, Liron; Baranov, Sergei; Barber, Tom; Barberio, Elisabetta Luigia; Barberis, Dario; Barbero, Marlon; Barillari, Teresa; Barisonzi, Marcello; Barklow, Timothy; Barlow, Nick; Barnett, Bruce; Barnett, Michael; Baroncelli, Antonio; Barone, Gaetano; Barr, Alan; Barreiro, Fernando; Barreiro Guimarães da Costa, João; Bartoldus, Rainer; Barton, Adam Edward; Bartos, Pavol; Bartsch, Valeria; Bassalat, Ahmed; Basye, Austin; Bates, Richard; Batkova, Lucia; Batley, Richard; Battistin, Michele; Bauer, Florian; Bawa, Harinder Singh; Beau, Tristan; Beauchemin, Pierre-Hugues; Beccherle, Roberto; Bechtle, Philip; Beck, Hans Peter; Becker, Anne Kathrin; Becker, Sebastian; Beckingham, Matthew; Beddall, Andrew; Beddall, Ayda; Bedikian, Sourpouhi; Bednyakov, Vadim; Bee, Christopher; Beemster, Lars; Beermann, Thomas; Begel, Michael; Behr, Katharina; Belanger-Champagne, Camille; Bell, Paul; Bell, William; Bella, Gideon; Bellagamba, Lorenzo; Bellerive, Alain; Bellomo, Massimiliano; Belloni, Alberto; Beloborodova, Olga; Belotskiy, Konstantin; Beltramello, Olga; Benary, Odette; Benchekroun, Driss; Bendtz, Katarina; Benekos, Nektarios; Benhammou, Yan; Benhar Noccioli, Eleonora; Benitez Garcia, Jorge-Armando; Benjamin, Douglas; Bensinger, James; Benslama, Kamal; Bentvelsen, Stan; Berge, David; Bergeaas Kuutmann, Elin; Berger, Nicolas; Berghaus, Frank; Berglund, Elina; Beringer, Jürg; Bernard, Clare; Bernat, Pauline; Bernhard, Ralf; Bernius, Catrin; Bernlochner, Florian Urs; Berry, Tracey; Berta, Peter; Bertella, Claudia; Bertolucci, Federico; Besana, Maria Ilaria; Besjes, Geert-Jan; Bessidskaia, Olga; Besson, Nathalie; Bethke, Siegfried; Bhimji, Wahid; Bianchi, Riccardo-Maria; Bianchini, Louis; Bianco, Michele; Biebel, Otmar; Bieniek, Stephen Paul; Bierwagen, Katharina; Biesiada, Jed; Biglietti, Michela; Bilbao De Mendizabal, Javier; Bilokon, Halina; Bindi, Marcello; Binet, Sebastien; Bingul, Ahmet; Bini, Cesare; Bittner, Bernhard


    The prompt and non-prompt production cross-sections for the $\\chi_{c1}$ and $\\chi_{c2}$ charmonium states are measured in $pp$ collisions at $\\sqrt{s}=7$ TeV with the ATLAS detector at the LHC using 4.5 fb-1 of integrated luminosity. The $\\chi_{c}$ states are reconstructed through the radiative decay $\\chi_{c}\\rightarrow J/\\psi\\,\\gamma$ (with $J/\\psi\\rightarrow\\mu^{+}\\mu^{-}$) where photons are reconstructed from $\\gamma\\rightarrow e^{+}e^{-}$ conversions. The production rate of the $\\chi_{c2}$ state relative to the $\\chi_{c1}$ state is measured for prompt and non-prompt $\\chi_{c}$ as a function of $J/\\psi$ transverse momentum. The prompt $\\chi_{c}$ cross-sections are combined with existing measurements of prompt $J/\\psi$ production to derive the fraction of prompt $J/\\psi$ produced in feed-down from $\\chi_{c}$ decays. The fractions of $\\chi_{c1}$ and $\\chi_{c2}$ produced in $b$-hadron decays are also measured. In addition to measurements of inclusive $\\chi_{c}$ production, the branching fraction ${\\cal B}(B^...

  19. Measurement of the $\\chi_b(3P)$ mass and of the relative rate of $\\chi_{b1}(1P)$ and $\\chi_{b2}(1P)$ production

    CERN Document Server

    Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Bjørnstad, Pål Marius; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brambach, Tobias; van den Brand, Johannes; Bressieux, Joël; Brett, David; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Brown, Henry; Bursche, Albert; Busetto, Giovanni; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Ciba, Krzystof; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cojocariu, Lucian; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Counts, Ian; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pascal; David, Pieter; Davis, Adam; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Di Canto, Angelo; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dreimanis, Karlis; Dujany, Giulio; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gavrilov, Gennadii; Geraci, Angelo; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Gianì, Sebastiana; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, Vladimir; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hunt, Philip; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jaton, Pierre; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kelsey, Matthew; Kenyon, Ian; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kozlinskiy, Alexandr; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leo, Sabato; Leroy, Olivier; Lesiak, Tadeusz; Lespinasse, Mickael; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Lohn, Stefan; Longstaff, Iain; Lopes, Jose; Lopez-March, Neus; Lowdon, Peter; Lu, Haiting; Lucchesi, Donatella; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martens, Aurelien; Martín Sánchez, Alexandra; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Moggi, Niccolò; Molina Rodriguez, Josue; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Katharina; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Oggero, Serena; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Orlandea, Marius; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Perrin-Terrin, Mathieu; Pescatore, Luca; Pesen, Erhan; Petridis, Konstantin; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Poluektov, Anton; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Roa Romero, Diego; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruiz, Hugo; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Sparkes, Ailsa; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Subbiah, Vijay Kartik; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Whitehead, Mark; Wicht, Jean; Wiedner, Dirk; Wilkinson, Guy; Williams, Matthew; Williams, Mike; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wu, Suzhi; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zvyagin, Alexander


    The production of $\\chi_b$ mesons in proton-proton collisions is studied using a data sample collected by the LHCb detector, at centre-of-mass energies of $\\sqrt{s}=7$ and $8$ TeV and corresponding to an integrated luminosity of 3.0 fb$^{-1}$. The $\\chi_b$ mesons are identified through their decays to $\\Upsilon(1S)\\gamma$ and $\\Upsilon(2S)\\gamma$ using photons that converted to $e^+e^-$ pairs in the detector. The $\\chi_b(3P)$ meson mass, and the relative prompt production rate of $\\chi_{b1}(1P)$ and $\\chi_{b2}(1P)$ mesons as a function of the $\\Upsilon(1S)$ transverse momentum in the $\\chi_b$ rapidity range 2.0< $y$<4.5, are measured. Assuming a mass splitting between the $\\chi_{b1}(3P)$ and the $\\chi_{b2}(3P)$ states of 10.5 MeV/$c^2$, the mass of the $\\chi_{b1}(3P)$ meson is \\begin{equation*} m(\\chi_{b1}(3P))= 10515.7^{+2.2}_{-3.9}(stat) ^{+1.5}_{-2.1}(syst) MeV/c^2. \\end{equation*}

  20. Escape angles in bulk chi((2)) soliton interactions


    Johansen, Steffen Kjær; Bang, Ole; Sørensen, Mads Peter


    We develop a theory for nonplanar interaction between two identical type I spatial solitons propagating at opposite, but arbitrary transverse angles in quadratic nonlinear (or so-called chi((2))) bulk, media. We predict quantitatively the outwards escape angle, below which the solitons turn around and collide, and above which they continue to move-away from each other. For in-plane interaction, the theory allows prediction of the Outcome of a collision through the inwards escape angle, i.e., ...

  1. Feynman Rules of Higher-order Poles in CHY Construction

    CERN Document Server

    Huang, Rijun; Luo, Ming-xing; Zhu, Chuan-Jie


    In this paper, we generalize the integration rules for scattering equations to situations where higher-order poles are present. We describe the strategy to deduce the Feynman rules of higher-order poles from known analytic results of simple CHY-integrands, and propose the Feynman rules for single double pole and triple pole as well as duplex-double pole and triplex-double pole structures. We demonstrate the validation and strength of these rules by ample non-trivial examples.

  2. Consumer Behaviour. Case: iPhone Ho Chi Minh City


    Tran, Thi Xuan Oanh


    The main aim of this thesis is to figure out the factors that have influenced consumer behaviour of young iPhone users in Ho Chi Minh City. In this study, the author draw a conclusion based on the data collected from the survey and proposed some feasible recommendations for Apple and other high-end smartphone companies to understand their consumers and enhance brand equity. For the secondary data, a variety of theories, including consumers’ characteristics, promotion and the decision mak...

  3. An Advanced Dictionary? Similarities and Differences between Duramazwi ReChiShona and Duramazwi Guru ReChiShona *

    Directory of Open Access Journals (Sweden)

    Emmanuel Chabata


    Full Text Available

    Abstract: In this article a comparative analysis of Duramazwi ReChiShona (DRC and Duramazwi Guru ReChiShona (DGC is made. Both DRC and DGC are monolingual Shona dictionaries compiled by a team of researchers under the African Languages Lexical (ALLEX Project, now the African Languages Research Institute (ALRI. During the compilation process, DRC was known as the General Shona Dictionary and DGC as the Advanced Shona Dictionary. A simple analysis of these titles shows that the dictionaries are similar in some ways and also different in others. The writer tries to show the ways in which DGC is regarded as a more advanced dictionary when compared to DRC. Although the argument of the article is mainly built on those differences which make DGC the more advanced, attention is also paid to the similarities between the dictionaries.


    Opsomming: 'n Gevorderde woordeboek? Ooreenkomste en verskille tussen Duramazwi ReChiShona en Duramazwi Guru ReChiShona. In hierdie artikel word 'n vergelykende ontleding van Duramazwi ReChiShona (DRC en Duramazwi Guru ReChiShona (DGC gemaak. Sowel die DRC en DGC is eentalige Sjonawoordeboeke, saamgestel deur ?n span navorsers by die African Languages Lexical (ALLEX Project, tans die African Languages Research Institute (ALRI. Gedurende die samestellingsproses was DRC bekend as die Algemene Sjonawoordeboek en DGC as die Gevorderde Sjonawoordeboek. 'n Eenvoudige ontleding van hierdie titels toon dat die woordeboeke op sommige maniere eenders en op ander ook verskillend is. Die skrywer probeer die maniere aantoon waarop DGC beskou word as 'n meer gevorderde woordeboek wanneer dit met DRC vergelyk word. Alhoewel die argument van die artikel hoofsaaklik gebou is op daardie verskille wat DGC die gevorderdste maak, word ook aandag gegee aan

  4. Measurement of the Branching Fraction for B+- --> chi_c0 K+-

    CERN Document Server

    Aubert, B; Boutigny, D; Gaillard, J M; Hicheur, A; Karyotakis, Yu; Lees, J P; Robbe, P; Tisserand, V; Zghiche, A; Palano, A; Pompili, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Borgland, A W; Breon, A B; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Day, C T; Gill, M S; Gritsan, A V; Groysman, Y; Jacobsen, R G; Kadel, R W; Kadyk, J; Kerth, L T; Kolomensky, Yu G; Kral, J F; Kukartsev, G; Le Clerc, C; Levi, M E; Lynch, G; Mir, L M; Oddone, P J; Orimoto, T J; Pripstein, M; Roe, N A; Romosan, A; Ronan, Michael T; Shelkov, V G; Telnov, A V; Wenzel, W A; Ford, K; Harrison, T J; Hawkes, C M; Knowles, D J; Morgan, S E; Penny, R C; Watson, A T; Watson, N K; Goetzen, K; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Peters, K; Schmücker, H; Steinke, M; Barlow, N R; Boyd, J T; Chevalier, N; Cottingham, W N; Kelly, M P; Latham, T E; MacKay, C; Wilson, F F; Abe, K; Çuhadar-Dönszelmann, T; Hearty, C; Mattison, T S; McKenna, J A; Thiessen, D; Kyberd, P; McKemey, A K; Blinov, V E; Bukin, A D; Golubev, V B; Ivanchenko, V N; Kravchenko, E A; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Yushkov, A N; Best, D; Bruinsma, M; Chao, M; Kirkby, D; Lankford, A J; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Buchanan, C; Hartfiel, B L; Shen, B C; Del Re, D; Hadavand, H K; Hill, E J; MacFarlane, D B; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Dahmes, B; Kuznetsova, N; Levy, S L; Long, O; Lu, A; Mazur, M A; Richman, J D; Verkerke, W; Beck, T W; Beringer, J; Eisner, A M; Heusch, C A; Lockman, W S; Schalk, T; Schmitz, R E; Schumm, B A; Seiden, A; Turri, M; Walkowiak, W; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dubois-Felsmann, G P; Dvoretskii, A; Hitlin, D G; Narsky, I; Porter, F C; Ryd, A; Samuel, A; Yang, S; Jayatilleke, S M; Mancinelli, G; Meadows, B T; Sokoloff, M D; Abe, T; Blanc, F; Bloom, P; Chen, S; Clark, P J; Ford, W T; Nauenberg, U; Olivas, A; Rankin, P; Roy, J; Smith, J G; Van Hoek, W C; Zhang, L; Harton, J L; Hu, T; Soffer, A; Toki, W H; Wilson, R J; Zhang, J; Altenburg, D; Brandt, T; Brose, J; Colberg, T; Dickopp, M; Dubitzky, R S; Hauke, A; Lacker, H M; Maly, E; Müller-Pfefferkorn, R; Nogowski, R; Otto, S; Schubert, J; Schubert, Klaus R; Schwierz, R; Spaan, B; Wilden, L; Bernard, D; Bonneaud, G R; Brochard, F; Cohen-Tanugi, J; Grenier, P; Thiebaux, C; Vasileiadis, G; Verderi, M; Khan, A; Lavin, D; Muheim, F; Playfer, S; Swain, J E; Andreotti, M; Azzolini, V; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Piemontese, L; Sarti, A; Treadwell, E; Anulli, F; Baldini-Ferroli, R; Biasini, M; Calcaterra, A; De Sangro, R; Falciai, D; Finocchiaro, G; Patteri, P; Peruzzi, I M; Piccolo, M; Pioppi, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Crosetti, G; Lo Vetere, M; Macri, M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Bailey, S; Morii, M; Won, E; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Eschrich, I; Gaillard, J R; Morton, G W; Nash, J A; Sanders, P; Taylor, G P; Grenier, G J; Lee, S J; Mallik, U; Cochran, J; Crawley, H B; Lamsa, J; Meyer, W T; Prell, S; Rosenberg, E I; Yi, J; Davier, M; Grosdidier, G; Höcker, A; Laplace, S; Le Diberder, F R; Lepeltier, V; Lutz, A M; Petersen, T C; Plaszczynski, S; Schune, M H; Tantot, L; Wormser, G; Brigljevic, V; Cheng, C H; Lange, D J; Wright, D M; Bevan, A J; Coleman, J P; Fry, J R; Gabathuler, Erwin; Gamet, R; Kay, M; Parry, R J; Payne, D J; Sloane, R J; Touramanis, C; Back, J J; Harrison, P F; Shorthouse, H W; Strother, P; Vidal, P B; Brown, C L; Cowan, G; Flack, R L; Flächer, H U; George, S; Green, M G; Kurup, A; Marker, C E; McMahon, T R; Ricciardi, S; Salvatore, F; Vaitsas, G; Winter, M A; Brown, D; Davis, C L; Allison, J; Barlow, R J; Forti, A C; Hart, P A; Hodgkinson, M C; Jackson, F; Lafferty, G D; Lyon, A J; Weatherall, J H; Williams, J C; Farbin, A; Jawahery, A; Kovalskyi, D; Lae, C K; Lillard, V; Roberts, D A; Blaylock, G; Dallapiccola, C; Flood, K T; Hertzbach, S S; Kofler, R; Koptchev, V B; Moore, T B; Saremi, S; Stängle, H; Willocq, S; Cowan, R; Sciolla, G; Taylor, F; Yamamoto, R K; Mangeol, D J J; Patel, P M; Lazzaro, A; Palombo, F; Bauer, J M; Cremaldi, L M; Eschenburg, V; Godang, R; Kroeger, R; Reidy, J; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Cote-Ahern, D; Hast, C; Taras, P; Nicholson, H; Cartaro, C; Cavallo, N; De Nardo, Gallieno; Fabozzi, F; Gatto, C; Lista, L; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M A; Raven, G; LoSecco, J M; Gabriel, T A; Brau, B; Gan, K K; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Pulliam, T; Wong, Q K; Brau, J E; Frey, R; Potter, C T; Sinev, N B; Strom, D; Torrence, E; Colecchia, F; Dorigo, A; Galeazzi, F; Margoni, M; Morandin, M; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Tiozzo, G; Voci, C; Benayoun, M; Briand, H; Chauveau, J; David, P; La Vaissière, C de; Del Buono, L; Hamon, O; John, M J J; Leruste, P; Ocariz, J; Pivk, M; Roos, L; Stark, J; T'Jampens, S; Therin, G; Manfredi, P F; Re, V; Behera, P K; Gladney, L; Guo, Q H; Panetta, J; Angelini, C; Batignani, G; Bettarini, S; Bondioli, M; Bucci, F; Calderini, G; Carpinelli, M; Del Gamba, V; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Martínez-Vidal, F; Morganti, M; Neri, N; Paoloni, E; Rama, M; Rizzo, G; Sandrelli, F; Walsh, J; Haire, M; Judd, D; Paick, K; Wagoner, D E; Danielson, N; Elmer, P; Lü, C; Miftakov, V; Olsen, J; Smith, A J S; Tanaka, H A; Varnes, E W; Bellini, F; Cavoto, G; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Mazzoni, M A; Morganti, S; Pierini, M; Piredda, G; Safai-Tehrani, F; Voena, C; Christ, S; Wagner, G; Waldi, R; Adye, T; De Groot, N; Franek, B J; Geddes, N I; Gopal, G P; Olaiya, E O; Xella, S M; Aleksan, Roy; Emery, S; Gaidot, A; Ganzhur, S F; Giraud, P F; Hamel de Monchenault, G; Kozanecki, Witold; Langer, M; Legendre, M; London, G W; Mayer, B; Schott, G; Vasseur, G; Yéche, C; Zito, M; Purohit, M V; Weidemann, A W; Yumiceva, F X; Aston, D; Bartoldus, R; Berger, N; Boyarski, A M; Buchmüller, O L; Convery, M R; Coupal, D P; Dong, D; Dorfan, J; Dujmic, D; Dunwoodie, W M; Field, R C; Glanzman, T; Gowdy, S J; Graugès-Pous, E; Hadig, T; Halyo, V; Hrynóva, T; Innes, W R; Jessop, C P; Kelsey, M H; Kim, P; Kocian, M L; Langenegger, U; Leith, D W G S; Luitz, S; Lüth, V; Lynch, H L; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Petrak, S; Ratcliff, B N; Robertson, S H; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Simi, G; Snyder, A; Soha, A; Stelzer, J; Su, D; Sullivan, M K; Vavra, J; Wagner, S R; Weaver, M; Weinstein, A J R; Wisniewski, W J; Wright, D H; Young, C C; Burchat, Patricia R; Edwards, A J; Meyer, T I; Petersen, B A; Roat, C; Ahmed, S; Alam, M S; Ernst, J A; Saleem, M; Wappler, F R; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Kim, H; Ritchie, J L; Schwitters, R F; Izen, J M; Kitayama, I; Lou, X C; Ye, S; Bianchi, F; Bóna, M; Gallo, F; Gamba, D; Borean, C; Bosisio, L; Della Ricca, G; Dittongo, S; Grancagnolo, S; Lanceri, L; Poropat, P; Vitale, L; Vuagnin, G; Panvini, R S; Banerjee, Sw; Brown, C M; Fortin, D; Jackson, P D; Kowalewski, R V; Roney, J M; Band, H R; Dasu, S; Datta, M; Eichenbaum, A M; Johnson, J R; Kutter, P E; Li, H; Liu, R; Di Lodovico, F; Mihályi, A; Mohapatra, A K; Pan, Y; Prepost, R; Sekula, S J; Von Wimmersperg-Töller, J H; Wu, J; Wu, S L; Yu, Z; Neal, H


    We present a measurement of the branching fraction of the decay B+- --> chi_c0 K+- from a sample of 89 million BB pairs collected by the BaBar detector at the PEP-II asymmetric-energy B Factory at SLAC. The chi_c0 meson is reconstructed through its two-body decays to pi+ pi- and K+ K-. We measure BR(B+- --> chi_c0 K+-)* BR(chi_c0 --> pi+ pi-) = (1.32^{+0.28}_{-0.27}(stat) +- 0.09(syst))*10^-6 and BR(B+- --> chi_c0 K+-) * BR(chi_c0 --> K+ K-) = (1.49^{+0.36}_{-0.34}(stat) +- 0.11(syst))* 10^-6. Using the known values for the chi_c0 decays branching fractions, we combine these results to obtain BR(B+- --> chi_c0 K+-) = (2.7+-0.7)* 10^-4.

  5. The best approximation of $P-$ metric space of $\\chi^{2}-$ defined by Musielak

    Directory of Open Access Journals (Sweden)



    Full Text Available In this paper, we introduce the idea of constructing sequence space $\\chi^{2}$ of best approximation in $p-$ metric defined by Musielak and also construct some general topological properties of approximation of $\\chi^{2}$

  6. Effect of tai chi exercise on proprioception of ankle and knee joints in old people


    Xu, D.; Hong, Y; Li, J.; Chan, K.


    Objectives: To assess if tai chi, a traditional Chinese form of exercise, could improve proprioception in old people and if the effects of tai chi on proprioception are more evident than other exercise forms in the elderly.

  7. Search for Factorization-Suppressed $B \\to{ chi_c} K^(*)$ Decays

    CERN Document Server

    Aubert, B; Boutigny, D; Couderc, F; Karyotakis, Yu; Lees, J P; Poireau, V; Tisserand, V; Zghiche, A; Graugès-Pous, E; Palano, A; Pompili, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Borgland, A W; Breon, A B; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Day, C T; Gill, M S; Gritsan, A V; Groysman, Y; Jacobsen, R G; Kadel, R W; Kadyk, J; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lynch, G; Mir, L M; Oddone, P J; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, Michael T; Wenzel, W A; Barrett, M; Ford, K E; Harrison, T J; Hart, A J; Hawkes, C M; Morgan, S E; Watson, A T; Fritsch, M; Goetzen, K; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Schröder, T; Steinke, M; Boyd, J T; Chevalier, N; Cottingham, W N; Kelly, M P; Latham, T E; Wilson, F F; Çuhadar-Dönszelmann, T; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Thiessen, D; Khan, A; Kyberd, P; Teodorescu, L; Blinov, A E; Blinov, V E; Druzhinin, V P; Golubev, V B; Ivanchenko, V N; Kravchenko, E A; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Yushkov, A N; Best, D; Bruinsma, M; Chao, M; Eschrich, I; Kirkby, D; Lankford, A J; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Buchanan, C; Hartfiel, B L; Weinstein, A J R; Foulkes, S D; Gary, J W; Long, O; Shen, B C; Wang, K; Del Re, D; Hadavand, H K; Hill, E J; MacFarlane, D B; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Lu, A; Mazur, M A; Richman, J D; Verkerke, W; Beck, T W; Eisner, A M; Heusch, C A; Kroseberg, J; Lockman, W S; Nesom, G; Schalk, T; Schumm, B A; Seiden, A; Spradlin, P; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dubois-Felsmann, G P; Dvoretskii, A; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Ryd, A; Samuel, A; Yang, S; Jayatilleke, S M; Mancinelli, G; Meadows, B T; Sokoloff, M D; Blanc, F; Bloom, P; Chen, S; Ford, W T; Nauenberg, U; Olivas, A; Rankin, P; Ruddick, W O; Smith, J G; Ulmer, K A; Zhang, J; Zhang, L; Chen, A; Eckhart, E A; Harton, J L; Soffer, A; Toki, W H; Wilson, R J; Zeng, Q; Spaan, B; Altenburg, D; Brandt, T; Brose, J; Dickopp, M; Feltresi, E; Hauke, A; Lacker, H M; Nogowski, R; Otto, S; Petzold, A; Schubert, J; Schubert, Klaus R; Schwierz, R; Sundermann, J E; Bernard, D; Bonneaud, G R; Grenier, P; Schrenk, S; Thiebaux, C; Vasileiadis, G; Verderi, M; Bard, D J; Clark, P J; Muheim, F; Playfer, S; Xie, Y; Andreotti, M; Azzolini, V; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Piemontese, L; Sarti, A; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Patteri, P; Peruzzi, I M; Piccolo, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Crosetti, G; Lo Vetere, M; Macri, M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Bailey, S; Brandenburg, G; Chaisanguanthum, K S; Morii, M; Won, E; Dubitzky, R S; Langenegger, U; Marks, J; Uwer, U; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Gaillard, J R; Morton, G W; Nash, J A; Nikolich, M B; Taylor, G P; Charles, M J; Grenier, G J; Mallik, U; Cochran, J; Crawley, H B; Lamsa, J; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Yi, J; Arnaud, N; Davier, M; Giroux, X; Grosdidier, G; Höcker, A; Le Diberder, F R; Lepeltier, V; Lutz, A M; Petersen, T C; Plaszczynski, S; Schune, M H; Wormser, G; Cheng, C H; Lange, D J; Simani, M C; Wright, D M; Bevan, A J; Chavez, C A; Coleman, J P; Forster, I J; Fry, J R; Gabathuler, Erwin; Gamet, R; Hutchcroft, D E; Parry, R J; Payne, D J; Touramanis, C; Cormack, C M; Di Lodovico, F; Brown, C L; Cowan, G; Flack, R L; Flächer, H U; Green, M G; Jackson, P S; McMahon, T R; Ricciardi, S; Salvatore, F; Winter, M A; Brown, D; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Hodgkinson, M C; Lafferty, G D; Williams, J C; Chen, C; Farbin, A; Hulsbergen, W D; Jawahery, A; Kovalskyi, D; Lae, C K; Lillard, V; Roberts, D A; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Kofler, R; Koptchev, V B; Moore, T B; Saremi, S; Stängle, H; Willocq, S; Cowan, R; Koeneke, K; Sciolla, G; Sekula, S J; Taylor, F; Yamamoto, R K; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L M; Eschenburg, V; Godang, R; Kroeger, R; Reidy, J; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Taras, P; Nicholson, H; Cavallo, N; Fabozzi, F; Gatto, C; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M; Bulten, H; Raven, G; Snoek, H L; Wilden, L; Jessop, C P; LoSecco, J M; Allmendinger, T; Benelli, G; Gan, K K; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Pulliam, T; Rahimi, A M; Ter-Antonian, R; Wong, Q K; Brau, J E; Frey, R; Igonkina, O; Lu, M; Potter, C T; Sinev, N B; Strom, D; Torrence, E; Colecchia, F; Dorigo, A; Galeazzi, F; Margoni, M; Morandin, M; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Benayoun, M; Briand, H; Chauveau, J; David, P; La Vaissière, C de; Del Buono, L; Hamon, O; John, M J J; Leruste, P; Malcles, J; Ocariz, J; Roos, L; Therin, G; Behera, P K; Gladney, L; Guo, Q H; Panetta, J; Biasini, M; Covarelli, R; Pioppi, M; Angelini, C; Batignani, G; Bettarini, S; Bondioli, M; Bucci, F; Calderini, G; Carpinelli, M; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Morganti, M; Neri, N; Paoloni, E; Rama, M; Rizzo, G; Simi, G; Walsh, J; Haire, M; Judd, D; Paick, K; Wagoner, D E; Danielson, N; Elmer, P; Lau, Y P; Lü, C; Miftakov, V; Olsen, J; Smith, A J S; Telnov, A V; Bellini, F; Cavoto, G; D'Orazio, A; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Li Gioi, L; Mazzoni, M A; Morganti, S; Pierini, M; Piredda, G; Polci, F; Safai-Tehrani, F; Voena, C; Christ, S; Schröder, H; Wagner, G; Waldi, R; Adye, T; De Groot, N; Franek, B J; Gopal, G P; Olaiya, E O; Aleksan, Roy; Emery, S; Gaidot, A; Ganzhur, S F; Giraud, P F; Hamel de Monchenault, G; Kozanecki, Witold; Legendre, M; London, G W; Mayer, B; Schott, G; Vasseur, G; Yéche, C; Zito, M; Purohit, M V; Weidemann, A W; Wilson, J R; Yumiceva, F X; Abe, T; Allen, M; Aston, D; Bartoldus, R; Berger, N; Boyarski, A M; Buchmüller, O L; Claus, R; Convery, M R; Cristinziani, M; De Nardo, Gallieno; Dingfelder, J C; Dong, D; Dorfan, J; Dujmic, D; Dunwoodie, W M; Fan, S; Field, R C; Glanzman, T; Gowdy, S J; Hadig, T; Halyo, V; Hast, C; Hrynóva, T; Innes, W R; Kelsey, M H; Kim, P; Kocian, M L; Leith, D W G S; Libby, J; Luitz, S; Lüth, V; Lynch, H L; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Soha, A; Stelzer, J; Strube, J; Su, D; Sullivan, M K; Thompson, J; Vavra, J; Wagner, S R; Weaver, M; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Young, C C; Burchat, Patricia R; Edwards, A J; Majewski, S A; Petersen, B A; Roat, C; Ahmed, M; Ahmed, S; Alam, M S; Ernst, J A; Saeed, M A; Saleem, M; Wappler, F R; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Kim, H; Ritchie, J L; Satpathy, A; Schwitters, R F; Izen, J M; Kitayama, I; Lou, X C; Ye, S; Bianchi, F; Bóna, M; Gallo, F; Gamba, D; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Dittongo, S; Grancagnolo, S; Lanceri, L; Poropat, P; Vitale, L; Vuagnin, G; Martínez-Vidal, F; Panvini, R S; Banerjee, S; Bhuyan, B; Brown, C M; Fortin, D; Jackson, P D; Kowalewski, R V; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Mohanty, G B; Band, H R; Chen, X; Cheng, B; Dasu, S; Datta, M; Eichenbaum, A M; Flood, K T; Graham, M; Hollar, J J; Johnson, J R; Kutter, P E; Li, H; Liu, R; Mihályi, A; Pan, Y; Prepost, R; Tan, P; Von Wimmersperg-Töller, J H; Wu, J; Wu, S L; Yu, Z; Greene, M G; Neal, H


    We search for the factorization-suppressed decays B -> chi_c0 K(*) and B -> chi_c2 K(*), with chi_c0 and chi_c2 decaying into J/psi gamma using a sample of 124 10^6 BBbar events collected with the BABAR detector at the PEP-II storage ring of the Stanford Linear Accelerator Center.

  8. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... Tai Chi and Qi Gong for Health and Well-Being Share: taichi_nccamIMG_2962.jpg © Mariann Seriff ... Tai Chi and Qi Gong for Health and Well-Being Video › Tai Chi and Qi Gong for ...

  9. Dicty_cDB: CHI614 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 850F7 (Roswell Park Cancer Institute Human BAC Library) complete sequence. 38 0.53 5 CR382125 |CR382125.1 Kluyveromyces lact...AAACCTTATTATCCA ATATTTTATTATCAGGTTTTAGG Length of 3' end seq. 743 Connected seq. ID CHI614P Connected seq. >...IILVXIINXVYNXFSGHS SEHTKNXLKXASKTSKKX--- ---DNHTFLRENRDPVKKMKHLPQGIL*sksirerffigfgtwhwwcts...ENRDPVKKMKHLPQGIL*sksirerffigfgtwhwwctsfsqss*ti*lc isitllvatyss*yv*tlvlcrn*sfmrtqisiikhwsrsksystmskrw*nya*ysts...d in the head. 40 2.1 2 CR238085 |CR238085.1 Forward strand read from insert in 5'HPRT insertion

  10. Dicty_cDB: CHI740 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI740 (Link to dictyBase) - - - Contig-U16419-1 - (Link to Original site) ... krftxchenctx** Frame B: ---xkttslvfkmxtks*m*i**prssmlc kgsp**mfikmshmamnvklitmvknvxsd pidhhhqkfvh*dahqnmnv ... slrcptwp*m*s*sqw*rmlxqi p*ttttrslfikmptkt*m*i**sw*kmlc kdsl**sl*frlw*rf*m*n*t*wfkmlc p frkttpttt*km**empxrp ... *m*s*stwkrmlrccp*txtkmlfkmstkt*m*sqpxw*r mlc *sspr*mfiemstrp*m*s*stwkrmxrccp*tttemlikmstkt*m*nqs ... lw*rml c *k*k*lfnl*rpktvkekvyxvp*klyxlik Homology vs CSM-cD ...

  11. Two-Photon Widths of the chi_cJ States of Charmonium

    CERN Document Server

    Ecklund, K M; Savinov, V; López, A; Méndez, H; Ramírez, J; Ge, J Y; Miller, D H; Shipsey, I P J; Xin, B; Adams, G S; Anderson, M; Cummings, J P; Danko, I; Hu, D; Moziak, B; Napolitano, J; He, Q; Insler, J; Muramatsu, H; Park, C S; Thorndike, E H; Yang, F; Artuso, M; Blusk, S; Khalil, S; Li, J; Mountain, R; Nisar, S; Randrianarivony, K; Sultana, N; Skwarnicki, T; Stone, S; Wang, J C; Zhang, L M; Bonvicini, G; Cinabro, D; Dubrovin, M; Lincoln, A; Naik, P; Rademacker, J; Asner, D M; Edwards, K W; Reed, J; Briere, R A; Ferguson, T; Tatishvili, G; Vogel, H; Watkins, M E; Rosner, J L; Alexander, J P; Cassel, D G; Duboscq, J E; Ehrlich, R; Fields, L; Galik, R S; Gibbons, L; Gray, R; Gray, S W; Hartill, D L; Hertz, D; Hunt, J M; Kandaswamy, J; Kreinick, D L; Kuznetsov, V E; Ledoux, J; Mahlke-Krüger, H; Mohapatra, D; Onyisi, P U E; Patterson, J R; Peterson, D; Riley, D; Ryd, A; Sadoff, A J; Shi, X; Stroiney, S; Sun, W M; Wilksen, T; Athar, S B; Patel, R; Yelton, J; Rubin, P; Eisenstein, B I; Karliner, I; Mehrabyan, S; Lowrey, N; Selen, M; White, E J; Wiss, J; Mitchell, R E; Shepherd, M R; Besson, D; Pedlar, T K; Cronin-Hennessy, D; Gao, K Y; Hietala, J; Kubota, Y; Klein, T; Lang, B W; Poling, R; Scott, A W; Zweber, P; Dobbs, S; Metreveli, Z; Seth, K K; Tomaradze, A G; Libby, J; Powell, A; Wilkinson, G


    Using a data sample of 24.5 million psi(2S) the reactions psi(2S)->gamma chi_cJ, chi_cJ->gamma gamma have been studied for the first time to determine the two-photon widths of the chi_cJ states of charmonium in their decay into two photons. The measured quantities are B(psi(2S)->gamma chi_c0)xB(chi_c0->gamma gamma)=(2.22+-0.32+-0.10)x10^-5, and B(psi(2S)->gamma chi_c2)xB(chi_c2->gamma gamma)=(2.70+-0.28+-0.15)x10^-5. Using values for B(psi(2S)->gamma chi_c0,c2) and \\Gamma(chi_c0,c2) from the literature the two-photon widths are derived to be \\Gamma_{gamma gamma}(chi_c0)=(2.53+-0.37+-0.26) keV, \\Gamma_{gamma gamma}(chi_c2)=(0.60+-0.06+-0.06) keV, and R=\\Gamma_{gamma gamma}(chi_c2)/\\Gamma_{gamma gamma}(chi_c0)= 0.237+-0.043+-0.034. The importance of the measurement of R is emphasized. For the forbidden transition, chi_c1->gamma gamma, an upper limit of \\Gamma_{gamma gamma}(chi_c1)<0.03 keV is established.

  12. Two-photon widths of the $\\chi_{c0, 2}$ states and helicity analysis for $\\chi_{c2}\\ar\\gamma\\gamma$}

    CERN Document Server

    Ablikim, M; Ambrose, D J; An, F F; An, Q; An, Z H; Bai, J Z; Ferroli, R B; Ban, Y; Becker, J; Berger, N; Bertani, M B; Bian, J M; Boger, E; Bondarenko, O; Boyko, I; Briere, R A; Bytev, V; Cai, X; Calcaterra, A C; Cao, G F; Chang, J F; Chelkov, G; Chen, G; Chen, H S; Chen, J C; Chen, M L; Chen, S J; Chen, Y; Chen, Y B; Cheng, H P; Chu, Y P; Cronin-Hennessy, D; Dai, H L; Dai, J P; Dedovich, D; Deng, Z Y; Denig, A; Denysenko, I; Destefanis, M; Ding, W M; Ding, Y; Dong, L Y; Dong, M Y; Du, S X; Fang, J; Fang, S S; Fava, L; Feldbauer, F; Feng, C Q; Fu, C D; Fu, J L; Gao, Y; Geng, C; Goetzen, K; Gong, W X; Gradl, W; Greco, M; Gu, M H; Gu, Y T; Guan, Y H; Guo, A Q; Guo, L B; Guo, Y P; Han, Y L; Hao, X Q; Harris, F A; He, K L; He, M; He, Z Y; Held, T; Heng, Y K; Hou, Z L; Hu, H M; Hu, J F; Hu, T; Huang, B; Huang, G M; Huang, J S; Huang, X T; Huang, Y P; Hussain, T; Ji, C S; Ji, Q; Ji, X B; Ji, X L; Jia, L K; Jiang, L L; Jiang, X S; Jiao, J B; Jiao, Z; Jin, D P; Jin, S; Jing, F F; Kalantar-Nayestanaki, N; Kavatsyuk, M; Kuehn, W; Lai, W; Lange, J S; Leung, J K C; Li, C H; Li, Cheng; Li, Cui; Li, D M; Li, F; Li, G; Li, H B; Li, J C; Li, K; Li, Lei; Li, N B; Li, Q J; Li, S L; Li, W D; Li, W G; Li, X L; Li, X N; Li, X Q; Li, X R; Li, Z B; Liang, H; Liang, Y F; Liang, Y T; Liao, G R; Liao, X T; Liu, B J; Liu, B J; Liu, C L; Liu, C X; Liu, C Y; Liu, F H; Liu, Fang; Liu, Feng; Liu, H; Liu, H B; Liu, H H; Liu, H M; Liu, H W; Liu, J P; Liu, Kun; Liu, Kai; Liu, K Y; Liu, P L; Liu, S B; Liu, X; Liu, X H; Liu, Y B; Liu, Y; Liu, Z A; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H; Lu, G R; Lu, H J; Lu, J G; Lu, Q W; Lu, X R; Lu, Y P; Luo, C L; Luo, M X; Luo, T; Luo, X L; Lv, M; Ma, C L; Ma, F C; Ma, H L; Ma, Q M; Ma, S; Ma, T; Ma, X Y; Ma, Y; Maas, F E; Maggiora, M; Malik, Q A; Mao, H; Mao, Y J; Mao, Z P; Messchendorp, J G; Min, J; Min, T J; Mitchell, R E; Mo, X H; Morales, C Morales; Motzko, C; Muchnoi, N Yu; Nefedov, Y; Nicholson, C; Nikolaev, I B; Ning, Z; Olsen, S L; Ouyang, Q; Pacetti, S P; Park, J W; Pelizaeus, M; Peters, K; Ping, J L; Ping, R G; Poling, R; Prencipe, E; Pun, C S J; Qi, M; Qian, S; Qiao, C F; Qin, X S; Qin, Y; Qin, Z H; Qiu, J F; Rashid, K H; Rong, G; Ruan, X D; Sarantsev, A; Schulze, J; Shao, M; Shen, C P; Shen, X Y; Sheng, H Y; Shepherd, M R; Song, X Y; Spataro, S; Spruck, B; Sun, D H; Sun, G X; Sun, J F; Sun, S S; Sun, X D; Sun, Y J; Sun, Y Z; Sun, Z J; Sun, Z T; Tang, C J; Tang, X; Thorndike, E H; Tian, H L; Toth, D; Ulrich, M U; Varner, G S; Wang, B; Wang, B Q; Wang, K; Wang, L L; Wang, L S; Wang, M; Wang, P; Wang, P L; Wang, Q; Wang, Q J; Wang, S G; Wang, X F; Wang, X L; Wang, Y D; Wang, Y F; Wang, Y Q; Wang, Z; Wang, Z G; Wang, Z Y; Wei, D H; Weidenkaff, P; Wen, Q G; Wen, S P; Werner, M W; Wiedner, U; Wu, L H; Wu, N; Wu, S X; Wu, W; Wu, Z; Xia, L G; Xiao, Z J; Xie, Y G; Xiu, Q L; Xu, G F; Xu, G M; Xu, H; Xu, Q J; Xu, X P; Xu, Y; Xu, Z R; Xue, F; Xue, Z; Yan, L; Yan, W B; Yan, Y H; Yang, H X; Yang, T; Yang, Y; Yang, Y X; Ye, H; Ye, M; Ye, M H; Yu, B X; Yu, C X; Yu, J S; Yu, S P; Yuan, C Z; Yuan, W L; Yuan, Y; Zafar, A A; Zallo, A Z; Zeng, Y; Zhang, B X; Zhang, B Y; Zhang, C C; Zhang, D H; Zhang, H H; Zhang, H Y; Zhang, J; Zhang, J G; Zhang, J Q; Zhang, J W; Zhang, J Y; Zhang, J Z; Zhang, L; Zhang, S H; Zhang, T R; Zhang, X J; Zhang, X Y; Zhang, Y; Zhang, Y H; Zhang, Y S; Zhang, Z P; Zhang, Z Y; Zhao, G; Zhao, H S; Zhao, J W; Zhao, K X; Zhao, Lei; Zhao, Ling; Zhao, M G; Zhao, Q; Zhao, S J; Zhao, T C; Zhao, X H; Zhao, Y B; Zhao, Z G; Zhemchugov, A; Zheng, B; Zheng, J P; Zheng, Y H; Zheng, Z P; Zhong, B; Zhong, J; Zhou, L; Zhou, X K; Zhou, X R; Zhu, C; Zhu, K; Zhu, K J; Zhu, S H; Zhu, X L; Zhu, X W; Zhu, Y M; Zhu, Y S; Zhu, Z A; Zhuang, J; Zou, B S; Zou, J H; Zuo, J X


    Based on a data sample of 106 M $\\psi^{\\prime}$ events collected with the BESIII detector, the decays $\\psi^{\\prime}\\ar\\gamma\\chi_{c0, 2}$,$\\chi_{c0, 2}\\ar\\gamma\\gamma$ are studied to determine the two-photon widths of the $\\chi_{c0, 2}$ states. The two-photon decay branching fractions are determined to be ${\\cal B}(\\chi_{c0}\\ar\\gamma\\gamma) = (2.24\\pm 0.19\\pm 0.12\\pm 0.08)\\times 10^{-4}$ and ${\\cal B}(\\chi_{c2}\\ar\\gamma\\gamma) = (3.21\\pm 0.18\\pm 0.17\\pm 0.13)\\times 10^{-4}$. From these, the two-photon widths are determined to be $\\Gamma_{\\gamma \\gamma}(\\chi_{c0}) = (2.33\\pm0.20\\pm0.13\\pm0.17)$ keV, $\\Gamma_{\\gamma \\gamma}(\\chi_{c2}) = (0.63\\pm0.04\\pm0.04\\pm0.04)$ keV, and $\\cal R$ $=\\Gamma_{\\gamma \\gamma}(\\chi_{c2})/\\Gamma_{\\gamma \\gamma}(\\chi_{c0})=0.271\\pm 0.029\\pm 0.013\\pm 0.027$, where the uncertainties are statistical, systematic, and those from the PDG ${\\cal B}(\\psi^{\\prime}\\ar\\gamma\\chi_{c0,2})$ and $\\Gamma(\\chi_{c0,2})$ errors, respectively. The ratio of the two-photon widths for helicity $\\lambda=0...

  13. Chi-Chi (Taiwan) earthquake of September 21, 1999. Findings for the nuclear installations in Switzerland: short report

    International Nuclear Information System (INIS)

    The Swiss Federal Nuclear Safety Inspectorate (HSK) has a great interest to be rapidly informed and documented on relevant consequences of major earthquakes in industrialized countries in the world, in particular with respect to nuclear installations. The main goal is to recognize within a short time after such events, if measures should be taken at the Swiss nuclear installations. Therefore, Basler and Hofmann have prepared a report on the Chi-Chi (1999) earthquake for HSK within a few weeks after the event. The information was obtained primarily from the Internet and by directly contacting local authorities and other selected organisations in Taiwan. This short report is a summary representation of the HSK report of November 23, 1999. No updated or additional information on the earthquake is included herein. The summary concentrates on the findings for the Swiss nuclear installations. Compared with Taiwan, Switzerland is situated in a seismically much less active region. However, similarities exist with respect to the focal mechanism (thrust), the compressional stress regime and the low focal depth. Thus, the pattern of the iso-seismal lines and the maximum acceleration values would be similar in Switzerland in the case of an equally strong event. Such a strong event has been considered as unrealistic to occur in Switzerland so far. In the PSA studies for the Swiss nuclear power plants, a maximum magnitude up to 7.5 was considered, but only with a low weight. Under the assumption of a magnitude 7.6 event in the seismically most active region in Switzerland (Valais), the SSE accelerations at the closest site (Muehleberg NPP) could probably be exceeded. Most effects at components observed during the Chi-Chi earthquake (at non-nuclear sites) are already known to HSK and they have been considered systematically at the Swiss NPPs. A rather sensitive point is the possible loss of power from emergency diesel generators, as observed at non-nuclear sites in Taiwan. The

  14. Exclusive Baryon-Antibaryon Decays of the chi_cJ Mesons

    CERN Document Server

    Naik, P; Asner, D M; Edwards, K W; Reed, J; Briere, R A; Ferguson, T; Tatishvili, G; Vogel, H; Watkins, M E; Rosner, J L; Alexander, J P; Cassel, D G; Duboscq, J E; Ehrlich, R; Fields, L; Gibbons, L; Gray, R; Gray, S W; Hartill, D L; Heltsley, B K; Hertz, D; Hunt, J M; Kandaswamy, J; Kreinick, D L; Kuznetsov, V E; Ledoux, J; Mahlke-Krüger, H; Mohapatra, D; Onyisi, P U E; Patterson, J R; Peterson, D; Riley, D; Ryd, A; Sadoff, A J; Shi, X; Stroiney, S; Sun, W M; Wilksen, T; Athar, S B; Patel, R; Yelton, J; Rubin, P; Eisenstein, B I; Karliner, I; Mehrabyan, S; Lowrey, N; Selen, M; White, E J; Wiss, J; Mitchell, R E; Shepherd, M R; Besson, D; Pedlar, T K; Cronin-Hennessy, D; Gao, K Y; Hietala, J; Kubota, Y; Klein, T; Lang, B W; Poling, R; Scott, A W; Zweber, P; Dobbs, S; Metreveli, Z; Seth, K K; Tomaradze, A G; Libby, J; Powell, A; Wilkinson, G; Ecklund, K M; Love, W; Savinov, V; Méndez, H; Ge, J Y; Miller, D H; Shipsey, I P J; Xin, B; Adams, G S; Anderson, M; Cummings, J P; Danko, I; Hu, D; Moziak, B; Napolitano, J; He, Q; Insler, J; Muramatsu, H; Park, C S; Thorndike, E H; Yang, F; Artuso, M; Blusk, S; Khalil, S; Li, J; Mountain, R; Nisar, S; Randrianarivony, K; Sultana, N; Skwarnicki, T; Stone, S; Wang, J C; Zhang, L M; Bonvicini, G; Cinabro, D; Dubrovin, M; Lincoln, A


    Using a sample of 2.59 \\times 10^7 psi(2S) decays collected by the CLEO--c detector, we present results of a study of chi_{cJ} (J=0,1,2) decays into baryon-antibaryon final states. We present the world's most precise measurements of the chi_cJ -> p-pbar and chi_cJ -> Lambda-Lambdabar branching fractions, and the first measurements of chi_c0 decays to other hyperons. These results illuminate the decay mechanism of the chi_c states.

  15. Tai Chi as a form of exercise training in people with chronic obstructive pulmonary disease. (United States)

    Leung, Regina W M; McKeough, Zoe J; Alison, Jennifer A


    Tai Chi is an ancient Chinese martial art which incorporates elements of strengthening, balance, postural alignment and concentration. The benefits of Tai Chi in the healthy population have been widely examined. In comparison, only three studies have evaluated the effects of Tai Chi in people with chronic obstructive pulmonary disease (COPD). Existing evidence suggests that the exercise intensity of Tai Chi reaches a moderate level in people with COPD. Furthermore, a short-term program of Tai Chi improves exercise capacity, health-related quality of life, balance and quadriceps strength in people with mild to moderate COPD. More studies are warranted to examine the effects of different styles of Tai Chi and the long-term benefits of Tai Chi as an exercise regimen for people with COPD. PMID:24224506

  16. mRNA Expression of EgCHI1, EgCHI2, and EgCHI3 in Oil Palm Leaves (Elaeis guineesis Jacq. after Treatment with Ganoderma boninense Pat. and Trichoderma harzianum Rifai

    Directory of Open Access Journals (Sweden)

    Laila Naher


    Full Text Available Background. Basal stem rot (BSR disease caused by the fungus Ganoderma boninense is the most serious disease affecting the oil palm; this is because the disease escapes the early disease detection. The biocontrol agent Trichoderma harzianum can protect the disease only at the early stage of the disease. In the present study, the expression levels of three oil palm (Elaeis guineensis Jacq. chitinases encoding EgCHI1, EgCHI2, and EgCHI3 at 2, 5, and 8 weeks inoculation were measured in oil palm leaves from plants treated with G. boninense or T. harzianum alone or both. Methods. The five-month-old oil palm seedlings were treated with Gano-wood blocks inoculum and trichomulch. Expression of EgCHI1, EgCHI2, and EgCHI3 in treated leaves tissue was determined by real-time PCR. Results. Oil palm chitinases were not strongly expressed in oil palm leaves of plants treated with G. boninense alone compared to other treatments. Throughout the 8-week experiment, expression of EgCHI1 increased more than 3-fold in leaves of plants treated with T. harzianum and G. boninense when compared to those of control and other treated plants. Conclusion. The data illustrated that chitinase cDNA expression varied depending on tissue and the type of treatment.

  17. Long-period ground motion characteristic of the 1999 Jiji (Chi-Chi), Taiwan, mainshock and aftershocks

    Institute of Scientific and Technical Information of China (English)

    LI Chun-feng; ZHANG Yang; ZHAO Jin-bao; TANG Hui


    This paper investigates long-period ground motion characteristic of the 1999 Jiji (Chi-Chi), Taiwan, mainshock and aftershocks on the basis of lots of high quality digital strong motion records. The study attaches the importance to the variation of strength of the long-period ground motion with the magnitude, distance, and site condition. In the meantime, the near-fault long-period ground motion characteristic is analyzed. The result shows that the shape of the long-period response spectrum is mainly controlled by site condition and magnitude (the spectrum of class D+E is wider than that of class B+C, and the spectrum of larger magnitude is wider than that of smaller magnitude), and the effect of fault distance on the shape is not evident. And near-fault long-period ground motion characteristic depends on fault activity apparently, that is to say, the long-term ground motion in the hanger is stronger than that in the footwall, and the long-term ground motion in the north is stronger than that in the south.

  18. mRNA Expression of EgCHI1, EgCHI2, and EgCHI3 in Oil Palm Leaves (Elaeis guineesis Jacq.) after Treatment with Ganoderma boninense Pat. and Trichoderma harzianum Rifai


    Laila Naher; Soon Guan Tan; Chai Ling Ho; Umi Kalsom Yusuf; Siti Hazar Ahmad; Faridah Abdullah


    Background. Basal stem rot (BSR) disease caused by the fungus Ganoderma boninense is the most serious disease affecting the oil palm; this is because the disease escapes the early disease detection. The biocontrol agent Trichoderma harzianum can protect the disease only at the early stage of the disease. In the present study, the expression levels of three oil palm (Elaeis guineensis Jacq.) chitinases encoding EgCHI1, EgCHI2, and EgCHI3 at 2, 5, and 8 weeks inoculation were measured in oil pa...

  19. High-level expression and characterization of two chitinases, ChiCH and ChiCW, of Bacillus cereus 28-9 in Escherichia coli

    International Nuclear Information System (INIS)

    Many chitinase genes have been cloned and sequenced from prokaryotes and eukaryotes but overexpression of chitinases in Escherichia coli cells was less reported. ChiCH and ChiCW of Bacillus cereus 28-9 belong to two distinct groups based on their amino acid sequences of catalytic domains, and in addition, domain structures of two enzymes are different. In this study, we established an ideal method for high-level expression of chitinases in E. coli as glutathione-S-transferase fusion proteins using pGEX-6P-1 vector. Both ChiCH and ChiCW were successfully highly expressed in E. coli cells as soluble GST-chitinase fusion proteins, and recombinant native ChiCH and ChiCW could be purified after cleavage with PreScission protease to remove GST tag. Purified chitinases were used for biochemical characterization of kinetics, hydrolysis products, and binding activities. The results indicate that ChiCW is an endo-chitinase and effectively hydrolyzes chitin and chito-multimers to chito-oligomers and the end product chitobiose, and ChiCH is an exo-chitinase and degrades chito-oligomers to produce chitobiose. Furthermore, due to higher affinity of ChiCW toward colloidal chitin than Avicel, C-terminal domain of ChiCW should be classified as a chitin-binding domain not a cellulose-binding domain although that was revealed as a cellulose-binding domain by conserved domain analysis. Therefore, the method of high-level expression of chitinases is helpful to studies and applications of chitinases

  20. The CHY representation of tree-level primitive QCD amplitudes

    CERN Document Server

    de la Cruz, Leonardo; Weinzierl, Stefan


    In this paper we construct a CHY representation for all tree-level primitive QCD amplitudes. The quarks may be massless or massive. We define a generalised cyclic factor $\\hat{C}(w,z)$ and a generalised permutation invariant function $\\hat{E}(z,p,\\varepsilon)$. The amplitude is then given as a contour integral encircling the solutions of the scattering equations with the product $\\hat{C} \\hat{E}$ as integrand. Equivalently, it is given as a sum over the inequivalent solutions of the scattering equations, where the summand consists of a Jacobian times the product $\\hat{C} \\hat{E}$. This representation separates information: The generalised cyclic factor does not depend on the helicities of the external particles, the generalised permutation invariant function does not depend on the ordering of the external particles.

  1. The CHY representation of tree-level primitive QCD amplitudes (United States)

    de la Cruz, Leonardo; Kniss, Alexander; Weinzierl, Stefan


    In this paper we construct a CHY representation for all tree-level primitive QCD amplitudes. The quarks may be massless or massive. We define a generalised cyclic factor Ĉ( w, z) and a generalised permutation invariant function Ê( z, p, ɛ). The amplitude is then given as a contour integral encircling the solutions of the scattering equations with the product ĈÊ as integrand. Equivalently, it is given as a sum over the inequivalent solutions of the scattering equations, where the summand consists of a Jacobian times the product Ĉ Ê. This representation separates information: The generalised cyclic factor does not depend on the helicities of the external particles, the generalised permutation invariant function does not depend on the ordering of the external particles.

  2. Two-dimensional Co-Seismic Surface Displacements Field of the Chi-Chi Earthquake Inferred from SAR Image Matching

    Directory of Open Access Journals (Sweden)

    Jian-Jun Zhu


    Full Text Available The Mw=7.6 Chi-Chi earthquake in Taiwan occurred in 1999 over the Chelungpu fault and caused a great surface rupture and severe damage. Differential Synthetic Aperture Radar Interferometry (DInSAR has been applied previously to study the co-seismic ground displacements. There have however been significant limitations in the studies. First, only one-dimensional displacements along the Line-of-Sight (LOS direction have been measured. The large horizontal displacements along the Chelungpu fault are largely missing from the measurements as the fault is nearly perpendicular to the LOS direction. Second, due to severe signal decorrelation on the hangling wall of the fault, the displacements in that area are un-measurable by differential InSAR method. We estimate the co-seismic displacements in both the azimuth and range directions with the method of SAR amplitude image matching. GPS observations at the 10 GPS stations are used to correct for the orbital ramp in the amplitude matching and to create the two-dimensional (2D co-seismic surface displacements field using the descending ERS-2 SAR image pair. The results show that the co-seismic displacements range from about -2.0 m to 0.7 m in the azimuth direction (with the positive direction pointing to the flight direction, with the footwall side of the fault moving mainly southwards and the hanging wall side northwards. The displacements in the LOS direction range from about -0.5 m to 1.0 m, with the largest displacement occuring in the northeastern part of the hanging wall (the positive direction points to the satellite from ground. Comparing the results from amplitude matching with those from DInSAR, we can see that while only a very small fraction of the LOS displacement has been recovered by the DInSAR mehtod, the azimuth displacements cannot be well detected with the DInSAR measurements as they are almost perpendicular to the LOS. Therefore, the amplitude matching method is obviously more

  3. $0^{++}$ Resonances Observed at BES


    Zou, B. S.; collaboration, for BES


    In last 10 years, $0^{++}$ resonances have been observed and studied at BES in many processes, such as $J/\\psi\\to\\gamma\\pi^+\\pi^-\\pi^+\\pi^-$, $\\gamma\\pi^+\\pi^-$, $\\gamma\\pi^0\\pi^0$, $\\gamma K^+K^-$, $\\gamma K_SK_S$, $\\gamma\\omega\\phi$, $\\omega\\pi^+\\pi^-$, $\\omega K^+K^-$, $\\phi\\pi^+\\pi^-$, $\\phi K^+K^-$, $\\psi(2S)\\to J/\\psi\\pi^+\\pi^-$, $\\chi_{c0}\\to\\pi^+\\pi^-K^+K^-$, $\\pi^+\\pi^-\\pi^+\\pi^-$ etc.. The results on $0^{++}$ resonances observed at BES are reviewed.

  4. Observation of direct ion heating in double-pulsing CHI in helicity injected spherical torus plasmas

    International Nuclear Information System (INIS)

    Anomalous ion heating has been observed for the first time during flux/current amplification by double-pulsing coaxial helicity injection (CHI) in the helicity injected spherical torus (HIST) device. Doppler ion temperature increases significantly near the separatrix on the inboard side during the second CHI pulse, whereas electron temperature remains constant. The experimental results indicate that selective ion heating may be associated with viscous damping of poloidal flows driven by the CHI pulse. (author)

  5. Training in ChiRunning to reduce blood pressure: a randomized controlled pilot study


    McDermott, Kelly; Kumar, Deepak; Goldman, Veronica; Feng, Haojun; Mehling, Wolf; Moskowitz, Judith T.; Souza, Richard B.; Frederick M Hecht


    Background People with prehypertension (120–130/80–90 mmHg) are at increased risk of progressing to hypertension. Recommendations for prehypertension include engaging in regular physical activity. We aimed to assess feasibility and acceptability and collect preliminary outcome data on ChiRunning for people with elevated blood pressure. ChiRunning is a commercially available running program based on the mindful movements of Tai Chi, which is aimed at decreasing injury by both increasing body a...

  6. Study of {chi}{sub c} production using HERA-B data

    Energy Technology Data Exchange (ETDEWEB)

    Aleksandrov, Aleksandar


    In this thesis the production of the charmonium states {chi}{sub c1} and {chi}{sub c2} in protonnucleus collisions at a proton-nucleon center-of-mass energy {radical}(s)=41.6 GeV was studied. The data used for the analysis have been taken by the fixed-target experiment HERA-B that uses the HERA proton beam to scatter protons off the nuclei of different wire targets. About 122.10{sup 3} recorded muonic J/{psi} decays, J/{psi}{yields}{mu}{sup +}{mu}{sup -}, resulted in almost 10000 reconstructed {chi}{sub c}{yields}J/{psi}{gamma}. The ratio R{sub {chi}{sub c}}= sum {sub i=1,2}{sigma}({chi}{sub ci})Br({chi}{sub ci}{yields}J/{psi}{gamma})/{sigma}(J/{psi}), which is the ratio of J/{psi} from {chi}{sub c} decays to all produced J/{psi}, was measured in the kinematical range -0.35chi}{sub c}}=0.190{sub -0.029}{sup +0.030}. Despite the small separation of the masses of the two {chi}{sub c} states, comparable to the detector resolution, the ratio R{sub 12}=R{sub {chi}{sub c}{sub 1}}/R{sub {chi}{sub c}{sub 2}} was measured yielding R{sub 12}=1.30{sub -0.37}{sup +0.59} which corresponds to a production cross section ratio ({sigma}({chi}{sub c1}))/({sigma}({chi}{sub c2}))=0.74{sub -0.22}{sup +0.34}. By using the known J/{psi} production cross section, the {chi}{sub c1} and {chi}{sub c2} production cross sections are calculated to be {sigma}({chi}{sub c1})=(153{+-}27) nb/nucleon and {sigma}({chi}{sub c2})=(207{+-}39) nb/nucleon, respectively. All results were obtained under the assumption that both the J/{psi} and {chi}{sub c} states are produced without polarization. In addition a study of possible deviations of R{sub {chi}{sub c}} and R{sub 12} due to the polarization of J/{psi} and {chi}{sub c} was performed. By varying the polarization parameter, {lambda}{sub obs}, of all produced J/{psi} by 2{sigma} around the value measured by HERA-B, and assuming fully

  7. Tai Chi Chuan Optimizes the Functional Organization of the Intrinsic Human Brain Architecture in Older Adults

    Directory of Open Access Journals (Sweden)

    Gao-Xia eWei


    Full Text Available Whether Tai Chi Chuan (TCC can influence the intrinsic functional architecture of the human brain remains unclear. To examine TCC-associated changes in functional connectomes, resting-state functional magnetic resonance images were acquired from 40 older individuals including 22 experienced TCC practitioners (experts and 18 demographically matched TCC-naïve healthy controls, and their local functional homogeneities across the cortical mantle were compared. Compared to the controls, the TCC experts had significantly greater and more experience-dependent functional homogeneity in the right postcentral gyrus (PosCG and less functional homogeneity in the left anterior cingulate cortex (ACC and the right dorsal lateral prefrontal cortex (DLPFC. Increased functional homogeneity in the PosCG was correlated with TCC experience. Intriguingly, decreases in functional homogeneity (improved functional specialization in the left ACC and increases in functional homogeneity (improved functional integration in the right PosCG both predicted performance gains on attention network behavior tests. These findings provide evidence for the functional plasticity of the brain’s intrinsic architecture toward optimizing locally functional organization, with great implications for understanding the effects of TCC on cognition, behavior and health in aging population.

  8. Learn with SAT to Minimize Büchi Automata

    Directory of Open Access Journals (Sweden)

    Stephan Barth


    Full Text Available We describe a minimization procedure for nondeterministic Büchi automata (NBA. For an automaton A another automaton A_min with the minimal number of states is learned with the help of a SAT-solver. This is done by successively computing automata A' that approximate A in the sense that they accept a given finite set of positive examples and reject a given finite set of negative examples. In the course of the procedure these example sets are successively increased. Thus, our method can be seen as an instance of a generic learning algorithm based on a "minimally adequate teacher'' in the sense of Angluin. We use a SAT solver to find an NBA for given sets of positive and negative examples. We use complementation via construction of deterministic parity automata to check candidates computed in this manner for equivalence with A. Failure of equivalence yields new positive or negative examples. Our method proved successful on complete samplings of small automata and of quite some examples of bigger automata. We successfully ran the minimization on over ten thousand automata with mostly up to ten states, including the complements of all possible automata with two states and alphabet size three and discuss results and runtimes; single examples had over 100 states.

  9. Electromagnetic Currents and Magnetic Moments in $\\chi$EFT

    Energy Technology Data Exchange (ETDEWEB)

    Saori Pastore, Luca Girlanda, Rocco Schiavilla, Michele Viviani, Robert Wiringa


    A two-nucleon potential and consistent electromagnetic currents are derived in chiral effective field theory ($\\chi$EFT) at, respectively, $Q^{\\, 2}$ (or N$^2$LO) and $e\\, Q$ (or N$^3$LO), where $Q$ generically denotes the low-momentum scale and $e$ is the electric charge. Dimensional regularization is used to renormalize the pion-loop corrections. A simple expression is derived for the magnetic dipole ($M1$) operator associated with pion loops, consisting of two terms, one of which is determined, uniquely, by the isospin-dependent part of the two-pion-exchange potential. This decomposition is also carried out for the $M1$ operator arising from contact currents, in which the unique term is determined by the contact potential. Finally, the low-energy constants (LEC's) entering the N$^2$LO potential are fixed by fits to the $np$ S- and P-wave phase shifts up to 100 MeV lab energies. Three additional LEC's are needed to completely specify the $M1$ operator at N$^3$L

  10. High chi polymer development for DSA applications using RAFT technology (United States)

    Sheehan, Michael T.; Farnham, William B.; Tran, Hoang V.; Londono, J. David; Brun, Yefim


    Directed self-assembly (DSA) of block copolymers is proving to be an interesting and innovative method to make three-dimensional periodic, uniform patterns useful in a variety of microelectronics applications. Attributes critical to acceptable DSA performance of block copolymers include molecular weight uniformity, final purity, and reproducibility in all the steps involved in producing the polymers. Reversible Addition Fragmentation Chain Transfer (RAFT) polymerization technology enables the production of such materials provided that careful process monitoring and compositional homogeneity measurement systems are employed. It is uniquely suited to construction of multiblocks with components of widely divergent surface energies and functionality. We describe a high chi diblock system comprising partially fluorinated methacrylates and substituted styrenics. While special new polymer separation strategies involving controlled polymer particle assembly in liquid media are required for some monomer systems and molecular weight regimes, we have been able to demonstrate high yield and compositionally homogeneous diblocks of lamellar and cylindrical morphology with polydispersities < 1.1. During purification processes, these diblock materials undergo assembly processes in liquid media, and with appropriate controls, this allows for removal of soluble homopolymer contaminants. SAXS analyses of solid polymer samples provide estimates of lamellar d-spacing, and a good correlation with molecular weight is shown. This system will be described.

  11. The challenges of water governance in Ho Chi Minh City. (United States)

    van Leeuwen, Cornelis J; Dan, Nguyen P; Dieperink, Carel


    Population growth, urbanization, pollution, and climate change pose urgent water challenges in cities. In this study, the sustainability of integrated water resources management in Ho Chi Minh City (HCMC) was evaluated using the City Blueprint approach. The City Blueprint is a set of 24 dedicated indicators divided over 8 categories (i.e., water security, water quality, drinking water, sanitation, infrastructure, climate robustness, biodiversity and attractiveness, and governance including public participation). The analysis showed that the rapid increase of water use for urban, industrial, and agricultural activities in HCMC has resulted in depletion of groundwater and severe pollution of both groundwater and surface water. Surface water quality, groundwater quality, biodiversity, and the sanitation of domestic and industrial wastewater are matters that need serious improvement. Current and future water supply in HCMC is at risk. HCMC can cope with it, but the 7 governance gaps as described by the Organisation for Economic Co-operation and Development (OECD) are major obstacles for HCMC. Rainwater harvesting, pollution reduction, as well as wastewater reuse are among the practical options. Wastewater reuse could lower the water stress index to 10%. The window to do this is narrow and rapidly closing as a result of the unprecedented urbanization and economic growth of this region. PMID:26009880

  12. Acute Cardiovascular Response to Sign Chi Do Exercise

    Directory of Open Access Journals (Sweden)

    Carol E. Rogers


    Full Text Available Safe and gentle exercise may be important for older adults overcoming a sedentary lifestyle. Sign Chi Do (SCD, a novel form of low impact exercise, has shown improved balance and endurance in healthy older adults, and there have been no SCD-related injuries reported. Sedentary older adults are known to have a greater cardiovascular (CV response to physical activity than those who regularly exercise. However their CV response to SCD is unknown. This study explored the acute CV response of older adults to SCD. Cross-sectional study of 34 sedentary and moderately active adults over age 55 with no previous experience practicing SCD. Participants completed a 10 min session of SCD. CV outcomes of heart rate, blood pressure, rate pressure product were recorded at 0, 5, 10 min of SCD performance, and after 10 min of rest. HR was recorded every minute. There was no difference in CV scores of sedentary and moderately active older adults after a session of SCD-related activity. All CV scores increased at 5 min, were maintained at 10 min, and returned to baseline within 10 min post SCD (p < 0.05. SCD may be a safe way to increase participation in regular exercise by sedentary older adults.

  13. Central Exclusive Production of $\\chi$ Mesons at LHCb

    CERN Document Server

    Bjornstad, Pal Marius

    The LHCb experiment is a forward spectrometer at the Large Hadron Collider, covering a range of pseudorapidity $1.9<\\eta<4.9$. It has a very precise vertex detector called the VELO, near the interaction point. The monitoring software for the VELO is discussed in this thesis. In proton-proton interactions, Central Exclusive Production (CEP) is a process where the protons remain intact after the interaction, and an additional simple central system is produced. CEP processes are selected experimentally by requiring that there is no activity in the detector apart from the central system. The installation of additional detectors to increase the sensitivity at small angles from the beam axis is discussed. A geometrical description of the region of the LHC up to $100$~m on each side of the LHCb interaction point is developed. Simulated forward shower counters are added to the model, and the efficiencies of the detectors are measured. The main part of this thesis describes an analysis of CEP of $\\chi_c$ mes...

  14. Resonances and resonance widths

    International Nuclear Information System (INIS)

    Two-dimensional betatron resonances are much more important than their simple one-dimensional counterparts and exhibit a strong dependence on the betatron phase advance per cell. A practical definition of ''width'' is expanded upon in order to display these relations in tables. A primarily pedagogical introduction is given to explain the tables, and also to encourage a wider capability for deriving resonance behavior and wider use of ''designer'' resonances

  15. Statistical analysis of earthquakes after the 1999 MW 7.7 Chi-Chi, Taiwan, earthquake based on a modified Reasenberg-Jones model (United States)

    Chen, Yuh-Ing; Huang, Chi-Shen; Liu, Jann-Yenq


    We investigated the temporal-spatial hazard of the earthquakes after the 1999 September 21 MW = 7.7 Chi-Chi shock in a continental region of Taiwan. The Reasenberg-Jones (RJ) model (Reasenberg and Jones, 1989, 1994) that combines the frequency-magnitude distribution (Gutenberg and Richter, 1944) and time-decaying occurrence rate (Utsu et al., 1995) is conventionally employed for assessing the earthquake hazard after a large shock. However, it is found that the b values in the frequency-magnitude distribution of the earthquakes in the study region dramatically decreased from background values after the Chi-Chi shock, and then gradually increased up. The observation of a time-dependent frequency-magnitude distribution motivated us to propose a modified RJ model (MRJ) to assess the earthquake hazard. To see how the models perform on assessing short-term earthquake hazard, the RJ and MRJ models were separately used to sequentially forecast earthquakes in the study region. To depict the potential rupture area for future earthquakes, we further constructed relative hazard (RH) maps based on the two models. The Receiver Operating Characteristics (ROC) curves (Swets, 1988) finally demonstrated that the RH map based on the MRJ model was, in general, superior to the one based on the original RJ model for exploring the spatial hazard of earthquakes in a short time after the Chi-Chi shock.

  16. Tachyonic Resonance Preheating in Expanding Universe

    CERN Document Server

    Abolhasani, Ali Akbar; Sheikh-Jabbari, M M


    In this paper the tachyonic resonance preheating generated from the bosonic trilinear $\\phi\\chi^2$ interactions in an expanding Universe is studied. In $\\lambda\\phi^4/4$ inflationary model the trilinear interaction, in contrast to the four-legs $\\phi^2\\chi^2$, breaks the conformal symmetry explicitly and the resonant source term becomes non-periodic, making the Floquet theorem inapplicable. We find that the occupation number of the produced $\\chi$-particles has a non-linear exponential growth with exponent $\\sim x^{3/2}$, where $x$ is the conformal time. This should be contrasted with preheating from a periodic resonant source, arising for example from the four-legs $\\phi^2\\chi^2$ interaction, where the occupation number has a linear exponential growth. We present an analytic method to compute the interference term coming from phases accumulated in non-tachyonic scattering regions and show that the effects of the interference term causes ripples on $x^{3/2}$ curve, a result which is confirmed by numerical ana...

  17. Observation of chi(cJ) decays to Lambda(Lambda)over-bar pi(+)pi(-)

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Ambrose, D. J.; An, F. F.; An, Q.; An, Z. H.; Bai, J. Z.; Ban, Y.; Becker, J.; Bennett, J. V.; Bertani, M.; Bian, J. M.; Boger, E.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Bytev, V.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, Y. B.; Cheng, H. P.; Chu, Y. P.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; Ding, W. M.; Ding, Y.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Fang, J.; Fang, S. S.; Fava, L.; Feldbauer, F.; Feng, C. Q.; Ferroli, R. B.; Fu, C. D.; Fu, J. L.; Gao, Y.; Geng, C.; Goetzen, K.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y. P.; Han, Y. L.; Harris, F. A.; He, K. L.; He, M.; He, Z. Y.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, H. M.; Hu, J. F.; Hu, T.; Huang, G. M.; Huang, J. S.; Huang, X. T.; Huang, Y. P.; Hussain, T.; Ji, C. S.; Ji, Q.; Ji, X. B.; Ji, X. L.; Jiang, L. L.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jing, F. F.; Kalantar-Nayestanaki, N.; Kavatsyuk, M.; Kuehn, W.; Lai, W.; Lange, J. S.; Li, C. H.; Li, Cheng; Li, Cui; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, K.; Li, Lei; Li, Q. J.; Li, S. L.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, X. R.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Liao, X. T.; Liu, B. J.; Liu, C. L.; Liu, C. X.; Liu, C. Y.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H.; Liu, H. B.; Liu, H. H.; Liu, H. M.; Liu, H. W.; Liu, J. P.; Liu, K. Y.; Liu, Kai; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. H.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H.; Lu, G. R.; Lu, H. J.; Lu, J. G.; Lu, Q. W.; Lu, X. R.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lv, M.; Ma, C. L.; Ma, F. C.; Ma, H. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X. Y.; Ma, Y.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Morales, C. Morales; Motzko, C.; Muchnoi, N. Yu.; Muramatsu, H.; Nefedov, Y.; Nicholson, C.; Nikolaev, I. B.; Ning, Z.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Park, J. W.; Pelizaeus, M.; Peng, H. P.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Prencipe, E.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, X. S.; Qin, Y.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Rong, G.; Ruan, X. D.; Sarantsev, A.; Schaefer, B. D.; Schulze, J.; Shao, M.; Shen, C. P.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, X. Y.; Spataro, S.; Spruck, B.; Sun, D. H.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tapan, I.; Thorndike, E. H.; Toth, D.; Ullrich, M.; Varner, G. S.; Wang, B.; Wang, B. Q.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q.; Wang, Q. J.; Wang, S. G.; Wang, X. L.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. Y.; Wei, D. H.; Weidenkaff, P.; Wen, Q. G.; Wen, S. P.; Wiedner, U.; Wu, L. H.; Wu, N.; Wu, S. X.; Wu, W.; Wu, Z.; Xia, L. G.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, G. M.; Xu, H.; Xu, Q. J.; Xu, X. P.; Xu, Z. R.; Xue, F.; Xue, Z.; Yan, L.; Yan, W. B.; Yan, Y. H.; Yang, H. X.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yu, B. X.; Yu, C. X.; Yu, J. S.; Yu, S. P.; Yuan, C. Z.; Yuan, Y.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, S. H.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. S.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, H. S.; Zhao, J. W.; Zhao, K. X.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, X. H.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, Y. H.; Zhong, B.; Zhong, J.; Zhou, L.; Zhou, X. K.; Zhou, X. R.; Zhu, C.; Zhu, K.; Zhu, K. J.; Zhu, S. H.; Zhu, X. L.; Zhu, X. W.; Zhu, Y. C.; Zhu, Y. M.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Werner, M.J.; Zheng, J.P.


    Decays of the chi(cJ) states (J = 0, 1, 2) to Lambda(Lambda) over bar pi(+)pi(-), including processes with intermediate Sigma(1385), are studied through the E1 transition psi(1) -> gamma chi(cJ) using 106 x 10(6) psi(1) events collected with the BESIII detector at BEPCII. This is the first observati

  18. Higher-order multipole amplitude measurement in psi ' -> gamma chi(c2)

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Alberto, D.; An, F. F.; An, Q.; An, Z. H.; Bai, J. Z.; Baldini, R.; Ban, Y.; Becker, J.; Berger, N.; Bertani, M.; Bian, J. M.; Boger, E.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Bytev, V.; Cai, X.; Calcaterra, A. C.; Cao, G. F.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, Y.; Chen, Y. B.; Cheng, H. P.; Chu, Y. P.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dedovich, D.; Deng, Z. Y.; Denysenko, I.; Destefanis, M.; Ding, Y.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Fang, J.; Fang, S. S.; Feng, C. Q.; Fu, C. D.; Fu, J. L.; Gao, Y.; Geng, C.; Goetzen, K.; Gong, W. X.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y. P.; Han, Y. L.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, M.; He, Z. Y.; Heng, Y. K.; Hou, Z. L.; Hu, H. M.; Hu, J. F.; Hu, T.; Huang, B.; Huang, G. M.; Huang, J. S.; Huang, X. T.; Huang, Y. P.; Hussain, T.; Ji, C. S.; Ji, Q.; Ji, X. B.; Ji, X. L.; Jia, L. K.; Jiang, L. L.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jing, F. F.; Kalantar-Nayestanaki, N.; Kavatsyuk, M.; Kuehn, W.; Lai, W.; Lange, J. S.; Leung, J. K. C.; Li, C. H.; Li, Cheng; Li, Cui; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, K.; Li, Lei; Li, N. B.; Li, Q. J.; Li, S. L.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, X. R.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, X. T.; Liu, B. J.; Liu, C. L.; Liu, C. X.; Liu, C. Y.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H.; Liu, H. B.; Liu, H. H.; Liu, H. M.; Liu, H. W.; Liu, J. P.; Liu, K.; Liu, K.; Liu, K. Y.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. H.; Liu, Y. B.; Liu, Y. W.; Liu, Yong; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H.; Lu, G. R.; Lu, H. J.; Lu, J. G.; Lu, Q. W.; Lu, X. R.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lv, M.; Ma, C. L.; Ma, F. C.; Ma, H. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X.; Ma, X. Y.; Maggiora, M.; Malik, Q. A.; Mao, H.; Mao, Y. J.; Mao, Z. P.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Muchnoi, N. Yu; Nefedov, Y.; Nikolaev, I. B.; Ning, Z.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Park, J. W.; Pelizaeus, M.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Pun, C. S. J.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, X. S.; Qiu, J. F.; Rashid, K. H.; Rong, G.; Ruan, X. D.; Sarantsev, A.; Schulze, J.; Shao, M.; Shen, C. P.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, X. Y.; Spataro, S.; Spruck, B.; Sun, D. H.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, X. D.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tian, H. L.; Toth, D.; Varner, G. S.; Wang, B.; Wang, B. Q.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q.; Wang, Q. J.; Wang, S. G.; Wang, X. L.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. Y.; Wei, D. H.; Wen, Q. G.; Wen, S. P.; Wiedner, U.; Wu, L. H.; Wu, N.; Wu, W.; Wu, Z.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, G. M.; Xu, H.; Xu, Q. J.; Xu, X. P.; Xu, Y.; Xu, Z. R.; Xu, Z. Z.; Xue, Z.; Yan, L.; Yan, W. B.; Yan, Y. H.; Yang, H. X.; Yang, T.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yu, B. X.; Yu, C. X.; Yu, S. P.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, L.; Zhang, S. H.; Zhang, T. R.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. S.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, H. S.; Zhao, Jiawei; Zhao, Jingwei; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, X. H.; Zhao, Y. B.; Zhao, Z. G.; Zhao, Z. L.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, Y. H.; Zheng, Z. P.; Zhong, B.; Zhong, J.; Zhong, L.; Zhou, L.; Zhou, X. K.; Zhou, X. R.; Zhu, C.; Zhu, K.; Zhu, K. J.; Zhu, S. H.; Zhu, X. L.; Zhu, X. W.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Zuo, J. X.


    Using 106 x 10(6) psi' events collected with the BESIII detector at the BEPCII storage ring, the higher-order multipole amplitudes in the radiative transition psi' -> gamma chi(c2) -> gamma pi(+)pi(-)/gamma K+K- are measured. A fit to the chi(c2) production and decay angular distributions yields M2

  19. Quantum key distribution by swapping the entanglement of {chi}-type state

    Energy Technology Data Exchange (ETDEWEB)

    Gao Gan, E-mail: [Department of Electrical Engineering, Tongling University, Tongling 244000 (China)


    We propose a quantum key distribution protocol using entanglement swapping of {chi}-type state; in this protocol, Alice and Bob transmit a particle sequence to each other and perform {chi}-type state measurements. Alice's and Bob's roles are completely symmetric.

  20. Implementing e-Health through CHI: A Very Canadian Solution to a Very Canadian Problem

    Directory of Open Access Journals (Sweden)

    Tom Daniels


    Full Text Available Canada Health Infoway (CHI was established as an arms-length body by the federal government in 2001 to provide funding to provinces for the development of interoperable e-health systems. CHI was established in response to a number of reports calling on the government to act to make use of technological advances to improve health care quality and provide more rigorous data. In addition to these explicit goals, through establishing CHI the federal government also sought to avoid potential criticism if the implementation of e-health failed, increase its own popularity ahead of the 2000 election and subtly redistribute wealth between the provinces. The paper suggests that the major influence behind the policy to establish CHI came from Canadian institutions and the fact that the federal government was hamstrung by the Canadian Constitution and Canada Health Act. Evaluation of the reform shows that progress has been made by CHI in implementing e-health solutions, but that Canada still lags behind other comparable health systems in the use of technologies. SWOT analysis of the CHI implementation highlights the criticism that CHI could stifle provincial innovation but recognizes that it also offers the opportunity for best practice dissemination across Canada and ensures that ring-fenced funding is available for e-health implementation across the provinces. In conclusion, the paper suggests that, because of constitutional constraints, the federal government was limited in options to implement e-health and that CHI represents a fair compromise.

  1. An Assessment of Tai Chi Exercise on Cognitive Ability in Older Adults

    Directory of Open Access Journals (Sweden)

    Hung Manh NGUYEN


    Full Text Available The purpose of this study was to evaluate the effects of Tai Chi exercise on cognitive performance of community - dwelling elderly in Vinh city, Vietnam. It is a controlled trial. One hundred subjected were recruited. Subjects were divided randomly into two groups. Tai Chi group was assigned 6 - months Tai Chi training. Control group was instructed to maintain their routine daily activities. Participants in Tai Chi group reported significant improvement cognitive ability, part A with F(1, 68 = 75.36, p < .001, and in part B with F(1, 68= 172.83, p < .001 in comparison with Control group. Tai Chi is beneficial to improve cognitive performance of the elderly.

  2. Tai chi training reduces self-report of inattention in healthy young adults. (United States)

    Converse, Alexander K; Ahlers, Elizabeth O; Travers, Brittany G; Davidson, Richard J


    It is important to identify effective non-pharmacological alternatives to stimulant medications that reduce symptoms of attention deficit hyperactivity disorder (ADHD). In this study of healthy young adults, we measured the effects of training in tai chi, which involves mindful attention to the body during movement. Using a non-randomized, controlled, parallel design, students in a 15-week introductory tai chi course (n = 28) and control participants (n = 44) were tested for ADHD indicators and cognitive function at three points over the course of the 15-weeks. The tai chi students' self-report of attention, but not hyperactivity-impulsivity, improved compared to controls. At baseline, inattention correlated positively with reaction time variability in an affective go/no-go task across all participants, and improvements in attention correlated with reductions in reaction time variability across the tai chi students. Affective bias changed in the tai chi students, as reaction times to positive- and negative-valenced words equalized over time. These results converge to suggest that tai chi training may help improve attention in healthy young adults. Further studies are needed to confirm these results and to evaluate tai chi as therapy for individuals with ADHD. PMID:24478679

  3. Tai chi training reduces self-report of inattention in healthy young adults

    Directory of Open Access Journals (Sweden)

    Alexander K. Converse


    Full Text Available It is important to identify effective non-pharmacological alternatives to stimulant medications that reduce symptoms of attention deficit hyperactivity disorder (ADHD. In this study of healthy young adults, we measured the effects of training in tai chi, which involves mindful attention to the body during movement. Using a non-randomized, controlled, parallel design, students in a 15-week introductory tai chi course (n=28 and control participants (n=44 were tested for ADHD indicators and cognitive function at three points over the course of the 15 weeks. The tai chi students' self-report of attention, but not hyperactivity-impulsivity, improved compared to controls. At baseline, inattention correlated positively with reaction time variability in an affective go/no-go task across all participants, and improvements in attention correlated with reductions in reaction time variability across the tai chi students. Affective bias changed in the tai chi students, as reaction times to positive- and negative-valenced words equalized over time. These results converge to suggest that tai chi training may help improve attention in healthy young adults. Further studies are needed to confirm these results and to evaluate tai chi as therapy for individuals with ADHD.

  4. Measurement of the relative prompt production rate of $\\chi_{c2}$ and $\\chi_{c1}$ in pp collisions at $\\sqrt{s}$ = 7 TeV

    CERN Document Server

    Chatrchyan, Serguei; Sirunyan, Albert M; Tumasyan, Armen; Adam, Wolfgang; Aguilo, Ernest; Bergauer, Thomas; Dragicevic, Marko; Erö, Janos; Fabjan, Christian; Friedl, Markus; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Hammer, Josef; Hörmann, Natascha; Hrubec, Josef; Jeitler, Manfred; Kiesenhofer, Wolfgang; Knünz, Valentin; Krammer, Manfred; Krätschmer, Ilse; Liko, Dietrich; Mikulec, Ivan; Pernicka, Manfred; Rahbaran, Babak; Rohringer, Christine; Rohringer, Herbert; Schöfbeck, Robert; Strauss, Josef; Taurok, Anton; Waltenberger, Wolfgang; Walzel, Gerhard; Widl, Edmund; Wulz, Claudia-Elisabeth; Mossolov, Vladimir; Shumeiko, Nikolai; Suarez Gonzalez, Juan; Bansal, Monika; Bansal, Sunil; Cornelis, Tom; De Wolf, Eddi A; Janssen, Xavier; Luyckx, Sten; Mucibello, Luca; Ochesanu, Silvia; Roland, Benoit; Rougny, Romain; Selvaggi, Michele; Staykova, Zlatka; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Van Spilbeeck, Alex; Blekman, Freya; Blyweert, Stijn; D'Hondt, Jorgen; Gonzalez Suarez, Rebeca; Kalogeropoulos, Alexis; Maes, Michael; Olbrechts, Annik; Van Doninck, Walter; Van Mulders, Petra; Van Onsem, Gerrit Patrick; Villella, Ilaria; Clerbaux, Barbara; De Lentdecker, Gilles; Dero, Vincent; Gay, Arnaud; Hreus, Tomas; Léonard, Alexandre; Marage, Pierre Edouard; Mohammadi, Abdollah; Reis, Thomas; Thomas, Laurent; Vander Marcken, Gil; Vander Velde, Catherine; Vanlaer, Pascal; Wang, Jian; Adler, Volker; Beernaert, Kelly; Cimmino, Anna; Costantini, Silvia; Garcia, Guillaume; Grunewald, Martin; Klein, Benjamin; Lellouch, Jérémie; Marinov, Andrey; Mccartin, Joseph; Ocampo Rios, Alberto Andres; Ryckbosch, Dirk; Strobbe, Nadja; Thyssen, Filip; Tytgat, Michael; Verwilligen, Piet; Walsh, Sinead; Yazgan, Efe; Zaganidis, Nicolas; Basegmez, Suzan; Bruno, Giacomo; Castello, Roberto; Ceard, Ludivine; Delaere, Christophe; Du Pree, Tristan; Favart, Denis; Forthomme, Laurent; Giammanco, Andrea; Hollar, Jonathan; Lemaitre, Vincent; Liao, Junhui; Militaru, Otilia; Nuttens, Claude; Pagano, Davide; Pin, Arnaud; Piotrzkowski, Krzysztof; Schul, Nicolas; Vizan Garcia, Jesus Manuel; Beliy, Nikita; Caebergs, Thierry; Daubie, Evelyne; Hammad, Gregory Habib; Alves, Gilvan; Correa Martins Junior, Marcos; De Jesus Damiao, Dilson; Martins, Thiago; Pol, Maria Elena; Henrique Gomes E Souza, Moacyr; Aldá Júnior, Walter Luiz; Carvalho, Wagner; Custódio, Analu; Da Costa, Eliza Melo; De Oliveira Martins, Carley; Fonseca De Souza, Sandro; Matos Figueiredo, Diego; Mundim, Luiz; Nogima, Helio; Oguri, Vitor; Prado Da Silva, Wanda Lucia; Santoro, Alberto; Soares Jorge, Luana; Sznajder, Andre; Souza Dos Anjos, Tiago; Bernardes, Cesar Augusto; De Almeida Dias, Flavia; Tomei, Thiago; De Moraes Gregores, Eduardo; Lagana, Caio; Da Cunha Marinho, Franciole; Mercadante, Pedro G; Novaes, Sergio F; Padula, Sandra; Genchev, Vladimir; Iaydjiev, Plamen; Piperov, Stefan; Rodozov, Mircho; Stoykova, Stefka; Sultanov, Georgi; Tcholakov, Vanio; Trayanov, Rumen; Vutova, Mariana; Dimitrov, Anton; Hadjiiska, Roumyana; Kozhuharov, Venelin; Litov, Leander; Pavlov, Borislav; Petkov, Peicho; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Jiang, Chun-Hua; Liang, Dong; Liang, Song; Meng, Xiangwei; Tao, Junquan; Wang, Jian; Wang, Xianyou; Wang, Zheng; Xiao, Hong; Xu, Ming; Zang, Jingjing; Zhang, Zhen; Asawatangtrakuldee, Chayanit; Ban, Yong; Guo, Yifei; Li, Wenbo; Liu, Shuai; Mao, Yajun; Qian, Si-Jin; Teng, Haiyun; Wang, Dayong; Zhang, Linlin; Zou, Wei; Avila, Carlos; Gomez, Juan Pablo; Gomez Moreno, Bernardo; Osorio Oliveros, Andres Felipe; Sanabria, Juan Carlos; Godinovic, Nikola; Lelas, Damir; Plestina, Roko; Polic, Dunja; Puljak, Ivica; Antunovic, Zeljko; Kovac, Marko; Brigljevic, Vuko; Duric, Senka; Kadija, Kreso; Luetic, Jelena; Morovic, Srecko; Attikis, Alexandros; Galanti, Mario; Mavromanolakis, Georgios; Mousa, Jehad; Nicolaou, Charalambos; Ptochos, Fotios; Razis, Panos A; Finger, Miroslav; Finger Jr, Michael; Assran, Yasser; Elgammal, Sherif; Ellithi Kamel, Ali; Khalil, Shaaban; Mahmoud, Mohammed; Radi, Amr; Kadastik, Mario; Müntel, Mait; Raidal, Martti; Rebane, Liis; Tiko, Andres; Eerola, Paula; Fedi, Giacomo; Voutilainen, Mikko; Härkönen, Jaakko; Heikkinen, Mika Aatos; Karimäki, Veikko; Kinnunen, Ritva; Kortelainen, Matti J; Lampén, Tapio; Lassila-Perini, Kati; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Mäenpää, Teppo; Peltola, Timo; Tuominen, Eija; Tuominiemi, Jorma; Tuovinen, Esa; Ungaro, Donatella; Wendland, Lauri; Banzuzi, Kukka; Karjalainen, Ahti; Korpela, Arja; Tuuva, Tuure; Besancon, Marc; Choudhury, Somnath; Dejardin, Marc; Denegri, Daniel; Fabbro, Bernard; Faure, Jean-Louis; Ferri, Federico; Ganjour, Serguei; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Locci, Elizabeth; Malcles, Julie; Millischer, Laurent; Nayak, Aruna; Rander, John; Rosowsky, André; Shreyber, Irina; Titov, Maksym; Baffioni, Stephanie; Beaudette, Florian; Benhabib, Lamia; Bianchini, Lorenzo; Bluj, Michal; Broutin, Clementine; Busson, Philippe; Charlot, Claude; Daci, Nadir; Dahms, Torsten; Dobrzynski, Ludwik; Granier de Cassagnac, Raphael; Haguenauer, Maurice; Miné, Philippe; Mironov, Camelia; Naranjo, Ivo Nicolas; Nguyen, Matthew; Ochando, Christophe; Paganini, Pascal; Sabes, David; Salerno, Roberto; Sirois, Yves; Veelken, Christian; Zabi, Alexandre; Agram, Jean-Laurent; Andrea, Jeremy; Bloch, Daniel; Bodin, David; Brom, Jean-Marie; Cardaci, Marco; Chabert, Eric Christian; Collard, Caroline; Conte, Eric; Drouhin, Frédéric; Ferro, Cristina; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Juillot, Pierre; Le Bihan, Anne-Catherine; Van Hove, Pierre; Fassi, Farida; Mercier, Damien; Beauceron, Stephanie; Beaupere, Nicolas; Bondu, Olivier; Boudoul, Gaelle; Chasserat, Julien; Chierici, Roberto; Contardo, Didier; Depasse, Pierre; El Mamouni, Houmani; Fay, Jean; Gascon, Susan; Gouzevitch, Maxime; Ille, Bernard; Kurca, Tibor; Lethuillier, Morgan; Mirabito, Laurent; Perries, Stephane; Sordini, Viola; Tschudi, Yohann; Verdier, Patrice; Viret, Sébastien; Tsamalaidze, Zviad; Anagnostou, Georgios; Autermann, Christian; Beranek, Sarah; Edelhoff, Matthias; Feld, Lutz; Heracleous, Natalie; Hindrichs, Otto; Jussen, Ruediger; Klein, Katja; Merz, Jennifer; Ostapchuk, Andrey; Perieanu, Adrian; Raupach, Frank; Sammet, Jan; Schael, Stefan; Sprenger, Daniel; Weber, Hendrik; Wittmer, Bruno; Zhukov, Valery; Ata, Metin; Caudron, Julien; Dietz-Laursonn, Erik; Duchardt, Deborah; Erdmann, Martin; Fischer, Robert; Güth, Andreas; Hebbeker, Thomas; Heidemann, Carsten; Hoepfner, Kerstin; Klingebiel, Dennis; Kreuzer, Peter; Magass, Carsten; Merschmeyer, Markus; Meyer, Arnd; Olschewski, Mark; Papacz, Paul; Pieta, Holger; Reithler, Hans; Schmitz, Stefan Antonius; Sonnenschein, Lars; Steggemann, Jan; Teyssier, Daniel; Weber, Martin; Bontenackels, Michael; Cherepanov, Vladimir; Erdogan, Yusuf; Flügge, Günter; Geenen, Heiko; Geisler, Matthias; Haj Ahmad, Wael; Hoehle, Felix; Kargoll, Bastian; Kress, Thomas; Kuessel, Yvonne; Nowack, Andreas; Perchalla, Lars; Pooth, Oliver; Sauerland, Philip; Stahl, Achim; Aldaya Martin, Maria; Behr, Joerg; Behrenhoff, Wolf; Behrens, Ulf; Bergholz, Matthias; Bethani, Agni; Borras, Kerstin; Burgmeier, Armin; Cakir, Altan; Calligaris, Luigi; Campbell, Alan; Castro, Elena; Costanza, Francesco; Dammann, Dirk; Diez Pardos, Carmen; Eckerlin, Guenter; Eckstein, Doris; Flucke, Gero; Geiser, Achim; Glushkov, Ivan; Gunnellini, Paolo; Habib, Shiraz; Hauk, Johannes; Hellwig, Gregor; Jung, Hannes; Kasemann, Matthias; Katsas, Panagiotis; Kleinwort, Claus; Kluge, Hannelies; Knutsson, Albert; Krämer, Mira; Krücker, Dirk; Kuznetsova, Ekaterina; Lange, Wolfgang; Lohmann, Wolfgang; Lutz, Benjamin; Mankel, Rainer; Marfin, Ihar; Marienfeld, Markus; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Mnich, Joachim; Mussgiller, Andreas; Naumann-Emme, Sebastian; Olzem, Jan; Perrey, Hanno; Petrukhin, Alexey; Pitzl, Daniel; Raspereza, Alexei; Ribeiro Cipriano, Pedro M; Riedl, Caroline; Ron, Elias; Rosin, Michele; Salfeld-Nebgen, Jakob; Schmidt, Ringo; Schoerner-Sadenius, Thomas; Sen, Niladri; Spiridonov, Alexander; Stein, Matthias; Walsh, Roberval; Wissing, Christoph; Blobel, Volker; Draeger, Jula; Enderle, Holger; Erfle, Joachim; Gebbert, Ulla; Görner, Martin; Hermanns, Thomas; Höing, Rebekka Sophie; Kaschube, Kolja; Kaussen, Gordon; Kirschenmann, Henning; Klanner, Robert; Lange, Jörn; Mura, Benedikt; Nowak, Friederike; Peiffer, Thomas; Pietsch, Niklas; Rathjens, Denis; Sander, Christian; Schettler, Hannes; Schleper, Peter; Schlieckau, Eike; Schmidt, Alexander; Schröder, Matthias; Schum, Torben; Seidel, Markus; Sola, Valentina; Stadie, Hartmut; Steinbrück, Georg; Thomsen, Jan; Vanelderen, Lukas; Barth, Christian; Berger, Joram; Böser, Christian; Chwalek, Thorsten; De Boer, Wim; Descroix, Alexis; Dierlamm, Alexander; Feindt, Michael; Guthoff, Moritz; Hackstein, Christoph; Hartmann, Frank; Hauth, Thomas; Heinrich, Michael; Held, Hauke; Hoffmann, Karl-Heinz; Honc, Simon; Katkov, Igor; Komaragiri, Jyothsna Rani; Lobelle Pardo, Patricia; Martschei, Daniel; Mueller, Steffen; Müller, Thomas; Niegel, Martin; Nürnberg, Andreas; Oberst, Oliver; Oehler, Andreas; Ott, Jochen; Quast, Gunter; Rabbertz, Klaus; Ratnikov, Fedor; Ratnikova, Natalia; Röcker, Steffen; Scheurer, Armin; Schilling, Frank-Peter; Schott, Gregory; Simonis, Hans-Jürgen; Stober, Fred-Markus Helmut; Troendle, Daniel; Ulrich, Ralf; Wagner-Kuhr, Jeannine; Wayand, Stefan; Weiler, Thomas; Zeise, Manuel; Daskalakis, Georgios; Geralis, Theodoros; Kesisoglou, Stilianos; Kyriakis, Aristotelis; Loukas, Demetrios; Manolakos, Ioannis; Markou, Athanasios; Markou, Christos; Mavrommatis, Charalampos; Ntomari, Eleni; Gouskos, Loukas; Mertzimekis, Theodoros; Panagiotou, Apostolos; Saoulidou, Niki; Evangelou, Ioannis; Foudas, Costas; Kokkas, Panagiotis; Manthos, Nikolaos; Papadopoulos, Ioannis; Patras, Vaios; Bencze, Gyorgy; Hajdu, Csaba; Hidas, Pàl; Horvath, Dezso; Sikler, Ferenc; Veszpremi, Viktor; Vesztergombi, Gyorgy; Beni, Noemi; Czellar, Sandor; Molnar, Jozsef; Palinkas, Jozsef; Szillasi, Zoltan; Karancsi, János; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Beri, Suman Bala; Bhatnagar, Vipin; Dhingra, Nitish; Gupta, Ruchi; Kaur, Manjit; Mehta, Manuk Zubin; Nishu, Nishu; Saini, Lovedeep Kaur; Sharma, Archana; Singh, Jasbir; Kumar, Ashok; Kumar, Arun; Ahuja, Sudha; Bhardwaj, Ashutosh; Choudhary, Brajesh C; Malhotra, Shivali; Naimuddin, Md; Ranjan, Kirti; Sharma, Varun; Shivpuri, Ram Krishen; Banerjee, Sunanda; Bhattacharya, Satyaki; Dutta, Suchandra; Gomber, Bhawna; Jain, Sandhya; Jain, Shilpi; Khurana, Raman; Sarkar, Subir; Sharan, Manoj; Abdulsalam, Abdulla; Choudhury, Rajani Kant; Dutta, Dipanwita; Kailas, Swaminathan; Kumar, Vineet; Mehta, Pourus; Mohanty, Ajit Kumar; Pant, Lalit Mohan; Shukla, Prashant; Aziz, Tariq; Ganguly, Sanmay; Guchait, Monoranjan; Maity, Manas; Majumder, Gobinda; Mazumdar, Kajari; Mohanty, Gagan Bihari; Parida, Bibhuti; Sudhakar, Katta; Wickramage, Nadeesha; Banerjee, Sudeshna; Dugad, Shashikant; Arfaei, Hessamaddin; Bakhshiansohi, Hamed; Etesami, Seyed Mohsen; Fahim, Ali; Hashemi, Majid; Hesari, Hoda; Jafari, Abideh; Khakzad, Mohsen; Mohammadi Najafabadi, Mojtaba; Paktinat Mehdiabadi, Saeid; Safarzadeh, Batool; Zeinali, Maryam; Abbrescia, Marcello; Barbone, Lucia; Calabria, Cesare; Chhibra, Simranjit Singh; Colaleo, Anna; Creanza, Donato; De Filippis, Nicola; De Palma, Mauro; Fiore, Luigi; Iaselli, Giuseppe; Lusito, Letizia; Maggi, Giorgio; Maggi, Marcello; Marangelli, Bartolomeo; My, Salvatore; Nuzzo, Salvatore; Pacifico, Nicola; Pompili, Alexis; Pugliese, Gabriella; Selvaggi, Giovanna; Silvestris, Lucia; Singh, Gurpreet; Venditti, Rosamaria; Zito, Giuseppe; Abbiendi, Giovanni; Benvenuti, Alberto; Bonacorsi, Daniele; Braibant-Giacomelli, Sylvie; Brigliadori, Luca; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Fasanella, Daniele; Giacomelli, Paolo; Grandi, Claudio; Guiducci, Luigi; Marcellini, Stefano; Masetti, Gianni; Meneghelli, Marco; Montanari, Alessandro; Navarria, Francesco; Odorici, Fabrizio; Perrotta, Andrea; Primavera, Federica; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gian Piero; Travaglini, Riccardo; Albergo, Sebastiano; Cappello, Gigi; Chiorboli, Massimiliano; Costa, Salvatore; Potenza, Renato; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Frosali, Simone; Gallo, Elisabetta; Gonzi, Sandro; Meschini, Marco; Paoletti, Simone; Sguazzoni, Giacomo; Tropiano, Antonio; Benussi, Luigi; Bianco, Stefano; Colafranceschi, Stefano; Fabbri, Franco; Piccolo, Davide; Fabbricatore, Pasquale; Musenich, Riccardo; Tosi, Silvano; Benaglia, Andrea; De Guio, Federico; Di Matteo, Leonardo; Fiorendi, Sara; Gennai, Simone; Ghezzi, Alessio; Malvezzi, Sandra; Manzoni, Riccardo Andrea; Martelli, Arabella; Massironi, Andrea; Menasce, Dario; Moroni, Luigi; Paganoni, Marco; Pedrini, Daniele; Ragazzi, Stefano; Redaelli, Nicola; Sala, Silvano; Tabarelli de Fatis, Tommaso; Buontempo, Salvatore; Carrillo Montoya, Camilo Andres; Cavallo, Nicola; De Cosa, Annapaola; Dogangun, Oktay; Fabozzi, Francesco; Iorio, Alberto Orso Maria; Lista, Luca; Meola, Sabino; Merola, Mario; Paolucci, Pierluigi; Azzi, Patrizia; Bacchetta, Nicola; Bisello, Dario; Branca, Antonio; Carlin, Roberto; Checchia, Paolo; Dorigo, Tommaso; Gasparini, Fabrizio; Gasparini, Ugo; Gozzelino, Andrea; Kanishchev, Konstantin; Lacaprara, Stefano; Lazzizzera, Ignazio; Margoni, Martino; Meneguzzo, Anna Teresa; Pazzini, Jacopo; Pozzobon, Nicola; Ronchese, Paolo; Simonetto, Franco; Torassa, Ezio; Tosi, Mia; Vanini, Sara; Zotto, Pierluigi; Zucchetta, Alberto; Zumerle, Gianni; Gabusi, Michele; Ratti, Sergio P; Riccardi, Cristina; Torre, Paola; Vitulo, Paolo; Biasini, Maurizio; Bilei, Gian Mario; Fanò, Livio; Lariccia, Paolo; Lucaroni, Andrea; Mantovani, Giancarlo; Menichelli, Mauro; Nappi, Aniello; Romeo, Francesco; Saha, Anirban; Santocchia, Attilio; Spiezia, Aniello; Taroni, Silvia; Azzurri, Paolo; Bagliesi, Giuseppe; Boccali, Tommaso; Broccolo, Giuseppe; Castaldi, Rino; D'Agnolo, Raffaele Tito; Dell'Orso, Roberto; Fiori, Francesco; Foà, Lorenzo; Giassi, Alessandro; Kraan, Aafke; Ligabue, Franco; Lomtadze, Teimuraz; Martini, Luca; Messineo, Alberto; Palla, Fabrizio; Rizzi, Andrea; Serban, Alin Titus; Spagnolo, Paolo; Squillacioti, Paola; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; Del Re, Daniele; Diemoz, Marcella; Fanelli, Cristiano; Grassi, Marco; Longo, Egidio; Meridiani, Paolo; Micheli, Francesco; Nourbakhsh, Shervin; Organtini, Giovanni; Paramatti, Riccardo; Rahatlou, Shahram; Sigamani, Michael; Soffi, Livia; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Biino, Cristina; Cartiglia, Nicolo; Costa, Marco; Demaria, Natale; Mariotti, Chiara; Maselli, Silvia; Migliore, Ernesto; Monaco, Vincenzo; Musich, Marco; Obertino, Maria Margherita; Pastrone, Nadia; Pelliccioni, Mario; Potenza, Alberto; Romero, Alessandra; Sacchi, Roberto; Solano, Ada; Staiano, Amedeo; Usai, Emanuele; Vilela Pereira, Antonio; Belforte, Stefano; Candelise, Vieri; Cossutti, Fabio; Della Ricca, Giuseppe; Gobbo, Benigno; Marone, Matteo; Montanino, Damiana; Penzo, Aldo; Schizzi, Andrea; Heo, Seong Gu; Kim, Tae Yeon; Nam, Soon-Kwon; Chang, Sunghyun; Kim, Dong Hee; Kim, Gui Nyun; Kong, Dae Jung; Park, Hyangkyu; Ro, Sang-Ryul; Son, Dong-Chul; Son, Taejin; Kim, Jae Yool; Kim, Zero Jaeho; Song, Sanghyeon; Choi, Suyong; Gyun, Dooyeon; Hong, Byung-Sik; Jo, Mihee; Kim, Hyunchul; Kim, Tae Jeong; Lee, Kyong Sei; Moon, Dong Ho; Park, Sung Keun; Choi, Minkyoo; Kim, Ji Hyun; Park, Chawon; Park, Inkyu; Park, Sangnam; Ryu, Geonmo; Cho, Yongjin; Choi, Young-Il; Choi, Young Kyu; Goh, Junghwan; Kim, Min Suk; Kwon, Eunhyang; Lee, Byounghoon; Lee, Jongseok; Lee, Sungeun; Seo, Hyunkwan; Yu, Intae; Bilinskas, Mykolas Jurgis; Grigelionis, Ignas; Janulis, Mindaugas; Juodagalvis, Andrius; Castilla-Valdez, Heriberto; De La Cruz-Burelo, Eduard; Heredia-de La Cruz, Ivan; Lopez-Fernandez, Ricardo; Magaña Villalba, Ricardo; Martínez-Ortega, Jorge; Sánchez-Hernández, Alberto; Villasenor-Cendejas, Luis Manuel; Carrillo Moreno, Salvador; Vazquez Valencia, Fabiola; Salazar Ibarguen, Humberto Antonio; Casimiro Linares, Edgar; Morelos Pineda, Antonio; Reyes-Santos, Marco A; Krofcheck, David; Bell, Alan James; Butler, Philip H; Doesburg, Robert; Reucroft, Steve; Silverwood, Hamish; Ahmad, Muhammad; Ansari, Muhammad Hamid; Asghar, Muhammad Irfan; Hoorani, Hafeez R; Khalid, Shoaib; Khan, Wajid Ali; Khurshid, Taimoor; Qazi, Shamona; Shah, Mehar Ali; Shoaib, Muhammad; Bialkowska, Helena; Boimska, Bozena; Frueboes, Tomasz; Gokieli, Ryszard; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Romanowska-Rybinska, Katarzyna; Szleper, Michal; Wrochna, Grzegorz; Zalewski, Piotr; Brona, Grzegorz; Bunkowski, Karol; Cwiok, Mikolaj; Dominik, Wojciech; Doroba, Krzysztof; Kalinowski, Artur; Konecki, Marcin; Krolikowski, Jan; Almeida, Nuno; Bargassa, Pedrame; David Tinoco Mendes, Andre; Faccioli, Pietro; Ferreira Parracho, Pedro Guilherme; Gallinaro, Michele; Seixas, Joao; Varela, Joao; Vischia, Pietro; Belotelov, Ivan; Bunin, Pavel; Gavrilenko, Mikhail; Golutvin, Igor; Gorbunov, Ilya; Kamenev, Alexey; Karjavin, Vladimir; Kozlov, Guennady; Lanev, Alexander; Malakhov, Alexander; Moisenz, Petr; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Smirnov, Vitaly; Volodko, Anton; Zarubin, Anatoli; Evstyukhin, Sergey; Golovtsov, Victor; Ivanov, Yury; Kim, Victor; Levchenko, Petr; Murzin, Victor; Oreshkin, Vadim; Smirnov, Igor; Sulimov, Valentin; Uvarov, Lev; Vavilov, Sergey; Vorobyev, Alexey; Vorobyev, Andrey; Andreev, Yuri; Dermenev, Alexander; Gninenko, Sergei; Golubev, Nikolai; Kirsanov, Mikhail; Krasnikov, Nikolai; Matveev, Viktor; Pashenkov, Anatoli; Tlisov, Danila; Toropin, Alexander; Epshteyn, Vladimir; Erofeeva, Maria; Gavrilov, Vladimir; Kossov, Mikhail; Lychkovskaya, Natalia; Popov, Vladimir; Safronov, Grigory; Semenov, Sergey; Stolin, Viatcheslav; Vlasov, Evgueni; Zhokin, Alexander; Belyaev, Andrey; Boos, Edouard; Dubinin, Mikhail; Dudko, Lev; Ershov, Alexander; Gribushin, Andrey; Klyukhin, Vyacheslav; Kodolova, Olga; Lokhtin, Igor; Markina, Anastasia; Obraztsov, Stepan; Perfilov, Maxim; Petrushanko, Sergey; Popov, Andrey; Sarycheva, Ludmila; Savrin, Viktor; Snigirev, Alexander; Andreev, Vladimir; Azarkin, Maksim; Dremin, Igor; Kirakosyan, Martin; Leonidov, Andrey; Mesyats, Gennady; Rusakov, Sergey V; Vinogradov, Alexey; Azhgirey, Igor; Bayshev, Igor; Bitioukov, Sergei; Grishin, Viatcheslav; Kachanov, Vassili; Konstantinov, Dmitri; Krychkine, Victor; Petrov, Vladimir; Ryutin, Roman; Sobol, Andrei; Tourtchanovitch, Leonid; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Adzic, Petar; Djordjevic, Milos; Ekmedzic, Marko; Krpic, Dragomir; Milosevic, Jovan; Aguilar-Benitez, Manuel; Alcaraz Maestre, Juan; Arce, Pedro; Battilana, Carlo; Calvo, Enrique; Cerrada, Marcos; Chamizo Llatas, Maria; Colino, Nicanor; De La Cruz, Begona; Delgado Peris, Antonio; Domínguez Vázquez, Daniel; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Ferrando, Antonio; Flix, Jose; Fouz, Maria Cruz; Garcia-Abia, Pablo; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M; Josa, Maria Isabel; Merino, Gonzalo; Puerta Pelayo, Jesus; Quintario Olmeda, Adrián; Redondo, Ignacio; Romero, Luciano; Santaolalla, Javier; Soares, Mara Senghi; Willmott, Carlos; Albajar, Carmen; Codispoti, Giuseppe; de Trocóniz, Jorge F; Brun, Hugues; Cuevas, Javier; Fernandez Menendez, Javier; Folgueras, Santiago; Gonzalez Caballero, Isidro; Lloret Iglesias, Lara; Piedra Gomez, Jonatan; Brochero Cifuentes, Javier Andres; Cabrillo, Iban Jose; Calderon, Alicia; Chuang, Shan-Huei; Duarte Campderros, Jordi; Felcini, Marta; Fernandez, Marcos; Gomez, Gervasio; Gonzalez Sanchez, Javier; Graziano, Alberto; Jorda, Clara; Lopez Virto, Amparo; Marco, Jesus; Marco, Rafael; Martinez Rivero, Celso; Matorras, Francisco; Munoz Sanchez, Francisca Javiela; Rodrigo, Teresa; Rodríguez-Marrero, Ana Yaiza; Ruiz-Jimeno, Alberto; Scodellaro, Luca; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Auffray, Etiennette; Auzinger, Georg; Bachtis, Michail; Baillon, Paul; Ball, Austin; Barney, David; Benitez, Jose F; Bernet, Colin; Bianchi, Giovanni; Bloch, Philippe; Bocci, Andrea; Bonato, Alessio; Botta, Cristina; Breuker, Horst; Camporesi, Tiziano; Cerminara, Gianluca; Christiansen, Tim; Coarasa Perez, Jose Antonio; D'Enterria, David; Dabrowski, Anne; De Roeck, Albert; Di Guida, Salvatore; Dobson, Marc; Dupont-Sagorin, Niels; Elliott-Peisert, Anna; Frisch, Benjamin; Funk, Wolfgang; Georgiou, Georgios; Giffels, Manuel; Gigi, Dominique; Gill, Karl; Giordano, Domenico; Giunta, Marina; Glege, Frank; Gomez-Reino Garrido, Robert; Govoni, Pietro; Gowdy, Stephen; Guida, Roberto; Hansen, Magnus; Harris, Philip; Hartl, Christian; Harvey, John; Hegner, Benedikt; Hinzmann, Andreas; Innocente, Vincenzo; Janot, Patrick; Kaadze, Ketino; Karavakis, Edward; Kousouris, Konstantinos; Lecoq, Paul; Lee, Yen-Jie; Lenzi, Piergiulio; Lourenco, Carlos; Magini, Nicolo; Maki, Tuula; Malberti, Martina; Malgeri, Luca; Mannelli, Marcello; Masetti, Lorenzo; Meijers, Frans; Mersi, Stefano; Meschi, Emilio; Moser, Roland; Mozer, Matthias Ulrich; Mulders, Martijn; Musella, Pasquale; Nesvold, Erik; Orimoto, Toyoko; Orsini, Luciano; Palencia Cortezon, Enrique; Perez, Emmanuelle; Perrozzi, Luca; Petrilli, Achille; Pfeiffer, Andreas; Pierini, Maurizio; Pimiä, Martti; Piparo, Danilo; Polese, Giovanni; Quertenmont, Loic; Racz, Attila; Reece, William; Rodrigues Antunes, Joao; Rolandi, Gigi; Rovelli, Chiara; Rovere, Marco; Sakulin, Hannes; Santanastasio, Francesco; Schäfer, Christoph; Schwick, Christoph; Segoni, Ilaria; Sekmen, Sezen; Sharma, Archana; Siegrist, Patrice; Silva, Pedro; Simon, Michal; Sphicas, Paraskevas; Spiga, Daniele; Tsirou, Andromachi; Veres, Gabor Istvan; Vlimant, Jean-Roch; Wöhri, Hermine Katharina; Worm, Steven; Zeuner, Wolfram Dietrich; Bertl, Willi; Deiters, Konrad; Erdmann, Wolfram; Gabathuler, Kurt; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; König, Stefan; Kotlinski, Danek; Langenegger, Urs; Meier, Frank; Renker, Dieter; Rohe, Tilman; Sibille, Jennifer; Bäni, Lukas; Bortignon, Pierluigi; Buchmann, Marco-Andrea; Casal, Bruno; Chanon, Nicolas; Deisher, Amanda; Dissertori, Günther; Dittmar, Michael; Donegà, Mauro; Dünser, Marc; Eugster, Jürg; Freudenreich, Klaus; Grab, Christoph; Hits, Dmitry; Lecomte, Pierre; Lustermann, Werner; Marini, Andrea Carlo; Martinez Ruiz del Arbol, Pablo; Mohr, Niklas; Moortgat, Filip; Nägeli, Christoph; Nef, Pascal; Nessi-Tedaldi, Francesca; Pandolfi, Francesco; Pape, Luc; Pauss, Felicitas; Peruzzi, Marco; Ronga, Frederic Jean; Rossini, Marco; Sala, Leonardo; Sanchez, Ann - Karin; Starodumov, Andrei; Stieger, Benjamin; Takahashi, Maiko; Tauscher, Ludwig; Thea, Alessandro; Theofilatos, Konstantinos; Treille, Daniel; Urscheler, Christina; Wallny, Rainer; Weber, Hannsjoerg Artur; Wehrli, Lukas; Amsler, Claude; Chiochia, Vincenzo; De Visscher, Simon; Favaro, Carlotta; Ivova Rikova, Mirena; Millan Mejias, Barbara; Otiougova, Polina; Robmann, Peter; Snoek, Hella; Tupputi, Salvatore; Verzetti, Mauro; Chang, Yuan-Hann; Chen, Kuan-Hsin; Kuo, Chia-Ming; Li, Syue-Wei; Lin, Willis; Liu, Zong-Kai; Lu, Yun-Ju; Mekterovic, Darko; Singh, Anil; Volpe, Roberta; Yu, Shin-Shan; Bartalini, Paolo; Chang, Paoti; Chang, You-Hao; Chang, Yu-Wei; Chao, Yuan; Chen, Kai-Feng; Dietz, Charles; Grundler, Ulysses; Hou, George Wei-Shu; Hsiung, Yee; Kao, Kai-Yi; Lei, Yeong-Jyi; Lu, Rong-Shyang; Majumder, Devdatta; Petrakou, Eleni; Shi, Xin; Shiu, Jing-Ge; Tzeng, Yeng-Ming; Wan, Xia; Wang, Minzu; Adiguzel, Aytul; Bakirci, Mustafa Numan; Cerci, Salim; Dozen, Candan; Dumanoglu, Isa; Eskut, Eda; Girgis, Semiray; Gokbulut, Gul; Gurpinar, Emine; Hos, Ilknur; Kangal, Evrim Ersin; Karaman, Turker; Karapinar, Guler; Kayis Topaksu, Aysel; Onengut, Gulsen; Ozdemir, Kadri; Ozturk, Sertac; Polatoz, Ayse; Sogut, Kenan; Sunar Cerci, Deniz; Tali, Bayram; Topakli, Huseyin; Vergili, Latife Nukhet; Vergili, Mehmet; Akin, Ilina Vasileva; Aliev, Takhmasib; Bilin, Bugra; Bilmis, Selcuk; Deniz, Muhammed; Gamsizkan, Halil; Guler, Ali Murat; Ocalan, Kadir; Ozpineci, Altug; Serin, Meltem; Sever, Ramazan; Surat, Ugur Emrah; Yalvac, Metin; Yildirim, Eda; Zeyrek, Mehmet; Gülmez, Erhan; Isildak, Bora; Kaya, Mithat; Kaya, Ozlem; Ozkorucuklu, Suat; Sonmez, Nasuf; Cankocak, Kerem; Levchuk, Leonid; Bostock, Francis; Brooke, James John; Clement, Emyr; Cussans, David; Flacher, Henning; Frazier, Robert; Goldstein, Joel; Grimes, Mark; Heath, Greg P; Heath, Helen F; Kreczko, Lukasz; Metson, Simon; Newbold, Dave M; Nirunpong, Kachanon; Poll, Anthony; Senkin, Sergey; Smith, Vincent J; Williams, Thomas; Basso, Lorenzo; Bell, Ken W; Belyaev, Alexander; Brew, Christopher; Brown, Robert M; Cockerill, David JA; Coughlan, John A; Harder, Kristian; Harper, Sam; Jackson, James; Kennedy, Bruce W; Olaiya, Emmanuel; Petyt, David; Radburn-Smith, Benjamin Charles; Shepherd-Themistocleous, Claire; Tomalin, Ian R; Womersley, William John; Bainbridge, Robert; Ball, Gordon; Beuselinck, Raymond; Buchmuller, Oliver; Colling, David; Cripps, Nicholas; Cutajar, Michael; Dauncey, Paul; Davies, Gavin; Della Negra, Michel; Ferguson, William; Fulcher, Jonathan; Futyan, David; Gilbert, Andrew; Guneratne Bryer, Arlo; Hall, Geoffrey; Hatherell, Zoe; Hays, Jonathan; Iles, Gregory; Jarvis, Martyn; Karapostoli, Georgia; Lyons, Louis; Magnan, Anne-Marie; Marrouche, Jad; Mathias, Bryn; Nandi, Robin; Nash, Jordan; Nikitenko, Alexander; Papageorgiou, Anastasios; Pela, Joao; Pesaresi, Mark; Petridis, Konstantinos; Pioppi, Michele; Raymond, David Mark; Rogerson, Samuel; Rose, Andrew; Ryan, Matthew John; Seez, Christopher; Sharp, Peter; Sparrow, Alex; Stoye, Markus; Tapper, Alexander; Vazquez Acosta, Monica; Virdee, Tejinder; Wakefield, Stuart; Wardle, Nicholas; Whyntie, Tom; Chadwick, Matthew; Cole, Joanne; Hobson, Peter R; Khan, Akram; Kyberd, Paul; Leggat, Duncan; Leslie, Dawn; Martin, William; Reid, Ivan; Symonds, Philip; Teodorescu, Liliana; Turner, Mark; Hatakeyama, Kenichi; Liu, Hongxuan; Scarborough, Tara; Charaf, Otman; Henderson, Conor; Rumerio, Paolo; Avetisyan, Aram; Bose, Tulika; Fantasia, Cory; Heister, Arno; St John, Jason; Lawson, Philip; Lazic, Dragoslav; Rohlf, James; Sperka, David; Sulak, Lawrence; Alimena, Juliette; Bhattacharya, Saptaparna; Cutts, David; Ferapontov, Alexey; Heintz, Ulrich; Jabeen, Shabnam; Kukartsev, Gennadiy; Laird, Edward; Landsberg, Greg; Luk, Michael; Narain, Meenakshi; Nguyen, Duong; Segala, Michael; Sinthuprasith, Tutanon; Speer, Thomas; Tsang, Ka Vang; Breedon, Richard; Breto, Guillermo; Calderon De La Barca Sanchez, Manuel; Chauhan, Sushil; Chertok, Maxwell; Conway, John; Conway, Rylan; Cox, Peter Timothy; Dolen, James; Erbacher, Robin; Gardner, Michael; Houtz, Rachel; Ko, Winston; Kopecky, Alexandra; Lander, Richard; Miceli, Tia; Pellett, Dave; Ricci-Tam, Francesca; Rutherford, Britney; Searle, Matthew; Smith, John; Squires, Michael; Tripathi, Mani; Vasquez Sierra, Ricardo; Andreev, Valeri; Cline, David; Cousins, Robert; Duris, Joseph; Erhan, Samim; Everaerts, Pieter; Farrell, Chris; Hauser, Jay; Ignatenko, Mikhail; Jarvis, Chad; Plager, Charles; Rakness, Gregory; Schlein, Peter; Traczyk, Piotr; Valuev, Vyacheslav; Weber, Matthias; Babb, John; Clare, Robert; Dinardo, Mauro Emanuele; Ellison, John Anthony; Gary, J William; Giordano, Ferdinando; Hanson, Gail; Jeng, Geng-Yuan; Liu, Hongliang; Long, Owen Rosser; Luthra, Arun; Nguyen, Harold; Paramesvaran, Sudarshan; Sturdy, Jared; Sumowidagdo, Suharyo; Wilken, Rachel; Wimpenny, Stephen; Andrews, Warren; Branson, James G; Cerati, Giuseppe Benedetto; Cittolin, Sergio; Evans, David; Golf, Frank; Holzner, André; Kelley, Ryan; Lebourgeois, Matthew; Letts, James; Macneill, Ian; Mangano, Boris; Padhi, Sanjay; Palmer, Christopher; Petrucciani, Giovanni; Pieri, Marco; Sani, Matteo; Sharma, Vivek; Simon, Sean; Sudano, Elizabeth; Tadel, Matevz; Tu, Yanjun; Vartak, Adish; Wasserbaech, Steven; Würthwein, Frank; Yagil, Avraham; Yoo, Jaehyeok; Barge, Derek; Bellan, Riccardo; Campagnari, Claudio; D'Alfonso, Mariarosaria; Danielson, Thomas; Flowers, Kristen; Geffert, Paul; Incandela, Joe; Justus, Christopher; Kalavase, Puneeth; Koay, Sue Ann; Kovalskyi, Dmytro; Krutelyov, Vyacheslav; Lowette, Steven; Mccoll, Nickolas; Pavlunin, Viktor; Rebassoo, Finn; Ribnik, Jacob; Richman, Jeffrey; Rossin, Roberto; Stuart, David; To, Wing; West, Christopher; Apresyan, Artur; Bornheim, Adolf; Chen, Yi; Di Marco, Emanuele; Duarte, Javier; Gataullin, Marat; Ma, Yousi; Mott, Alexander; Newman, Harvey B; Rogan, Christopher; Spiropulu, Maria; Timciuc, Vladlen; Veverka, Jan; Wilkinson, Richard; Xie, Si; Yang, Yong; Zhu, Ren-Yuan; Akgun, Bora; Azzolini, Virginia; Calamba, Aristotle; Carroll, Ryan; Ferguson, Thomas; Iiyama, Yutaro; Jang, Dong Wook; Liu, Yueh-Feng; Paulini, Manfred; Vogel, Helmut; Vorobiev, Igor; Cumalat, John Perry; Drell, Brian Robert; Edelmaier, Christopher; Ford, William T; Gaz, Alessandro; Heyburn, Bernadette; Luiggi Lopez, Eduardo; Smith, James; Stenson, Kevin; Ulmer, Keith; Wagner, Stephen Robert; Alexander, James; Chatterjee, Avishek; Eggert, Nicholas; Gibbons, Lawrence Kent; Heltsley, Brian; Khukhunaishvili, Aleko; Kreis, Benjamin; Mirman, Nathan; Nicolas Kaufman, Gala; Patterson, Juliet Ritchie; Ryd, Anders; Salvati, Emmanuele; Sun, Werner; Teo, Wee Don; Thom, Julia; Thompson, Joshua; Tucker, Jordan; Vaughan, Jennifer; Weng, Yao; Winstrom, Lucas; Wittich, Peter; Winn, Dave; Abdullin, Salavat; Albrow, Michael; Anderson, Jacob; Bauerdick, Lothar AT; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C; Bloch, Ingo; Burkett, Kevin; Butler, Joel Nathan; Chetluru, Vasundhara; Cheung, Harry; Chlebana, Frank; Elvira, Victor Daniel; Fisk, Ian; Freeman, Jim; Gao, Yanyan; Green, Dan; Gutsche, Oliver; Hanlon, Jim; Harris, Robert M; Hirschauer, James; Hooberman, Benjamin; Jindariani, Sergo; Johnson, Marvin; Joshi, Umesh; Kilminster, Benjamin; Klima, Boaz; Kunori, Shuichi; Kwan, Simon; Leonidopoulos, Christos; Linacre, Jacob; Lincoln, Don; Lipton, Ron; Lykken, Joseph; Maeshima, Kaori; Marraffino, John Michael; Maruyama, Sho; Mason, David; McBride, Patricia; Mishra, Kalanand; Mrenna, Stephen; Musienko, Yuri; Newman-Holmes, Catherine; O'Dell, Vivian; Prokofyev, Oleg; Sexton-Kennedy, Elizabeth; Sharma, Seema; Spalding, William J; Spiegel, Leonard; Tan, Ping; Taylor, Lucas; Tkaczyk, Slawek; Tran, Nhan Viet; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vidal, Richard; Whitmore, Juliana; Wu, Weimin; Yang, Fan; Yumiceva, Francisco; Yun, Jae Chul; Acosta, Darin; Avery, Paul; Bourilkov, Dimitri; Chen, Mingshui; Cheng, Tongguang; Das, Souvik; De Gruttola, Michele; Di Giovanni, Gian Piero; Dobur, Didar; Drozdetskiy, Alexey; Field, Richard D; Fisher, Matthew; Fu, Yu; Furic, Ivan-Kresimir; Gartner, Joseph; Hugon, Justin; Kim, Bockjoo; Konigsberg, Jacobo; Korytov, Andrey; Kropivnitskaya, Anna; Kypreos, Theodore; Low, Jia Fu; Matchev, Konstantin; Milenovic, Predrag; Mitselmakher, Guenakh; Muniz, Lana; Remington, Ronald; Rinkevicius, Aurelijus; Sellers, Paul; Skhirtladze, Nikoloz; Snowball, Matthew; Yelton, John; Zakaria, Mohammed; Gaultney, Vanessa; Hewamanage, Samantha; Lebolo, Luis Miguel; Linn, Stephan; Markowitz, Pete; Martinez, German; Rodriguez, Jorge Luis; Adams, Todd; Askew, Andrew; Bochenek, Joseph; Chen, Jie; Diamond, Brendan; Gleyzer, Sergei V; Haas, Jeff; Hagopian, Sharon; Hagopian, Vasken; Jenkins, Merrill; Johnson, Kurtis F; Prosper, Harrison; Veeraraghavan, Venkatesh; Weinberg, Marc; Baarmand, Marc M; Dorney, Brian; Hohlmann, Marcus; Kalakhety, Himali; Vodopiyanov, Igor; Adams, Mark Raymond; Anghel, Ioana Maria; Apanasevich, Leonard; Bai, Yuting; Bazterra, Victor Eduardo; Betts, Russell Richard; Bucinskaite, Inga; Callner, Jeremy; Cavanaugh, Richard; Evdokimov, Olga; Gauthier, Lucie; Gerber, Cecilia Elena; Hofman, David Jonathan; Khalatyan, Samvel; Lacroix, Florent; Malek, Magdalena; O'Brien, Christine; Silkworth, Christopher; Strom, Derek; Turner, Paul; Varelas, Nikos; Akgun, Ugur; Albayrak, Elif Asli; Bilki, Burak; Clarida, Warren; Duru, Firdevs; Griffiths, Scott; Merlo, Jean-Pierre; Mermerkaya, Hamit; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Newsom, Charles Ray; Norbeck, Edwin; Onel, Yasar; Ozok, Ferhat; Sen, Sercan; Tiras, Emrah; Wetzel, James; Yetkin, Taylan; Yi, Kai; Barnett, Bruce Arnold; Blumenfeld, Barry; Bolognesi, Sara; Fehling, David; Giurgiu, Gavril; Gritsan, Andrei; Guo, Zijin; Hu, Guofan; Maksimovic, Petar; Rappoccio, Salvatore; Swartz, Morris; Whitbeck, Andrew; Baringer, Philip; Bean, Alice; Benelli, Gabriele; Grachov, Oleg; Kenny Iii, Raymond Patrick; Murray, Michael; Noonan, Daniel; Sanders, Stephen; Stringer, Robert; Tinti, Gemma; Wood, Jeffrey Scott; Zhukova, Victoria; Barfuss, Anne-Fleur; Bolton, Tim; Chakaberia, Irakli; Ivanov, Andrew; Khalil, Sadia; Makouski, Mikhail; Maravin, Yurii; Shrestha, Shruti; Svintradze, Irakli; Gronberg, Jeffrey; Lange, David; Wright, Douglas; Baden, Drew; Boutemeur, Madjid; Calvert, Brian; Eno, Sarah Catherine; Gomez, Jaime; Hadley, Nicholas John; Kellogg, Richard G; Kirn, Malina; Kolberg, Ted; Lu, Ying; Marionneau, Matthieu; Mignerey, Alice; Pedro, Kevin; Peterman, Alison; Skuja, Andris; Temple, Jeffrey; Tonjes, Marguerite; Tonwar, Suresh C; Twedt, Elizabeth; Apyan, Aram; Bauer, Gerry; Bendavid, Joshua; Busza, Wit; Butz, Erik; Cali, Ivan Amos; Chan, Matthew; Dutta, Valentina; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Hahn, Kristan Allan; Kim, Yongsun; Klute, Markus; Krajczar, Krisztian; Li, Wei; Luckey, Paul David; Ma, Teng; Nahn, Steve; Paus, Christoph; Ralph, Duncan; Roland, Christof; Roland, Gunther; Rudolph, Matthew; Stephans, George; Stöckli, Fabian; Sumorok, Konstanty; Sung, Kevin; Velicanu, Dragos; Wenger, Edward Allen; Wolf, Roger; Wyslouch, Bolek; Yang, Mingming; Yilmaz, Yetkin; Yoon, Sungho; Zanetti, Marco; Cooper, Seth; Dahmes, Bryan; De Benedetti, Abraham; Franzoni, Giovanni; Gude, Alexander; Kao, Shih-Chuan; Klapoetke, Kevin; Kubota, Yuichi; Mans, Jeremy; Pastika, Nathaniel; Rusack, Roger; Sasseville, Michael; Singovsky, Alexander; Tambe, Norbert; Turkewitz, Jared; Cremaldi, Lucien Marcus; Kroeger, Rob; Perera, Lalith; Rahmat, Rahmat; Sanders, David A; Avdeeva, Ekaterina; Bloom, Kenneth; Bose, Suvadeep; Butt, Jamila; Claes, Daniel R; Dominguez, Aaron; Eads, Michael; Keller, Jason; Kravchenko, Ilya; Lazo-Flores, Jose; Malbouisson, Helena; Malik, Sudhir; Snow, Gregory R; Baur, Ulrich; Godshalk, Andrew; Iashvili, Ia; Jain, Supriya; Kharchilava, Avto; Kumar, Ashish; Shipkowski, Simon Peter; Smith, Kenneth; Alverson, George; Barberis, Emanuela; Baumgartel, Darin; Chasco, Matthew; Haley, Joseph; Nash, David; Trocino, Daniele; Wood, Darien; Zhang, Jinzhong; Anastassov, Anton; Kubik, Andrew; Mucia, Nicholas; Odell, Nathaniel; Ofierzynski, Radoslaw Adrian; Pollack, Brian; Pozdnyakov, Andrey; Schmitt, Michael; Stoynev, Stoyan; Velasco, Mayda; Won, Steven; Antonelli, Louis; Berry, Douglas; Brinkerhoff, Andrew; Hildreth, Michael; Jessop, Colin; Karmgard, Daniel John; Kolb, Jeff; Lannon, Kevin; Luo, Wuming; Lynch, Sean; Marinelli, Nancy; Morse, David Michael; Pearson, Tessa; Planer, Michael; Ruchti, Randy; Slaunwhite, Jason; Valls, Nil; Wayne, Mitchell; Wolf, Matthias; Bylsma, Ben; Durkin, Lloyd Stanley; Hill, Christopher; Hughes, Richard; Kotov, Khristian; Ling, Ta-Yung; Puigh, Darren; Rodenburg, Marissa; Vuosalo, Carl; Williams, Grayson; Winer, Brian L; Adam, Nadia; Berry, Edmund; Elmer, Peter; Gerbaudo, Davide; Halyo, Valerie; Hebda, Philip; Hegeman, Jeroen; Hunt, Adam; Jindal, Pratima; Lopes Pegna, David; Lujan, Paul; Marlow, Daniel; Medvedeva, Tatiana; Mooney, Michael; Olsen, James; Piroué, Pierre; Quan, Xiaohang; Raval, Amita; Safdi, Ben; Saka, Halil; Stickland, David; Tully, Christopher; Werner, Jeremy Scott; Zuranski, Andrzej; Acosta, Jhon Gabriel; Brownson, Eric; Huang, Xing Tao; Lopez, Angel; Mendez, Hector; Oliveros, Sandra; Ramirez Vargas, Juan Eduardo; Zatserklyaniy, Andriy; Alagoz, Enver; Barnes, Virgil E; Benedetti, Daniele; Bolla, Gino; Bortoletto, Daniela; De Mattia, Marco; Everett, Adam; Hu, Zhen; Jones, Matthew; Koybasi, Ozhan; Kress, Matthew; Laasanen, Alvin T; Leonardo, Nuno; Maroussov, Vassili; Merkel, Petra; Miller, David Harry; Neumeister, Norbert; Shipsey, Ian; Silvers, David; Svyatkovskiy, Alexey; Vidal Marono, Miguel; Yoo, Hwi Dong; Zablocki, Jakub; Zheng, Yu; Guragain, Samir; Parashar, Neeti; Adair, Antony; Boulahouache, Chaouki; Ecklund, Karl Matthew; Geurts, Frank JM; Padley, Brian Paul; Redjimi, Radia; Roberts, Jay; Zabel, James; Betchart, Burton; Bodek, Arie; Chung, Yeon Sei; Covarelli, Roberto; de Barbaro, Pawel; Demina, Regina; Eshaq, Yossof; Ferbel, Thomas; Garcia-Bellido, Aran; Goldenzweig, Pablo; Han, Jiyeon; Harel, Amnon; Miner, Daniel Carl; Vishnevskiy, Dmitry; Zielinski, Marek; Bhatti, Anwar; Ciesielski, Robert; Demortier, Luc; Goulianos, Konstantin; Lungu, Gheorghe; Malik, Sarah; Mesropian, Christina; Arora, Sanjay; Barker, Anthony; Chou, John Paul; Contreras-Campana, Christian; Contreras-Campana, Emmanuel; Duggan, Daniel; Ferencek, Dinko; Gershtein, Yuri; Gray, Richard; Halkiadakis, Eva; Hidas, Dean; Lath, Amitabh; Panwalkar, Shruti; Park, Michael; Patel, Rishi; Rekovic, Vladimir; Robles, Jorge; Rose, Keith; Salur, Sevil; Schnetzer, Steve; Seitz, Claudia; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Cerizza, Giordano; Hollingsworth, Matthew; Spanier, Stefan; Yang, Zong-Chang; York, Andrew; Eusebi, Ricardo; Flanagan, Will; Gilmore, Jason; Kamon, Teruki; Khotilovich, Vadim; Montalvo, Roy; Osipenkov, Ilya; Pakhotin, Yuriy; Perloff, Alexx; Roe, Jeffrey; Safonov, Alexei; Sakuma, Tai; Sengupta, Sinjini; Suarez, Indara; Tatarinov, Aysen; Toback, David; Akchurin, Nural; Damgov, Jordan; Dragoiu, Cosmin; Dudero, Phillip Russell; Jeong, Chiyoung; Kovitanggoon, Kittikul; Lee, Sung Won; Libeiro, Terence; Roh, Youn; Volobouev, Igor; Appelt, Eric; Delannoy, Andrés G; Florez, Carlos; Greene, Senta; Gurrola, Alfredo; Johns, Willard; Johnston, Cody; Kurt, Pelin; Maguire, Charles; Melo, Andrew; Sharma, Monika; Sheldon, Paul; Snook, Benjamin; Tuo, Shengquan; Velkovska, Julia; Arenton, Michael Wayne; Balazs, Michael; Boutle, Sarah; Cox, Bradley; Francis, Brian; Goodell, Joseph; Hirosky, Robert; Ledovskoy, Alexander; Lin, Chuanzhe; Neu, Christopher; Wood, John; Yohay, Rachel; Gollapinni, Sowjanya; Harr, Robert; Karchin, Paul Edmund; Kottachchi Kankanamge Don, Chamath; Lamichhane, Pramod; Sakharov, Alexandre; Anderson, Michael; Belknap, Donald; Borrello, Laura; Carlsmith, Duncan; Cepeda, Maria; Dasu, Sridhara; Friis, Evan; Gray, Lindsey; Grogg, Kira Suzanne; Grothe, Monika; Hall-Wilton, Richard; Herndon, Matthew; Hervé, Alain; Klabbers, Pamela; Klukas, Jeffrey; Lanaro, Armando; Lazaridis, Christos; Leonard, Jessica; Loveless, Richard; Mohapatra, Ajit; Ojalvo, Isabel; Palmonari, Francesco; Pierro, Giuseppe Antonio; Ross, Ian; Savin, Alexander; Smith, Wesley H; Swanson, Joshua


    A measurement is presented of the relative prompt production rate of $\\chi_{c2}$ and $\\chi_{c1}$ with 4.6 inverse femtobarns of data collected by the CMS experiment at the LHC in pp collisions at $\\sqrt{s}$ = 7 TeV. The two states are measured via their radiative decays $\\chi_{c} \\to J/\\psi + \\gamma$, with the photon converting into a dielectron pair for J/$\\psi$ rapidity abs(y(J/$\\psi$)) 0.5 GeV. The measurement is given for six intervals of pt(J/$\\psi$) between 7 and 25 GeV. The results are compared to theoretical predictions.

  5. Characterization of new cell line stably expressing CHI3L1 oncogene

    Directory of Open Access Journals (Sweden)

    Chekhonin V. P.


    Full Text Available Aim. To characterize the immortalized 293 cell line after stable transfection with human oncogene (CHI3L1. Methods. 293 cells, stably transfected with pcDNA3.1_CHI3L1, and 293 cells, stably transfected with pcDNA3.1 as a negative control, were used throughout all experiments. The clones of CHI3L1-expressing 293 cells and 293 cells, transfected with pcDNA3.1, were analyzed by immunofluorescence and confocal microscopy. Cell proliferation was measured using MTT assay; analyses of ERK1/2 and AKT activation and their cellular localization were performed with anti-phospho-ERK and anti-phospho-AKT antibodies. Specific activation of MAP and PI3 kinases was measured by densitometric analysis of Western-blot signals. Results. The obtained results show quite modest ability of CHI3L1 to stimulate cell growth and reflect rather an improved cellular plating efficiency of the 293 cells stably transfected with pcDNA3.1_CHI3L1 as compared to the 293 cells transfected with an «empty» vector. ERK1/2 and AKT are activated in the 293_CHI3L1 cells. In these cells phosphorylated ERK1/2 were localized in both cell cytoplasm and nuclei while AKT only in cytoplasm. The 293_CHI3L1 cells differed from the 293 cells, transfected with an «empty» vector, in their size and ability to adhere to the culture plates. Conclusions. The overexpression of CHI3L1 is likely to have an important role in tumorigenesis via a mechanism which involves activation of PI3K and ERK1/2 pathways. The tumors which can be induced by orthotopic implantation of the transformed human cells with overexpressed human oncogene CHI3L1 into the rat brain can be used as a target for anticancer drug development.

  6. A {chi}{sup 2} veto for continuous gravitational wave searches

    Energy Technology Data Exchange (ETDEWEB)

    Sancho de la Jordana, Llucia; Sintes, Alicia M [Departament de Fisica, Universitat de les Illes Balears, Cra. Valldemossa Km. 7.5, E-07122 Palma de Mallorca (Spain)], E-mail:, E-mail:


    {chi}{sup 2} vetoes are commonly used in searching for gravitational waves, in particular for broadband signals, but they can also be applied to narrowband continuous wave signals, such as those expected from rapidly rotating neutron stars. In this paper, we present a {chi}{sup 2} veto adapted to the Hough transform searches for continuous gravitational wave signals; we characterize the {chi}{sup 2} significance plane for different frequency bands and discuss the expected performance of this veto in LIGO analysis.

  7. A proposal for a different chi-square function for Poisson distributions


    Almeida Jr., F. M. L.; Barbi, M; Vale, M. A. B. do


    We obtain an approximate Gaussian distribution from a Poisson distribution after doing a change of variable. A new chi-square function is obtained which can be used for parameter estimations and goodness-of-fit testing when adjusting curves to histograms. Since the new distribution is approximately Gaussian we can use it even when the bin contents are small. The corresponding chi-square function can be used for curve fitting. This chi-square function is simple to implement and presents a fast...

  8. A randomized controlled trial of tai chi for long-term low back pain (TAI CHI: Study rationale, design, and methods

    Directory of Open Access Journals (Sweden)

    Hall Amanda M


    Full Text Available Abstract Background Low back pain persisting for longer than 3 months is a common and costly condition for which many current treatments have low-moderate success rates at best. Exercise is among the more successful treatments for this condition, however, the type and dosage of exercise that elicits the best results is not clearly defined. Tai chi is a gentle form of low intensity exercise that uses controlled movements in combination with relaxation techniques and is currently used as a safe form of exercise for people suffering from other chronic pain conditions such as arthritis. To date, there has been no scientific evaluation of tai chi as an intervention for people with back pain. Thus the aim of this study will be to examine the effects of a tai chi exercise program on pain and disability in people with long-term low back pain. Methods and design The study will recruit 160 healthy individuals from the community setting to be randomised to either a tai chi intervention group or a wait-list control group. Individuals in the tai chi group will attend 2 tai chi sessions (40 minutes/week for 8 weeks followed by 1 tai chi session/week for 2 weeks. The wait-list control will continue their usual health care practices and have the opportunity to participate in the tai chi program once they have completed the follow-up assessments. The primary outcome will be bothersomeness of back symptoms measured with a 0–10 numerical rating scale. Secondary outcomes include, self-reports of pain-related disability, health-related quality of life and global perceived effect of treatment. Statistical analysis of primary and secondary outcomes will be based on the intention to treat principle. Linear mixed models will be used to test for the effect of treatment on outcome at 10 weeks follow up. This trial has received ethics approval from The University of Sydney Human Research Ethics Committee. HREC Approval No.10452 Discussion This study will be the first

  9. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... that features tai chi A practice in traditional Chinese medicine that uses a series of slow, gentle ... stress. and qi gong A component of traditional Chinese medicine that combines movement, meditation, and controlled breathing. ...

  10. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... Online Continuing Education Series Distinguished Lecture Series Integrated Medicine Research Lecture Series All Training Information News & Events ... features tai chi A practice in traditional Chinese medicine that uses a series of slow, gentle movements ...

  11. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... Legislation Advisory Council Job Opportunities All About NCCIH Health Topics A-Z # A B C D E ... Y Z Tai Chi and Qi Gong for Health and Well-Being Share: © Mariann Seriff The following ...

  12. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... NCCIH Clinical Digest A monthly newsletter with evidence-based information on complementary and integrative practices and a health condition All News & Events About NCCIH NCCIH At a Glance Mission and Vision Organizational ... Tai Chi and Qi ...

  13. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... Advisory Council Job Opportunities All About NCCIH Health Topics A-Z # A B C D E F ... up Qi Gong Tai Chi Cool Down This page last modified February 12, 2015 Follow NCCIH: Read ...

  14. Tai Chi and Qi Gong for Health and Well-Being (United States)

    ... Vision Organizational Structure Director's Message Strategic Plans & Reports Budget & Legislation Advisory Council Job Opportunities All About NCCIH ... tool that features tai chi A practice in traditional Chinese medicine that uses a series of slow, ...

  15. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... Vision Organizational Structure Director's Message Strategic Plans & Reports Budget & Legislation Advisory Council Job Opportunities All About NCCIH ... tool that features tai chi A practice in traditional Chinese medicine that uses a series of slow, ...

  16. chi_cJ Decays to h^+h^-h^0

    CERN Document Server

    Athar, S; Potlia, V; Yelton, J; Rubin, P; Cawlfield, C; Eisenstein, B I; Karliner, I; Kim, D; Lowrey, N; Naik, P; Sedlack, C; Selen, M; White, E J; Wiss, J; Shepherd, M R; Besson, D; Pedlar, T K; Cronin-Hennessy, D; Gao, K Y; Gong, D T; Hietala, J; Kubota, Y; Klein, T; Lang, B W; Poling, R; Scott, A W; Smith, A; Zweber, P; Dobbs, S; Metreveli, Z V; Seth, K K; Tomaradze, A G; Ernst, J; Severini, H; Dytman, S A; Love, W; Savinov, V; Aquines, O; Li, Z; López, A; Mehrabyan, S S; Méndez, H; Ramírez, J; Huang, G S; Miller, D H; Pavlunin, V; Sanghi, B; Shipsey, I P J; Xin, B; Adams, G S; Anderson, M; Cummings, J P; Danko, I; Napolitano, J; He, Q; Insler, J; Muramatsu, H; Park, C S; Thorndike, E H; Yang, F; Coan, T E; Gao, Y S; Liu, F; Artuso, M; Blusk, S; Butt, J; Li, J; Menaa, N; Mountain, R; Nisar, S; Randrianarivony, K; Redjimi, R; Sia, R; Skwarnicki, T; Stone, S; Wang, J C; Zhang, K; Csorna, S E; Bonvicini, G; Cinabro, D; Dubrovin, M; Lincoln, A; Asner, D M; Edwards, K W; Briere, R A; Brock, I; Chen, J; Ferguson, T; Tatishvili, G T; Vogel, H; Watkins, M E; Rosner, J L; Adam, N E; Alexander, J P; Berkelman, K; Cassel, D G; Duboscq, J E; Ecklund, K M; Ehrlich, R; Fields, L; Galik, R S; Gibbons, L; Gray, R; Gray, S W; Hartill, D L; Heltsley, B K; Hertz, D; Jones, C D; Kandaswamy, J; Kreinick, D L; Kuznetsov, V E; Mahlke-Krüger, H; Onyisi, P U E; Patterson, J R; Peterson, D; Pivarski, J; Riley, D; Ryd, A; Sadoff, A J; Schwarthoff, H; Shi, X; Stroiney, S; Sun, W M; Wilksen, T; Weinberger, M


    Using a sample of 3x10^6 psi(2S) decays recorded by the CLEO detector, we study three body decays of the chi_{c0}, chi_{c1}, and chi_{c2} produced in radiative decays of the psi(2S). We consider the decay modes pi+ pi- eta, K+ K- eta, p pbar eta, pi+ pi- etaprime, K+ K- pi0, p pbar pi0, pi+ K- K0S, and K+ pbar Lambda measuring branching fractions or placing upper limits. For chi_{c1} to pi+ pi- eta, K+ K- pi0, and pi+ K- K0S our observed samples are large enough to study the substructure in a Dalitz plot analysis. The results presented in this document are preliminary.

  17. chi_{cJ} Decays to h^+h^-h^0

    CERN Document Server

    Athar, S; Potlia, V; Yelton, J; Rubin, P; Cawlfield, C; Eisenstein, B I; Karliner, I; Kim, D; Lowrey, N; Naik, P; Selen, M; White, E J; Wiss, J; Mitchell, R E; Shepherd, M R; Besson, D; Pedlar, T K; Cronin-Hennessy, D; Gao, K Y; Hietala, J; Kubota, Y; Klein, T; Lang, B W; Poling, R; Scott, A W; Smith, A; Zweber, P; Dobbs, S; Metreveli, Z V; Seth, K K; Tomaradze, A G; Ernst, J; Severini, H; Love, W; Savinov, V; Aquines, O; Li, Z; López, A; Mehrabyan, S S; Méndez, H; Ramírez, J; Huang, G S; Miller, D H; Pavlunin, V; Sanghi, B; Shipsey, I P J; Xin, B; Adams, G S; Anderson, M; Cummings, J P; Danko, I; Hu, D; Moziak, B; Napolitano, J; He, Q; Insler, J; Muramatsu, H; Park, C S; Thorndike, E H; Yang, F; Coan, T E; Gao, Y S; Artuso, M; Blusk, S; Butt, J; Li, J; Menaa, N; Mountain, R; Nisar, S; Randrianarivony, K; Sia, R; Skwarnicki, T; Stone, S; Wang, J C; Zhang, K; Bonvicini, G; Cinabro, D; Dubrovin, M; Lincoln, A; Asner, D M; Edwards, K W; Briere, R A; Ferguson, T; Tatishvili, G T; Vogel, H; Watkins, M E; Rosner, J L; Adam, N E; Alexander, J P; Cassel, D G; Duboscq, J E; Ecklund, K M; Ehrlich, R; Fields, L; Gibbons, L; Gray, R; Gray, S W; Hartill, D L; Heltsley, B K; Hertz, D; Jones, C D; Kandaswamy, J; Kreinick, D L; Kuznetsov, V E; Mahlke-Krüger, H; Onyisi, P U E; Patterson, J R; Peterson, D; Pivarski, J; Riley, D; Ryd, A; Sadoff, A J; Schwarthoff, H; Shi, X; Stroiney, S; Sun, W M; Wilksen, T; Weinberger, M; al, et


    Using a sample of 3 million psi(2S) decays recorded by the CLEO detector, we study three-body decays of the chi_c0, chi_c1, and chi_c2 produced in radiative decays of the psi(2S). We consider the final states pi+ pi- eta, K+ K- eta, p p-bar eta, pi+ pi- eta-prime, K+ K- pi0, p p-bar pi0, pi+ K- K0S, and K+ p-bar Lambda, measuring branching fractions or placing upper limits. For chi_c1 decays to pi+ pi- eta, K+ K- pi0, and pi+ K- K0S our observed samples are large enough to study the substructure in a Dalitz plot analysis.

  18. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... tool that features tai chi A practice in traditional Chinese medicine that uses a series of slow, gentle movements coordinated with breathing and meditation. The goal is to enhance physical functioning, improve balance and ...

  19. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... Council Job Opportunities All About NCCIH Health Topics A-Z # A B C D E F G H I ... be an educational tool that features tai chi A practice in traditional Chinese medicine that uses a ...

  20. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... tool that features tai chi A practice in traditional Chinese medicine that uses a series of slow, ... reduce stress. and qi gong A component of traditional Chinese medicine that combines movement, meditation, and controlled ...

  1. Chi 2 tests: how useful are they in the analysis of medical research data? (United States)

    Osborn, J F


    This paper has outlined analyses of data for which the chi 2 test is commonly applied and has shown that on its own, a chi 2 test provides very little information about the interpretation of the data. In goodness to fit tests, at best, the chi 2 test is a mere first step in the interpretation of the data and much more information can be gleaned from the deviations between the observed and theoretical distributions, and graphical methods are more sensitive for assessing Normality. Similarly, the chi 2 test as the analysis of a 2 x 2 contingency table misses the most important features of the data. A chi 2 value and associated p value should not be presented without an estimation of the effect and its confidence interval. The use of NS, (not significant), after a chi 2 value (or any other test statistic) is particularly meaningless as it does not even specify a level of significance. The analysis of 2 x 2 contingency tables should specify a measure of the effect such as the difference between two proportions, their ratio or the odds ratio. Confidence intervals should be calculated and least importantly, statistical significance assessed by the Standard Normal Deviate. Chi 2 has no useful role to play in the analysis of 2 x 2 contingency tables. In fact, even with larger two dimensional tables, although chi 2 can be used to test the significance of associations between the rows and columns, such results are seldom of much interest as they give no indication of where in the table associations may exist. They are insensitive particularly if the categories of the row or column variables are quantitative since chi 2 takes no account of the ordering of the rows and columns. Although simple analyses of such tables are inefficient the advent of desk-top computers means that more sophisticated techniques such as logistic regression for proportions and Poisson regression for larger or multidimensional contingency tables can be applied. Although these methods may involve chi 2

  2. Deciding the weak definability of Büchi definable tree languages


    Colcombet, Thomas; Kuperberg, Denis; Löding, Christof; Vanden Boom, Michael


    Weakly definable languages of infinite trees are an expressive subclass of regular tree languages definable in terms of weak monadic second-order logic, or equivalently weak alternating automata. Our main result is that given a Büchi automaton, it is decidable whether the language is weakly definable. We also show that given a parity automaton, it is decidable whether the language is recognizable by a nondeterministic co-Büchi automaton. The decidability proofs build on recent results abou...

  3. A Randomized Controlled Trial of Patient-Reported Outcomes With Tai Chi Exercise in Parkinson's Disease


    Li, Fuzhong; Harmer, Peter; Liu, Yu; Eckstrom, Elizabeth; Fitzgerald, Kathleen; Stock, Ronald; Chou, Li-Shan


    A previous randomized, controlled trial of tai chi showed improvements in objectively measured balance and other motor-related outcomes in patients with Parkinson's disease. This study evaluated whether patient-reported outcomes could be improved through exercise interventions and whether improvements were associated with clinical outcomes and exercise adherence. In a secondary analysis of the tai chi trial, patient-reported and clinical outcomes and exercise adherence measures were compared ...

  4. Quality of Reporting of Randomized Clinical Trials in Tai Chi Interventions—A Systematic Review

    Directory of Open Access Journals (Sweden)

    Jing-Yi Li


    Full Text Available Objectives. To evaluate the reporting quality of published randomized clinical trials (RCTs in the Tai Chi literature following the publication of the CONSORT guidelines in 2001. Data Sources. The OVID MEDLINE and PUBMED databases. Review Methods. To survey the general characteristics of Tai Chi RCTs in the literature, we included any report if (i it was an original report of the trial; (ii its design was RCT; (iii one of the treatments being tested was Tai Chi; and (iv it was in English. In addition, we assessed the reporting quality of RCTs that were published between 2002 and 2007, using a modified CONSORT checklist of 40 items. The adequate description of Tai Chi interventions in these trials was examined against a 10-item checklist adapted from previous reviews. Results. The search yielded 31 Tai Chi RCTs published from 2002 to 2007 and only 11 for 1992–2001. Among trials published during 2002–2007, the most adequately reported criteria were related to background, participant eligibility and interpretation of the study results. Nonetheless, the most poorly reported items were associated with randomization allocation concealment, implementation of randomization and the definitions of period of recruitment and follow-up. In addition, only 23% of RCTs provided adequate details of Tai Chi intervention used in the trials. Conclusion. The findings in this review indicated that the reporting quality of Tai Chi intervention trials is sub-optimal. Substantial improvement is required to meet the CONSORT guidelines and allow assessment of the quality of evidence. We believe that not only investigators, but also journal editors, reviewers and funding agencies need to follow the CONSORT guidelines to improve the standards of research and strengthen the evidence base for Tai Chi and for complementary and alternative medicine.

  5. Ground Reaction Forces and Plantar Pressure Distribution Generated by Two Tai Chi Movements


    Wong, Shiu Hong Trevor


    Tai Chi Chuan, Tai Chi (TC) in short, is a popular form of Chinese martial arts which have been practised by millions of people and provides various health benefits, such as improving balance control, strengthening leg muscles, reducing fear of falling, enhancing flexibility and many more. The American Geriatrics Society and the British Geriatrics Society have recommended TC as a suitable exercise for preventing falls of older people. However, it is not clear which TC components are the most ...

  6. Asymptotic Chi-Square Tests for a Large Class of Factor Analysis Models


    Amemiya, Yasuo; Anderson, T W


    Three types of asymptotic $\\chi^2$ goodness-of-fit tests derived under the normal assumption have been used widely in factor analysis. Asymptotic behavior of the test statistics is investigated here for the factor analysis model with linearly or nonlinearly restricted factor loadings under weak assumptions on the factor vector and the error vector. In particular the limiting $\\chi^2$ result for the three tests is shown to hold for the factor vector, either fixed or random with any distributio...

  7. Water-based Tai Chi: theoretical benefits in musculoskeletal diseases. Current evidence


    Macías-Hernández, Salvador Israel; Vázquez-Torres, Lucio; Morones-Alba, Juan Daniel; Coronado-Zarco, Roberto; de los Angeles Soria-Bastida, María; Cruz-Medina, Eva; Nava-Bringas, Tania Inés


    Tai Chi is a low-impact and moderate intensity exercise that has shown positive effects in patients with musculoskeletal disorders. Recently have been developed clinical studies on the benefits of Tai Chi techniques combined with hydrotherapy. Both types of treatment include physical training of balance, mobility, strength, coordination and sensory input that could complement each other. This report aims to present the current evidence about the benefits of the combination of water based Tai ...

  8. A systematic review of the health benefits of Tai Chi for students in higher education


    Webster, Craig S.; Luo, Anna Y.; Krägeloh, Chris; Moir, Fiona; Henning, Marcus


    Background The poor health consequences of stress are well recognized, and students in higher education may be at particular risk. Tai Chi integrates physical exercise with mindfulness techniques and seems well suited to relieve stress and related conditions. Methods We conducted a systematic review of the health benefits of Tai Chi for students in higher education reported in the English and Chinese literature, using an evidence hierarchy approach, allowing the inclusion of studies additiona...

  9. CHI3L1 nuclear localization in monocyte derived dendritic cells. (United States)

    Di Rosa, Michelino; Tibullo, Daniele; Saccone, Salvatore; Distefano, Gisella; Basile, Maria Sofia; Di Raimondo, Francesco; Malaguarnera, Lucia


    Chitinase-3-like-1 protein (CHI3L1) is a glycosyl hydrolase (GH) highly expressed in a variety of inflammatory diseases at infectious and non-infectious etiology. CHI3L1 is produced by a wide variety of cells including monocyte-derived macrophages cell lines such as polarized M1 and M2 type macrophages, osteoclasts and Kupffer cells. In this study we have examined the expression of CHI3L1 during the differentiation and maturation of dendritic cells. Magnetically-isolated peripheral blood monocytes were differentiated toward immature DCs (iDC) and mature DCs (mDCs) through a combination of factors and cytokines. Our result showed, for the first time, that CHI3L1 is expressed during the process of differentiation and maturation of dendritic cells in time dependent manner. Furthermore, the CHI3L1 is evenly distributed in cytoplasm and in the nucleus of both the iDCs and mDCs. These results suggest that CHI3L1 may play crucial role in the DCs immunoresponse. PMID:26466985

  10. Cross-ratio Identities and Higher-order Poles of CHY-integrand

    CERN Document Server

    Cardona, Carlos; Gomez, Humberto; Huang, Rijun


    The evaluation of generic Cachazo-He-Yuan(CHY)-integrands is a big challenge and efficient computational methods are in demand for practical evaluation. In this paper, we propose a systematic decomposition algorithm by using cross-ratio identities, which provides an analytic and easy to implement method for the evaluation of any CHY-integrand. This algorithm aims to decompose a given CHY-integrand containing higher-order poles as a linear combination of CHY-integrands with only simple poles in a finite number of steps, which ultimately can be trivially evaluated by integration rules of simple poles. To make the method even more efficient for CHY-integrands with large number of particles and complicated higher-order pole structures, we combine the $\\Lambda$-algorithm and the cross-ratio identities, and as a by-product it provides us a way to deal with CHY-integrands where the $\\Lambda$-algorithm was not applicable in its original formulation.

  11. Nonperturbative and spin effects in the central exclusive production of tensor \\chi_c(2^+) meson

    CERN Document Server

    Pasechnik, R S; Teryaev, O V


    We discuss central exclusive production (CEP) of the tensor $\\chi_c(2^{+})$ meson in proton-(anti)proton collisions at Tevatron, RHIC and LHC energies. The amplitude for the process is derived within the $k_t$-factorisation approach. Differential and total cross sections are calculated for several unintegrated gluon distributions (UGDFs). We compare exclusive production of all charmonium states $\\chi_c(0^+), \\chi_c(1^+)$ and $\\chi_c(2^+)$. Good description of the recent Tevatron data is achieved both with Martin-Ryskin phenomenological UGDF and UGDF based on unified BFKL-DGLAP approach. Unlike for Higgs production, the main contribution to the diffractive amplitude of heavy quarkonia comes from nonperturbative region of gluon transverse momenta $Q_{\\perp}<1 \\GeV$. At $y \\approx$ 0, we predict the contribution of $\\chi_c(1^+,2^+)$ to the $J/\\Psi + \\gamma$ channel to be larger than that of the $\\chi_c(0^+)$ one. This is partially due to a significant contribution from lower polarization states $\\lambda=0$ fo...

  12. Use of a chiA probe for detection of chitinase genes in bacteria from the Chesapeake Bay

    Digital Repository Service at National Institute of Oceanography (India)

    Ramaiah, N.; Hill, R.T.; Chun, J.; Ravel, J.; Matte, M.H.; Straube, W.L.; Colwell, R.R.

    from several distantly re- lated bacteria facilitated selection of highly conserved re- gions of the chiA gene for design of PCR primers expected to have broad speci¢city for detection of chiA in a wide range of bacteria. Our aims were to construct a...,34]. In the present study, chiA gene-speci¢c PCR primers and a chiA gene probe were developed and their speci¢city veri¢ed using a large assemblage of reference strains. The chiA frag- ments ampli¢ed by PCR from representative strains were sequenced to con...

  13. Towards nature of the X(3872) resonance

    CERN Document Server

    Achasov, N N


    We construct spectra of decays of the resonance X(3872) with good analytical and unitary properties which allows to define the branching ratio of the X(3872) \\to D^{*0}\\bar D^0 + c.c. decay studying only one more decay, for example, the X(3872)\\to\\pi^+\\pi^- J/\\psi(1S) decay, and show that our spectra are effective means of selection of models for the resonance X(3872). Then we discuss the scenario where the X(3872 resonance is the c\\bar c = \\chi_{c1}(2P) charmonium which "sits on" the D^{*0}\\bar D^0 threshold. We explain the shift of the mass of the X(3872) resonance with respect to the prediction of a potential model for the mass of the \\chi_{c1}(2P) charmonium by the contribution of the virtual D^*\\bar D+c.c. intermediate states into the self energy of the X(3872) resonance. This allows us to estimate the coupling constant of the X(7872) resonance with the D^{*0}\\bar D^0 channel, the branching ratio of the X(3872) \\to D^{*0}\\bar D^0 + c.c. decay, and the branching ratio of the X(3872) decay into all non-D^{...

  14. The autonomic and rate pressure product responses of Tai Chi practitioners

    Directory of Open Access Journals (Sweden)

    Michael A Figueroa


    Full Text Available Background: Spectral analysis of autonomic nervous system activity can provide insight into cardiovascular function. Rate pressure product is the parameter often targeted pharmacologically to decrease the incidence of myocardial events. Aim: The purpose of this study was to investigate whether or not Tai Chi Chuan practitioners would demonstrate autonomic responses that would be more cardioprotective when compared to non-trained controls. Materials and Methods: This was a cross-sectional study that measured the autonomic responses and rate pressure product of 2 groups of subjects; a Tai Chi Chuan trained (n = 13 and non-trained sedentary controls (n = 13 at rest and during 2 stressor phases that simulated functional activities of daily living. Results: The Tai Chi group maintained a greater parasympathetic outflow at rest and during the isometric grip stressor phase (P<0.05. Sympathetic outflow, systolic blood pressure and rate pressure product were significantly lower in the Tai Chi group at rest, during the isometric grip and standing stressor phases (P<0.05. Conclusion: Although a cause-and-effect relationship cannot be concluded in this study, the Tai Chi group was able to demonstrate efficiency of the myocardium with suppressed rate pressure product values and autonomic responses that favored parasympathetic outflow. This type of training may complement non-pharmacological anti-hypertensive therapy.

  15. Polarized $\\chi_{c2}$-charmonium production in antiproton-nucleus interactions

    CERN Document Server

    Larionov, A B; Bleicher, M


    Starting from the Feynman diagram representation of multiple scattering we consider the polarized $\\chi_c$(1P)-charmonia production in antiproton-nucleus reactions close to the threshold ($p_{\\rm lab}=5-7$ GeV/c). The rescattering and absorption of the incoming antiproton and outgoing charmonium on nucleons are taken into account, including the possibility of the elastic and nondiagonal (flavor-conserving) scattering $\\chi_{cJ} N \\to \\chi_{cJ^\\prime} N$, $J,J^\\prime=0,1,2$. The elementary amplitudes of the latter processes are evaluated by expanding the physical $\\chi_c$-states in the Clebsch-Gordan series of the $c \\bar c$ states with fixed values of internal orbital angular momentum ($L_z$) and spin projections on the $\\chi_c$ momentum axis. The total interaction cross sections of these $c \\bar c$ states with nucleons have been calculated in previous works using the QCD factorization theorem and the nonrelativistic quarkonium model and turned out to be strongly $L_z$-dependent due to the transverse size dif...

  16. Dynamic mechanisms of the post-seismic deformation following large events:Case study of the 1999 Chi-Chi earthquake in Taiwan of China

    Institute of Scientific and Technical Information of China (English)

    ZHU ShouBiao; CAI YongEn


    The mechanism of postseismic deformation related to strong earthquakes is important in geodynamics,and presumably afterslip or viscoelastic relaxation is responsible for the postsesimic deformation.The 1999 Chi-Chi,Taiwan of China,earthquake occurred in the region where GPS observation station is most densely deployed in the world.The unprecedented GPS data provides a unique opportunity to study the physical processes of postseismic deformation.Here we assume that the interactions of viscoelastic relaxation,afterslip,fault zone collapse,poroelastic rebound,flow of underground fluids,and all these combined contribute to the surface displacements following the main shock.In order to know the essence of the postseismic deformation after the strong event,fault zone collapse,poroelastic rebound,flow of underground fluids,and so on,are represented equivalently by the variations of the focal medium properties.Therefore,the viscoelastic relaxation,afterslip,and the variations of the equivalent focal medium properties are inverted by applying the GPS temporal series measurement data with viscoelastic finite element method.Both the afterslip rate distribution along the fault and the afterslip evolution with time are obtained by means of inversion.Also,the preliminary result suggests that viscosities of the lower crust and the upper mantle in Taiwan region is 2.7×10~(18) and 4.2×10~(20) Pa.s,respectively.Moreover,the inversion results indicate that the afterslip contributing to postseismic deformation of 44.6% in 450 days after the Chi-Chi earthquake,with 34.7% caused by the viscous relaxation and 20.7% by other factors such as fault zone collapse,poroelastic rebound,and the flow of liquids.

  17. Dynamic mechanisms of the post-seismic deformation following large events:Case study of the 1999 Chi-Chi earthquake in Taiwan of China

    Institute of Scientific and Technical Information of China (English)


    The mechanism of postseismic deformation related to strong earthquakes is important in geodynamics, and presumably afterslip or viscoelastic relaxation is responsible for the postsesimic deformation. The 1999 Chi-Chi, Taiwan of China, earthquake occurred in the region where GPS observation station is most densely deployed in the world. The unprecedented GPS data provides a unique opportunity to study the physical processes of postseismic deformation. Here we assume that the interactions of viscoelastic relaxation, afterslip, fault zone collapse, poroelastic rebound, flow of underground fluids, and all these combined contribute to the surface displacements following the main shock. In order to know the essence of the postseismic deformation after the strong event, fault zone collapse, poroelastic rebound, flow of underground fluids, and so on, are represented equivalently by the variations of the focal medium properties. Therefore, the viscoelastic relaxation, afterslip, and the variations of the equivalent focal medium properties are inverted by applying the GPS temporal series measurement data with viscoelastic finite element method. Both the afterslip rate distribution along the fault and the afterslip evolution with time are obtained by means of inversion. Also, the preliminary result suggests that viscosities of the lower crust and the upper mantle in Taiwan region is 2.7×1018 and 4.2×1020 Pa·s, respectively. Moreover, the inversion results indicate that the afterslip contributing to postseismic deformation of 44.6% in 450 days after the Chi-Chi earthquake, with 34.7% caused by the viscous relaxation and 20.7% by other factors such as fault zone collapse, poroelastic rebound, and the flow of liquids.

  18. A randomized controlled trial of tai chi for long-term low back pain (TAI CHI): Study rationale, design, and methods


    Hall Amanda M; Maher Chris G; Latimer Jane; Ferreira Manuela L; Lam Paul


    Abstract Background Low back pain persisting for longer than 3 months is a common and costly condition for which many current treatments have low-moderate success rates at best. Exercise is among the more successful treatments for this condition, however, the type and dosage of exercise that elicits the best results is not clearly defined. Tai chi is a gentle form of low intensity exercise that uses controlled movements in combination with relaxation techniques and is currently used as a safe...

  19. Towards ensemble asteroseismology of the young open clusters Chi Persei and NGC 6910

    CERN Document Server

    Saesen, S; Carrier, F; Michalska, G; Aerts, C; De Ridder, J; Briquet, M; Handler, G; Kolaczkowski, Z; Acke, B; Bauwens, E; Beck, P G; Blom, Y; Blommaert, J; Broeders, E; Cherix, M; Davignon, G; Debosscher, J; Degroote, P; Decin, L; Dehaes, S; De Meester, W; Deroo, P; Desmet, M; Drummond, R; Eggen, J R; Fu, J; Gazeas, K; Gelven, G A; Gielen, C; Huygen, R; Jiang, X; Kalomeni, B; Kim, S -L; Kim, D H; Kopacki, G; Kwon, J -H; Ladjal, D; Lee, C -U; Lee, Y -J; Lefever, K; Leitner, A; Lenz, P; Liakos, A; Lorenz, D; Narwid, A; Niarchos, P; Oestensen, R; Poretti, E; Prins, S; Provencal, J; Antolin, E Puga; Puschnig, J; Raskin, G; Reed, M D; Reyniers, M; Schmidt, E; Schmitzberger, L; Spano, M; Steininger, B; Steslicki, M; Uytterhoeven, K; Vanautgaerden, J; Vandenbussche, B; Van Helshoecht, V; Vanhollebeke, E; Van Winckel, H; Verhoelst, T; Vuckovic, M; Waelkens, C; Wolf, G W; Yakut, K; Zhang, C; Zima, W


    As a result of the variability survey in Chi Persei and NGC6910, the number of Beta Cep stars that are members of these two open clusters is increased to twenty stars, nine in NGC6910 and eleven in Chi Persei. We compare pulsational properties, in particular the frequency spectra, of Beta Cep stars in both clusters and explain the differences in terms of the global parameters of the clusters. We also indicate that the more complicated pattern of the variability among B type stars in Chi Persei is very likely caused by higher rotational velocities of stars in this cluster. We conclude that the sample of pulsating stars in the two open clusters constitutes a very good starting point for the ensemble asteroseismology of Beta Cep-type stars and maybe also for other B-type pulsators.

  20. Tai Chi for treating knee osteoarthritis: Designing a long-term follow up randomized controlled trial

    Directory of Open Access Journals (Sweden)

    Rones Ramel


    Full Text Available Abstract Background Knee Osteoarthritis (KOA is a major cause of pain and functional impairment among elders. Currently, there are neither feasible preventive intervention strategies nor effective medical remedies for the management of KOA. Tai Chi, an ancient Chinese mind-body exercise that is reported to enhance muscle function, balance and flexibility, and to reduce pain, depression and anxiety, may safely and effectively be used to treat KOA. However, current evidence is inconclusive. Our study examines the effects of a 12-week Tai Chi program compared with an attention control (wellness education and stretching on pain, functional capacity, psychosocial variables, joint proprioception and health status in elderly people with KOA. The study will be completed by July 2009. Methods/Design Forty eligible patients, age > 55 yr, BMI ≤ 40 kg/m2 with tibiofemoral osteoarthritis (American College of Rheumatology criteria are identified and randomly allocated to either Tai Chi (10 modified forms from classical Yang style Tai Chi or attention control (wellness education and stretching. The 60-minute intervention sessions take place twice weekly for 12 weeks. The study is conducted at an urban tertiary medical center in Boston, Massachusetts. The primary outcome measure is the Western Ontario and McMaster Universities (WOMAC pain subscale at 12 weeks. Secondary outcomes include weekly WOMAC pain, function and stiffness scores, patient and physician global assessments, lower-extremity function, knee proprioception, depression, self-efficacy, social support, health-related quality of life, adherence and occurrence of adverse events after 12, 24 and 48 weeks. Discussion In this article, we present the challenges of designing a randomized controlled trial with long-term follow up. The challenges encountered in this design are: strategies for recruitment, avoidance of selection bias, the actual practice of Tai Chi, and the maximization of adherence


    Directory of Open Access Journals (Sweden)

    Youlian Hong


    Full Text Available DESCRIPTION This collection on the latest and practical research data about the characteristics and beneficial effects of Tai Chi Chuan on various physiological and pathological matters is published as the 52nd volume of Medicine and Sport Science Journal. PURPOSE To address the effects of Tai Chi Chuan in the fields of biomechanics and physiology, sensory motor control and fall prevention, psychology and social aspects, as well as various clinical applications. FEATURES The book is organised into four sections, each containing four to seven chapters: the first section focuses on biomechanical and physiological aspects of Tai Chi in seven chapters, the second section addresses the benefits of the sport in terms of sensory motor control and fall prevention in five chapters, the third section highlights the psychological and social aspects in four chapters, and in the last section the application of Tai Chi in clinical intervention such as in Parkinson's disease, Alzheimer's diseases, coronary heart disease, chronic heart failure, breast cancer, rheumatoid arthritis and diabetes is demonstrated in six chapters. AUDIENCE This is a thorough reference book for students, researchers, teachers and healthcare professionals in exercise science and medicine. In fact, anyone already practicing Tai Chi Chuan or considering it up would benefit from this book. ASSESSMENT This 52nd volume of Medicine and Sport Science Journal on Tai Chi Chuan is a valuable and essential source of information brought together by recognized researchers around the Globe. The book is for everybody who is interested in understanding the effects and application of this fascinating form of exercise which has been developed as a form of martial arts and used for health exercise for centuries in China.

  2. Electrical properties of resistive switches based on Ba{sub 1-{chi}S}r{sub {chi}T}iO{sub 3} thin films prepared by RF co-sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Marquez H, A.; Hernandez R, E.; Zapata T, M. [IPN, Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada, Calzada Legaria No. 694, Col. Irrigacion, 11500 Mexico D. F. (Mexico); Guillen R, J. [Instituto Tecnologico y de Estudios Superiores de Monterrey, Campus Tampico, Puerto Industrial, Altamira 89600, Tamaulipas (Mexico); Cruz, M. P. [UNAM, Centro de Nanociencias y Nanotecnologia, Km. 107 Carretera Tijuana-Ensenada, 22860 Ensenada, Baja California (Mexico); Calzadilla A, O. [Universidad de la Habana, Facultad de Fisica-IMRE, San Lazaro y L. Municipio Plaza de la Revolucion, La Habana, Cuba (Cuba); Melendez L, M., E-mail: amarquez@ipn.m [IPN, Centro de Investigacion y de Estudios Avanzados, Departamento de Fisica, A. P. 14-740, 07000 Mexico D. F. (Mexico)


    In this work, was proposed the use of Ba{sub 1-{chi}S}r{sub {chi}T}iO{sub 3}(0{<=}x{<=}1) thin films for the construction of metal-insulator-metal heterostructures; and their great potential for the development of non-volatile resistance memories (ReRAM) is shown. The deposition of Ba{sub 1-{chi}S}r{sub {chi}T}iO{sub 3} thin films was done by the RF co-sputtering technique using two magnetron sputtering cathodes with BaTiO{sub 3} and SrTiO{sub 3} targets. The chemical composition (x parameter) in the deposited Ba{sub 1-{chi}S}r{sub {chi}T}iO{sub 3} thin films was varied through the RF powder applied to the targets. The constructed metal-insulator-metal heterostructures were Al/Ba{sub 1-{chi}S}r{sub {chi}T}iO{sub 3}/nichrome. The I-V measurements of the heterostructures showed that their hysteretic characteristics change depending on the Ba/Sr ratio of the Ba{sub 1-{chi}S}r{sub {chi}T}iO{sub 3} thin films; the Ba/Sr ratio was determined by employing the energy dispersive spectroscopy; Sem micrographs showed that Ba{sub 1-{chi}S}r{sub {chi}T}iO{sub 3} thin films were uniform without cracks or pinholes. Additionally, the analysis of the X-ray diffraction results indicated the substitutional incorporation of Sr into the BaTiO{sub 3} lattice and the obtainment of crystalline films for the entire range of the x values. (Author)

  3. Tai Chi for osteopenic women: design and rationale of a pragmatic randomized controlled trial

    Directory of Open Access Journals (Sweden)

    Fischer Mary


    Full Text Available Abstract Background Post-menopausal osteopenic women are at increased risk for skeletal fractures. Current osteopenia treatment guidelines include exercise, however, optimal exercise regimens for attenuating bone mineral density (BMD loss, or for addressing other fracture-related risk factors (e.g. poor balance, decreased muscle strength are not well-defined. Tai Chi is an increasingly popular weight bearing mind-body exercise that has been reported to positively impact BMD dynamics and improve postural control, however, current evidence is inconclusive. This study will determine the effectiveness of Tai Chi in reducing rates of bone turnover in post-menopausal osteopenic women, compared with standard care, and will preliminarily explore biomechanical processes that might inform how Tai Chi impacts BMD and associated fracture risks. Methods/Design A total of 86 post-menopausal women, aged 45-70y, T-score of the hip and/or spine -1.0 and -2.5, have been recruited from primary care clinics of a large healthcare system based in Boston. They have been randomized to a group-based 9-month Tai Chi program plus standard care or to standard care only. A unique aspect of this trial is its pragmatic design, which allows participants randomized to Tai Chi to choose from a pre-screened list of community-based Tai Chi programs. Interviewers masked to participants' treatment group assess outcomes at baseline and 3 and 9 months after randomization. Primary outcomes are serum markers of bone resorption (C-terminal cross linking telopeptide of type I collagen, bone formation (osteocalcin, and BMD of the lumbar spine and proximal femur (dual-energy X-ray absorptiometry. Secondary outcomes include health-related quality-of-life, exercise behavior, and psychological well-being. In addition, kinetic and kinematic characterization of gait, standing, and rising from a chair are assessed in subset of participants (n = 16 to explore the feasibility of modeling skeletal

  4. Connor H. G. Patros: Psi Chi/APA Edwin B. Newman Graduate Research Award. (United States)


    The Edwin B. Newman Graduate Research Award is given jointly by Psi Chi and APA. The award was established to recognize young researchers at the beginning of their professional lives and to commemorate both the 50th anniversary of Psi Chi and the 100th anniversary of psychology as a science (dating from the founding of Wundt's laboratory). The 2015 recipient is Connor H. G Patros. Patros was chosen for "an excellent research paper that examines the complex relationship between working memory, choice-impulsivity, and the attention-deficit/hyperactivity disorder (ADHD) phenotype." Patros's award citation, biography, and a selected bibliography are presented here. PMID:26618965

  5. Novel probe of new light Higgs bosons from bottomonium chi_{b0} decay

    CERN Document Server

    Godfrey, Stephen


    We calculate the branching ratios of chi_{b0} --> tau+ tau- via an s-channel Higgs boson and estimate the sensitivity to this process from Upsilon --> gamma chi_{b0} --> gamma tau+ tau-. We show that future running at the Upsilon(3S) at a very high luminosity super B factory can put significant constraints on the Type-II two Higgs doublet model when the discovered 125 GeV Higgs boson is the heavier of the two CP-even scalars.

  6. Variation in CHI3LI in relation to type 2 diabetes and related quantitative traits.

    Directory of Open Access Journals (Sweden)

    Camilla Noelle Rathcke

    Full Text Available BACKGROUND: CHI3LI encoding the inflammatory glycoprotein YKL-40 is located on chromosome 1q32.1. YKL-40 is involved in inflammatory processes and patients with Type 2 Diabetes (T2D have elevated circulating YKL-40 levels which correlate with their level of insulin resistance. Interestingly, it has been reported that rs10399931 (-329 G/A of CHI3LI contributes to the inter-individual plasma YKL-40 levels in patients with sarcoidosis, and that rs4950928 (-131 C/G is a susceptibility polymorphism for asthma and a decline in lung function. We hypothesized that single nucleotide polymorphisms (SNPs or haplotypes thereof the CHI3LI locus might influence risk of T2D. The aim of the present study was to investigate the putative association between SNPs and haplotype blocks of CHI3LI and T2D and T2D related quantitative traits. METHODS/PRINCIPAL FINDINGS: Eleven SNPs of CHI3LI were genotyped in 6514 individuals from the Inter99 cohort and 2924 individuals from the outpatient clinic at Steno Diabetes Center. In cas-control studies a total of 2345 T2D patients and 5302 individuals with a normal glucose tolerance test were examined. We found no association between rs10399931 (OR, 0.98 (CI, 0.88-1.10, p = 0.76, rs4950928 (0.98 (0.87-1.10, p = 0.68 or any of the other SNPs with T2D. Similarly, we found no significant association between any of the 11 tgSNPs and T2D related quantitative traits, all p>0.14. None of the identified haplotype blocks of CHI3LI showed any association with T2D, all p>0.16. CONCLUSIONS/SIGNIFICANCE: None of the examined SNPs or haplotype blocks of CHI3LI showed any association with T2D or T2D related quantitative traits. Estimates of insulin resistance and dysregulated glucose homeostasis in T2D do not seem to be accounted for by the examined variations of CHI3LI.

  7. NLO corrections to $\\chi_{bJ}$ two-body exclusive decay processes

    CERN Document Server

    Chen, Long-Bin


    The next-to-leading order QCD corrections for $\\chi_{bJ}$, the p-wave bottomonium, to $J/\\psi$ pair decay processes were evaluated utilizing NRQCD factorization formalism. It was determined that the scale dependence was depressed with NLO corrections, and hence the uncertainties in the leading order results were greatly reduced. The total branch ratios were found to be the order of $10^{-5}$ for all three $\\chi_{bJ}\\rightarrow J/\\psi J/\\psi$ processes,indicating that they were observable in the LHC and super-B experiments.

  8. Introduction of a tryptophan side chain into subsite +1 enhances transglycosylation activity of a GH-18 chitinase from Arabidopsis thaliana, AtChiC

    DEFF Research Database (Denmark)

    Umemoto, Naoyuki; Ohnuma, Takayuki; Mizuhara, Mamiko; Sato, Hirokazu; Skriver, Karen; Fukamizo, Tamo


    A tryptophan side chain was introduced into subsite +1 of family GH-18 (class V) chitinases from Nicotiana tabacum and Arabidopsis thaliana (NtChiV and AtChiC, respectively) by the mutation of a glycine residue to tryptophan (G74W-NtChiV and G75W-AtChiC). The specific activity toward glycol chitin...

  9. Robust Satellite Techniques (RST) for monitoring earthquake prone areas by satellite TIR observations: The case of 1999 Chi-Chi earthquake (Taiwan) (United States)

    Genzano, N.; Filizzola, C.; Paciello, R.; Pergola, N.; Tramutoli, V.


    different years (from 1995 to 2002). In this dataset the Chi-Chi earthquake (MW = 7.6) which occurred on September 20, 1999 represents the major, but not unique, event. The analysis shows that all identified SSTAs occur in the pre-fixed space-time window around (in terms of time and location) earthquakes with M > 4. The false positive rate remains zero even if only earthquakes with M > 4.5 are considered. In the case of the Chi-Chi earthquake, 3 SSTAs were identified (all within the established space-time correlation window), one of them appearing about 2 weeks before and very close to the epicentre of the earthquake just along the associated tectonic lineaments. The wide considered space-time window, together with the high seismicity of the considered area, surely positively conditioned the achieved results, so that further analyses should be carried out by using longer datasets and different geographic areas. However, also considering the coincidence with other (possible) precursor phenomena, independently reported (particularly within the iSTEP project) at the time of the Chi Chi earthquake, achieved results seem already sufficient (at least) to qualify TIR anomalies (identified by RST) among the parameters to be considered in the framework of a multi-parametric approach to a time-Dependent Assessment of Seismic Hazard (t-DASH).

  10. Resilience of aging populations after devastating earthquake event and its determinants - A case study of the Chi-Chi earthquake in Taiwan (United States)

    Hung, Chih-Hsuan; Hung, Hung-Chih


    1.Background Major portions of urban areas in Asia are highly exposed and vulnerable to devastating earthquakes. Many studies identify ways to reduce earthquake risk by concentrating more on building resilience for the particularly vulnerable populations. By 2020, as the United Nations' warning, many Asian countries would become 'super-aged societies', such as Taiwan. However, local authorities rarely use resilience approach to frame earthquake disaster risk management and land use strategies. The empirically-based research about the resilience of aging populations has also received relatively little attention. Thus, a challenge arisen for decision-makers is how to enhance resilience of aging populations within the context of risk reduction. This study aims to improve the understanding of the resilience of aging populations and its changes over time in the aftermath of a destructive earthquake at the local level. A novel methodology is proposed to assess the resilience of aging populations and to characterize their changes of spatial distribution patterns, as well as to examine their determinants. 2.Methods and data An indicator-based assessment framework is constructed with the goal of identifying composite indicators (including before, during and after a disaster) that could serve as proxies for attributes of the resilience of aging populations. Using the recovery process of the Chi-Chi earthquake struck central Taiwan in 1999 as a case study, we applied a method combined a geographical information system (GIS)-based spatial statistics technique and cluster analysis to test the extent of which the resilience of aging populations is spatially autocorrelated throughout the central Taiwan, and to explain why clustering of resilient areas occurs in specific locations. Furthermore, to scrutinize the affecting factors of resilience, we develop an aging population resilience model (APRM) based on existing resilience theory. Using the APRM, we applied a multivariate

  11. Cynthia J. Najdowski: Psi Chi/APA Edwin B. Newman Graduate Research Award (United States)

    American Psychologist, 2012


    Presents a short biography of the winner of the American Psychological Association's Psi Chi/APA Edwin B. Newman Graduate Research Award. The 2012 winner is Cynthia J. Najdowski for an outstanding research paper that examines how jurors' judgments are influenced by a juvenile defendant's confession and status as intellectually disabled. Through…

  12. Gregory Daniel Webster: Psi Chi/APA Edwin B. Newman Graduate Research Award. (United States)


    Presents a citation for Gregory Daniel Webster, who received the Psi Chi/APA Edwin B. Newman Graduate Research Award "for an outstanding research paper whose findings report that APA journal articles became shorter in length after the year 2000." A brief profile and a selected bibliography accompany the citation. ((c) 2006 APA, all rights reserved). PMID:17115835

  13. Towards the Reuse of Municipal Biowastes in Vietnam: a case study about Ho Chi Minh City

    NARCIS (Netherlands)

    Buuren, van J.C.L.; Thi, Le K.O.


    Table of contents: 1. Solid waste segragation at source in Ho Chi Minh City. 2. Survey of technical efficiency and economic viability of existing composting ventures and survey of the institutional and regulatory framework regarding composting in Vietnam. 3. Demand analysis of urban waste compost. 4

  14. Hannah Höchi ja feministide peavoolu poliitikat häiriv eraelu / Rebeka Põldsam

    Index Scriptorium Estoniae

    Põldsam, Rebeka


    Saksa kunstniku Hannah Höchi näitus "Personal is Political. Hannah Höch ja tema kunsti tõlgendus" Tallinna Kunstihoones 17. oktoobrini 2010, kuraator Reet Varblane. Eksponeeritakse ka Guerrilla Girlsi (USA), Martha Rosleri (USA), Shadi Ghadiriani (Iraan), Anna-Stina Treumundi (Eesti) jt. töid

  15. Diabetes Control among Vietnamese Patients in Ho Chi Minh City: An Observational Cross-Sectional Study (United States)

    Yokokawa, Hirohide; Khue, Nguyen Thy; Goto, Aya; Nam, Tran Quang; Trung, Tran The; Khoa, Vo Tuan; Ngoc, Nguyen Thi Boi; Minh, Pham Nghiem; Vinh, Nguyen Quang; Okayama, Akira; Yasumura, Seiji


    The objective of this study was to assess the extent of diabetic control and its associated factors among Vietnamese patients with diabetes mellitus (DM). The study was conducted among 652 outpatients who were recruited at a public general hospital (People Hospital 115) and a private clinic (Medic Center) in Ho Chi Minh City, Vietnam. Median age…

  16. A Chi-Square Program for a Microcomputer Using a Tape Unit. (United States)

    Dreger, Ralph Mason


    A program is described utilizing a microcomputer and tape drive with any contingency or chi-square table from 2x2 to 8x8. It requires only the entering of the number of rows and number of columns, plus one-time entry of cell frequencies. (Author/JKS)

  17. Chi Sigma Iota Chapter Leadership and Professional Identity Development in Early Career Counselors (United States)

    Luke, Melissa; Goodrich, Kristopher M.


    As the academic and professional honor society of counseling, Chi Sigma Iota (CSI) has been recognized in developing advocacy, leadership, and professional identity in student and professional members. A qualitative, grounded theory study was conducted to investigate experiences of 15 early career counselors who were CSI chapter leaders as…

  18. Observation of Persistent Edge Current Driven by Coaxial Helicity Injection (CHI)

    International Nuclear Information System (INIS)

    Coaxial Helicity Injection, CHI, has been used on the National Spherical Torus Experiment (NSTX) [M. Ono et al., Nucl. Fusion 40 (2000) 557], the Helicity Injected Torus (HIT) [B.A. Nelson et al., Phys. Rev. Lett. 72 (1994) 3666] and HIT-II [T.R. Jarboe et al., Phys. Plasmas 5 (1998) 1807] to initiate plasma and to drive up to 400 kA of toroidal current. On HIT-II, CHI initiated discharges have been successfully coupled to ohmic sustainment [R. Raman et al., Phys. Plasmas 11 (2004) 2565]. This paper presents the first results on the use of CHI to demonstrate the persistence of edge current drive in a preestablished single-null diverted inductive discharge. Edge current drive has the potential to improve plasma stability limits [J.E. Menard et al., Nucl. Fusion 37 (1997) 595]. While most current drive methods drive current in the interior of the plasma, CHI is well suited for driving current in the edge plasma

  19. R by C Chi-Square Analysis with Small Expected Cell Frequencies. (United States)

    Berry, Kenneth J.; Mielke, Paul W., Jr.


    A nonasymptotic Chi-Square analysis algorithm is presented to investigate r by c contingency tables where small expected cell frequencies render the usual asymptotic analysis inappropriate. A FORTRAN subroutine is provided for analyzing the tables having highly disproportionate or small marginal totals. (Author/GDC)

  20. $\\chi$EFT studies of few-nucleon systems: a status report

    CERN Document Server

    Schiavilla, R


    A status report on $\\chi$EFT studies of few-nucleon electroweak structure and dynamics is provided, including electromagnetic form factors of few-nucleon systems, the $pp$ weak fusion and muon weak captures on deuteron and $^3$He, and a number of parity-violating processes induced by hadronic weak interactions.

  1. City networks and commodity chains: identifying global flows and local connections in Ho Chi Minh City

    DEFF Research Database (Denmark)

    Vind, Ingeborg; Fold, Niels


    Any analytical framework for understanding actual forms of the intensified incorporation of cities into the world economy needs to go beyond the exclusive focus on advanced producer services, which is characteristic of most of the World City Network (WCN) approach. Simultaneously, an account of t...... electronics industry located in Ho Chi Minh City and the agricultural sector in its rural hinterland, the Mekong Delta....

  2. Light stop decays into $W b \\tilde{\\chi}_1^0$ near the kinematic threshold

    CERN Document Server

    Grober, Ramona; Popenda, Eva; Wlotzka, Alexander


    We investigate the decays of the light stop in scenarios with the lightest neutralino $\\tilde{\\chi}_1^0$ being the lightest supersymmetric particle, including flavour-violating (FV) effects. We analyse the region where the three-body decay $\\tilde{t}_1\\to W b \\tilde{\\chi}_1^0$ is kinematically allowed and provide a proper description of the transition region between the three-body decay and the four-body decay $\\tilde{t}_1 \\to\\tilde{\\chi}_1^0 b f \\bar{f}'$. The improved treatment has been implemented in the Fortran package {\\tt SUSY-HIT} and is used for the analysis of this region. A scan over the parameter range including all relevant experimental constraints reveals that the FV two-body decay into charm and $\\tilde{\\chi}_1^0$ can be as important as the three-, respectively, four-body decays if not dominant and therefore should be taken into account in order to complete the experimental searches for the light stop.

  3. Effects of Tai Chi exercise on physical and psychological health of older people. (United States)

    Blake, Holly; Hawley, Helen


    Tai Chi is a traditional Chinese form of conditioning exercise derived from martial arts and rooted in eastern philosophy and Chinese Medicine. Based on the inter-relatedness of mind, body and spirit this form of exercise focuses on producing an inner calmness which is thought to have both physical and psychological therapeutic value. This article provides a brief overview of selected current evidence examining the relationship between Tai Chi and physical, neurocognitive and psychosocial outcomes in older people. This is an emerging and growing area of research and improvements have often been reported in health functioning, physical and emotional health, reducing falls, fear of falling and risk of falls, and possibly enhancing cardiovascular functioning in older adults although the effects on bone density, cognitive and immunological functioning are less clear. Results overall are inconsistent and health improvements have not been evident in all studies. Tai Chi is becoming increasingly popular in practice, and more recent evidence is emerging which is based on experimental and longitudinal designs, although many of the proposed benefits of Tai Chi are yet to be validated in large, randomised controlled trials. PMID:21762093

  4. The efficacy of Tai Chi Chuan in older adults: a systematic review

    NARCIS (Netherlands)

    A.P. Verhagen (Arianne); M. Immink; A. van der Meulen; S.M. Bierma-Zeinstra (Sita)


    textabstractOBJECTIVES: The purpose of this study was to assess the effect of Tai Chi Chuan (TCC) on fall prevention, balance and cardiorespiratory functions in the elderly. METHODS: A systematic review was carried out according to the Cochrane standards. A computerized literature

  5. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... Legislation Advisory Council Job Opportunities All About NCCIH Health Topics A-Z # A B C D E ... Y Z Tai Chi and Qi Gong for Health and Well-Being Share: taichi_nccamIMG_2962.jpg © ...

  6. Effects of Aging and Tai Chi on a Finger-Pointing Task with a Choice Paradigm

    Directory of Open Access Journals (Sweden)

    William W. N. Tsang


    Full Text Available Background. This cross-sectional study examined the effect of aging on performing finger-pointing tasks involving choices and whether experienced older Tai Chi practitioners perform better than healthy older controls in such tasks. Methods. Thirty students and 30 healthy older controls were compared with 31 Tai Chi practitioners. All the subjects performed a rapid index finger-pointing task. The visual signal appeared randomly under 3 conditions: (1 to touch a black ball as quickly and as accurately as possible, (2 not to touch a white ball, (3 to touch only the white ball when a black and a white ball appeared simultaneously. Reaction time (RT of anterior deltoid electromyogram, movement time (MT from electromyogram onset to touching of the target, end-point accuracy from the center of the target, and the number of wrong movements were recorded. Results. Young students displayed significantly faster RT and MT, achieving significantly greater end-point accuracy and fewer wrong movements than older controls. Older Tai Chi practitioners had significantly faster MT than older controls. Conclusion. Finger-pointing tasks with a choice paradigm became slower and less accurate with age. Positive findings suggest that Tai Chi may slow down the aging effect on eye-hand coordination tasks involving choices that require more cognitive progressing.

  7. $\\chi$EFT studies of few-nucleon systems: a status report

    Energy Technology Data Exchange (ETDEWEB)

    Schiavilla, Rocco [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Old Dominion Univ., Norfolk, VA (United States)


    A status report on $\\chi$EFT studies of few-nucleon electroweak structure and dynamics is provided, including electromagnetic elastic form factors of few-nucleon systems, the $pp$ weak fusion and muon weak captures on deuteron and $^3$He, and a number of parity-violating processes induced by hadronic weak interactions.

  8. Immunosuppressive CD11b+Ly6Chi monocytes in pristane-induced lupus mouse model. (United States)

    Ma, Huijuan; Wan, Suigui; Xia, Chang-Qing


    Myeloid-derived suppressor cells with immunosuppressive functions have been described to be associated with one of the mechanisms by which malignant tumors escape immune surveillance. However, little is known about the role of myeloid-derived suppressor cells in autoimmunity. In the current study, when we attempted to characterize the peritoneal cells in pristane-induced lupus model, as reported previously, we observed that there were markedly increased CD11b(+)Ly6C(hi) monocytes. Surprisingly, this type of monocytes was almost phenotypically identical to the reported monocytic myeloid-derived suppressor cells. Further analysis on how these CD11b(+)Ly6C(hi) cells affected T cell response showed that they strongly suppressed T cell proliferation in vitro in a manner dependent on cell-cell contact, NO, and PGE2. In addition, we found that CD11b(+)Ly6C(hi) monocytes inhibited Th1 differentiation but enhanced development of forkhead box p3(+)CD4(+) regulatory T cells. Consistent with the in vitro experimental results, the in vivo adoptive cell transfer study showed that infusion of pristane-treated syngeneic CD11b(+)Ly6C(hi) monocytes significantly suppressed the production of anti-keyhole limpet hemocyanin antibodies induced by keyhole limpet hemocyanin immunization. In addition, we found that CD11b(+)Ly6C(hi) monocytes were also increased significantly in spleen and peripheral blood and showed immunosuppressive characteristics similar to their peritoneal counterparts. Our findings indicate that CD11b(+)Ly6C(hi) monocytes in a pristane-induced lupus mouse model are monocytic myeloid-derived suppressor cells instead of inflammatory monocytes, as demonstrated previously. To our knowledge, this is the first to describe myeloid-derived suppressor cells in a pristane-induced lupus mouse model, which may lead to a better understanding of the role of CD11b(+)Ly6C(hi) monocytes in this specific pristane-induced lupus model. PMID:26657791

  9. Tai Chi on psychological well-being: systematic review and meta-analysis

    Directory of Open Access Journals (Sweden)

    Scott Tammy


    Full Text Available Abstract Background Physical activity and exercise appear to improve psychological health. However, the quantitative effects of Tai Chi on psychological well-being have rarely been examined. We systematically reviewed the effects of Tai Chi on stress, anxiety, depression and mood disturbance in eastern and western populations. Methods Eight English and 3 Chinese databases were searched through March 2009. Randomized controlled trials, non-randomized controlled studies and observational studies reporting at least 1 psychological health outcome were examined. Data were extracted and verified by 2 reviewers. The randomized trials in each subcategory of health outcomes were meta-analyzed using a random-effects model. The quality of each study was assessed. Results Forty studies totaling 3817 subjects were identified. Approximately 29 psychological measurements were assessed. Twenty-one of 33 randomized and nonrandomized trials reported that 1 hour to 1 year of regular Tai Chi significantly increased psychological well-being including reduction of stress (effect size [ES], 0.66; 95% confidence interval [CI], 0.23 to 1.09, anxiety (ES, 0.66; 95% CI, 0.29 to 1.03, and depression (ES, 0.56; 95% CI, 0.31 to 0.80, and enhanced mood (ES, 0.45; 95% CI, 0.20 to 0.69 in community-dwelling healthy participants and in patients with chronic conditions. Seven observational studies with relatively large sample sizes reinforced the beneficial association between Tai Chi practice and psychological health. Conclusions Tai Chi appears to be associated with improvements in psychological well-being including reduced stress, anxiety, depression and mood disturbance, and increased self-esteem. Definitive conclusions were limited due to variation in designs, comparisons, heterogeneous outcomes and inadequate controls. High-quality, well-controlled, longer randomized trials are needed to better inform clinical decisions.

  10. Transport simulations of ohmic TFTR experiments with profile-consistent microinstability-based models for chi/sub e/ and chi/sub i/

    International Nuclear Information System (INIS)

    Transport simulations of ohmically heated TFTR experiments with recently developed profile-consistent microinstability models for the anomalous thermal diffusivities, chi/sub e/ and chi/sub i/, give good agreement with experimental data. The steady-state temperature profiles and the total energy confinement times, tau/sub e/, were found to agree for each of the ohmic TFTR experiments simulated, including three high radiation cases and two plasmas fueled by pellet injection. Both collisional and collisionless models are tested. The trapped-electron drift wave microinstability model results are consistent with the thermal confinement of large plasma ohmic experiments on TFTR. We also find that transport due to the toroidal ion temperature gradient (eta/sub i/) modes can cause saturation in tau/sub E/ at the highest densities comparable to that observed on TFTR and equivalent to a neoclassical anomaly factor of 3. Predictions based on stabilized eta/sub i/-mode-driven ion transport are found to be in agreement with the enhanced global energy confinement times for pellet-fueled plasmas. 33 refs., 26 figs., 4 tabs

  11. Enhancing the Psychological Well-Being of Elderly Individuals through Tai Chi Exercise: A Latent Growth Curve Analysis. (United States)

    Li, Fuzhong; Duncan, Terry E.; Duncan, Susan C.; McAuley, Edward; Chaumeton, Nigel R.; Harmer, Peter


    Examined whether a Tai Chi exercise program enhanced the psychological well-being of 98 elderly individuals. Analyzed repeated measures data about participants using latent growth curve analysis. Results indicate the beneficial effects of participation in the Tai Chi program. Discusses implications related to the exercise-psychological health…

  12. 改进卡方检验%A Modified Chi-Squared Goodness-of-Fit Test

    Institute of Scientific and Technical Information of China (English)

    戴家佳; 杨爱军


    In goodness-of-fit tests,Pearson's chi-squared test is one of most widely used tools of formal statistical analysis.However,Pearson's chi-squared test depends on the partition of the sample space.Different constructions of the partition of the sample space may lead to different conclusions.Based on an equiprobable partition of sample space,a modified chi-squared test is proposed.A method for constructing the modified chi-squared test is proposed.As an application,the proposed test is used to test whether vectorial data come from an uniformity distribution defined on the hypersphere.Some simulation studies show that the modified chi-squared test against different alternative is robust.

  13. $f_0(500)$, $f_0(980)$ and $a_0(980)$ production in the $\\chi_{c1} \\to \\eta \\pi^+\\pi^-$ reaction

    CERN Document Server

    Liang, Wei-Hong; Oset, E


    We study the $\\chi_{c1} \\to \\eta \\pi^+ \\pi^-$ decay, paying attention to the production of $f_0(500)$, $f_0(980)$ and $a_0(980)$ from the final state interaction of pairs of mesons that can lead to these three mesons in the final state, which is implemented using the chiral unitary approach. Very clean and strong signals are obtained for the $a_0(980)$ excitation in the $\\eta \\pi$ invariant mass distribution and for the $f_0(500)$ in the $\\pi^+ \\pi^-$ mass distribution. A smaller, but also clear signal for the $f_0(980)$ excitation is obtained. The results are contrasted with experimental data and the agreement found is good, providing yet one more test in support of the picture where these resonances are dynamically generated from the meson-meson interaction.

  14. Variation in CHI3LI in relation to type 2 diabetes and related quantitative traits

    DEFF Research Database (Denmark)

    Rathcke, Camilla Noelle; Holmkvist, Johan; Jørgensen, Torben; Borch-Johnsen, Knut; Hansen, Torben; Pedersen, Oluf; Vestergaard, Henrik


    BACKGROUND: CHI3LI encoding the inflammatory glycoprotein YKL-40 is located on chromosome 1q32.1. YKL-40 is involved in inflammatory processes and patients with Type 2 Diabetes (T2D) have elevated circulating YKL-40 levels which correlate with their level of insulin resistance. Interestingly, it...... has been reported that rs10399931 (-329 G/A) of CHI3LI contributes to the inter-individual plasma YKL-40 levels in patients with sarcoidosis, and that rs4950928 (-131 C/G) is a susceptibility polymorphism for asthma and a decline in lung function. We hypothesized that single nucleotide polymorphisms...... 6514 individuals from the Inter99 cohort and 2924 individuals from the outpatient clinic at Steno Diabetes Center. In cas-control studies a total of 2345 T2D patients and 5302 individuals with a normal glucose tolerance test were examined. We found no association between rs10399931 (OR, 0.98 (CI, 0...

  15. Conjectures and experiments concerning the moments of $L(1/2,\\chi_d)$

    CERN Document Server

    Alderson, Matthew W


    We report on some extensive computations and experiments concerning the moments of quadratic Dirichlet $L$-functions at the critical point. We computed the values of $L(1/2,\\chi_d)$ for $- 5\\times 10^{10} < d < 1.3 \\times 10^{10}$ in order to numerically test conjectures concerning the moments $\\sum_{|d|chi_d)^k$. Specifically, we tested the full asymptotics for the moments conjectured by Conrey, Farmer, Keating, Rubinstein, and Snaith, as well as the conjectures of Diaconu, Goldfeld, Hoffstein, and Zhang concerning additional lower terms in the moments. We also describe the algorithms used for this large scale computation.

  16. Multi-Core Emptiness Checking of Timed Büchi Automata using Inclusion Abstraction

    DEFF Research Database (Denmark)

    Laarman, Alfons; Olesen, Mads Chr.; Dalsgaard, Andreas;


    the first parallel LTL model checking algorithm for timed automata. The algorithms are implemented in LTSmin, and experimental evaluations show the effectiveness and scalability of both contributions: subsumption halves the number of states in the real-world FDDI case study, and the multi......This paper contributes to the multi-core model checking of timed automata (TA) with respect to liveness properties, by investigating checking of TA Büchi emptiness under the very coarse inclusion abstraction or zone subsumption, an open problem in this field. We show that in general Büchi emptiness...... is not preserved under this abstraction, but some other structural properties are preserved. Based on those, we propose a variation of the classical nested depth-first search (NDFS) algorithm that exploits subsumption. In addition, we extend the multi-core cndfs algorithm with subsumption, providing...

  17. Polynomial reduction and evaluation of tree- and loop-level CHY amplitudes

    CERN Document Server

    Zlotnikov, Michael


    We develop a polynomial reduction procedure that transforms any gauge fixed CHY amplitude integrand for $n$ scattering particles into a $\\sigma$-moduli multivariate polynomial of what we call the $\\textit{standard form}$. We show that a standard form polynomial must have a specific $\\textit{ladder type}$ monomial structure, which has finite size at any $n$, with highest multivariate degree given by $\\frac{(n-3)(n-4)}{2}$. This set of monomials spans a complete basis for polynomials with rational coefficients in kinematic data on the support of scattering equations. Subsequently, at tree and one-loop level, we employ the global residue theorem to derive a prescription that evaluates any CHY amplitude by means of collecting simple residues at infinity only. The prescription is then applied explicitly to some tree and one-loop amplitude examples.

  18. Influences of Seasoned Equity Offerings on Stock Return of Ho Chi Minh Market

    Directory of Open Access Journals (Sweden)

    Ho Viet Tien


    Full Text Available This paper investigated the impact of seasoned equity offerings (SEO on stock return of listed companies in Ho Chi Minh City market using the method “event study” which has been basically formed by Campbell, Lo, and MacKinlay (1997. The sample includes 332 SEOs from 2007 to 2010. The main findings show evidence that the Ho Chi Minh City market was not efficient in terms of the semi-strong form because the price has increased significantly on the ex-right date, day 0. In an opposite way, the market also reacted significantly negatively from T-4 to T-2. There are some significant impacts of timing on issue methods – equity right issues were in priority for favorable time and issues as “dividend by stocks” were chosen during unfavorable time.

  19. Design, Installation and Performance of the New insulator for NSTX CHI Experiments

    Energy Technology Data Exchange (ETDEWEB)

    Mueller, D; Chrzanowski, J; Gates, D; Menard, J; Raman, R; Jarboe, T R; Nelson, B A; Maqueda, R J; Schaffer, M J


    Coaxial Helicity Injection (CHI), a non-inductive method to initiate plasma and generate toroidal plasma current, is being investigated in the National Spherical Torus Experiment (NSTX). The center stack and outer vacuum vessel are separated by insulating gaps at the top and bottom of the slim central column so that a high voltage (up to 2 kV) can be applied between them from a pulsed power supply or a capacitor bank to initiate an arc discharge. In the presence of a suitable poloidal magnetic field, the discharge is initiated at the lower gap (the injector gap) and because of the strong toroidal field develops a helical structure resulting in substantial toroidal plasma current being driven. In NSTX, up to 390 kA of toroidal current has been generated for an injected current of 25 kA. The early investigations of CHI however frequently developed arcs across the insulator at the top of the machine (the absorber gap), which terminated the desired discharge. This arcing greatly restricted the operational space available for CHI studies. During 2002, the absorber region was modified to suppress these arcs. The new design includes a new ceramic insulator on the high field side of the absorber region with a much longer tracking distance between conducting elements at the different potentials. Furthermore, two new coils were installed near the absorber to provide the ability to minimize the poloidal field connecting the center stack and outer vacuum vessel. During the subsequent experimental campaign, CHI operation was less prone to arcing in the absorber and those arcs that did occur did not terminate the main discharge.)

  20. Frog value chain case study in Ho Chi Minh City Vietnam


    Le, Minh Quoc


    Frog is valuable product in Vietnam but the natural frogs are overexploited thus, the new model to raising frog is desired. Many species of frogs are cultured in Vietnam, especially in Ho Chi Minh City, for trial of the adaptive ability of exotic species in Vietnam condition. Recently, the frogs’ species from Thailand and Taiwan are prepotent and spread out Vietnam. Nowadays, frog culture becomes one of the newest industries in Vietnam. With a short life cycle, frog culture is farming as econ...

  1. Knowledge Organization of Integrated Water Resources Management: A Case of Chi River Basin, Thailand


    Nattapong Kaewboonma; Kulthida Tuamsuk; Wanida Kanarkard


    This study is a part of the research project on the Development of an Ontology-Based Semantic Search for Integrated Water Resources Management of the Chi River Basin (CRB), Thailand. The study aimed at developing the knowledge domain of water resources management for CRB. The research methods included document analysis and qualitative research by adopting Liou (1990)’s knowledge acquisition approach. Fifteen experts including ten experts in the areas of environmental engineerin...

  2. Users' Searching Behaviour in Using Online Databases at Vietnam National University - Ho Chi Minh City


    Hong Sinh, Nguyen; Hong Nhung, Hoang Thi


    Purpose: This paper focuses on identifying the searching behaviors of the users, their difficulties as well as their expectations from library supports while using online databases at the Central Library of Vietnam National University – Ho Chi Minh city. Methods: Usage Reports of six online databases subscribed by the Central Library were analyzed and a survey by emailing users a questionnaire was conducted. Findings: The amount of usage increases yearly, however it is still low in comp...

  3. Formation of macrocyclic lactones in the Paternò–Büchi dimerization reaction


    Manabu Abe; Yoshikazu Hiraga; Junya Arimura; Tsutomu Mizuta


    Furan-2-ylmethyl 2-oxoacetates 1a,b, in which the furan ring and the carbonyl moiety were embedded intramolecularly, were synthesized from commercially available furan-2-ylmethanol and their photochemical reaction (hν > 290 nm) was investigated. Twelve-membered macrocyclic lactones 2a,b with Ci symmetry including two oxetane-rings, which are the Paternò–Büchi dimerization products, were isolated in ca. 20% yield. The intramolecular cyclization products, such as 3-alkox...

  4. Energy and macronutrient intakes in preschool children in urban areas of Ho Chi Minh City, Vietnam


    Sibbritt David W; Dibley Michael J; Huynh Dieu TT; Tran Hanh TM


    Abstract Background An increasing prevalence of overweight and obesity has been documented in preschool children in Ho Chi Minh City (HCMC), Vietnam. However, little is known about what preschool children in HCMC eat or how well their nutrient intake meets nutrient recommendations. This study aims to describe the energy and macronutrient intake and compare these nutrient intakes with the recommendations for Vietnamese children aged four to five years. Methods The data comes from the baseline ...

  5. Implications of a $\\chi(3.86)$ State for Theoretical Models

    CERN Document Server

    Tuan, S F


    Recent preliminary evidence for a $D \\bar{D}$ state $\\chi(3.86)$ raises extremely interesting implications for theoretical models, particularly those currently in vogue, e.g. the flux tube model and a molecular charmonium picture. We examine the experimental consequences as well as the possible unveiling of a strata of C-exotic states in heavy quarkonia systems by future facilities like BES Upgrade/Tau-Charm Factory and CLEO III/B-Factories.

  6. The pragmatic import of pronominal usage in chiShona discourse


    Pedzisai Mashiri; Sinfree Makoni


    This article discusses the pragmatic significance of chiShona pronouns by examining the use of different pronouns: personal, enumerative, and demonstrative, and by demonstrating their address and referential value and social meanings. Two important issues are addressed.  First, we demonstrate that a purely grammatical analysis of pronouns, which emphasise the internal analysis and the anaphoric function of pronouns, fails to capture the complexity of pronominal usage in ordinary conversations...

  7. Chi Square Feature Extraction Based Svms Arabic Language Text Categorization System


    Abdelwadood M.A. MESLEH


    This paper aims to implement a Support Vector Machines (SVMs) based text classification system for Arabic language articles. This classifier uses CHI square method as a feature selection method in the pre-processing step of the Text Classification system design procedure. Comparing to other classification methods, our system shows a high classification effectiveness for Arabic data set in term of F-measure (F=88.11).

  8. The efficacy of Tai Chi Chuan in older adults: a systematic review


    Verhagen, Arianne; Immink, M.; van der Meulen, A; Bierma-zeinstra, Sita


    textabstractOBJECTIVES: The purpose of this study was to assess the effect of Tai Chi Chuan (TCC) on fall prevention, balance and cardiorespiratory functions in the elderly. METHODS: A systematic review was carried out according to the Cochrane standards. A computerized literature search was carried out. Studies were selected when they had an experimental design; the age of the study population was >50; one of the interventions was a form of TCC; and when falls, balance or cardiorespiratory f...

  9. Increased first and second pulse harmonics in Tai Chi Chuan practitioners


    Lu, Wan-An; Chen, Yung-Sheng; Kuo, Cheng-Deng


    Background Tai Chi Chuan (TCC) is known to be a good calisthenics for people. This study examined the relationship between pulse harmonics and autonomic nervous modulation in TCC practitioners. Methods Power spectral measures of right pulse wave and heart rate variability (HRV) measures were compared between TCC practitioners and control subjects. Correlation analyses between pulse harmonics and HRV measures were performed using linear regression analysis. Results At baseline, the total power...

  10. The rate of convergence of some asymptotically chi-square distributed statistics by Stein's method


    Gaunt, Robert E.; Reinert, Gesine


    We build on recent works on Stein's method for functions of multivariate normal random variables to derive bounds for the rate of convergence of some asymptotically chi-square distributed statistics. We obtain some general bounds and establish some simple sufficient conditions for convergence rates of order $n^{-1}$ for smooth test functions. These general bounds are applied to Friedman's statistic for comparing $r$ treatments across $n$ trials and the family of power divergence statistics fo...

  11. Chi-Square Goodness-if-Fit Tests for Randomly Censored Data


    Habib, M. G.; Thomas, D R


    Two Pearson-type goodness-of-fit test statistics for parametric families are considered for randomly right-censored data. Asymptotic distribution theory for the test statistics is based on the result that the product-limit process with MLE for nuisance parameters converges weakly to a Gaussian process. The Chernoff-Lehmann (1954) result extends to a generalized Pearson statistic. A modified Pearson statistic is shown to have a limiting chi-square null distribution.

  12. Evaluating the effects of Tai Chi on physical fitness and mental health of the elderly


    Nguyen, Manh Hung


    The aims of this study are to examine the effects of 24-form Tai Chi exercise in six months on physical fitness, blood pressure and perceived health as well as sleep quality, visual attention, and balance ability of older people living in dwelling community. This study is also aimed to compare differences in physical fitness and subjectively rated health between German and Vietnamese older adults in terms cross-cultural study between Vietnamese and German samples. The subjects were divided...

  13. Changes in heart-rate variability of survivors of nasopharyngeal cancer during Tai Chi Qigong practice


    Fong, Shirley S.M.; Wong, Janet Y. H.; Chung, Louisa M. Y.; Yam, Timothy T.T.; Chung, Joanne W. Y.; Lee, Y.M.; Chow, Lina P. Y.; Luk, W. S.; Ng, Shamay S.M.


    [Purpose] To explore the changes in heart-rate variability (HRV) of survivors of nasopharyngeal cancer (NPC) before, during, and after a Tai Chi (TC) Qigong exercise. [Subjects and Methods] Eleven survivors of NPC participated voluntarily in the study. The heart rate of each participant was measured continuously for 1 minute before the TC Qigong intervention, during the 5-minute TC Qigong intervention, and for 1 minute after the intervention, using a Polar heart-rate monitor. Spectral HRV was...

  14. Chi-square goodness of fit tests for weighted histograms. Review and improvements

    International Nuclear Information System (INIS)

    Weighted histograms are used for the estimation of probability density functions. Computer simulation is the main domain of application of this type of histogram. A review of chi-square goodness of fit tests for weighted histograms is presented in this paper. Improvements are proposed to these tests that have size more close to its nominal value. Numerical examples are presented in this paper for evaluation of tests and to demonstrate various applications of tests

  15. Nonlinear resonances

    CERN Document Server

    Rajasekar, Shanmuganathan


    This introductory text presents the basic aspects and most important features of various types of resonances and anti-resonances in dynamical systems. In particular, for each resonance, it covers the theoretical concepts, illustrates them with case studies, and reviews the available information on mechanisms, characterization, numerical simulations, experimental realizations, possible quantum analogues, applications and significant advances made over the years. Resonances are one of the most fundamental phenomena exhibited by nonlinear systems and refer to specific realizations of maximum response of a system due to the ability of that system to store and transfer energy received from an external forcing source. Resonances are of particular importance in physical, engineering and biological systems - they can prove to be advantageous in many applications, while leading to instability and even disasters in others. The book is self-contained, providing the details of mathematical derivations and techniques invo...

  16. Tai Chi Chuan for Cardiac Rehabilitation in Patients with Coronary Arterial Disease

    Directory of Open Access Journals (Sweden)

    Rosane Maria Nery


    Full Text Available Background: Several studies have shown that Tai Chi Chuan can improve cardiac function in patients with heart disease. Objective: To conduct a systematic review of the literature to assess the effects of Tai Chi Chuan on cardiac rehabilitation for patients with coronary artery disease. Methods: We performed a search for studies published in English, Portuguese and Spanish in the following databases: MEDLINE, EMBASE, LILACS and Cochrane Register of Controlled Trials. Data were extracted in a standardized manner by three independent investigators, who were responsible for assessing the methodological quality of the manuscripts. Results: The initial search found 201 studies that, after review of titles and abstracts, resulted in a selection of 12 manuscripts. They were fully analyzed and of these, nine were excluded. As a final result, three randomized controlled trials remained. The studies analyzed in this systematic review included patients with a confirmed diagnosis of coronary artery disease, all were clinically stable and able to exercise. The three experiments had a control group that practiced structured exercise training or received counseling for exercise. Follow-up ranged from 2 to 12 months. Conclusion: Preliminary evidence suggests that Tai Chi Chuan can be an unconventional form of cardiac rehabilitation, being an adjunctive therapy in the treatment of patients with stable coronary artery disease. However, the methodological quality of the included articles and the small sample sizes clearly indicate that new randomized controlled trials are needed in this regard.

  17. A proposal for a different chi-square function for Poisson distributions

    International Nuclear Information System (INIS)

    We obtain an approximate Gaussian distribution from a Poisson distribution after doing a change of variable. A new chi-square function is obtained which can be used for parameter estimations and goodness-of-fit testing when adjusting curves to histograms. Since, the new distribution is approximately Gaussian we can use it even when the bin contents are small. The corresponding chi-square function can be used for curve fitting. This chi-square function is simple to implement and presents a fast convergence of the parameters to the correct value, especially for the parameters associated with the width of the fitted curve. We present a Monte Carlo comparative study of the fitting method introduced here and two other methods for three types of curves: Gaussian, Breit-Wigner and Moyal, when each bin content obeys a Poisson distribution. It is also shown that the new method and the other two converge to the same result when the number of events increases

  18. Chi-square Fitting When Overall Normalization is a Fit Parameter

    CERN Document Server

    Roe, Byron


    The problem of fitting an event distribution when the total expected number of events is not fixed, keeps appearing in experimental studies. In a chi-square fit, if overall normalization is one of the parameters parameters to be fit, the fitted curve may be seriously low with respect to the data points, sometimes below all of them. This problem and the solution for it are well known within the statistics community, but, apparently, not well known among some of the physics community. The purpose of this note is didactic, to explain the cause of the problem and the easy and elegant solution. The solution is to use maximum likelihood instead of chi-square. The essential difference between the two approaches is that maximum likelihood uses the normalization of each term in the chi-square assuming it is a normal distribution, 1/sqrt(2 pi sigma-square). In addition, the normalization is applied to the theoretical expectation not to the data. In the present note we illustrate what goes wrong and how maximum likeliho...

  19. Effects of an Exercise Program with Tai Chi in Older Women

    Directory of Open Access Journals (Sweden)

    Mónica Andrea Silva-Zemanate


    Full Text Available Objective: This research was aimed at determining the effects of an exercise program with the art of Tai Chi in older women. Material and Methods: A quasi-experimental study with a longitudinal cutting was conducted; the study population was a group of elderly in the city of Popayan. It consisted of three phases: in the first one, an initial evaluation of physical capacity (walking, balance, daily basic activities was applied, afterward, the scale of Yesavage for signs of depression, and finally the Folstien Mini Mental Test to assess cognitive functions. In the second phase, a program of Tai Chi exercises in one weekly session for a twelve weeks period was implemented. In the third phase, the evaluation of the results of the program through participant re-evaluating was carried out. Results: The functional capacity improved in all the tested aspects, the difference in walking speed and the static and dynamic balance were statistically significant; in the same way, the cognitive ability improved in all the tested items, statistical significance was found in aspects such as memory, attention, calculation and language. All participants achieved full functionality of the daily basic activities. Conclusions: The application of a Tai Chi technique provides significant benefits in the balance and the cognitive ability of the elderly, leading to a breakthrough in their independent behavior and improving their functional capacity, so it could be recommended as an alternative technique of physiotherapeutic intervention in neuronal rehabilitation.

  20. Non-inductive plasma start-up on NSTX and projections to NSTX-U using transient CHI

    International Nuclear Information System (INIS)

    Transient coaxial helicity injection (CHI) in the National Spherical Torus Experiment (NSTX) has generated toroidal current on closed-flux surfaces without the use of the central solenoid. When induction from the central solenoid was added, CHI initiated discharges in NSTX achieved 1 MA of plasma current using 65% of the solenoid flux of standard induction-only discharges. In addition, the CHI-initiated discharges have lower density and a low normalized internal plasma inductance of 0.35, as desired for achieving advanced scenarios. Transient CHI will be used for non-inductive plasma start-up on the upgrade to NSTX (NSTX-U) that is now under construction. It will have numerous improvements that significantly enhance CHI start-up capability. The TSC code is now starting to be used for full discharge simulation, which includes solenoid-less start-up with CHI and subsequent non-inductive current ramp-up using neutral beams. These results suggest that the increased injector flux capability of NSTX-U should allow CHI start-up at more than the 400 kA level and that the new tangential neutral beam system on NSTX-U should be able to ramp the current to the 1 MA levels. (paper)

  1. A randomized controlled trial of Tai chi for balance, sleep quality and cognitive performance in elderly Vietnamese

    Directory of Open Access Journals (Sweden)

    Nguyen MH


    Full Text Available Manh Hung Nguyen, Andreas KruseInstitute of Gerontology, Heidelberg University, Heidelberg, GermanyObjective: To evaluate the effects of Tai chi exercise on balance, sleep quality, and cognitive performance in community-dwelling elderly in Vinh city, Vietnam.Design: A randomized controlled trial.Participants: One hundred two subjects were recruited.Intervention: Subjects were divided randomly into two groups. The Tai chi group was assigned 6 months' Tai chi training. The control group was instructed to maintain their routine daily activities.Outcome measures: The Falls Efficacy Scale (FES, Pittsburgh Sleep Quality Index (PSQI, and Trail Making Test (TMT were used as primary outcome measures.Results: Participants in the Tai chi group reported significant improvement in TMT (part A (F [1, 71] = 78.37, P < 0.001 and in TMT (part B, (F [1, 71] = 175.00, P < 0.001 in comparison with the control group. Tai chi participants also reported better scores in FES (F [1, 71] = 96.90, P < 0.001 and in PSQI (F [1,71] = 43.69, P = 0.001 than the control group.Conclusion: Tai chi is beneficial to improve balance, sleep quality, and cognitive performance of the elderly.Keywords: Tai chi, sleep, balance 

  2. A small RNA controls expression of the chitinase ChiA in Listeria monocytogenes.

    Directory of Open Access Journals (Sweden)

    Jesper S Nielsen

    Full Text Available In recent years, more than 60 small RNAs (sRNAs have been identified in the gram-positive human pathogen Listeria monocytogenes, but their putative roles and mechanisms of action remain largely unknown. The sRNA LhrA was recently shown to be a post-transcriptional regulator of a single gene, lmo0850, which encodes a small protein of unknown function. LhrA controls the translation and degradation of the lmo0850 mRNA by an antisense mechanism, and it depends on the RNA chaperone Hfq for efficient binding to its target. In the present study, we sought to gain more insight into the functional role of LhrA in L. monocytogenes. To this end, we determined the effects of LhrA on global-wide gene expression. We observed that nearly 300 genes in L. monocytogenes are either positively or negatively affected by LhrA. Among these genes, we identified lmo0302 and chiA as direct targets of LhrA, thus establishing LhrA as a multiple target regulator. Lmo0302 encodes a hypothetical protein with no known function, whereas chiA encodes one of two chitinases present in L. monocytogenes. We show here that LhrA acts as a post-transcriptional regulator of lmo0302 and chiA by interfering with ribosome recruitment, and we provide evidence that both LhrA and Hfq act to down-regulate the expression of lmo0302 and chiA. Furthermore, in vitro binding experiments show that Hfq stimulates the base pairing of LhrA to chiA mRNA. Finally, we demonstrate that LhrA has a negative effect on the chitinolytic activity of L. monocytogenes. In marked contrast to this, we found that Hfq has a stimulating effect on the chitinolytic activity, suggesting that Hfq plays multiple roles in the complex regulatory pathways controlling the chitinases of L. monocytogenes.

  3. Validation of Chinese Version of Polycystic Ovary Syndrome Health-Related Quality of Life Questionnaire (Chi-PCOSQ.

    Directory of Open Access Journals (Sweden)

    Chung-Ying Lin

    Full Text Available To evaluate the responsiveness, longitudinal validity, and measurement invariance of the Chinese version of the Polycystic Ovary Syndrome Health-related Quality of Life Questionnaire (Chi-PCOSQ.This prospective study was conducted in a medical center in southern Taiwan. 102 women aged 18-45 years and diagnosed with PCOS were enrolled. Objective indicators for clinical changes of PCOS included assessing the 2-hour glucose and insulin levels before and after treatment. The responsiveness of Chi-PCOSQ and WHOQOL-BREF was analyzed using paired t-tests and the standard response mean. Confirmatory factor analysis was performed to assess the measurement invariance of Chi-PCOSQ.With improved 2-hour glucose and insulin levels, we also found significantly increased Chi-PCOSQ total and individual domain scores (total score: t (49 = 5.20; p < 0.001, domain scores: t (49 = 2.72 to 3.87; p < 0.01, except for hair growth. Half of the domains scores (3 of 6 and the total score of Chi-PCOSQ had a medium responsiveness, but WHOQOL-BREF was not sufficiently responsive to clinical changes of PCOS. Improved PCOS-specific health-related quality of life (HRQoL, as indicated by Chi-PCOSQ scores, was significantly associated with improved 2-hour glucose and insulin levels. All indices of the data-model fit of the Chi-PCOSQ structure were satisfactory, except for the slightly high standardized root mean square residual values (0.087 to 0.088. The measurement invariance of Chi-PCOSQ was supported across time.Chi-PCOSQ is sufficiently sensitive in detecting clinical changes and its measurement structure is suitable for Chinese women with PCOS. It is thus a promising tool for assessing the HRQoL of ethnic Chinese women with PCOS.

  4. The chitinase C gene PsChiC from Pseudomonas sp. and its synergistic effects on larvicidal activity

    Directory of Open Access Journals (Sweden)

    Wanfang Zhong


    Full Text Available Pseudomonas sp. strain TXG6-1, a chitinolytic gram-negative bacterium, was isolated from a vegetable field in Taixing city, Jiangsu Province, China. In this study, a Pseudomonas chitinase C gene (PsChiC was isolated from the chromosomal DNA of this bacterium using a pair of specific primers. The PsChiC gene consisted of an open reading frame of 1443 nucleotides and encoded 480 amino acid residues with a calculated molecular mass of 51.66 kDa. The deduced PsChiC amino acid sequence lacked a signal sequence and consisted of a glycoside hydrolase family 18 catalytic domain responsible for chitinase activity, a fibronectin type III-like domain (FLD and a C-terminal chitin-binding domain (ChBD. The amino acid sequence of PsChiCshowed high sequence homology (> 95% with chitinase C from Serratia marcescens. SDS-PAGE showed that the molecular mass of chitinase PsChiC was 52 kDa. Chitinase assays revealed that the chitobiosidase and endochitinase activities of PsChiCwere 51.6- and 84.1-fold higher than those of pET30a, respectively. Although PsChiC showed little insecticidal activity towards Spodoptera litura larvae, an insecticidal assay indicated that PsChiC increased the insecticidal toxicity of SpltNPV by 1.78-fold at 192 h and hastened death. These results suggest that PsChiC from Pseudomonas sp. could be useful in improving the pathogenicity of baculoviruses.

  5. $J-\\psi$ Production via $\\chi_c$ Decays in 920 GeV pA Interactions

    CERN Document Server

    Abt, I; Adams, M; Albrecht, H; Amaral, V S; Amorim, A; Aplin, S J; Arefev, A; Arino, I; Atiya, M; Aushev, V M; Bagaturia, Yu S; Baghshetsyan, R; Balagura, V; Bargiotti, M; Barsuk, S; Barsukova, O; Bassetti, V; Bastos, J; Bauer, C; Bauer, T S; Beck, M; Belkov, A A; Belotelov, I; Belyaev, I; Berkhan, K; Bertin, A; Bobchenko, B M; Böcker, M; Bogatyrev, A; Böhm, G; Borgmeier, C; Brauer, M; Broemmelsiek, D R; Bruinsma, M; Bruschi, M; Buchholz, P; Büchler, M C; Buran, T; Capéans-Garrido, M; Capponi, M; Carvalho, J; Chamanina, J; Chen, B X; Chistov, R; Chmeissani, M; Christensen, A; Conde, P; Cruse, C; Dam, M; Danielsen, K M; Danilov, M; De Castro, S; Deckers, H; Dehmelt, K; Deppe, H; Dolgoshein, B A; Dong, X; Dreis, H B; Dressel, M; Dujmic, D; Eckmann, R; Egorytchev, V; Ehret, K; Eiges, V; Eisele, Franz; Emeliyanov, D; Erhan, S; Essenov, S; Fabbri, Franco Luigi; Faccioli, P; Fallot-Burghardt, W; Feuerstack-Raible, M; Flammer, J; Fleckenstein, H; Fominykh, B A; Fourletov, S; Fuljahn, T; Funcke, M; Galli, D; García, A; Garrido, L; Gascón, D; Gellrich, A; Gerndt, K E K; Giacobbe, B; Glass, J; Glebe, T; Goloubkov, D; Golutvin, A; Golutvin, I A; Gorbunov, I V; Gorisek, A; Gouchtchine, O; Goulart, D C; Gradl, S; Gradl, W; Guilitsky, Yu; Hamacher, T; Hansen, J D; Harr, R; Hast, C; Hausmann, S A; Hernández, J M; Hildebrandt, M; Hölscher, A; Höpfner, K; Hofmann, W; Hohlmann, M; Hott, T; Hulsbergen, W D; Husemann, U; Igonkina, O; Ispirian, M K; Issever, I; Itterbeck, H; Ivarsson, J; Jagla, T; Jia, Y; Jiang, C; Kaoukher, A; Kapitza, H; Karabekyan, S; Karchin, P; Karpenko, N; Ke, Z; Keller, S; Khasanov, F M; Kim, H; Kiryushin, Yu T; Kisel, I V; Klefenz, F; Knöpfle, K T; Kochetkov, V; Kolanoski, H; Korpar, S; Krauss, C; Kreuzer, P K; Krizan, P; Krücker, D; Kvaratskheliia, T; Lange, A; Lanyov, A V; Lau, K; Leffers, G; Legrand, I; Lewendel, B; Liu Ya Qian; Lohse, T; Loke, R; Lomonosov, B N; Lüdemann, J; Männer, R; Mankel, R; Marconi, U; Masciocchi, S; Massa, I; Matchikhilian, I; Medin, G; Medinnis, M; Mevius, M; Michetti, A; Mikhailov, Yu; Miquel, R; Mizuk, R; Mohapatra, A; Moshkin, A; Moshous, B; Muresan, R; Nam, S; Negodaev, M A; Negri, I; Nörenberg, M; Nowak, S; Núñez-Pardo de Vera, M T; Oest, T; Oliveira, A; Ouchrif, M; Ould-Saada, F; Padilla, C; Pakhlov, P; Pavlenko, Yu N; Peralta, D; Pernack, R; Perschke, T; Pestotnik, R; Petersen, B AA; Piccinini, M; Pleier, M A; Poli, M; Popov, V; Pose, A V; Pose, D; Pugatch, V; Pylypchenko, Y; Pyrlik, J; Ramachandran, S; Ratnikov, F; Reeves, K; Ressing, D; Riechmann, K; Rieling, J; Rietz, M; Riu, I; Robmann, P; Rosen, J; Rothe, C; Rückstuhl, W; Rusinov, V Yu; Rybnikov, V; Ryzhikov, D; Saadi-Ludemann, F; Samtleben, D; Sánchez, F; Sang, M; Saveliev, V; Sbrizzi, A; Schaller, S C; Schlein, Peter E; Schmelling, M; Schmidt, B; Schmidt, S; Schmidt-Parzefall, W; Schreiner, A T; Schröder, H; Schultz, H D; Schwanke, U; Schwartz, A J; Schwarz, A S; Schwenninger, B; Schwingenheuer, B; Schwitters, Roy F; Sciacca, F; Semenov, S; Semprini-Cesari, N; Sexauer, E; Seybold, L; Shiu, J; Shuvalov, S M; Siccama, I; Skrk, D; Sozuer, L; Soldatov, A; Solunin, S A; Somov, A; Somov, S V; Souvorov, V; Spahn, M; Spengler, J; Spighi, R; Spiridonov, A A; Spratte, S; Stanovnik, A; Staric, M; Saint-Denis, R; Stegmann, C; Steinbeck, S; Steinkamp, O; Stieler, D; Straumann, U; Sun, F; Sun, H; Symalla, M; Takach, S F; Tesch, N; Thurn, H; Tikhomirov, I; Titov, M L; Trunk, U; Truöl, P; Tsakov, I; Uwer, U; Vagnoni, V M; Van Eldik, C; Van Staa, R; Vasilev, Yu; Villa, M; Vitale, A; Vukotic, I; Wagner, G; Wagner, W; Wahlberg, H; Walenta, Albert H; Walter, M; Walter, T; Wang, J J; Wang, Y M; Wanke, R; Wegener, D; Werthenbach, U; Weyers, P J; Wolters, H; Wurth, R; Würtz, A; Xella, S M; Yang, J; Zaitsev, Yu; Zavertyaev, M V; Zech, G; Zeuner, T; Zhelezov, A; Zheng, Z; Zhu, Z; Zimmermann, R; Zivko, T; Zoccoli, A; Zweizig, J


    Using data collected by the HERA-B experiment, we have measured the fraction of J\\psi's produced via radiative chi_c decays in interactions of 920 GeV protons with carbon and titanium targets. We obtained R_{\\chi_c} = 0.32 \\pm 0.06_{stat} \\pm 0.04_{sys} for the fraction of J\\psi from chi_c decays averaged over proton-carbon and proton-titanium collisions. This result is in agreement with previous measurements and is compared with theoretical predictions.

  6. Categorization of Mechanics Problems by Students in Large Introductory Physics Courses: A Comparison with the Chi, Feltovich, and Glaser Study

    CERN Document Server

    Mason, Andrew


    With inspiration from the classic study by Chi, Feltovich, and Glaser [1], we asked introductory physics students in three introductory physics classes to categorize mechanics problems based upon similarity of solutions. To evaluate the effect of problem context on students' ability to categorize, two sets of problems were developed for categorization. Some problems in one of the problem sets that students were asked to categorize included those available from the prior study by Chi et al. Our findings, which contrast from those of Chi et al., suggest that there is a much wider distribution of expertise among introductory students.

  7. The Influence of Tai Chi Exercise on Proprioception in Patients with Knee Osteoarthritis: Results from a Pilot Randomized Controlled Trial


    Schmid, Anna; McAlindon, Timothy; Schmid, Christopher H.; Wang, Chenchen


    Purpose: Previous long-term observational studies found that Tai Chi practitioners had better knee- joint proprioceptive acuity versus controls in an older population. We evaluated the effects of Tai Chi for knee- joint proprioception in knee osteoarthritis (OA) in a randomized controlled trial. Methods: We randomized 40 eligible individuals (age > 55, BMI ≤ 40 kg/m2 with knee pain on most days of the previous month and tibiofemoral OA (K/L grade ≥2) to Tai Chi (10 modified forms from clas...

  8. S-matrix poles for chaotic quantum systems as eigenvalues of complex symmetric random matrices from isolated to overlapping resonances

    CERN Document Server

    Sommers, H J; Titov, M L; Fyodorov, Yan V.


    We study complex eigenvalues of large $N\\times N$ symmetric random matrices of the form ${\\cal H}=\\hat{H}-i\\hat{\\Gamma}$, where both $\\hat{H}$ and to describe the universal statistics of S-matrix poles (resonances) in the complex energy plane. We derive the ensuing distribution of the resonance widths which generalizes the well-known $\\chi^2$ distribution to the case of overlapping resonances. We also consider a different class of "almost real" matrices when

  9. Preheating and locked inflation: an analytic approach towards parametric resonance

    CERN Document Server

    Wang, Lingfei


    We take an analytic approach towards the framework of parametric resonance and apply it on preheating and locked inflation. A two-scalar toy model is analytically solved for the \\lambda\\phi^2\\chi^2 coupling for the homogenous modes. The effects of dynamic universe background and backreaction are taken into account. We show the average effect of parametric resonance to be that \\chi's amplitude doubles for each cycle of \\phi. Our framework partly solves the preheating scenario, showing two distinct stages of preheating and making the parameters of preheating analytically calculable. It is demonstrated for slowroll inflation models, preheating is terminated, if by backreaction, typically in the 5th e-fold. Under our framework, a possible inhomogeneity amplification effect is also found during preheating, which both may pose strong constraints on some inflationary models and may amplify tiny existing inhomogeneities to the desired scale. For demonstration, we show it rules out the backreaction end of preheating o...

  10. Consumer Health Informatics in the Context of Engaged Citizens and eHealth Services - A New CHI Meta Model. (United States)

    Wiesner, Martin; Griebel, Lena; Becker, Kurt; Pobiruchin, Monika


    Consumer Health Informatics (CHI) is a relatively new and interdisciplinary field in Medical Informatics. It focuses on consumer- rather than professional-centered services. However, the definitions and understanding of a) what is a "consumer"? or b) what is health technology in the context of CHI? and c) what factors and actors influence the usage of eHealth services? vary widely. The CHI special interest group (SIG) - associated with the German Association for Medical Informatics, Biometry and Epidemiology - conducted two workshops in 2015 to improve the common understanding on these topics. The workshop outcomes, the derived CHI-specific meta model and examples how to apply this model are presented in this paper. The model supports the definition of multi-actor contexts, as it not solely reflects the conventional patient-physician relationship but also allows for the description of second health market providers. PMID:27332268

  11. Exact Chi-Square and Fisher's Exact Probability Test for 3 by 2 Cross-Classification Tables. (United States)

    Berry, Kenneth J.; Mielke, Paul W., Jr.


    Subroutines to calculate exact chi square and Fisher's exact probability tests are presented for 3 by 2 cross-classification tables. A nondirectional probability value for each test is computed recursively. (Author/GDC)

  12. Ly6Chi Monocytes Provide a Link between Antibiotic-Induced Changes in Gut Microbiota and Adult Hippocampal Neurogenesis

    Directory of Open Access Journals (Sweden)

    Luisa Möhle


    Full Text Available Antibiotics, though remarkably useful, can also cause certain adverse effects. We detected that treatment of adult mice with antibiotics decreases hippocampal neurogenesis and memory retention. Reconstitution with normal gut flora (SPF did not completely reverse the deficits in neurogenesis unless the mice also had access to a running wheel or received probiotics. In parallel to an increase in neurogenesis and memory retention, both SPF-reconstituted mice that ran and mice supplemented with probiotics exhibited higher numbers of Ly6Chi monocytes in the brain than antibiotic-treated mice. Elimination of Ly6Chi monocytes by antibody depletion or the use of knockout mice resulted in decreased neurogenesis, whereas adoptive transfer of Ly6Chi monocytes rescued neurogenesis after antibiotic treatment. We propose that the rescue of neurogenesis and behavior deficits in antibiotic-treated mice by exercise and probiotics is partially mediated by Ly6Chi monocytes.

  13. The concentration of manufacturing industries in Vietnam with particular reference to Ho Chi Minh City and its surrounding.


    Ercole, Roberto


    The research aims to invesDgate the economic agglomeration and concentration of manufacturing industries in Vietnam with particular reference to Ho Chi Minh and its surrounding provinces using a-spatial and spatial statistics.

  14. LUX Constraints on Magnetic Dark Matter in the $S\\bar{E} \\chi$y Model with(out) Naturality

    CERN Document Server

    Frandsen, Mads T; Shoemaker, Ian M; Svendsen, Ole


    We study phenomenological constraints in a simple $S\\bar{E} \\chi$y extension of the Standard Model (SM) with a 125 GeV Higgs, a vector-like heavy electron $(E)$, a complex scalar electron $(S)$ and a standard model singlet Dirac fermion $(\\chi)$. The interactions among the dark matter candidate $\\chi$ and the standard model particles occur via loop-induced processes involving the Yukawa interaction $S\\bar{E} \\chi$y. The model is an explicit perturbative realization of so-called magnetic dark matter. The field content allows for a cancelation of quadratic divergences in the scalar masses at one-loop, a phenomenon which we refer to as perturbative naturality. The basic model is constrained dominantly by direct detection experiments and its parameter space can be nearly entirely covered by up-coming ton-scale direct detection experiments. We conclude this work by discussing different variations of the model.

  15. Specific depletion of Ly6C(hi inflammatory monocytes prevents immunopathology in experimental cerebral malaria.

    Directory of Open Access Journals (Sweden)

    Beatrix Schumak

    Full Text Available Plasmodium berghei ANKA (PbA infection of C57BL/6 mice leads to experimental cerebral malaria (ECM that is commonly associated with serious T cell mediated damage. In other parasitic infection models, inflammatory monocytes have been shown to regulate Th1 responses but their role in ECM remains poorly defined, whereas neutrophils are reported to contribute to ECM immune pathology. Making use of the recent development of specific monoclonal antibodies (mAb, we depleted in vivo Ly6C(hi inflammatory monocytes (by anti-CCR2, Ly6G+ neutrophils (by anti-Ly6G or both cell types (by anti-Gr1 during infection with Ovalbumin-transgenic PbA parasites (PbTg. Notably, the application of anti-Gr1 or anti-CCR2 but not anti-Ly6G antibodies into PbTg-infected mice prevented ECM development. In addition, depletion of Ly6C(hi inflammatory monocytes but not neutrophils led to decreased IFNγ levels and IFNγ+CD8+ T effector cells in the brain. Importantly, anti-CCR2 mAb injection did not prevent the generation of PbTg-specific T cell responses in the periphery, whereas anti-Gr1 mAb injection strongly diminished T cell frequencies and CTL responses. In conclusion, the specific depletion of Ly6C(hi inflammatory monocytes attenuated brain inflammation and immune cell recruitment to the CNS, which prevented ECM following Plasmodium infection, pointing out a substantial role of Ly6C+ monocytes in ECM inflammatory processes.

  16. Chinese-chi and Kundalini yoga Meditations Effects on the Autonomic Nervous System: Comparative Study

    Directory of Open Access Journals (Sweden)

    Anilesh Dey


    Full Text Available Cardiac disease is one of the major causes for death all over the world. Heart rate variability (HRV is a significant parameter that used in assessing Autonomous Nervous System (ANS activity. Generally, the 2D Poincare′ plot and 3D Poincaré plot of the HRV signals reflect the effect of different external stimuli on the ANS. Meditation is one of such external stimulus, which has different techniques with different types of effects on the ANS. Chinese Chi-meditation and Kundalini yoga are two different effective meditation techniques. The current work is interested with the analysis of the HRV signals under the effect of these two based on meditation techniques. The 2D and 3D Poincare′ plots are generally plotted by fitting respectively an ellipse/ellipsoid to the dense region of the constructed Poincare′ plot of HRV signals. However, the 2D and 3D Poincaré plots sometimes fail to describe the proper behaviour of the system. Thus in this study, a three-dimensional frequency-delay plot is proposed to properly distinguish these two famous meditation techniques by analyzing their effects on ANS. This proposed 3D frequency-delay plot is applied on HRV signals of eight persons practicing same Chi-meditation and four other persons practising same Kundalini yoga. To substantiate the result for larger sample of data, statistical Student t-test is applied, which shows a satisfactory result in this context. The experimental results established that the Chi-meditation has large impact on the HRVcompared to the Kundalini yoga.

  17. The effects of Tai-Chi-Soft-Ball training on physical functional health of Chinese older adult


    Lam, Michael Huen Sum; Cheung, Siu Yin; Chow, Bik Chu


    This study was designed to investigate a 10-week training effects of Tai-Chi-Soft-Ball (TCSB), a novel Chinese exercise which combined the elements of Tai Chi and badminton, on physical functional health of private institutionalized older adults. Thirty-four participants were recruited in the training group with 60 minutes per session and two sessions per week TCSB training. Thirty-two participants were recruited simultaneously in the control group (no training). The measurements included the...

  18. Analysis of static and dynamic balance in healthy elderly practitioners of Tai Chi Chuan versus ballroom dancing

    Directory of Open Access Journals (Sweden)

    Miguel Antônio Rahal


    Full Text Available OBJECTIVE: To determine whether Tai Chi Chuan or ballroom dancing promotes better performance with respect to postural balance, gait, and postural transfer among elderly people. METHODS: We evaluated 76 elderly individuals who were divided into two groups: the Tai Chi Chuan Group and the Dance Group. The subjects were tested using the NeuroCom Balance Master¯ force platform system with the following protocols: static balance tests (the Modified Clinical Tests of Sensory Interaction on Balance and Unilateral Stance and dynamic balance tests (the Walk Across Test and Sit-to-stand Transfer Test. RESULTS: In the Modified Clinical Test of Sensory Interaction on Balance, the Tai Chi Chuan Group presented a lower sway velocity on a firm surface with open and closed eyes, as well as on a foam surface with closed eyes. In the Modified Clinical Test of Sensory Interaction on Unilateral Stance, the Tai Chi Chuan Group presented a lower sway velocity with open eyes, whereas the Dance Group presented a lower sway velocity with closed eyes. In the Walk Across Test, the Tai Chi Chuan Group presented faster walking speeds than those of the Dance Group. In the Sit-to-stand Transfer Test, the Tai Chi Chuan Group presented shorter transfer times from the sitting to the standing position, with less sway in the final standing position. CONCLUSION: The elderly individuals who practiced Tai Chi Chuan had better bilateral balance with eyes open on both types of surfaces compared with the Dance Group. The Dance Group had better unilateral postural balance with eyes closed. The Tai Chi Chuan Group had faster walking speeds, shorter transfer times, and better postural balance in the final standing position during the Sit-to-stand Test.

  19. A Study on the Biodiversity of Natural Food Production to Support Community Upstream of Chi Basin, Thailand


    Pramuk Srichaiwong; Luckhana Kwewjai; Patarapong Kroeksakul


    This biodiversity study of natural food production to supporting the communities upstream of Chi River Basin aims at collecting the name and species of natural food plants in the forest around the upstream areas of Chi River Basin. This is a phenomenal study of species and potential benefits of forest food. Qualitative methodology was mainly used to collect data; the study relied on the knowledge of the local people had to recall the local data, which significantly focused on the species of n...

  20. Validation of Chinese Version of Polycystic Ovary Syndrome Health-Related Quality of Life Questionnaire (Chi-PCOSQ) (United States)

    Lin, Chung-Ying; Ou, Huang-tz; Wu, Meng-Hsing; Chen, Pei-Chi


    Objectives To evaluate the responsiveness, longitudinal validity, and measurement invariance of the Chinese version of the Polycystic Ovary Syndrome Health-related Quality of Life Questionnaire (Chi-PCOSQ). Research Design and Method This prospective study was conducted in a medical center in southern Taiwan. 102 women aged 18–45 years and diagnosed with PCOS were enrolled. Objective indicators for clinical changes of PCOS included assessing the 2-hour glucose and insulin levels before and after treatment. The responsiveness of Chi-PCOSQ and WHOQOL-BREF was analyzed using paired t-tests and the standard response mean. Confirmatory factor analysis was performed to assess the measurement invariance of Chi-PCOSQ. Results With improved 2-hour glucose and insulin levels, we also found significantly increased Chi-PCOSQ total and individual domain scores (total score: t (49) = 5.20; p PCOS. Improved PCOS-specific health-related quality of life (HRQoL), as indicated by Chi-PCOSQ scores, was significantly associated with improved 2-hour glucose and insulin levels. All indices of the data-model fit of the Chi-PCOSQ structure were satisfactory, except for the slightly high standardized root mean square residual values (0.087 to 0.088). The measurement invariance of Chi-PCOSQ was supported across time. Conclusion Chi-PCOSQ is sufficiently sensitive in detecting clinical changes and its measurement structure is suitable for Chinese women with PCOS. It is thus a promising tool for assessing the HRQoL of ethnic Chinese women with PCOS. PMID:27124836

  1. To explore the prevention and treatment of Tai Chi Chuan Exercise on hypertension based on the theory of chaos

    Directory of Open Access Journals (Sweden)

    Xiang-Lin CHI


    Full Text Available In this paper,review and analysis of  the fluctuations of blood pressure and pathogenesis of hypertension were presented a review and analysed based on chaos theory. At the same time, we interpreted philosophically the special concept of Tai Chi Chuan Exercise. Furthermore, the possible mechanisms of prevention and treatment of Tai Chi Chuan on hypertension was reviewed on the basis of clinical research literature.

  2. Reconstructing Chi-squared Intra-table Distances in the Analysis of a Set of Contingency Tables


    Zárraga Castro, María Amaya; Goitisolo Lezama, Beatriz


    To study similarities among the set of rows -and columns- of a contingency table, Correspondence Analysis uses chi-squared distances between row profiles -and column profiles- of that table. This article presents a factor analysis for the study of a set of contingency tables in which, unlike more classical methods such as the analysis of juxtaposition and Intra Analysis; the existing relationships within each table -defined across the chi-squared distances-, are not altered.

  3. Healing and the mind/body arts: massage, acupuncture, yoga, t'ai chi, and Feldenkrais. (United States)

    Wanning, T


    1. The health practitioner may encounter clients who are faced with problems that do not seem to respond to traditional health care. 2. One way that some choose to confront these systemic complaints is to employ some of the health traditions of other cultures and to view the body and mind as a balanced whole. 3. Massage, acupuncture and acupressure, t'ai chi, and Feldenkrais focus on the mind/body connection to facilitate healing through relaxation, pressure points, and movement. PMID:8338610

  4. Relations for Einstein-Yang-Mills amplitudes from the CHY representation

    CERN Document Server

    de la Cruz, Leonardo; Weinzierl, Stefan


    We show that a recently discovered relation, which expresses tree-level single trace Einstein-Yang-Mills amplitudes with one graviton and $(n-1)$ gauge bosons as a linear combination of pure Yang-Mills tree amplitudes with $n$ gauge bosons, can be derived from the CHY representation. In addition we show that there is a generalisation, which expresses tree-level single trace Einstein-Yang-Mills amplitudes with $r$ gravitons and $(n-r)$ gauge bosons as a linear combination of pure Yang-Mills tree amplitudes with $n$ gauge bosons. We present a general formula for this case.

  5. Production of chi mesons in 225 GeV/c π-Be interactions

    International Nuclear Information System (INIS)

    Gamma rays associated with psi mesons have been studied in 225 GeV/c π-Be interactions. The psi-γ mass spectrum shows an excess of 47 +- 11 events above background centered at 3.531 GeV/c2 with an rms width of 22.4 MeV. Attributing this excess of events to the decay chi → psi γ implies that 38 +- 9 % of all psi mesons are produced by this mechanism. The experimental setup and results are detailed

  6. The Role of M\\"obius Constants and Scattering Functions in CHY Scalar Amplitudes


    Lam, C. S.; Yao, York-Peng


    The integrations leading to the Cachazo-He-Yuan (CHY) double-color $n$-point massless scalar amplitude are carried out one integral at a time. M\\"obius invariance dictates the final amplitude to be independent of the three M\\"obius constants $\\sigma_r, \\sigma_s, \\sigma_t$, but their choice affects integrations and the intermediate results. The effect of the M\\"obius constants, the two colors, and the scattering functions on each integration is investigated. A systematic way to carry out the $...

  7. Complementary and alternative treatment for neck pain: chiropractic, acupuncture, TENS, massage, yoga, Tai Chi, and Feldenkrais. (United States)

    Plastaras, Christopher T; Schran, Seth; Kim, Natasha; Sorosky, Susan; Darr, Deborah; Chen, Mary Susan; Lansky, Rebecca


    Of the multitude of treatment options for the management of neck pain, no obvious single treatment modality has been shown to be most efficacious. As such, the clinician should consider alternative treatment modalities if a modality is engaging, available, financially feasible, potentially efficacious, and is low risk for the patient. As evidence-based medicine for neck pain develops, the clinician is faced with the challenge of which treatments to encourage patients to pursue. Treatment modalities explored in this article, including chiropractic, acupuncture, TENS, massage, yoga, Tai Chi, and Feldenkrais, represent reasonable complementary and alternative medicine methods for patients with neck pain. PMID:21824591

  8. Formation of macrocyclic lactones in the Paternò–Büchi dimerization reaction

    Directory of Open Access Journals (Sweden)

    Manabu Abe


    Full Text Available Furan-2-ylmethyl 2-oxoacetates 1a,b, in which the furan ring and the carbonyl moiety were embedded intramolecularly, were synthesized from commercially available furan-2-ylmethanol and their photochemical reaction (hν > 290 nm was investigated. Twelve-membered macrocyclic lactones 2a,b with Ci symmetry including two oxetane-rings, which are the Paternò–Büchi dimerization products, were isolated in ca. 20% yield. The intramolecular cyclization products, such as 3-alkoxyoxetane and 2,7-dioxabicyclo[2.2.1]hept-5-ene derivatives, were not detected in the photolysate.

  9. The Effect of Tai Chi on Knee Osteoarthritis Pain in Cognitively Impaired Elders: Pilot Study


    Tsai, Pao-Feng; Beck, Cornelia; Chang, Jason Y.; Hagen, Jody; Yong-Fang, Kuo; Roberson, Paula K.; Rosengren, Karl; Beuscher, Linda; Doan, Cathy; Anand, K. J. S.


    This article reports a pilot study of the effect of tai chi (TC), a pharmacological adjunct and mild aerobic exercise, on osteoarthritic knee pain in elders with cognitive impairment (CI). The TC program included a warm-up, 12-form Sun-style TC, and a cool-down period, for a total of 20-40 minutes per session, twice a week for 15 weeks. The results showed no significant differences in knee pain after the TC intervention in 7 elders with CI. However, more minutes of TC attendance were related ...

  10. Research on psychoneuroimmunology: tai chi as a stress management approach for individuals with HIV disease. (United States)

    Robins, Jo Lynne W; McCain, Nancy L; Gray, D Patricia; Elswick, R K; Walter, Jeanne M; McDade, Elizabeth


    Psychoneuroimmunology is a framework for mind-body practice and research that combines cutting-edge scientific exploration with holistic philosophy to appreciate and understand stress responses. The rapidly growing research literature provides a foundation for building an integrative stress management model with the potential to positively influence the stress-disease relationship and, ultimately, health outcomes. This article introduces a novel tai chi intervention and provides quantitative and qualitative data from a randomized clinical trial indicating its effects on psychosocial variables in individuals living with various stages of HIV disease. PMID:16455435

  11. GraphChi-DB: Simple Design for a Scalable Graph Database System -- on Just a PC


    Kyrola, Aapo; Guestrin, Carlos


    We propose a new data structure, Parallel Adjacency Lists (PAL), for efficiently managing graphs with billions of edges on disk. The PAL structure is based on the graph storage model of GraphChi (Kyrola et. al., OSDI 2012), but we extend it to enable online database features such as queries and fast insertions. In addition, we extend the model with edge and vertex attributes. Compared to previous data structures, PAL can store graphs more compactly while allowing fast access to both the incom...

  12. Breastfeeding among Vietnamese women in Ho Chi Minh City: Attitudes and confidence


    Mogensen, Hanna; Westin, Frida


    Breastfeeding has several advantages for both mother and child. A woman’s attitude to breastfeeding is a good predictor for infant feeding method and her confidence in breastfeeding has an impact on her breastfeeding duration. Aim:The aim of the study was to assess the attitude to and confidence in breastfeeding among Vietnamese women in Ho Chi Minh City. The aim was also to investigate if the type of family, nuclear and extended, influences the Vietnamese women’s attitude to and confidence i...


    Directory of Open Access Journals (Sweden)

    Pao-Hung Chung


    Full Text Available The aim of this study was to determine whether performing Tai Chi Chuan on a customized vibration platform could enhance balance control and lower extremity muscle power more efficiently than Tai Chi Chuan alone in an untrained young population. Forty-eight healthy young adults were randomly assigned to the following three groups: a Tai Chi Chuan combined with vibration training group (TCV, a Tai Chi Chuan group (TCC or a control group. The TCV group underwent 30 minutes of a reformed Tai Chi Chuan program on a customized vibration platform (32 Hz, 1 mm three times a week for eight weeks, whereas the TCC group was trained without vibration stimuli. A force platform was used to measure the moving area of a static single leg stance and the heights of two consecutive countermovement jumps. The activation of the knee extensor and flexor was also measured synchronously by surface electromyography in all tests. The results showed that the moving area in the TCV group was significantly decreased by 15.3%. The second jump height in the TCV group was significantly increased by 8.14%, and the activation of the knee extensor/flexor was significantly decreased in the first jump. In conclusion, Tai Chi Chuan combined with vibration training can more efficiently improve balance control, and the positive training effect on the lower extremity muscle power induced by vibration stimuli still remains significant because there is no cross-interaction between the two different types of training methods.

  14. Proton magnetic resonance spectroscopy and perfusion magnetic resonance imaging in the evaluation of musculoskeletal tumors

    International Nuclear Information System (INIS)

    Objective: To assess the role of proton magnetic resonance spectroscopy and dynamic contrast-enhanced magnetic resonance imaging in the differentiation between malignant and benign musculoskeletal tumors. Materials And Methods: Fifty-five patients with musculoskeletal tumors (27 malignant and 28 benign) were studied. The examinations were performed in a 1.5 T magnetic resonance scanner with standard protocol, and single voxel proton magnetic resonance spectroscopy with 135 msec echo time. The dynamic contrast study was performed using T1-weighted gradient-echo sequence after intravenous gadolinium injection. Time signal intensity curves and slope values were calculated. The statistical analysis was performed with the Levene's test, followed by a Student's t-test, besides the Pearson's chi-squared and Fischer's exact tests. Results: Proton magnetic resonance spectroscopy sensitivity, specificity and accuracy were, respectively, 87.5%, 92.3% and 90.9% (p < 0.0001). Statistically significant difference was observed in the slope (%/min) between benign (mean, 27.5%/min) and malignant (mean, 110.9%/min) lesions (p < 0.0001). Conclusion: The time-intensity curve and slope values using dynamic-enhanced perfusion magnetic resonance imaging in association with the presence of choline peak demonstrated by single voxel magnetic resonance spectroscopy study are useful in the differentiation between malignant and benign musculoskeletal tumors. (author)

  15. Tai Chi Chuan and Qigong in scientific research: present and future. [Tai Chi Chuan y Qigong en el ámbito científico: presente y futuro].

    Directory of Open Access Journals (Sweden)

    Pedro Jesús Jiménez-Martín


    Full Text Available Introduction Asian natural health practices are increasingly present in the physical and sporting habits of the Western population. In particular, the Tai Chi Chuan (TCC and Qigong (QG have become an everyday activity that can be performed both in parks and sports facilities in Western cities. The impact of these activities on a global level is very difficult to measure, however, given the lack of statistics on the number of practitioners, associations and existing schools. The degree of acceptance that these disciplines have achieved can be measured by the number of informative publications about them. According to the study by Perez and Gutierrez (2008, 215 (62.3 % of the 345 papers published between 1960 and 2006 on Chinese martial arts were on QG, and 115 (33.3 % papers were on TCC, implying that both practices represented 95.6 percent of these publications. More importantly, during the 1990-1999 and 2000-2006 time periods, TCC came to occupy the top of monographs published, ahead of the rest of all forms of Chinese, Japanese and Korean martial arts; during the last time period, QG represented the third most published. According to the authors, the rise of this activity can be attributed to motivation changes for sports. Health, personal development, education, and socialization, as opposed to competition, have become increasingly important goals, which both TCC and QG fit perfectly.

  16. Constraining the mass and width of the $N^*(1685)$ resonance

    CERN Document Server

    Mart, T


    We have examined the existence of the $N^*(1685)$ resonance, which is recently listed by the Particle Data Group as a one-star nucleon resonance, by using a covariant isobar model for kaon photoproduction and assuming that the resonance has $J^p=1/2^+$, in accordance with our previous finding. After the inclusion of this resonance the changes in the total $\\chi^2$ show two clear minima at $M_{N^*}=1650$ and 1696 MeV, which correspond to two different resonance states. The former corresponds to the narrow nucleon resonance found in our previous investigation, whereas the latter corresponds to a new resonance found as we increase the resonance width. From the latter we derive the mass and width relation of the $N^*(1685)$ resonance. We observe that the properties of both the $N^*(1685)$ and $N^*(1710)P_{11}$ resonances are strongly correlated. Although the best fit of the present work yields $M_{N^*}=1696$ MeV and $\\Gamma_{N^*}=76$ MeV, the apparently small $N^*(1710)P_{11}$ coupling constant to the $K^+\\Lambda...

  17. The Sequencing and Analysis of the Genome of ChiVMV Wenchang Isolate(ChiVMV-WC)%辣椒脉斑驳病毒文昌分离物基因组测序及分析

    Institute of Scientific and Technical Information of China (English)

    龚殿; 王健华; 吴育鹏; 张雨良; 王洪星; 孙玉娟; 刘志昕


    辣椒脉斑驳病毒(Chilli veinal mottle virus,ChiVMV)近年来严重危害海南黄灯笼辣椒的产量,开展针对该病毒的研究以求达到对其有效防控迫在眉睫。本研究分7段克隆了ChiVMV文昌分离物(ChiVMV Wenchang isolate,ChiVMV-WC)的基因组。分段克隆的测序结果通过拼接,共获得ChiVMV-WC基因组9717个核苷酸(nt)序列(GenBank登录号:GQ981316)。在核苷酸序列的第164位~第9270位存在一个大的开放阅读框(ORF),编码一个多聚蛋白(分子量为350.44kD)。近年来被证实的马铃薯Y病毒科的一个新的ORF(pretty interesting potyviridae ORF,PIPO)存在于ChiVMV-WC基因组核苷酸序列的第2892位~第3110位,编码一个由72个氨基酸聚合而成的多肽(分子量为8.26kD)。ChiVMV-WC与ChiVMV其它分离物的基因组核苷酸序列比较发现该病毒存在着较高的变异率。本研究通过与同属内病毒的同源性分析以及系统进化树分析,确定了ChiVMV-WC在生物进化史上的地位。%Chilli veinal mottle virus,ChiVMV had recently brought catastrophic damages to the production of Capsicum chinense Jacp.'Yellow Lantern' in Hainan which lead to the development of the research project on this virus in order to find effective and efficient ways to prevent and control it.In the present study,we cloned the genome of ChiVMV Wenchang isolate(ChiVMV-WC) by dividing it into 7 segments.Then by assembling the results together,we obtained the genome of ChiVMV-WC of 9 717 nucleotide(GenBank Accession No.GQ9813-16).A large open reading frame(ORF) was located from the 164th to the 9 270th of the nucleotide sequence which encoding a polypeptide of 350.44 kD.Pretty Interesting Potyviridae ORF(PIPO) which was proved to be a completely novel ORF exsiting in Potyviridae was located form the 2 892th to the 3 110th of the nucleotide sequence,and encoding a 72 amino acids polypeptide of 8.26 kD.By comparing with other

  18. 辣椒脉斑驳病毒文昌分离物基因组测序及分析%The Sequencing and Analysis of the Genome of ChiVMV Wenchang Isolate (ChiVMV-WC)

    Institute of Scientific and Technical Information of China (English)

    龚殿; 王健华; 吴育鹏; 张雨良; 王洪星; 孙玉娟; 刘志昕


    辣椒脉斑驳病毒(Chilli veinal mottle virus,ChiVMV)近年来严重危害海南黄灯笼辣椒的产量,开展针对该病毒的研究以求达到对其有效防控迫在眉睫.本研究分7段克隆了ChiVMV文昌分离物(ChiVMV Wenchang isolate,ChiVMV-WC)的基因组.分段克隆的测序结果通过拼接,共获得ChiVMV-WC基因组9 717个核苷酸(nt)序列(GenBank登录号:GQ981316).在核苷酸序列的第164位~第9 270位存在一个大的开放阅读框(ORF),编码一个多聚蛋白(分子量为350.44 kD).近年来被证实的马铃薯Y病毒科的一个新的ORF (pretty interesting potyviridae ORF,PIPO)存在于ChiVMV-WC基因组核苷酸序列的第2 892位~第3 110位,编码一个由72个氨基酸聚合而成的多肽(分子量为8.26 kD).ChiVMV-WC与ChiVMV其它分离物的基因组核苷酸序列比较发现该病毒存在着较高的变异率.本研究通过与同属内病毒的同源性分析以及系统进化树分析,确定了ChiVMV-WC在生物进化史上的地位.%Chilli veinal mottle virus, ChiVMV had recently brought catastrophic damages to the production of Capsicum chinense Jacp. 'Yellow Lantern' in Hainan which lead to the development of the research project on this virus in order to find effective and efficient ways to prevent and control it. In the present study, we cloned the genome of ChiVMV Wenchang isolate (ChiVMV-WC) by dividing it into 7 segments. Then by assembling the results together, we obtained the genome of ChiVMV-WC of 9 717 nucleotide (GenBank Accession No. GQ9813-16). A large open reading frame (ORF) was located from the 164th to the 9 270th of the nucleotide sequence which encoding a polypeptide of 350.44 kD. Pretty Interesting Potyviridae ORF (PIPO) which was proved to be a com pletely novel ORF exsiting in Potyviridae was located form the 2 892th to the 3 110th of the nucleotide sequence, and encoding a 72 amino acids polypeptide of 8.26 kD. By comparing with other isolates of ChiVMV, we found that this isolate has

  19. Neuroaesthetic Resonance

    DEFF Research Database (Denmark)

    Brooks, Anthony Lewis


    the unencumbered motion-to-computer-generated activities - ‘Music Making’, ‘Painting’, ‘Robotic’ and ‘Video Game’ control. A focus of this position paper is to highlight how Aesthetic Resonance, in this context, relates to the growing body of research on Neuroaesthetics to evolve Neuroaesthetic Resonance.......Neuroaesthetic Resonance emerged from a mature body of patient- centered gesture-control research investigating non-formal rehabilitation via ICT-enhanced-Art to question ‘Aesthetic Resonance’. Motivating participation, ludic engagement, and augmenting physical motion in non-formal (fun) treatment...... tailored channeling of sensory stimulus aligned as ‘art-making’ and ‘game playing’ core experiences. Thus, affecting brain plasticity and human motoric-performance via the adaptability (plasticity) of digital medias result in closure of the human afferent-efferent neural feedback loop closure through...

  20. Orientation of cohesive end site cos determines the active orientation of chi sequence in stimulating recA . recBC-mediated recombination in phage lambda lytic infections.


    Kobayashi, I.; Murialdo, H; Crasemann, J M; Stahl, M. M.; Stahl, F. W.


    Sequence chi, 5'G-C-T-G-G-T-G-G, locally enhances homologous recombination by recA and recBC proteins of Escherichia coli. Previous work showed that, in phage lambda, chi is more active in one orientation (leftward) than in the other (rightward). Inverting cos, the sequence for the mature DNA ends of lambda, reverses this orientation dependence: the rightward chi becomes fully active, and the leftward chi becomes relatively inactive. We surmise that chi action in phage lambda is coupled with ...

  1. Performance test of RM CLEAN and its evaluation with chi-square value (United States)

    Miyashita, Yoshimitsu; Ideguchi, Shinsuke; Takahashi, Keitaro


    RM CLEAN is a standard method to reconstruct the distribution of cosmic magnetic fields and polarized sources along the line of sight (LOS) from the observed polarization spectrum. This method is similar to the CLEAN algorithm for aperture synthesis of radio telescope images but it is rather unclear in what cases RM CLEAN works well. In this paper, we evaluate the performance of RM CLEAN by simulating spectro-polarimetric observations of two compact sources located in the same LOS, varying the relative initial polarization angle and Faraday depth systematically. In particular, we focus on whether the two polarized sources can be resolved in the Faraday depth space and how well the source parameters can be estimated. We confirm the previous studies that two sources cannot be resolved when they are closely located in the Faraday depth space for specific values of the relative initial polarization angle. Further, we calculate the chi-square value for the fit between the mock polarization spectrum data and the one from RM CLEAN. We find that the chi-square value is not always significantly large even when RM CLEAN gives wrong results.

  2. Ho Chi Minh City adaptation to increasing risk of coastal and fluvial floods (United States)

    Scussolini, Paolo; Lasage, Ralph


    Coastal megacities in southeast Asia are a hotspot of vulnerability to floods. In such contexts, the combination of fast socio-economic development and of climate change impacts on precipitation and sea level generates concerns about the flood damage to people and assets. This work focuses on Ho Chi Minh City, Vietnam, for which we estimate the present and future direct risk from river and coastal floods. A model cascade is used that comprises the Saigon river basin and the urban network, plus the land-use-dependent damaging process. Changes in discharge for five return periods are simulated, enabling the probabilistic calculation of the expected annual economic damage to assets, for differnt scenarios of global emissions, local socio-economic growth, and land subsidence, up to year 2100. The implementation of a range of adaptation strategies is simulated, including building dykes, elevating, creating reservoirs, managing water and sediment upstream, flood-proofing, halting groundwater abstraction. Results are presented on 1) the relative weight of each future driver in determining the flood risk of Ho Chi Minh, and 2) the efficiency and feasibility of each adaptation strategy.

  3. Sümeyra Tosun: Psi Chi/APA Edwin B. Newman Graduate Research Award. (United States)


    The Edwin B. Newman Graduate Research Award is given jointly by Psi Chi and APA. The award was established to recognize young researchers at the beginning of their professional lives and to commemorate both the 50th anniversary of Psi Chi and the 100th anniversary of psychology as a science (dating from the founding of Wundt's laboratory). The 2014 recipient is Sümeyra Tosun. Tosun was chosen for "an outstanding research paper that examines the cognitive repercussions of obligatory versus optional marking of evidentiality, the linguistic coding of the source of information. In English, evidentiality is conveyed in the lexicon through the use of adverbs. In Turkish, evidentiality is coded in the grammar. In two experiments, it was found that English speakers were equally good at remembering and monitoring the source of firsthand information and the source of non-firsthand information. Turkish speakers were worse at remembering and monitoring non-firsthand information than firsthand information and were worse than English speakers at remembering and monitoring non-firsthand information." Tosun's award citation, biography, and a selected bibliography are presented here. PMID:25486159

  4. Search for Surface Magnetic Fields in Mira Stars. First Detection in chi Cyg

    CERN Document Server

    Lèbre, A; Fabas, N; Gillet, D; Herpin, F; Konstantinova-Antova, R; Petit, P


    In order to complete the knowledge of the magnetic field and of its influence during the transition from Asymptotic Giant Branch to Planetary Nebulae stages, we have undertaken a search for magnetic fields at the surface of Mira stars. We used spectropolarimetric observations, collected with the Narval instrument at TBL, in order to detect - with Least Squares Deconvolution method - a Zeeman signature in the visible part of the spectrum. We present the first spectropolarimetric observations of the S-type Mira star chi Cyg, performed around its maximum light. We have detected a polarimetric signal in the Stokes V spectra and we have established its Zeeman origin. We claim that it is likely to be related to a weak magnetic field present at the photospheric level and in the lower part of the stellar atmosphere. We have estimated the strength of its longitudinal component to about 2-3 Gauss. This result favors a 1/r law for the variation of the magnetic field strength across the circumstellar envelope of chi Cyg....

  5. Globe Event | Lecture by Hervé Dessimoz and Thomas Büchi | 14 May

    CERN Multimedia

    Globe Info


    At the summit of Sustainable Development, by Hervé Dessimoz and Thomas Büchi.   Globe de la science et de l'innovation Route de Meyrin, 1211 Genève Tuesday 14 May 2013 at 8:30 p.m. The lecture will be in French Refuge du Goûter. Hervé Dessimoz and Thomas Büchi have been committed to sustainable development since the 2000s. They created the Palais de l’Équilibre at Expo.02. They designed an exhibition in conjunction with the Cité de la Science et de l’Industrie (Paris) to educate visitors about sustainable development. The pavilion was donated to CERN by the Swiss Confederation and rebuilt on the CERN site in 2004. It is now known as the Globe of Science and Innovation. The Refuge du Goûter, on the slopes of Mont Blanc, is the culmination of their research into sustainable development, with the aim of demonstrating that if we can construct a building at 3835 m which is a...

  6. Performance test of RM CLEAN and its evaluation with chi-square value (United States)

    Miyashita, Yoshimitsu; Ideguchi, Shinsuke; Takahashi, Keitaro


    RM CLEAN is a standard method to reconstruct the distribution of cosmic magnetic fields and polarized sources along the line of sight (LOS) from the observed polarization spectrum. This method is similar to the CLEAN algorithm for aperture synthesis of radio telescope images but it is rather unclear in what cases RM CLEAN works well. In this paper, we evaluate the performance of RM CLEAN by simulating spectro-polarimetric observations of two compact sources located in the same LOS, varying the relative initial polarization angle and Faraday depth systematically. In particular, we focus on whether the two polarized sources can be resolved in the Faraday depth space and how well the source parameters can be estimated. We confirm the previous studies that two sources cannot be resolved when they are closely located in the Faraday depth space for specific values of the relative initial polarization angle. Further, we calculate the chi-square value for the fit between the mock polarization spectrum data and the one from RM CLEAN. We find that the chi-square value is not always significantly large even when RM CLEAN gives wrong results.

  7. The Effect of Tai Chi Chuan on Obstacle Crossing Strategy in Older Adults. (United States)

    Chang, Yao-Ting; Huang, Chen-Fu; Chang, Jia-Hao


    The purpose of this study was to determine the effect of Tai Chi Chuan on the strategies of obstacle-crossing behavior in older adults aged over 65 years. Fifteen Tai Chi group (TCG) participants were compared with 15 general group (GG) participants. Kinematic parameters (by Vicon motion analysis system) and ground reaction forces (by Kistler force plates) were synchronously recorded. A two-way mixed-design ANOVA (α = 0.05) was used to test the effects of the group and the obstacle height. The TCG performed significantly faster stride velocities, longer stride lengths, and shorter stride times than GG while crossing the obstacles. TCG could also produce significantly larger forward ground reaction forces to propel the body and were able to make a significantly greater flexion angle of the hip of the leading leg compared with the GG. It was concluded that the TCG adopted a different strategy with GG to cross the obstacles and completed the crossing behavior more effectively. PMID:26114218

  8. Precipitation of sigma and chi phases in δ-ferrite of Type 316FR weld metals

    International Nuclear Information System (INIS)

    The decomposition behavior and kinetics of δ-ferrite are examined using aging treatments between 873 and 1073 K for Type 316FR stainless steel weld metals with different solidification modes (316FR AF, 316FR FA). The dominant precipitates are sigma, chi, and secondary austenite nucleated at δ-ferrite/austenite interfaces or in the interior of the ferrite grains. These precipitates consume all the ferrite during isothermal aging in both 316FR AF and FA weld metals. Differences in the precipitation behavior (precipitation initiation time and precipitation speed) between weld metals can be explained by i) the degree of Cr and Mo microsegregation within δ-ferrite or austenite near ferrite and ii) the nucleation sites induced due to the solidification mode (AF or FA), such as the ferrite amount. For both weld materials, a Johnson–Mehl-type equation can express the precipitation behavior of the sigma + chi phases and quantitatively predict the behavior at the service-exposure temperatures of a fast breed reactor. - Highlights: • Precipitation of σ and χ phase in Type 316FR welds (two solidification modes) • Different precipitation behaviors: precipitation initiation time and growth speed • Johnson-Mehl–type equation is the most applicable to the precipitation behaviors • Precipitation behaviors are predicted under service conditions of FBRs

  9. Use of the Chi-square Test to Determine Significance of Cumulative Antibiogram Data

    Directory of Open Access Journals (Sweden)

    Rocco J. Perla


    Full Text Available An important function of a hospital’s Infectious Disease and Pharmacy programs is to review and compare the most recent antibiogram with that of the previous year to determine if significant changes in antibiotic susceptibility results are noted and to communicate this information and its consequences to the medical staff. However, there are currently no formal analytical (decision-making models in use to determine if the rate of resistance to an antibiotic from one year to the next has significantly changed more or less than one would expect due to sampling error and test reliability. The purpose of this article, therefore, is to demonstrate the utility of using a well-established and simple nonparametric statistical technique (chi-square for analyzing annual variations in cumulative antibiogram data and to determine whether such variations are significantly different from chance and to what to degree. The chi-square model outlined here is a simple, practical, quick, low burden and easy to understand and execute approach that greatly improves the analysis of antibiogram data and decision-making by practitioners. More work and research is needed to develop additional inferential statistical methods and models that can be applied to antibiogram data.

  10. Measurement of the production cross section ratio $\\sigma(\\chi_{b2}(1\\mathrm{P}))/ \\sigma(\\chi_{b1}(1\\mathrm{P}))$ in pp collisions at $\\sqrt{s}$ = 8 TeV

    CERN Document Server

    Khachatryan, Vardan; Tumasyan, Armen; Adam, Wolfgang; Bergauer, Thomas; Dragicevic, Marko; Erö, Janos; Fabjan, Christian; Friedl, Markus; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Hartl, Christian; Hörmann, Natascha; Hrubec, Josef; Jeitler, Manfred; Kiesenhofer, Wolfgang; Knünz, Valentin; Krammer, Manfred; Krätschmer, Ilse; Liko, Dietrich; Mikulec, Ivan; Rabady, Dinyar; Rahbaran, Babak; Rohringer, Herbert; Schöfbeck, Robert; Strauss, Josef; Taurok, Anton; Treberer-Treberspurg, Wolfgang; Waltenberger, Wolfgang; Wulz, Claudia-Elisabeth; Mossolov, Vladimir; Shumeiko, Nikolai; Suarez Gonzalez, Juan; Alderweireldt, Sara; Bansal, Monika; Bansal, Sunil; Cornelis, Tom; De Wolf, Eddi A; Janssen, Xavier; Knutsson, Albert; Luyckx, Sten; Ochesanu, Silvia; Roland, Benoit; Rougny, Romain; Van De Klundert, Merijn; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Van Spilbeeck, Alex; Blekman, Freya; Blyweert, Stijn; D'Hondt, Jorgen; Daci, Nadir; Heracleous, Natalie; Keaveney, James; Lowette, Steven; Maes, Michael; Olbrechts, Annik; Python, Quentin; Strom, Derek; Tavernier, Stefaan; Van Doninck, Walter; Van Mulders, Petra; Van Onsem, Gerrit Patrick; Villella, Ilaria; Caillol, Cécile; Clerbaux, Barbara; De Lentdecker, Gilles; Dobur, Didar; Favart, Laurent; Gay, Arnaud; Grebenyuk, Anastasia; Léonard, Alexandre; Mohammadi, Abdollah; Perniè, Luca; Reis, Thomas; Seva, Tomislav; Thomas, Laurent; Vander Velde, Catherine; Vanlaer, Pascal; Wang, Jian; Adler, Volker; Beernaert, Kelly; Benucci, Leonardo; Cimmino, Anna; Costantini, Silvia; Crucy, Shannon; Dildick, Sven; Fagot, Alexis; Garcia, Guillaume; Mccartin, Joseph; Ocampo Rios, Alberto Andres; Ryckbosch, Dirk; Salva Diblen, Sinem; Sigamani, Michael; Strobbe, Nadja; Thyssen, Filip; Tytgat, Michael; Yazgan, Efe; Zaganidis, Nicolas; Basegmez, Suzan; Beluffi, Camille; Bruno, Giacomo; Castello, Roberto; Caudron, Adrien; Ceard, Ludivine; Da Silveira, Gustavo Gil; Delaere, Christophe; Du Pree, Tristan; Favart, Denis; Forthomme, Laurent; Giammanco, Andrea; Hollar, Jonathan; Jez, Pavel; Komm, Matthias; Lemaitre, Vincent; Nuttens, Claude; Pagano, Davide; Perrini, Lucia; Pin, Arnaud; Piotrzkowski, Krzysztof; Popov, Andrey; Quertenmont, Loic; Selvaggi, Michele; Vidal Marono, Miguel; Vizan Garcia, Jesus Manuel; Beliy, Nikita; Caebergs, Thierry; Daubie, Evelyne; Hammad, Gregory Habib; Aldá Júnior, Walter Luiz; Alves, Gilvan; Brito, Lucas; Correa Martins Junior, Marcos; Dos Reis Martins, Thiago; Mora Herrera, Clemencia; Pol, Maria Elena; Carvalho, Wagner; Chinellato, Jose; Custódio, Analu; Da Costa, Eliza Melo; De Jesus Damiao, Dilson; De Oliveira Martins, Carley; Fonseca De Souza, Sandro; Malbouisson, Helena; Matos Figueiredo, Diego; Mundim, Luiz; Nogima, Helio; Prado Da Silva, Wanda Lucia; Santaolalla, Javier; Santoro, Alberto; Sznajder, Andre; Tonelli Manganote, Edmilson José; Vilela Pereira, Antonio; Bernardes, Cesar Augusto; Dogra, Sunil; Tomei, Thiago; De Moraes Gregores, Eduardo; Mercadante, Pedro G; Novaes, Sergio F; Padula, Sandra; Aleksandrov, Aleksandar; Genchev, Vladimir; Iaydjiev, Plamen; Marinov, Andrey; Piperov, Stefan; Rodozov, Mircho; Stoykova, Stefka; Sultanov, Georgi; Tcholakov, Vanio; Vutova, Mariana; Dimitrov, Anton; Glushkov, Ivan; Hadjiiska, Roumyana; Kozhuharov, Venelin; Litov, Leander; Pavlov, Borislav; Petkov, Peicho; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Chen, Mingshui; Du, Ran; Jiang, Chun-Hua; Liang, Song; Plestina, Roko; Tao, Junquan; Wang, Xianyou; Wang, Zheng; Asawatangtrakuldee, Chayanit; Ban, Yong; Guo, Yifei; Li, Qiang; Li, Wenbo; Liu, Shuai; Mao, Yajun; Qian, Si-Jin; Wang, Dayong; Zhang, Linlin; Zou, Wei; Avila, Carlos; Chaparro Sierra, Luisa Fernanda; Florez, Carlos; Gomez, Juan Pablo; Gomez Moreno, Bernardo; Sanabria, Juan Carlos; Godinovic, Nikola; Lelas, Damir; Polic, Dunja; Puljak, Ivica; Antunovic, Zeljko; Kovac, Marko; Brigljevic, Vuko; Kadija, Kreso; Luetic, Jelena; Mekterovic, Darko; Sudic, Lucija; Attikis, Alexandros; Mavromanolakis, Georgios; Mousa, Jehad; Nicolaou, Charalambos; Ptochos, Fotios; Razis, Panos A; Bodlak, Martin; Finger, Miroslav; Finger Jr, Michael; Assran, Yasser; Ellithi Kamel, Ali; Mahmoud, Mohammed; Radi, Amr; Kadastik, Mario; Murumaa, Marion; Raidal, Martti; Tiko, Andres; Eerola, Paula; Fedi, Giacomo; Voutilainen, Mikko; Härkönen, Jaakko; Karimäki, Veikko; Kinnunen, Ritva; Kortelainen, Matti J; Lampén, Tapio; Lassila-Perini, Kati; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Mäenpää, Teppo; Peltola, Timo; Tuominen, Eija; Tuominiemi, Jorma; Tuovinen, Esa; Wendland, Lauri; Tuuva, Tuure; Besancon, Marc; Couderc, Fabrice; Dejardin, Marc; Denegri, Daniel; Fabbro, Bernard; Faure, Jean-Louis; Favaro, Carlotta; Ferri, Federico; Ganjour, Serguei; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Locci, Elizabeth; Malcles, Julie; Rander, John; Rosowsky, André; Titov, Maksym; Baffioni, Stephanie; Beaudette, Florian; Busson, Philippe; Charlot, Claude; Dahms, Torsten; Dalchenko, Mykhailo; Dobrzynski, Ludwik; Filipovic, Nicolas; Florent, Alice; Granier de Cassagnac, Raphael; Mastrolorenzo, Luca; Miné, Philippe; Mironov, Camelia; Naranjo, Ivo Nicolas; Nguyen, Matthew; Ochando, Christophe; Paganini, Pascal; Regnard, Simon; Salerno, Roberto; Sauvan, Jean-Baptiste; Sirois, Yves; Veelken, Christian; Yilmaz, Yetkin; Zabi, Alexandre; Agram, Jean-Laurent; Andrea, Jeremy; Aubin, Alexandre; Bloch, Daniel; Brom, Jean-Marie; Chabert, Eric Christian; Collard, Caroline; Conte, Eric; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Goetzmann, Christophe; Le Bihan, Anne-Catherine; Van Hove, Pierre; Gadrat, Sébastien; Beauceron, Stephanie; Beaupere, Nicolas; Boudoul, Gaelle; Bouvier, Elvire; Brochet, Sébastien; Carrillo Montoya, Camilo Andres; Chasserat, Julien; Chierici, Roberto; Contardo, Didier; Depasse, Pierre; El Mamouni, Houmani; Fan, Jiawei; Fay, Jean; Gascon, Susan; Gouzevitch, Maxime; Ille, Bernard; Kurca, Tibor; Lethuillier, Morgan; Mirabito, Laurent; Perries, Stephane; Ruiz Alvarez, José David; Sabes, David; Sgandurra, Louis; Sordini, Viola; Vander Donckt, Muriel; Verdier, Patrice; Viret, Sébastien; Xiao, Hong; Tsamalaidze, Zviad; Autermann, Christian; Beranek, Sarah; Bontenackels, Michael; Edelhoff, Matthias; Feld, Lutz; Hindrichs, Otto; Klein, Katja; Ostapchuk, Andrey; Perieanu, Adrian; Raupach, Frank; Sammet, Jan; Schael, Stefan; Weber, Hendrik; Wittmer, Bruno; Zhukov, Valery; Ata, Metin; Dietz-Laursonn, Erik; Duchardt, Deborah; Erdmann, Martin; Fischer, Robert; Güth, Andreas; Hebbeker, Thomas; Heidemann, Carsten; Hoepfner, Kerstin; Klingebiel, Dennis; Knutzen, Simon; Kreuzer, Peter; Merschmeyer, Markus; Meyer, Arnd; Millet, Philipp; Olschewski, Mark; Padeken, Klaas; Papacz, Paul; Reithler, Hans; Schmitz, Stefan Antonius; Sonnenschein, Lars; Teyssier, Daniel; Thüer, Sebastian; Weber, Martin; Cherepanov, Vladimir; Erdogan, Yusuf; Flügge, Günter; Geenen, Heiko; Geisler, Matthias; Haj Ahmad, Wael; Heister, Arno; Hoehle, Felix; Kargoll, Bastian; Kress, Thomas; Kuessel, Yvonne; Lingemann, Joschka; Nowack, Andreas; Nugent, Ian Michael; Perchalla, Lars; Pooth, Oliver; Stahl, Achim; Asin, Ivan; Bartosik, Nazar; Behr, Joerg; Behrenhoff, Wolf; Behrens, Ulf; Bell, Alan James; Bergholz, Matthias; Bethani, Agni; Borras, Kerstin; Burgmeier, Armin; Cakir, Altan; Calligaris, Luigi; Campbell, Alan; Choudhury, Somnath; Costanza, Francesco; Diez Pardos, Carmen; Dooling, Samantha; Dorland, Tyler; Eckerlin, Guenter; Eckstein, Doris; Eichhorn, Thomas; Flucke, Gero; Garay Garcia, Jasone; Geiser, Achim; Gunnellini, Paolo; Hauk, Johannes; Hempel, Maria; Horton, Dean; Jung, Hannes; Kalogeropoulos, Alexis; Kasemann, Matthias; Katsas, Panagiotis; Kieseler, Jan; Kleinwort, Claus; Krücker, Dirk; Lange, Wolfgang; Leonard, Jessica; Lipka, Katerina; Lobanov, Artur; Lohmann, Wolfgang; Lutz, Benjamin; Mankel, Rainer; Marfin, Ihar; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Mittag, Gregor; Mnich, Joachim; Mussgiller, Andreas; Naumann-Emme, Sebastian; Nayak, Aruna; Novgorodova, Olga; Nowak, Friederike; Ntomari, Eleni; Perrey, Hanno; Pitzl, Daniel; Placakyte, Ringaile; Raspereza, Alexei; Ribeiro Cipriano, Pedro M; Ron, Elias; Sahin, Mehmet Özgür; Salfeld-Nebgen, Jakob; Saxena, Pooja; Schmidt, Ringo; Schoerner-Sadenius, Thomas; Schröder, Matthias; Seitz, Claudia; Spannagel, Simon; Vargas Trevino, Andrea Del Rocio; Walsh, Roberval; Wissing, Christoph; Aldaya Martin, Maria; Blobel, Volker; Centis Vignali, Matteo; Draeger, Arne-Rasmus; Erfle, Joachim; Garutti, Erika; Goebel, Kristin; Görner, Martin; Haller, Johannes; Hoffmann, Malte; Höing, Rebekka Sophie; Kirschenmann, Henning; Klanner, Robert; Kogler, Roman; Lange, Jörn; Lapsien, Tobias; Lenz, Teresa; Marchesini, Ivan; Ott, Jochen; Peiffer, Thomas; Pietsch, Niklas; Poehlsen, Jennifer; Pöhlsen, Thomas; Rathjens, Denis; Sander, Christian; Schettler, Hannes; Schleper, Peter; Schlieckau, Eike; Schmidt, Alexander; Seidel, Markus; Sola, Valentina; Stadie, Hartmut; Steinbrück, Georg; Troendle, Daniel; Usai, Emanuele; Vanelderen, Lukas; Barth, Christian; Baus, Colin; Berger, Joram; Böser, Christian; Butz, Erik; Chwalek, Thorsten; De Boer, Wim; Descroix, Alexis; Dierlamm, Alexander; Feindt, Michael; Frensch, Felix; Giffels, Manuel; Hartmann, Frank; Hauth, Thomas; Husemann, Ulrich; Katkov, Igor; Kornmayer, Andreas; Kuznetsova, Ekaterina; Lobelle Pardo, Patricia; Mozer, Matthias Ulrich; Müller, Thomas; Nürnberg, Andreas; Quast, Gunter; Rabbertz, Klaus; Ratnikov, Fedor; Röcker, Steffen; Simonis, Hans-Jürgen; Stober, Fred-Markus Helmut; Ulrich, Ralf; Wagner-Kuhr, Jeannine; Wayand, Stefan; Weiler, Thomas; Wolf, Roger; Anagnostou, Georgios; Daskalakis, Georgios; Geralis, Theodoros; Giakoumopoulou, Viktoria Athina; Kyriakis, Aristotelis; Loukas, Demetrios; Markou, Athanasios; Markou, Christos; Psallidas, Andreas; Topsis-Giotis, Iasonas; Kesisoglou, Stilianos; Panagiotou, Apostolos; Saoulidou, Niki; Stiliaris, Efstathios; Aslanoglou, Xenofon; Evangelou, Ioannis; Flouris, Giannis; Foudas, Costas; Kokkas, Panagiotis; Manthos, Nikolaos; Papadopoulos, Ioannis; Paradas, Evangelos; Bencze, Gyorgy; Hajdu, Csaba; Hidas, Pàl; Horvath, Dezso; Sikler, Ferenc; Veszpremi, Viktor; Vesztergombi, Gyorgy; Zsigmond, Anna Julia; Beni, Noemi; Czellar, Sandor; Karancsi, János; Molnar, Jozsef; Palinkas, Jozsef; Szillasi, Zoltan; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Swain, Sanjay Kumar; Beri, Suman Bala; Bhatnagar, Vipin; Dhingra, Nitish; Gupta, Ruchi; Bhawandeep, Bhawandeep; Kalsi, Amandeep Kaur; Kaur, Manjit; Mittal, Monika; Nishu, Nishu; Singh, Jasbir; Kumar, Ashok; Kumar, Arun; Ahuja, Sudha; Bhardwaj, Ashutosh; Choudhary, Brajesh C; Kumar, Ajay; Malhotra, Shivali; Naimuddin, Md; Ranjan, Kirti; Sharma, Varun; Banerjee, Sunanda; Bhattacharya, Satyaki; Chatterjee, Kalyanmoy; Dutta, Suchandra; Gomber, Bhawna; Jain, Sandhya; Jain, Shilpi; Khurana, Raman; Modak, Atanu; Mukherjee, Swagata; Roy, Debarati; Sarkar, Subir; Sharan, Manoj; Abdulsalam, Abdulla; Dutta, Dipanwita; Kailas, Swaminathan; Kumar, Vineet; Mohanty, Ajit Kumar; Pant, Lalit Mohan; Shukla, Prashant; Topkar, Anita; Aziz, Tariq; Banerjee, Sudeshna; Bhowmik, Sandeep; Chatterjee, Rajdeep Mohan; Dewanjee, Ram Krishna; Dugad, Shashikant; Ganguly, Sanmay; Ghosh, Saranya; Guchait, Monoranjan; Gurtu, Atul; Kole, Gouranga; Kumar, Sanjeev; Maity, Manas; Majumder, Gobinda; Mazumdar, Kajari; Mohanty, Gagan Bihari; Parida, Bibhuti; Sudhakar, Katta; Wickramage, Nadeesha; Bakhshiansohi, Hamed; Behnamian, Hadi; Etesami, Seyed Mohsen; Fahim, Ali; Goldouzian, Reza; Jafari, Abideh; Khakzad, Mohsen; Mohammadi Najafabadi, Mojtaba; Naseri, Mohsen; Paktinat Mehdiabadi, Saeid; Rezaei Hosseinabadi, Ferdos; Safarzadeh, Batool; Zeinali, Maryam; Felcini, Marta; Grunewald, Martin; Abbrescia, Marcello; Barbone, Lucia; Calabria, Cesare; Chhibra, Simranjit Singh; Colaleo, Anna; Creanza, Donato; De Filippis, Nicola; De Palma, Mauro; Fiore, Luigi; Iaselli, Giuseppe; Maggi, Giorgio; Maggi, Marcello; My, Salvatore; Nuzzo, Salvatore; Pompili, Alexis; Pugliese, Gabriella; Radogna, Raffaella; Selvaggi, Giovanna; Silvestris, Lucia; Singh, Gurpreet; Venditti, Rosamaria; Verwilligen, Piet; Zito, Giuseppe; Abbiendi, Giovanni; Benvenuti, Alberto; Bonacorsi, Daniele; Braibant-Giacomelli, Sylvie; Brigliadori, Luca; Campanini, Renato; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Codispoti, Giuseppe; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Fasanella, Daniele; Giacomelli, Paolo; Grandi, Claudio; Guiducci, Luigi; Marcellini, Stefano; Masetti, Gianni; Montanari, Alessandro; Navarria, Francesco; Perrotta, Andrea; Primavera, Federica; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gian Piero; Tosi, Nicolò; Travaglini, Riccardo; Albergo, Sebastiano; Cappello, Gigi; Chiorboli, Massimiliano; Costa, Salvatore; Giordano, Ferdinando; Potenza, Renato; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Gallo, Elisabetta; Gonzi, Sandro; Gori, Valentina; Lenzi, Piergiulio; Meschini, Marco; Paoletti, Simone; Sguazzoni, Giacomo; Tropiano, Antonio; Benussi, Luigi; Bianco, Stefano; Fabbri, Franco; Piccolo, Davide; Ferro, Fabrizio; Lo Vetere, Maurizio; Robutti, Enrico; Tosi, Silvano; Dinardo, Mauro Emanuele; Fiorendi, Sara; Gennai, Simone; Gerosa, Raffaele; Ghezzi, Alessio; Govoni, Pietro; Lucchini, Marco Toliman; Malvezzi, Sandra; Manzoni, Riccardo Andrea; Martelli, Arabella; Marzocchi, Badder; Menasce, Dario; Moroni, Luigi; Paganoni, Marco; Pedrini, Daniele; Ragazzi, Stefano; Redaelli, Nicola; Tabarelli de Fatis, Tommaso; Buontempo, Salvatore; Cavallo, Nicola; Di Guida, Salvatore; Fabozzi, Francesco; Iorio, Alberto Orso Maria; Lista, Luca; Meola, Sabino; Merola, Mario; Paolucci, Pierluigi; Azzi, Patrizia; Bacchetta, Nicola; Bisello, Dario; Branca, Antonio; Carlin, Roberto; Checchia, Paolo; Dall'Osso, Martino; Dorigo, Tommaso; Dosselli, Umberto; Galanti, Mario; Gasparini, Fabrizio; Gasparini, Ugo; Giubilato, Piero; Gonella, Franco; Gozzelino, Andrea; Kanishchev, Konstantin; Lacaprara, Stefano; Margoni, Martino; Montecassiano, Fabio; Pazzini, Jacopo; Pozzobon, Nicola; Ronchese, Paolo; Simonetto, Franco; Tosi, Mia; Zotto, Pierluigi; Zucchetta, Alberto; Zumerle, Gianni; Gabusi, Michele; Ratti, Sergio P; Riccardi, Cristina; Salvini, Paola; Vitulo, Paolo; Biasini, Maurizio; Bilei, Gian Mario; Ciangottini, Diego; Fanò, Livio; Lariccia, Paolo; Mantovani, Giancarlo; Menichelli, Mauro; Romeo, Francesco; Saha, Anirban; Santocchia, Attilio; Spiezia, Aniello; Androsov, Konstantin; Azzurri, Paolo; Bagliesi, Giuseppe; Bernardini, Jacopo; Boccali, Tommaso; Broccolo, Giuseppe; Castaldi, Rino; Ciocci, Maria Agnese; Dell'Orso, Roberto; Donato, Silvio; Fiori, Francesco; Foà, Lorenzo; Giassi, Alessandro; Grippo, Maria Teresa; Ligabue, Franco; Lomtadze, Teimuraz; Martini, Luca; Messineo, Alberto; Moon, Chang-Seong; Palla, Fabrizio; Rizzi, Andrea; Savoy-Navarro, Aurore; Serban, Alin Titus; Spagnolo, Paolo; Squillacioti, Paola; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Vernieri, Caterina; Barone, Luciano; Cavallari, Francesca; D'imperio, Giulia; Del Re, Daniele; Diemoz, Marcella; Grassi, Marco; Jorda, Clara; Longo, Egidio; Margaroli, Fabrizio; Meridiani, Paolo; Micheli, Francesco; Nourbakhsh, Shervin; Organtini, Giovanni; Paramatti, Riccardo; Rahatlou, Shahram; Rovelli, Chiara; Santanastasio, Francesco; Soffi, Livia; Traczyk, Piotr; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Bellan, Riccardo; Biino, Cristina; Cartiglia, Nicolo; Casasso, Stefano; Costa, Marco; Degano, Alessandro; Demaria, Natale; Dujany, Giulio; Finco, Linda; Mariotti, Chiara; Maselli, Silvia; Migliore, Ernesto; Monaco, Vincenzo; Musich, Marco; Obertino, Maria Margherita; Ortona, Giacomo; Pacher, Luca; Pastrone, Nadia; Pelliccioni, Mario; Pinna Angioni, Gian Luca; Potenza, Alberto; Romero, Alessandra; Ruspa, Marta; Sacchi, Roberto; Solano, Ada; Staiano, Amedeo; Tamponi, Umberto; Belforte, Stefano; Candelise, Vieri; Casarsa, Massimo; Cossutti, Fabio; Della Ricca, Giuseppe; Gobbo, Benigno; La Licata, Chiara; Marone, Matteo; Montanino, Damiana; Schizzi, Andrea; Umer, Tomo; Zanetti, Anna; Chang, Sunghyun; Kropivnitskaya, Anna; Nam, Soon-Kwon; Kim, Dong Hee; Kim, Gui Nyun; Kim, Min Suk; Kong, Dae Jung; Lee, Sangeun; Oh, Young Do; Park, Hyangkyu; Sakharov, Alexandre; Son, Dong-Chul; Kim, Tae Jeong; Kim, Jae Yool; Song, Sanghyeon; Choi, Suyong; Gyun, Dooyeon; Hong, Byung-Sik; Jo, Mihee; Kim, Hyunchul; Kim, Yongsun; Lee, Byounghoon; Lee, Kyong Sei; Park, Sung Keun; Roh, Youn; Choi, Minkyoo; Kim, Ji Hyun; Park, Inkyu; Park, Sangnam; Ryu, Geonmo; Ryu, Min Sang; Choi, Young-Il; Choi, Young Kyu; Goh, Junghwan; Kim, Donghyun; Kwon, Eunhyang; Lee, Jongseok; Seo, Hyunkwan; Yu, Intae; Juodagalvis, Andrius; Komaragiri, Jyothsna Rani; Md Ali, Mohd Adli Bin; Castilla-Valdez, Heriberto; De La Cruz-Burelo, Eduard; Heredia-de La Cruz, Ivan; Lopez-Fernandez, Ricardo; Sánchez Hernández, Alberto; Carrillo Moreno, Salvador; Vazquez Valencia, Fabiola; Pedraza, Isabel; Salazar Ibarguen, Humberto Antonio; Casimiro Linares, Edgar; Morelos Pineda, Antonio; Krofcheck, David; Butler, Philip H; Reucroft, Steve; Ahmad, Ashfaq; Ahmad, Muhammad; Hassan, Qamar; Hoorani, Hafeez R; Khalid, Shoaib; Khan, Wajid Ali; Khurshid, Taimoor; Shah, Mehar Ali; Shoaib, Muhammad; Bialkowska, Helena; Bluj, Michal; Boimska, Bożena; Frueboes, Tomasz; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Romanowska-Rybinska, Katarzyna; Szleper, Michal; Zalewski, Piotr; Brona, Grzegorz; Bunkowski, Karol; Cwiok, Mikolaj; Dominik, Wojciech; Doroba, Krzysztof; Kalinowski, Artur; Konecki, Marcin; Krolikowski, Jan; Misiura, Maciej; Olszewski, Michał; Wolszczak, Weronika; Bargassa, Pedrame; Beirão Da Cruz E Silva, Cristóvão; Faccioli, Pietro; Ferreira Parracho, Pedro Guilherme; Gallinaro, Michele; Nguyen, Federico; Rodrigues Antunes, Joao; Seixas, Joao; Varela, Joao; Vischia, Pietro; Golutvin, Igor; Gorbunov, Ilya; Karjavin, Vladimir; Konoplyanikov, Viktor; Korenkov, Vladimir; Lanev, Alexander; Malakhov, Alexander; Matveev, Viktor; Mitsyn, Valeri Valentinovitch; Moisenz, Petr; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Skatchkov, Nikolai; Smirnov, Vitaly; Tikhonenko, Elena; Yuldashev, Bekhzod S; Zarubin, Anatoli; Golovtsov, Victor; Ivanov, Yury; Kim, Victor; Levchenko, Petr; Murzin, Victor; Oreshkin, Vadim; Smirnov, Igor; Sulimov, Valentin; Uvarov, Lev; Vavilov, Sergey; Vorobyev, Alexey; Vorobyev, Andrey; Andreev, Yuri; Dermenev, Alexander; Gninenko, Sergei; Golubev, Nikolai; Kirsanov, Mikhail; Krasnikov, Nikolai; Pashenkov, Anatoli; Tlisov, Danila; Toropin, Alexander; Epshteyn, Vladimir; Gavrilov, Vladimir; Lychkovskaya, Natalia; Popov, Vladimir; Safronov, Grigory; Semenov, Sergey; Spiridonov, Alexander; Stolin, Viatcheslav; Vlasov, Evgueni; Zhokin, Alexander; Andreev, Vladimir; Azarkin, Maksim; Dremin, Igor; Kirakosyan, Martin; Leonidov, Andrey; Mesyats, Gennady; Rusakov, Sergey V; Vinogradov, Alexey; Belyaev, Andrey; Boos, Edouard; Dubinin, Mikhail; Dudko, Lev; Ershov, Alexander; Gribushin, Andrey; Klyukhin, Vyacheslav; Kodolova, Olga; Lokhtin, Igor; Obraztsov, Stepan; Petrushanko, Sergey; Savrin, Viktor; Snigirev, Alexander; Azhgirey, Igor; Bayshev, Igor; Bitioukov, Sergei; Kachanov, Vassili; Kalinin, Alexey; Konstantinov, Dmitri; Krychkine, Victor; Petrov, Vladimir; Ryutin, Roman; Sobol, Andrei; Tourtchanovitch, Leonid; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Adzic, Petar; Ekmedzic, Marko; Milosevic, Jovan; Rekovic, Vladimir; Alcaraz Maestre, Juan; Battilana, Carlo; Calvo, Enrique; Cerrada, Marcos; Chamizo Llatas, Maria; Colino, Nicanor; De La Cruz, Begona; Delgado Peris, Antonio; Domínguez Vázquez, Daniel; Escalante Del Valle, Alberto; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Flix, Jose; Fouz, Maria Cruz; Garcia-Abia, Pablo; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M; Josa, Maria Isabel; Merino, Gonzalo; Navarro De Martino, Eduardo; Pérez Calero Yzquierdo, Antonio María; Puerta Pelayo, Jesus; Quintario Olmeda, Adrián; Redondo, Ignacio; Romero, Luciano; Soares, Mara Senghi; Albajar, Carmen; de Trocóniz, Jorge F; Missiroli, Marino; Moran, Dermot; Brun, Hugues; Cuevas, Javier; Fernandez Menendez, Javier; Folgueras, Santiago; Gonzalez Caballero, Isidro; Lloret Iglesias, Lara; Brochero Cifuentes, Javier Andres; Cabrillo, Iban Jose; Calderon, Alicia; Duarte Campderros, Jordi; Fernandez, Marcos; Gomez, Gervasio; Graziano, Alberto; Lopez Virto, Amparo; Marco, Jesus; Marco, Rafael; Martinez Rivero, Celso; Matorras, Francisco; Munoz Sanchez, Francisca Javiela; Piedra Gomez, Jonatan; Rodrigo, Teresa; Rodríguez-Marrero, Ana Yaiza; Ruiz-Jimeno, Alberto; Scodellaro, Luca; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Auffray, Etiennette; Auzinger, Georg; Bachtis, Michail; Baillon, Paul; Ball, Austin; Barney, David; Benaglia, Andrea; Bendavid, Joshua; Benhabib, Lamia; Benitez, Jose F; Bernet, Colin; Bianchi, Giovanni; Bloch, Philippe; Bocci, Andrea; Bonato, Alessio; Bondu, Olivier; Botta, Cristina; Breuker, Horst; Camporesi, Tiziano; Cerminara, Gianluca; Colafranceschi, Stefano; D'Alfonso, Mariarosaria; D'Enterria, David; Dabrowski, Anne; David Tinoco Mendes, Andre; De Guio, Federico; De Roeck, Albert; De Visscher, Simon; Dobson, Marc; Dordevic, Milos; Dupont-Sagorin, Niels; Elliott-Peisert, Anna; Eugster, Jürg; Franzoni, Giovanni; Funk, Wolfgang; Gigi, Dominique; Gill, Karl; Giordano, Domenico; Girone, Maria; Glege, Frank; Guida, Roberto; Gundacker, Stefan; Guthoff, Moritz; Hammer, Josef; Hansen, Magnus; Harris, Philip; Hegeman, Jeroen; Innocente, Vincenzo; Janot, Patrick; Kousouris, Konstantinos; Krajczar, Krisztian; Lecoq, Paul; Lourenco, Carlos; Magini, Nicolo; Malgeri, Luca; Mannelli, Marcello; Marrouche, Jad; Masetti, Lorenzo; Meijers, Frans; Mersi, Stefano; Meschi, Emilio; Moortgat, Filip; Morovic, Srecko; Mulders, Martijn; Musella, Pasquale; Orsini, Luciano; Pape, Luc; Perez, Emmanuelle; Perrozzi, Luca; Petrilli, Achille; Petrucciani, Giovanni; Pfeiffer, Andreas; Pierini, Maurizio; Pimiä, Martti; Piparo, Danilo; Plagge, Michael; Racz, Attila; Rolandi, Gigi; Rovere, Marco; Sakulin, Hannes; Schäfer, Christoph; Schwick, Christoph; Sharma, Archana; Siegrist, Patrice; Silva, Pedro; Simon, Michal; Sphicas, Paraskevas; Spiga, Daniele; Steggemann, Jan; Stieger, Benjamin; Stoye, Markus; Treille, Daniel; Tsirou, Andromachi; Veres, Gabor Istvan; Vlimant, Jean-Roch; Wardle, Nicholas; Wöhri, Hermine Katharina; Wollny, Heiner; Zeuner, Wolfram Dietrich; Bertl, Willi; Deiters, Konrad; Erdmann, Wolfram; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; Kotlinski, Danek; Langenegger, Urs; Renker, Dieter; Rohe, Tilman; Bachmair, Felix; Bäni, Lukas; Bianchini, Lorenzo; Bortignon, Pierluigi; Buchmann, Marco-Andrea; Casal, Bruno; Chanon, Nicolas; Deisher, Amanda; Dissertori, Günther; Dittmar, Michael; Donegà, Mauro; Dünser, Marc; Eller, Philipp; Grab, Christoph; Hits, Dmitry; Lustermann, Werner; Mangano, Boris; Marini, Andrea Carlo; Martinez Ruiz del Arbol, Pablo; Meister, Daniel; Mohr, Niklas; Nägeli, Christoph; Nessi-Tedaldi, Francesca; Pandolfi, Francesco; Pauss, Felicitas; Peruzzi, Marco; Quittnat, Milena; Rebane, Liis; Rossini, Marco; Starodumov, Andrei; Takahashi, Maiko; Theofilatos, Konstantinos; Wallny, Rainer; Weber, Hannsjoerg Artur; Amsler, Claude; Canelli, Maria Florencia; Chiochia, Vincenzo; De Cosa, Annapaola; Hinzmann, Andreas; Hreus, Tomas; Kilminster, Benjamin; Lange, Clemens; Millan Mejias, Barbara; Ngadiuba, Jennifer; Robmann, Peter; Ronga, Frederic Jean; Taroni, Silvia; Verzetti, Mauro; Yang, Yong; Cardaci, Marco; Chen, Kuan-Hsin; Ferro, Cristina; Kuo, Chia-Ming; Lin, Willis; Lu, Yun-Ju; Volpe, Roberta; Yu, Shin-Shan; Chang, Paoti; Chang, You-Hao; Chang, Yu-Wei; Chao, Yuan; Chen, Kai-Feng; Chen, Po-Hsun; Dietz, Charles; Grundler, Ulysses; Hou, George Wei-Shu; Kao, Kai-Yi; Lei, Yeong-Jyi; Liu, Yueh-Feng; Lu, Rong-Shyang; Majumder, Devdatta; Petrakou, Eleni; Tzeng, Yeng-Ming; Wilken, Rachel; Asavapibhop, Burin; Srimanobhas, Norraphat; Suwonjandee, Narumon; Adiguzel, Aytul; Bakirci, Mustafa Numan; Cerci, Salim; Dozen, Candan; Dumanoglu, Isa; Eskut, Eda; Girgis, Semiray; Gokbulut, Gul; Gurpinar, Emine; Hos, Ilknur; Kangal, Evrim Ersin; Kayis Topaksu, Aysel; Onengut, Gulsen; Ozdemir, Kadri; Ozturk, Sertac; Polatoz, Ayse; Sogut, Kenan; Sunar Cerci, Deniz; Tali, Bayram; Topakli, Huseyin; Vergili, Mehmet; Akin, Ilina Vasileva; Bilin, Bugra; Bilmis, Selcuk; Gamsizkan, Halil; Karapinar, Guler; Ocalan, Kadir; Sekmen, Sezen; Surat, Ugur Emrah; Yalvac, Metin; Zeyrek, Mehmet; Gülmez, Erhan; Isildak, Bora; Kaya, Mithat; Kaya, Ozlem; Bahtiyar, Hüseyin; Barlas, Esra; Cankocak, Kerem; Vardarli, Fuat Ilkehan; Yücel, Mete; Levchuk, Leonid; Sorokin, Pavel; Brooke, James John; Clement, Emyr; Cussans, David; Flacher, Henning; Frazier, Robert; Goldstein, Joel; Grimes, Mark; Heath, Greg P; Heath, Helen F; Jacob, Jeson; Kreczko, Lukasz; Lucas, Chris; Meng, Zhaoxia; Newbold, Dave M; Paramesvaran, Sudarshan; Poll, Anthony; Senkin, Sergey; Smith, Vincent J; Williams, Thomas; Bell, Ken W; Belyaev, Alexander; Brew, Christopher; Brown, Robert M; Cockerill, David JA; Coughlan, John A; Harder, Kristian; Harper, Sam; Olaiya, Emmanuel; Petyt, David; Shepherd-Themistocleous, Claire; Thea, Alessandro; Tomalin, Ian R; Womersley, William John; Worm, Steven; Baber, Mark; Bainbridge, Robert; Buchmuller, Oliver; Burton, Darren; Colling, David; Cripps, Nicholas; Cutajar, Michael; Dauncey, Paul; Davies, Gavin; Della Negra, Michel; Dunne, Patrick; Ferguson, William; Fulcher, Jonathan; Futyan, David; Gilbert, Andrew; Hall, Geoffrey; Iles, Gregory; Jarvis, Martyn; Karapostoli, Georgia; Kenzie, Matthew; Lane, Rebecca; Lucas, Robyn; Lyons, Louis; Magnan, Anne-Marie; Malik, Sarah; Mathias, Bryn; Nash, Jordan; Nikitenko, Alexander; Pela, Joao; Pesaresi, Mark; Petridis, Konstantinos; Raymond, David Mark; Rogerson, Samuel; Rose, Andrew; Seez, Christopher; Sharp, Peter; Tapper, Alexander; Vazquez Acosta, Monica; Virdee, Tejinder; Cole, Joanne; Hobson, Peter R; Khan, Akram; Kyberd, Paul; Leggat, Duncan; Leslie, Dawn; Martin, William; Reid, Ivan; Symonds, Philip; Teodorescu, Liliana; Turner, Mark; Dittmann, Jay; Hatakeyama, Kenichi; Kasmi, Azeddine; Liu, Hongxuan; Scarborough, Tara; Charaf, Otman; Cooper, Seth; Henderson, Conor; Rumerio, Paolo; Avetisyan, Aram; Bose, Tulika; Fantasia, Cory; Lawson, Philip; Richardson, Clint; Rohlf, James; Sperka, David; St John, Jason; Sulak, Lawrence; Alimena, Juliette; Berry, Edmund; Bhattacharya, Saptaparna; Christopher, Grant; Cutts, David; Demiragli, Zeynep; Ferapontov, Alexey; Garabedian, Alex; Heintz, Ulrich; Kukartsev, Gennadiy; Laird, Edward; Landsberg, Greg; Luk, Michael; Narain, Meenakshi; Segala, Michael; Sinthuprasith, Tutanon; Speer, Thomas; Swanson, Joshua; Breedon, Richard; Breto, Guillermo; Calderon De La Barca Sanchez, Manuel; Chauhan, Sushil; Chertok, Maxwell; Conway, John; Conway, Rylan; Cox, Peter Timothy; Erbacher, Robin; Gardner, Michael; Ko, Winston; Lander, Richard; Miceli, Tia; Mulhearn, Michael; Pellett, Dave; Pilot, Justin; Ricci-Tam, Francesca; Searle, Matthew; Shalhout, Shalhout; Smith, John; Squires, Michael; Stolp, Dustin; Tripathi, Mani; Wilbur, Scott; Yohay, Rachel; Cousins, Robert; Everaerts, Pieter; Farrell, Chris; Hauser, Jay; Ignatenko, Mikhail; Rakness, Gregory; Takasugi, Eric; Valuev, Vyacheslav; Weber, Matthias; Babb, John; Burt, Kira; Clare, Robert; Ellison, John Anthony; Gary, J William; Hanson, Gail; Heilman, Jesse; Ivova Rikova, Mirena; Jandir, Pawandeep; Kennedy, Elizabeth; Lacroix, Florent; Liu, Hongliang; Long, Owen Rosser; Luthra, Arun; Malberti, Martina; Nguyen, Harold; Olmedo Negrete, Manuel; Shrinivas, Amithabh; Sumowidagdo, Suharyo; Wimpenny, Stephen; Andrews, Warren; Branson, James G; Cerati, Giuseppe Benedetto; Cittolin, Sergio; D'Agnolo, Raffaele Tito; Evans, David; Holzner, André; Kelley, Ryan; Klein, Daniel; Lebourgeois, Matthew; Letts, James; Macneill, Ian; Olivito, Dominick; Padhi, Sanjay; Palmer, Christopher; Pieri, Marco; Sani, Matteo; Sharma, Vivek; Simon, Sean; Sudano, Elizabeth; Tadel, Matevz; Tu, Yanjun; Vartak, Adish; Welke, Charles; Würthwein, Frank; Yagil, Avraham; Yoo, Jaehyeok; Barge, Derek; Bradmiller-Feld, John; Campagnari, Claudio; Danielson, Thomas; Dishaw, Adam; Flowers, Kristen; Franco Sevilla, Manuel; Geffert, Paul; George, Christopher; Golf, Frank; Gouskos, Loukas; Incandela, Joe; Justus, Christopher; Mccoll, Nickolas; Richman, Jeffrey; Stuart, David; To, Wing; West, Christopher; Apresyan, Artur; Bornheim, Adolf; Bunn, Julian; Chen, Yi; Di Marco, Emanuele; Duarte, Javier; Mott, Alexander; Newman, Harvey B; Pena, Cristian; Rogan, Christopher; Spiropulu, Maria; Timciuc, Vladlen; Wilkinson, Richard; Xie, Si; Zhu, Ren-Yuan; Azzolini, Virginia; Calamba, Aristotle; Carlson, Benjamin; Ferguson, Thomas; Iiyama, Yutaro; Paulini, Manfred; Russ, James; Vogel, Helmut; Vorobiev, Igor; Cumalat, John Perry; Ford, William T; Gaz, Alessandro; Luiggi Lopez, Eduardo; Nauenberg, Uriel; Smith, James; Stenson, Kevin; Ulmer, Keith; Wagner, Stephen Robert; Alexander, James; Chatterjee, Avishek; Chu, Jennifer; Dittmer, Susan; Eggert, Nicholas; Mirman, Nathan; Nicolas Kaufman, Gala; Patterson, Juliet Ritchie; Ryd, Anders; Salvati, Emmanuele; Skinnari, Louise; Sun, Werner; Teo, Wee Don; Thom, Julia; Thompson, Joshua; Tucker, Jordan; Weng, Yao; Winstrom, Lucas; Wittich, Peter; Winn, Dave; Abdullin, Salavat; Albrow, Michael; Anderson, Jacob; Apollinari, Giorgio; Bauerdick, Lothar AT; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C; Burkett, Kevin; Butler, Joel Nathan; Cheung, Harry; Chlebana, Frank; Cihangir, Selcuk; Elvira, Victor Daniel; Fisk, Ian; Freeman, Jim; Gao, Yanyan; Gottschalk, Erik; Gray, Lindsey; Green, Dan; Grünendahl, Stefan; Gutsche, Oliver; Hanlon, Jim; Hare, Daryl; Harris, Robert M; Hirschauer, James; Hooberman, Benjamin; Jindariani, Sergo; Johnson, Marvin; Joshi, Umesh; Kaadze, Ketino; Klima, Boaz; Kreis, Benjamin; Kwan, Simon; Linacre, Jacob; Lincoln, Don; Lipton, Ron; Liu, Tiehui; Lykken, Joseph; Maeshima, Kaori; Marraffino, John Michael; Martinez Outschoorn, Verena Ingrid; Maruyama, Sho; Mason, David; McBride, Patricia; Mishra, Kalanand; Mrenna, Stephen; Musienko, Yuri; Nahn, Steve; Newman-Holmes, Catherine; O'Dell, Vivian; Prokofyev, Oleg; Sexton-Kennedy, Elizabeth; Sharma, Seema; Soha, Aron; Spalding, William J; Spiegel, Leonard; Taylor, Lucas; Tkaczyk, Slawek; Tran, Nhan Viet; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vidal, Richard; Whitbeck, Andrew; Whitmore, Juliana; Yang, Fan; Acosta, Darin; Avery, Paul; Bourilkov, Dimitri; Carver, Matthew; Cheng, Tongguang; Curry, David; Das, Souvik; De Gruttola, Michele; Di Giovanni, Gian Piero; Field, Richard D; Fisher, Matthew; Furic, Ivan-Kresimir; Hugon, Justin; Konigsberg, Jacobo; Korytov, Andrey; Kypreos, Theodore; Low, Jia Fu; Matchev, Konstantin; Milenovic, Predrag; Mitselmakher, Guenakh; Muniz, Lana; Rinkevicius, Aurelijus; Shchutska, Lesya; Snowball, Matthew; Yelton, John; Zakaria, Mohammed; Hewamanage, Samantha; Linn, Stephan; Markowitz, Pete; Martinez, German; Rodriguez, Jorge Luis; Adams, Todd; Askew, Andrew; Bochenek, Joseph; Diamond, Brendan; Haas, Jeff; Hagopian, Sharon; Hagopian, Vasken; Johnson, Kurtis F; Prosper, Harrison; Veeraraghavan, Venkatesh; Weinberg, Marc; Baarmand, Marc M; Hohlmann, Marcus; Kalakhety, Himali; Yumiceva, Francisco; Adams, Mark Raymond; Apanasevich, Leonard; Bazterra, Victor Eduardo; Berry, Douglas; Betts, Russell Richard; Bucinskaite, Inga; Cavanaugh, Richard; Evdokimov, Olga; Gauthier, Lucie; Gerber, Cecilia Elena; Hofman, David Jonathan; Khalatyan, Samvel; Kurt, Pelin; Moon, Dong Ho; O'Brien, Christine; Silkworth, Christopher; Turner, Paul; Varelas, Nikos; Albayrak, Elif Asli; Bilki, Burak; Clarida, Warren; Dilsiz, Kamuran; Duru, Firdevs; Haytmyradov, Maksat; Merlo, Jean-Pierre; Mermerkaya, Hamit; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Ogul, Hasan; Onel, Yasar; Ozok, Ferhat; Penzo, Aldo; Rahmat, Rahmat; Sen, Sercan; Tan, Ping; Tiras, Emrah; Wetzel, James; Yetkin, Taylan; Yi, Kai; Barnett, Bruce Arnold; Blumenfeld, Barry; Bolognesi, Sara; Fehling, David; Gritsan, Andrei; Maksimovic, Petar; Martin, Christopher; Swartz, Morris; Baringer, Philip; Bean, Alice; Benelli, Gabriele; Bruner, Christopher; Gray, Julia; Kenny III, Raymond Patrick; Malek, Magdalena; Murray, Michael; Noonan, Daniel; Sanders, Stephen; Sekaric, Jadranka; Stringer, Robert; Wang, Quan; Wood, Jeffrey Scott; Barfuss, Anne-Fleur; Chakaberia, Irakli; Ivanov, Andrew; Khalil, Sadia; Makouski, Mikhail; Maravin, Yurii; Saini, Lovedeep Kaur; Shrestha, Shruti; Skhirtladze, Nikoloz; Svintradze, Irakli; Gronberg, Jeffrey; Lange, David; Rebassoo, Finn; Wright, Douglas; Baden, Drew; Belloni, Alberto; Calvert, Brian; Eno, Sarah Catherine; Gomez, Jaime; Hadley, Nicholas John; Kellogg, Richard G; Kolberg, Ted; Lu, Ying; Marionneau, Matthieu; Mignerey, Alice; Pedro, Kevin; Skuja, Andris; Tonjes, Marguerite; Tonwar, Suresh C; Apyan, Aram; Barbieri, Richard; Bauer, Gerry; Busza, Wit; Cali, Ivan Amos; Chan, Matthew; Di Matteo, Leonardo; Dutta, Valentina; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Gulhan, Doga; Klute, Markus; Lai, Yue Shi; Lee, Yen-Jie; Levin, Andrew; Luckey, Paul David; Ma, Teng; Paus, Christoph; Ralph, Duncan; Roland, Christof; Roland, Gunther; Stephans, George; Stöckli, Fabian; Sumorok, Konstanty; Velicanu, Dragos; Veverka, Jan; Wyslouch, Bolek; Yang, Mingming; Zanetti, Marco; Zhukova, Victoria; Dahmes, Bryan; Gude, Alexander; Kao, Shih-Chuan; Klapoetke, Kevin; Kubota, Yuichi; Mans, Jeremy; Pastika, Nathaniel; Rusack, Roger; Singovsky, Alexander; Tambe, Norbert; Turkewitz, Jared; Acosta, John Gabriel; Oliveros, Sandra; Avdeeva, Ekaterina; Bloom, Kenneth; Bose, Suvadeep; Claes, Daniel R; Dominguez, Aaron; Gonzalez Suarez, Rebeca; Keller, Jason; Knowlton, Dan; Kravchenko, Ilya; Lazo-Flores, Jose; Malik, Sudhir; Meier, Frank; Snow, Gregory R; Dolen, James; Godshalk, Andrew; Iashvili, Ia; Kharchilava, Avto; Kumar, Ashish; Rappoccio, Salvatore; Alverson, George; Barberis, Emanuela; Baumgartel, Darin; Chasco, Matthew; Haley, Joseph; Massironi, Andrea; Morse, David Michael; Nash, David; Orimoto, Toyoko; Trocino, Daniele; Wang, Ren-Jie; Wood, Darien; Zhang, Jinzhong; Hahn, Kristan Allan; Kubik, Andrew; Mucia, Nicholas; Odell, Nathaniel; Pollack, Brian; Pozdnyakov, Andrey; Schmitt, Michael; Stoynev, Stoyan; Sung, Kevin; Velasco, Mayda; Won, Steven; Brinkerhoff, Andrew; Chan, Kwok Ming; Drozdetskiy, Alexey; Hildreth, Michael; Jessop, Colin; Karmgard, Daniel John; Kellams, Nathan; Lannon, Kevin; Luo, Wuming; Lynch, Sean; Marinelli, Nancy; Pearson, Tessa; Planer, Michael; Ruchti, Randy; Valls, Nil; Wayne, Mitchell; Wolf, Matthias; Woodard, Anna; Antonelli, Louis; Brinson, Jessica; Bylsma, Ben; Durkin, Lloyd Stanley; Flowers, Sean; Hill, Christopher; Hughes, Richard; Kotov, Khristian; Ling, Ta-Yung; Puigh, Darren; Rodenburg, Marissa; Smith, Geoffrey; Winer, Brian L; Wolfe, Homer; Wulsin, Howard Wells; Driga, Olga; Elmer, Peter; Hebda, Philip; Hunt, Adam; Koay, Sue Ann; Lujan, Paul; Marlow, Daniel; Medvedeva, Tatiana; Mooney, Michael; Olsen, James; Piroué, Pierre; Quan, Xiaohang; Saka, Halil; Stickland, David; Tully, Christopher; Werner, Jeremy Scott; Zenz, Seth Conrad; Zuranski, Andrzej; Brownson, Eric; Mendez, Hector; Ramirez Vargas, Juan Eduardo; Barnes, Virgil E; Benedetti, Daniele; Bolla, Gino; Bortoletto, Daniela; De Mattia, Marco; Hu, Zhen; Jha, Manoj; Jones, Matthew; Jung, Kurt; Kress, Matthew; Leonardo, Nuno; Lopes Pegna, David; Maroussov, Vassili; Merkel, Petra; Miller, David Harry; Neumeister, Norbert; Radburn-Smith, Benjamin Charles; Shi, Xin; Shipsey, Ian; Silvers, David; Svyatkovskiy, Alexey; Wang, Fuqiang; Xie, Wei; Xu, Lingshan; Yoo, Hwi Dong; Zablocki, Jakub; Zheng, Yu; Parashar, Neeti; Stupak, John; Adair, Antony; Akgun, Bora; Ecklund, Karl Matthew; Geurts, Frank JM; Li, Wei; Michlin, Benjamin; Padley, Brian Paul; Redjimi, Radia; Roberts, Jay; Zabel, James; Betchart, Burton; Bodek, Arie; Covarelli, Roberto; de Barbaro, Pawel; Demina, Regina; Eshaq, Yossof; Ferbel, Thomas; Garcia-Bellido, Aran; Goldenzweig, Pablo; Han, Jiyeon; Harel, Amnon; Khukhunaishvili, Aleko; Petrillo, Gianluca; Vishnevskiy, Dmitry; Ciesielski, Robert; Demortier, Luc; Goulianos, Konstantin; Lungu, Gheorghe; Mesropian, Christina; Arora, Sanjay; Barker, Anthony; Chou, John Paul; Contreras-Campana, Christian; Contreras-Campana, Emmanuel; Duggan, Daniel; Ferencek, Dinko; Gershtein, Yuri; Gray, Richard; Halkiadakis, Eva; Hidas, Dean; Kaplan, Steven; Lath, Amitabh; Panwalkar, Shruti; Park, Michael; Patel, Rishi; Salur, Sevil; Schnetzer, Steve; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Thomassen, Peter; Walker, Matthew; Rose, Keith; Spanier, Stefan; York, Andrew; Bouhali, Othmane; Castaneda Hernandez, Alfredo; Eusebi, Ricardo; Flanagan, Will; Gilmore, Jason; Kamon, Teruki; Khotilovich, Vadim; Krutelyov, Vyacheslav; Montalvo, Roy; Osipenkov, Ilya; Pakhotin, Yuriy; Perloff, Alexx; Roe, Jeffrey; Rose, Anthony; Safonov, Alexei; Sakuma, Tai; Suarez, Indara; Tatarinov, Aysen; Akchurin, Nural; Cowden, Christopher; Damgov, Jordan; Dragoiu, Cosmin; Dudero, Phillip Russell; Faulkner, James; Kovitanggoon, Kittikul; Kunori, Shuichi; Lee, Sung Won; Libeiro, Terence; Volobouev, Igor; Appelt, Eric; Delannoy, Andrés G; Greene, Senta; Gurrola, Alfredo; Johns, Willard; Maguire, Charles; Mao, Yaxian; Melo, Andrew; Sharma, Monika; Sheldon, Paul; Snook, Benjamin; Tuo, Shengquan; Velkovska, Julia; Arenton, Michael Wayne; Boutle, Sarah; Cox, Bradley; Francis, Brian; Goodell, Joseph; Hirosky, Robert; Ledovskoy, Alexander; Li, Hengne; Lin, Chuanzhe; Neu, Christopher; Wood, John; Clarke, Christopher; Harr, Robert; Karchin, Paul Edmund; Kottachchi Kankanamge Don, Chamath; Lamichhane, Pramod; Sturdy, Jared; Belknap, Donald; Carlsmith, Duncan; Cepeda, Maria; Dasu, Sridhara; Dodd, Laura; Duric, Senka; Friis, Evan; Hall-Wilton, Richard; Herndon, Matthew; Hervé, Alain; Klabbers, Pamela; Lanaro, Armando; Lazaridis, Christos; Levine, Aaron; Loveless, Richard; Mohapatra, Ajit; Ojalvo, Isabel; Perry, Thomas; Pierro, Giuseppe Antonio; Polese, Giovanni; Ross, Ian; Sarangi, Tapas; Savin, Alexander; Smith, Wesley H; Vuosalo, Carl; Woods, Nathaniel


    A measurement of the production cross section ratio $\\sigma(\\chi_{b2}(1\\mathrm{P}))/ \\sigma(\\chi_{b1}(1\\mathrm{P}))$ is presented. The $\\chi_{b1}(1\\mathrm{P})$ and $\\chi_{b2}(1\\mathrm{P})$ bottomonium states, promptly produced in pp collisions at $\\sqrt{s}$= 8 TeV, are detected by the CMS experiment at the CERN LHC through their radiative decays $\\chi_{b1,2}(1\\mathrm{P}) \\rightarrow \\Upsilon(1\\mathrm{S}) + \\gamma$. The emitted photons are measured through their conversion to e$^+$e$^-$ pairs, whose reconstruction allows the two states to be resolved. The $\\Upsilon(1\\mathrm{S})$ is measured through its decay to two muons. An event sample corresponding to an integrated luminosity of 20.7 fb$^{-1}$ is used to measure the cross section ratio in a phase-space region defined by the photon pseudorapidity, |$\\eta^\\gamma$| < 1.0; the $\\Upsilon(1\\mathrm{S})$ rapidity, |$y^\\Upsilon$| < 1.5; and the $\\Upsilon(1\\mathrm{S})$ transverse momentum, 7 < $p_{\\mathrm{T}}^\\Upsilon$ < 40 GeV. The cross section ratio sh...

  11. Chi-square analysis of the reduction of ATP levels in L-02 hepatocytes by hexavalent chromium

    Directory of Open Access Journals (Sweden)

    Yang Yuan


    Full Text Available This study explored the reduction of adenosine triphosphate (ATP levels in L-02 hepatocytes by hexavalent chromium (Cr(VI using chi-square analysis. Cells were treated with 2, 4, 8, 16, or 32 μM Cr(VI for 12, 24, or 36 h. Methyl thiazolyl tetrazolium (MTT experiments and measurements of intracellular ATP levels were performed by spectrophotometry or bioluminescence assays following Cr(VI treatment. The chi-square test was used to determine the difference between cell survival rate and ATP levels. For the chi-square analysis, the results of the MTT or ATP experiments were transformed into a relative ratio with respect to the control (%. The relative ATP levels increased at 12 h, decreased at 24 h, and increased slightly again at 36 h following 4, 8, 16, 32 μM Cr(VI treatment, corresponding to a "V-shaped" curve. Furthermore, the results of the chi-square analysis demonstrated a significant difference of the ATP level in the 32-μM Cr(VI group (P < 0.05. The results suggest that the chi-square test can be applied to analyze the interference effects of Cr(VI on ATP levels in L-02 hepatocytes. The decreased ATP levels at 24 h indicated disruption of mitochondrial energy metabolism and the slight increase of ATP levels at 36 h indicated partial recovery of mitochondrial function or activated glycolysis in L-02 hepatocytes.

  12. Chemical dampening of Ly6C(hi) monocytes in the periphery produces anti-depressant effects in mice. (United States)

    Zheng, Xiao; Ma, Sijing; Kang, An; Wu, Mengqiu; Wang, Lin; Wang, Qiong; Wang, Guangji; Hao, Haiping


    The involvement of systemic immunity in depression pathogenesis promises a periphery-targeting paradigm in novel anti-depressant discovery. However, relatively little is known about druggable targets in the periphery for mental and behavioral control. Here we report that targeting Ly6C(hi) monocytes in blood can serve as a strategy for anti-depressant purpose. A natural compound, ginsenoside Rg1 (Rg1), was firstly validated as a periphery-restricted chemical probe. Rg1 selectively suppressed Ly6C(hi) monocytes recruitment to the inflamed mice brain. The proinflammatory potential of Ly6C(hi) monocytes to activate astrocytes was abrogated by Rg1, which led to a blunted feedback release of CCL2 to recruit the peripheral monocytes. In vitro study demonstrated that Rg1 pretreatment on activated THP-1 monocytes retarded their ability to trigger CCL2 secretion from co-cultured U251 MG astrocytes. CCL2-triggered p38/MAPK and PI3K/Akt activation were involved in the action of Rg1. Importantly, in mice models, we found that dampening Ly6C(hi) monocytes at the periphery ameliorated depression-like behavior induced by neuroinflammation or chronic social defeat stress. Together, our work unravels that blood Ly6C(hi) monocytes may serve as the target to enable remote intervention on the depressed brain, and identifies Rg1 as a lead compound for designing drugs targeting peripheral CCL2 signals. PMID:26783261

  13. Chemical dampening of Ly6Chi monocytes in the periphery produces anti-depressant effects in mice (United States)

    Zheng, Xiao; Ma, Sijing; Kang, An; Wu, Mengqiu; Wang, Lin; Wang, Qiong; Wang, Guangji; Hao, Haiping


    The involvement of systemic immunity in depression pathogenesis promises a periphery-targeting paradigm in novel anti-depressant discovery. However, relatively little is known about druggable targets in the periphery for mental and behavioral control. Here we report that targeting Ly6Chi monocytes in blood can serve as a strategy for anti-depressant purpose. A natural compound, ginsenoside Rg1 (Rg1), was firstly validated as a periphery-restricted chemical probe. Rg1 selectively suppressed Ly6Chi monocytes recruitment to the inflamed mice brain. The proinflammatory potential of Ly6Chi monocytes to activate astrocytes was abrogated by Rg1, which led to a blunted feedback release of CCL2 to recruit the peripheral monocytes. In vitro study demonstrated that Rg1 pretreatment on activated THP-1 monocytes retarded their ability to trigger CCL2 secretion from co-cultured U251 MG astrocytes. CCL2-triggered p38/MAPK and PI3K/Akt activation were involved in the action of Rg1. Importantly, in mice models, we found that dampening Ly6Chi monocytes at the periphery ameliorated depression-like behavior induced by neuroinflammation or chronic social defeat stress. Together, our work unravels that blood Ly6Chi monocytes may serve as the target to enable remote intervention on the depressed brain, and identifies Rg1 as a lead compound for designing drugs targeting peripheral CCL2 signals. PMID:26783261

  14. Prompt charmonia production and polarization at LHC in the NRQCD with kt-factorization. Part II: $\\chi_c$ mesons

    CERN Document Server

    Baranov, S P; Zotov, N P


    In the framework of kt-factorization approach,the production of prompt $\\chi_c$ mesons in pp collisions at the LHC energies is studied. Our consideration is based on the off-shell amplitudes for hard partonic subprocesses $g^*g^*\\to\\chi_{cJ}$ and non-relativistic QCD formalism for bound states. The transverse momentum dependent (unintegrated) gluon densities in a proton were derived from Ciafaloni-Catani-Fiorani-Marchesini evolution equation or, alternatively, were chosen in accordance with Kimber-Martin-Ryskin prescription. Taking into account both color singlet and color octet contributions, we deduce the corresponding non-perturbative long-distance matrix elements from the fits to the latest ATLAS data on $\\chi_{c1}$ and $\\chi_{c2}$ transverse momentum distributions at $\\sqrt s = 7$ TeV. We find that these distributions at small and moderate pt are formed mainly by the color singlet components. We successfully described the data on the differential cross sections and relative production rates $\\sigma(\\chi_...

  15. Mining of unexplored habitats for novel chitinases--chiA as a helper gene proxy in metagenomics. (United States)

    Cretoiu, Mariana Silvia; Kielak, Anna Maria; Abu Al-Soud, Waleed; Sørensen, Søren J; van Elsas, Jan Dirk


    The main objective of this study was to assess the abundance and diversity of chitin-degrading microbial communities in ten terrestrial and aquatic habitats in order to provide guidance to the subsequent exploration of such environments for novel chitinolytic enzymes. A combined protocol which encompassed (1) classical overall enzymatic assays, (2) chiA gene abundance measurement by qPCR, (3) chiA gene pyrosequencing, and (4) chiA gene-based PCR-DGGE was used. The chiA gene pyrosequencing is unprecedented, as it is the first massive parallel sequencing of this gene. The data obtained showed the existence across habitats of core bacterial communities responsible for chitin assimilation irrespective of ecosystem origin. Conversely, there were habitat-specific differences. In addition, a suite of sequences were obtained that are as yet unregistered in the chitinase database. In terms of chiA gene abundance and diversity, typical low-abundance/diversity versus high-abundance/diversity habitats was distinguished. From the combined data, we selected chitin-amended agricultural soil, the rhizosphere of the Arctic plant Oxyria digyna and the freshwater sponge Ephydatia fluviatilis as the most promising habitats for subsequent bioexploration. Thus, the screening strategy used is proposed as a guide for further metagenomics-based exploration of the selected habitats. PMID:22526805

  16. Clarification of the use of chi-square and likelihood functions in fits to histograms

    International Nuclear Information System (INIS)

    We consider the problem of fitting curves to histograms in which the data obey multinomial or Poisson statistics. Techniques commonly used by physicists are examined in light of standard results found in the statistics literature. We review the relationship between multinomial and Poisson distributions, and clarify a sufficient condition for equality of the area under the fitted curve and the number of events on the histogram. Following the statisticians, we use the likelihood ratio test to construct a general Z2 statistic, Zsub(lambda)2, which yields parameter and error estimates identical to those of the method of maximum likelihood. The Zsub(lambda)2 statistic is further useful for testing goodness-of-fit since the value of its minimum asymptotically obeys a classical chi-square distribution. One should be aware, however, of the potential for statistical bias, especially when the number of events is small. (orig.)

  17. Probing scalar meson structures in $\\chi_{c1}$ decays into pseudoscalar and scalar

    CERN Document Server

    Wang, Qian; Zhao, Qiang


    We evaluate the decay branching ratios of $\\chi_{c1}\\to PS$, in a quark model parametrization scheme, where $P$ and $S$ stand for pseudoscalar and scalar meson, respectively. An interesting feature of this decay process is that the $c\\bar{c}$ annihilate via the pQCD hair-pin diagram is supposed to be dominant. Hence, this decay process should be sensitive to the quark components of the final-state light mesons, and would provide a great opportunity for testing the mixing relations among the scalar mesons, i.e. $f_0(1370)$, $f_0(1500)$ and $f_0(1710)$, by tagging the final state pseudoscalar mesons.

  18. The Role of M\\"obius Constants and Scattering Functions in CHY Scalar Amplitudes

    CERN Document Server

    Lam, C S


    The integrations leading to the Cachazo-He-Yuan (CHY) double-color $n$-point massless scalar amplitude are carried out one integral at a time. M\\"obius invariance dictates the final amplitude to be independent of the three M\\"obius constants $\\sigma_r, \\sigma_s, \\sigma_t$, but their choice affects integrations and the intermediate results. The effect of the M\\"obius constants, the two colors, and the scattering functions on each integration is investigated. A systematic way to carry out the $n-3$ integrations is explained, each exposing one of the $n-3$ propagators of the Feynman diagrams. Two detailed examples are shown to illustrate the procedure, one a five-point amplitude, and the other a nine-point amplitude.

  19. An Efficient Algorithm for Auto Upload and Chi - Square Test on Application Software

    Directory of Open Access Journals (Sweden)

    Sampada Kembhavi


    Full Text Available In this paper weproposed a novel algorithm for autouploading the data in the cloud environment withoutanylicense considerationand suggest a novelframework where data is auto upload after a properauthentication and processing their task (gatheringand sharing inthe cloudenvironment.Here wepresent the authenticationprocess with autouploading process.We also use the traditionalmethod of data uploading, data gathering andsharing.So that we compare our statistics. We useobject orientedprograming (OOP programsas adata which is used for data sharing and gathering.We use java programs for comparison.Thenweapply Chi-Square test, to test the hypothesis forcorrectness. Then we check the program capabilityunder three parameters; first is F-measure (FM,second is odds ratio (OR and third is power (PO.Based on the three parameters we can find the betterapplication software as a service approach. Basedon the above phenomena we can compare theexecutiontimein different operating applicationwith the help of software quality metrics

  20. Chaotic Behavior of Heart Rate Signals during Chi and Kundalini Meditation

    Directory of Open Access Journals (Sweden)

    Atefeh Goshvarpour


    Full Text Available Nonlinear dynamics has been introduced to the analysis of biological data and increasingly recognized to be functionally relevant. The aim of this study is to quantify and compare the contribution of nonlinear and chaotic dynamics of human heart rate variability during two forms of meditation: (i Chinese Chi (or Qigong meditation and (ii Kundalini Yoga meditation. For this purpose, Poincare plots, Lyapunov exponents and Hurst exponents of heart rate variability signals were analyzed. In this study, we examined the different behavior of heart rate signals during two specific meditation techniques. The results show that heart rate signals became more periodic and their chaotic behavior was decreased in both techniques of meditation. Therefore, nonlinear chaotic indices may serve as a quantitative measure for psychophysiological states such as meditation. In addition, different forms of meditation appear to differentially alter specific components of heart rate signals.

  1. Neuroaesthetic Resonance


    Brooks, Anthony Lewis


    Neuroaesthetic Resonance emerged from a mature body of patient- centered gesture-control research investigating non-formal rehabilitation via ICT-enhanced-Art to question ‘Aesthetic Resonance’. Motivating participation, ludic engagement, and augmenting physical motion in non-formal (fun) treatment sessions are achieved via adaptive action-analyzed activities. These interactive virtual environments are designed to empower patients’ creative and/or playful expressions via digital feedback stimu...

  2. Bacterial and fungal chitinase chiJ orthologs evolve under different selective constraints following horizontal gene transfer

    Directory of Open Access Journals (Sweden)

    Ubhayasekera Wimal


    Full Text Available Abstract Background Certain bacteria from the genus Streptomyces are currently used as biological control agents against plant pathogenic fungi. Hydrolytic enzymes that degrade fungal cell wall components, such as chitinases, are suggested as one possible mechanism in biocontrol interactions. Adaptive evolution of chitinases are previously reported for plant chitinases involved in defence against fungal pathogens, and in fungal chitinases involved in fungal-fungal interactions. In this study we investigated the molecular evolution of chitinase chiJ in the bacterial genus Streptomyces. In addition, as chiJ orthologs are previously reported in certain fungal species as a result from horizontal gene transfer, we conducted a comparative study of differences in evolutionary patterns between bacterial and fungal taxa. Findings ChiJ contained three sites evolving under strong positive selection and four groups of co-evolving sites. Regions of high amino acid diversity were predicted to be surface-exposed and associated with coil regions that connect certain α-helices and β-strands in the family 18 chitinase TIM barrel structure, but not associated with the catalytic cleft. The comparative study with fungal ChiJ orthologs identified three regions that display signs of type 1 functional divergence, where unique adaptations in the bacterial and fungal taxa are driven by positive selection. Conclusions The identified surface-exposed regions of chitinase ChiJ where sequence diversification is driven by positive selection may putatively be related to functional divergence between bacterial and fungal orthologs. These results show that ChiJ orthologs have evolved under different selective constraints following the horizontal gene transfer event.

  3. Business plan for a european style coffee shop in Ho Chi Minh city : case: AT Ltd. Company


    Tran, Vu Ai


    This thesis is aimed to assist AT Company in its venture of running a European style coffee shop in Ho Chi Minh City. Hence, based on an analysis of the potential of the Vietnamese coffee industry with a focus on the Ho Chi Minh City market, its creative business idea is formulated together with new concepts. Correspondingly, a business plan is generated to describe an appropriate direction for the venture. In the sphere of the thesis, the author only concentrates on the process of implementi...

  4. SURMAT : decision support tool to select municipal solid waste treatment technologies : case study in Ho Chi Minh City, Viet Nam


    Thi, Le, K.O.


    The aim of this thesis is to enable taking more sustainable and cost-effective decisions on MSW management in developing cities. For this purpose, a tool named SURMAT was developed and applied using data of Ho Chi Minh City, Viet Nam (chapter 6). In order to prepare the tool for modeling of the MSW management in Ho Chi Minh City, an analysis of the current MSW management system (chapter 2), a selection of technologies (chapter 3, 4) and a costs analysis of the selected technologies (chapter 5...

  5. $\\chi^{\\vphantom\\dagger}_{c0}(3915)$ As the Lightest $c\\bar c s \\bar s$ State


    Lebed, Richard F.; Polosa, Antonio D.


    The state $\\chi^{\\vphantom\\dagger}_{c0}(3915)$ has recently been demoted by the Particle Data Group from its previous status as the conventional $c\\bar c$ $2 {}^3P_0$ state, largely due to the absence of expected $D\\bar D$ decays. We propose that $\\chi^{\\vphantom\\dagger}_{c0}(3915)$ is actually the lightest $c\\bar c s \\bar s$ state, and calculate the spectrum of such states using the diquark model, identifying many of the observed charmoniumlike states that lack open-charm decay modes as $c\\b...

  6. Franchising as a Potential Growth Strategy for a Small Business : A Case of Sam-Chi Fast Food Restaurant


    Odunsi, Sadiq


    The purpose of this study was to find out whether Sam-Chi fast food restaurant can grow through franchising as well as to give the owners recommendations on how to effectively adopt the franchising business model as a means to grow their business. Sam-Chi restaurant is situated in Lagos, Nigeria and the restaurant is owned and operated by Samuel Okore and his wife Chichi Okore. The theoretical framework of this research is separated into two sections. The first section covers the growth of a ...

  7. Pyrite alteration and neoformed magnetic minerals in the fault zone of the Chi-Chi earthquake (Mw7.6, 1999): Evidence for frictional heating and co-seismic fluids (United States)

    Chou, Yu-Min; Song, Sheng-Rong; Aubourg, Charles; Song, Yen-Fang; Boullier, Anne-Marie; Lee, Teh-Quei; Evans, Mark; Yeh, En-Chao; Chen, Yi-Ming


    During an earthquake, physical and chemical transformations lead to alteration and formation of minerals in the gouge layer. Altered and neoformed minerals can be used as tracers of some earthquake processes. In this study, we investigate pyrite and magnetic minerals within the host Chinshui siltstone and the 16-cm-thick gouge. This gouge hosts the principal slip zone of Chi-Chi earthquake (Mw7.6, 1999). In the Chinshui siltstone, pyrite framboids of various sizes and euhedral pyrite are observed. The magnetic mineral assemblage comprises stoichiometric magnetite, greigite, and fine-grained pyrrhotite. The pyrite content is generally reduced in the gouge compared to the wall rock. The magnetic mineral assemblage in the gouge consists of goethite, pyrrhotite, and partially oxidized magnetite. The pyrrhotite, goethite and some magnetite are neoformed. Pyrrhotite likely formed from high temperature decomposition of pyrite (>500°C) generated during co-seismic slip of repeated earthquakes. Goethite is inferred to have formed from hot aqueous co-seismic fluid (>350°C) in association with the 1999 Chi-Chi event. Elevated fluid temperatures can also explain the partial alteration of magnetite and the retrograde alteration of some pyrrhotite to pyrite. We suggest that characterization of neoformed magnetic minerals can provide important information for studying earthquake slip zones in sediment-derived fault gouge.





    Chi Li, one of the outstanding women writers in the 1980s, portrays various images of women in her works. Female image that Chi Li describe is from obedient to tradition type until self determination and independence, and gain a clairvoyance of that females culture existence state and the value conception separately. Chi Li thinks deeply of the meaning of Chinese females life, in search of the culture value of contemporary female throughout the different female images, which figured in the...

  9. Appropriate Model for Zoning Local Fish Conservation in front of Buddhist Temple on the Bank of the Chi River by Sustainable Community Participation


    Somchob Poo-Inna; Song-Koon Jantakajon; Terdthai Pantachai


    Problem statement: The fresh water fish in The Chi River was a major source of food of people living in this area. The objectives of this research were: (1) to study the historical background, current situation and problems of local fish conservation in front of The Chi River by community participation and (2) to find the opriate model for zoning the local fish conservation on the bank of The Chi River by sustainable community participation. Approach: The research area in Esan Reg...

  10. Effects of Tai Chi versus Proprioception Exercise Program on Neuromuscular Function of the Ankle in Elderly People: A Randomized Controlled Trial


    Jing Liu; Xue-Qiang Wang; Jie-Jiao Zheng; Yu-Jian Pan; Ying-Hui Hua; Shang-Min Zhao; Li-Yan Shen; Shuai Fan; Jiu-Gen Zhong


    Background. Tai Chi is a traditional Chinese medicine exercise used for improving neuromuscular function. This study aimed to investigate the effects of Tai Chi versus proprioception exercise program on neuromuscular function of the ankle in elderly people. Methods. Sixty elderly subjects were randomly allocated into three groups of 20 subjects per group. For 16 consecutive weeks, subjects participated in Tai Chi, proprioception exercise, or no structured exercise. Primary outcome measures in...



    Wang, Wenchao; Qiu, Chen; Ota, Toyosaku; Sawada, Masayuki; Kishimoto, Naoko; Kishimoto, Toshifumi


    Background: To our knowledge,there is no study that has examined the effect of Tai Chi exercise(Tai Chi) on attention function using functional brain imaging methodologies. Recent developments in near-infrared spectroscopy(NIRS) have enabled non-invasive clarification of brain functions by measurement of hemoglobin concentrations as cerebral blood volume. So, in the present study, we examined the effects of Tai Chi in the healthy elderly as measured by NIRS during the Stroop task. Methods: Tw...

  12. Cross-Sectional Comparison of Executive Attention Function in Normally Aging Long-Term T'ai Chi, Meditation, and Aerobic Fitness Practitioners Versus Sedentary Adults


    Hawkes, Teresa D; Manselle, Wayne; Woollacott, Marjorie H


    This cross-sectional field study documented the effect of long-term t'ai chi, meditation, or aerobic exercise training versus a sedentary lifestyle on executive function. It was predicted that long-term training in t'ai chi and meditation plus exercise would produce greater benefits to executive function than aerobic exercise. T'ai chi and meditation plus exercise include mental and physical training. Fifty-four volunteers were tested: t'ai chi (n=10); meditation+exercise (n=16); aerobic exer...

  13. What have we learned from HaChi (HAZE IN CHINA) project? (United States)

    Zhao, Chunsheng; Wiedensohler, Alfred


    HaChi (Haze in China) project, a joint research between Chinese NSFC and German DFG, focuses on investigating the aerosol hygroscopic properties in the North China Plain and their relationships to aerosol optics, radiation, cloud physics and ozone photochemistry. As we know, Eastern China has suffered from severe pollution caused by large concentrations of aerosol particles resulting from emissions from fossil fuel and biomass burning, transportation and some other combustion sources. Low visibility events are frequently encountered and mainly accompanied with haze as a result of either high aerosol loading or the strong hygroscopic growth of the aerosol particles. Especially at relative humidities between 90 and 99%, the aerosol particles grow exponentially. The hygroscopic behaviors at relative humidities close to 100% are also strongly linked to the particles ability to grow into cloud droplets at supersaturation. In my talk, I will present an overview of the up to date results from a serial of intensive and comprehensive field campaigns conducted at the sites of Wuqing and Xianghe, China, between 2009 and 2014. The measurements of the ambient aerosol hygroscopic properties at high RH between 90 and 98.5% are reported first. These in situ field measurements of atmospheric aerosol are unique with respect to their high RH range and especially of importance to better understand the widespread anthropogenic haze over the North China Plain. Then I will introduce the methods for calculating of aerosol hygroscopicity and their parameterization schemes derived from size-segregated chemical composition and the light scattering enhancement factor measurements in the North China Plain. A new method was proposed to retrieve the ratio of the externally mixed light absorbing carbon mass to the total mass of light absorbing carbon. A new parameterization scheme of light extinction for low visibilities on hazy days is proposed based on visibility, relative humidity, aerosol

  14. Green tea polyphenols and Tai Chi for bone health: Designing a placebo-controlled randomized trial

    Directory of Open Access Journals (Sweden)

    Chyu Ming-Chien


    Full Text Available Abstract Background Osteoporosis is a major health problem in postmenopausal women. Evidence suggests the importance of oxidative stress in bone metabolism and bone loss. Tea consumption may be beneficial to osteoporosis due to its antioxidant capability. However, lack of objective data characterizing tea consumption has hindered the precise evaluation of the association between tea ingestion and bone mineral density in previous questionnaire-based epidemiological studies. On the other hand, although published studies suggest that Tai Chi (TC exercise can benefit bone health and may reduce oxidative stress, all studies were conducted using a relatively healthy older population, instead of a high-risk one such as osteopenic postmenopausal women. Therefore, this study was designed to test an intervention including green tea polyphenol (GTP and TC exercise for feasibility, and to quantitatively assess their individual and interactive effects on postmenopausal women with osteopenia. Methods/Design One hundred and forty postmenopausal women with osteopenia (defined as bone mineral density T-score at the spine and/or hip between 1 to 2.5 SD below the reference database were randomly assigned to 4 treatment arms: (1 placebo group receiving 500 mg medicinal starch daily, (2 GTP group receiving 500 mg of GTP per day, (3 placebo+TC group receiving both placebo treatment and TC training (60-minute group exercise, 3 times per week, and (4 GTP+TC group receiving both GTP and TC training for 24 weeks. The outcome measures were bone formation biomarker (serum bone alkaline phosphatase, bone resorption biomarker (serum tartrate resistant acid phosphatase, and oxidative DNA damage biomarker (urinary 8-hydroxy-2'-deoxyguanosine. All outcome measures were determined at baseline, 4, 12, and 24 weeks. Urinary and serum GTP concentrations were also determined at baseline, 4, 12, and 24 weeks for bioavailability. Liver function was monitored monthly for safety. A

  15. Conformations of peptide fragments comprising the complete sequence of component III of Chi t I and their relationship to T-cell stimulation. (United States)

    Czisch, M; Liebers, V; Bernstein, R; Chen, Z; Baur, X; Holak, T A


    Conformational preferences of synthetic peptides that span the complete sequence of Chironomus thummi hemoglobin (Chi t I) component III were studied by nuclear magnetic resonance (NMR) and CD spectroscopies. The peptides, 19-21 amino acids in length, were studied in water, except for the C-terminal peptide, which was investigated in DMSO-d6. NMR showed that all investigated peptides lacked uniquely folded conformations in water at 4 degrees C and pH 3.0 or at 10 degrees C and pD 6.6 in DMSO. However, some preferential helix-like conformations for the peptides corresponding to the helices of the folded protein could be seen in solution. These peptides showed characteristic interactions for conformations in both the beta- and alpha-regions of phi-psi space, based on strong C alpha H(i)-NH(i + 1) interactions, and on NH-NH, C alpha H(i)-NH-(i + 2), C alpha H(i)-NH(i + 3), and C alpha H(i)-C beta H(i + 3) interactions, respectively. Helical motifs seem not to be the most important factors in determining MHC-binding and/or T-cell recognition. However, there is a tendency that more stabilized secondary structures show higher T-cell stimulation. PMID:8068617

  16. Plasma YKL-40 and CHI3L1 in systemic inflammation and sepsis—Experience from two prospective cohorts

    DEFF Research Database (Denmark)

    Kornblit, Brian; Hellemann, Dorthe; Munthe-Fog, Lea;


    YKL-40, derived from the CHI3L1 gene, has been associated with outcome of infectious and inflammatory diseases. We hypothesized that plasma YKL-40 concentrations and CHI3L1 genotype could be used as prognostic biomarkers in the assessment of systemic inflammatory response syndrome (SIRS) and sepsis....... The objective of the study was to assess the prognostic value of plasma YKL-40 and CHI3L1 genotype in patients with SIRS and sepsis. Plasma YKL-40 and CHI3L1 genotype (rs4950928) were analyzed at time of admission to intensive care units (ICU), in two prospective cohorts of consecutive SIRS patients...... (cohort 1, n=272; cohort 2, n=502). The plasma YKL-40 cut-off for predicting survival was determined in cohort 1 by receiver operator characteristic analyses and validated in cohort 2. In cohort 1 patients with plasma YKL-40 ≤505ng/ml (area under the curve 0.64 (95% confidence interval (CI) 0.57-0.70), p...

  17. SURMAT : decision support tool to select municipal solid waste treatment technologies : case study in Ho Chi Minh City, Viet Nam

    NARCIS (Netherlands)

    Thi, Le K.O.


    The aim of this thesis is to enable taking more sustainable and cost-effective decisions on MSW management in developing cities. For this purpose, a tool named SURMAT was developed and applied using data of Ho Chi Minh City, Viet Nam (chapter 6). In order to prepare the tool for modeling of the MSW

  18. Production porcine dans les fermes d'Etat à Ho-Chi-Minh Ville/Viet-nam

    Directory of Open Access Journals (Sweden)

    Franceschetto, ML.


    Full Text Available Pig production in State farms at Ho-Chi-Minh Ville. Vietnam. An inquiry carried out in Guinea has revealed that the disappearance of trypanotolerance within some local N'Dama cattle can not be attributed to the vaccination campaign initiated against infectious bovine pleuropneumonia but to diverse environmental and animal management factors prevalant in these areas.

  19. Observation of chi(c1) Decays into Vector Meson Pairs phi phi, omega omega, and omega phi

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; An, L.; An, Q.; An, Z. H.; Bai, J. Z.; Baldini, R.; Ban, Y.; Becker, J.; Berger, N.; Bertani, M.; Bian, J. M.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Bytev, V.; Cai, X.; Cao, G. F.; Cao, X. X.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, Y.; Chen, Y. B.; Cheng, H. P.; Chu, Y. P.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dedovich, D.; Deng, Z. Y.; Denysenko, I.; Destefanis, M.; Ding, Y.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Duan, M. Y.; Fan, R. R.; Fang, J.; Fang, S. S.; Feng, C. Q.; Fu, C. D.; Fu, J. L.; Gao, Y.; Geng, C.; Goetzen, K.; Gong, W. X.; Greco, M.; Grishin, S.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y. P.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, M.; He, Z. Y.; Heng, Y. K.; Hou, Z. L.; Hu, H. M.; Hu, J. F.; Hu, T.; Huang, B.; Huang, G. M.; Huang, J. S.; Huang, X. T.; Huang, Y. P.; Hussain, T.; Ji, C. S.; Ji, Q.; Ji, X. B.; Ji, X. L.; Jia, L. K.; Jiang, L. L.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jing, F. F.; Kavatsyuk, M.; Komamiya, S.; Kuehn, W.; Lange, J. S.; Leung, J. K. C.; Li, Cheng; Li, Cui; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, Lei; Li, N. B.; Li, Q. J.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, X. R.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Liao, X. T.; Liu, B. J.; Liu, B. J.; Liu, C. L.; Liu, C. X.; Liu, C. Y.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, G. C.; Liu, H.; Liu, H. B.; Liu, H. M.; Liu, H. W.; Liu, J. P.; Liu, K.; Liu, K. Y.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. H.; Liu, Y. B.; Liu, Y. W.; Liu, Yong; Liu, Z. A.; Liu, Z. Q.; Loehner, H.; Lu, G. R.; Lu, H. J.; Lu, J. G.; Lu, Q. W.; Lu, X. R.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Ma, C. L.; Ma, F. C.; Ma, H. L.; Ma, Q. M.; Ma, T.; Ma, X.; Ma, X. Y.; Maggiora, M.; Malik, Q. A.; Mao, H.; Mao, Y. J.; Mao, Z. P.; Messchendorp, J. G.; Min, J.; Mitchell, R. E.; Mo, X. H.; Muchnoi, N. Yu.; Nefedov, Y.; Ning, Z.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Pelizaeus, M.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Pun, C. S. J.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, X. S.; Qiu, J. F.; Rashid, K. H.; Rong, G.; Ruan, X. D.; Sarantsev, A.; Schulze, J.; Shao, M.; Shen, C. P.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, X. Y.; Sonoda, S.; Spataro, S.; Spruck, B.; Sun, D. H.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, X. D.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tang, X. F.; Tian, H. L.; Toth, D.; Varner, G. S.; Wan, X.; Wang, B. Q.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q.; Wang, S. G.; Wang, X. L.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. Y.; Wei, D. H.; Wen, Q. G.; Wen, S. P.; Wiedner, U.; Wu, L. H.; Wu, N.; Wu, W.; Wu, Z.; Xiao, Z. J.; Xie, Y. G.; Xu, G. F.; Xu, G. M.; Xu, H.; Xu, Y.; Xu, Z. R.; Xu, Z. Z.; Xue, Z.; Yan, L.; Yan, W. B.; Yan, Y. H.; Yang, H. X.; Yang, M.; Yang, T.; Yang, Y.; Yang, Y. X.; Ye, M.; Ye, M. H.; Yu, B. X.; Yu, C. X.; Yu, L.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, L.; Zhang, S. H.; Zhang, T. R.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, H. S.; Zhao, Jiawei; Zhao, Jingwei; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, X. H.; Zhao, Y. B.; Zhao, Z. G.; Zhao, Z. L.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, Y. H.; Zheng, Z. P.; Zhong, B.; Zhong, J.; Zhong, L.; Zhou, L.; Zhou, X. K.; Zhou, X. R.; Zhu, C.; Zhu, K.; Zhu, K. J.; Zhu, S. H.; Zhu, X. L.; Zhu, X. W.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Zuo, J. X.; Zweber, P.


    Using (106 +/- 4) x 10(6) psi(3686) events accumulated with the BESIII detector at the BEPCII e(+) e(-) collider, we present the first measurement of decays of chi(c1) to vector meson pairs phi phi, omega omega, and omega phi. The branching fractions are measured to be (4.4 +/- 0.3 +/- 0.5) x 10(-4)

  20. Modelling and evaluating municipal solid waste management strategies in a mega-city: The case of Ho Chi Minh City

    NARCIS (Netherlands)

    ThiKimOanh, L.; Bloemhof-Ruwaard, J.M.; Buuren, van J.C.L.; Vorst, van der J.G.A.J.; Rulkens, W.H.


    Ho Chi Minh City is a large city that will become a mega-city in the near future. The city struggles with a rapidly increasing flow of municipal solid waste and a foreseeable scarcity of land to continue landfilling, the main treatment of municipal solid waste up to now. Therefore, additional munici

  1. Effectiveness of a Tai-Chi Training and Detraining on Functional Capacity, Symptomatology and Psychological Outcomes in Women with Fibromyalgia

    Directory of Open Access Journals (Sweden)

    Alejandro Romero-Zurita


    Full Text Available Background. The purpose was to analyze the effects of Tai-Chi training in women with fibromyalgia (FM. Methods. Thirty-two women with FM (mean age, 51.4±6.8 years attended to Tai-Chi intervention 3 sessions weekly for 28 weeks. The outcome measures were: tenderness, body composition, functional capacity and psychological outcomes (Fibromyalgia impact questionnaire (FIQ, Short Form Health Survey 36 (SF-36. Results. Patients showed improvements on pain threshold, total number of tender points and algometer score (all <0.001. The intervention was effective on 6-min walk (=0.006, back scratch (=0.002, handgrip strength (=0.006, chair stand, chair sit & reach, 8 feet up & go and blind flamingo tests (all <0.001. Tai-Chi group improved the FIQ total score (<0.001 and six subscales: stiffness (=0.005, pain, fatigue, morning tiredness, anxiety, and depression (all <0.001. The intervention was also effective in six SF-36 subscales: bodily pain (=0.003, vitality (=0.018, physical functioning, physical role, general health, and mental health (all <0.001. Conclusions. A 28-week Tai-Chi intervention showed improvements on pain, functional capacity, symptomatology and psychological outcomes in female FM patients.

  2. A bijection which implies Melzer's polynomial identities: the $\\chi_{1,1}^{(p,p+1)}$ case


    Foda, O.; Warnaar, S. O.


    We obtain a bijection between certain lattice paths and partitions. This implies a proof of polynomial identities conjectured by Melzer. In a limit, these identities reduce to Rogers--Ramanujan-type identities for the $\\chi_{1,1}^{(p,p+1)}(q)$ Virasoro characters, conjectured by the Stony Brook group.

  3. A bijection which implies Melzer's polynomial identities the $\\chi${1,1}^{(p,p+1)} case

    CERN Document Server

    Foda, O E; Foda, O; Warnaar, S O


    We obtain a bijection between certain lattice paths and partitions. This implies a proof of polynomial identities conjectured by Melzer. In a limit, these identities reduce to Rogers--Ramanujan-type identities for the \\chi_{1,1}^{(p,p+1)}(q) Virasoro characters, conjectured by the Stony Brook group.

  4. Measures of effect size for chi-squared and likelihood-ratio goodness-of-fit tests. (United States)

    Johnston, Janis E; Berry, Kenneth J; Mielke, Paul W


    A fundamental shift in editorial policy for psychological journals was initiated when the fourth edition of the Publication Manual of the American Psychological Association (1994) placed emphasis on reporting measures of effect size. This paper presents measures of effect size for the chi-squared and the likelihood-ratio goodness-of-fit statistic tests. PMID:17165404

  5. The effects of Tai Chi on fall prevention, fear of falling and balance in older people: a meta-analysis.

    NARCIS (Netherlands)

    Logghe, I.H.; Verhagen, A.P.; Rademaker, A.C.; Bierma-Zeinstra, S.M.; Rossum, E. van; Faber, M.J.; Koes, B.W.


    OBJECTIVE: Tai Chi (TC) is an exercise training that is becoming increasingly popular as an intervention for single fall prevention. This meta-analysis was performed to evaluate the efficacy of TC on fall rate, fear of falling and balance in older people. METHODS: Randomized controlled trials publis

  6. Feasibility and effectiveness of a Chen-style Tai Chi programme for stress reduction in junior secondary school students. (United States)

    Lee, Linda Y K; Chong, Yeuk Lan; Li, Ngai Yin; Li, Man Chung; Lin, Lai Na; Wong, Lee Yi; Wong, Brian Kit; Yip, Wing Ping; Hon, Cho Hang; Chung, Pui Kuen; Man, Shuk Yee


    Stress is common in junior secondary school students (JSSS). This study aimed to determine the feasibility and effectiveness of a Chen-style Tai Chi programme for stress reduction in JSSS. A non-equivalent pre-test/post-test control group design was adopted, and a convenience sample of 69 JSSS was recruited. The experimental group (n = 32) joined a Chen-style Tai Chi programme, which included 10 sessions of 80-minute Tai Chi training (one session per week). The control group (n = 37) proceeded with self-study. Participants' stress levels were assessed using the Perceived Stress Scale. Feasibility was determined as the percentage of participants completing and attending the programme. Effectiveness was measured as the significant difference in changes in stress levels before and after the intervention between the two groups. Results preliminarily supported that the programme was feasible for JSSS. Completion rate was 100%, and attendance rate was 90%. However, no significant difference was noted in changes in stress levels before and after the intervention between the two groups. The potential health benefits of Tai Chi could not be detected owing to the restrictions imposed by the research setting and study limitations. The present study represents initial efforts in this direction and serves as reference for future study. PMID:22674634

  7. Fragmentation contributions to hadroproduction of prompt $J/\\psi$ and $\\chi_{cJ}$ states

    CERN Document Server

    Bodwin, Geoffrey T; Chung, Hee Sok; Kim, U-Rae; Lee, Jungil; Ma, Yan-Qing


    We compute fragmentation corrections to hadroproduction of the quarkonium states $J/\\psi$, $\\chi_{cJ}$, and $\\psi(2S)$ at leading power in $m_c/p_T$, where $m_c$ is the charm-quark mass and $p_T$ is the quarkonium transverse momentum. The computation is carried out in the framework of nonrelativistic QCD. We include corrections to the parton-production cross sections through next-to-leading order in the strong coupling $\\alpha_s$ and corrections to the fragmentation functions through second order in $\\alpha_s$. We also sum leading logarithms of $p_T^2/m_c^2$ to all orders in perturbation theory. We find that, when we combined these leading-power fragmentation corrections with fixed-order calculations through next-to-leading order in $\\alpha_s$, we are able to obtain good fits for $p_T\\geq 10$ GeV to hadroproduction cross sections that were measured at the Tevatron and the LHC. Using values for the nonperturbative long-distance matrix elements that we extract from the cross-section fits, we make predictions fo...

  8. Impacts of Land Cover Changes on Hydrologic Responses: A Case Study of Chi River Basin, Thailand (United States)

    Homdee, Tipaporn; Pongput, Kobkiat; Kanae, Shinjiro

    Land use and land cover (LULC) have been continuously changing, through human activities, leading to variations in hydrological cycle. In this study, we applied SWAT model to investigate potential impacts of LULC on water budget of the Chi river basin in Thailand. Five plausible scenarios of land use change were evaluated, including an conversion of forested area, expansion of farmland, switching of rice paddy fields to energy crops and two scenarios involving conversion of farmland to rice and sugarcane plantation. The results indicated that different land use scenarios contributed to various effects in annual and seasonal water yield and evapotranspiration (ET). Conversion of forested area and farmland showed slightly small changes on water flows and ET. Substitution of paddy fields by sugarcane plantation showed clearly reduced water flows and increased ET by almost 5.0% in dry season. Particularly, in case of expansion of rice paddy fields to farmland, small changes occur on annual flow and ET but more significant effect occur on seasonal flows. The results showed decrease in ET by nearly 12.0%, leading to increase of water yield by up to 5.1% during dry season. Finally, conversion of farmland to sugarcane plantation for biofuel production showed significant effect on seasonal ET, mainly decreasing in dry season by 4.5 % but small changes were detected on water yields.

  9. Tai chi chuan exercise for patients with breast cancer: a systematic review and meta-analysis. (United States)

    Pan, Yuanqing; Yang, Kehu; Shi, Xiue; Liang, Haiqian; Zhang, Fengwa; Lv, Qingfang


    Objective. Tai Chi Chuan (TCC) is a form of aerobic exercise that may be an effective therapy for improving psychosomatic capacity among breast cancer survivors. This meta-analysis analyzed the available randomized controlled trials (RCTs) on the effects of TCC in relieving treatment-related side effects and quality of life in women with breast cancer. Methods. RCTs were searched in PubMed, Embase, Web of Science, and Cochrane Library through April 2014. Data were analyzed on pathology (pain, interleukin-6, and insulin-like growth factor 1), physical capacity (handgrip, limb physical fitness, and BMI), and well-being (physical, social, emotional, and general quality of life). Results. Nine RCTs, including a total of 322 breast cancer patients, were examined. Compared with control therapies, the pooled results suggested that TCC showed significant effects in improving handgrip dynamometer strength, limb elbow flexion (elbow extension, abduction, and horizontal adduction). No significant differences were observed in pain, interleukin-6, insulin-like growth factor, BMI, physical well-being, social or emotional well-being, or general health-related quality of life. Conclusion. The short-term effects of TCC may have potential benefits in upper limb functional mobility in patients with breast cancer. Additional randomized controlled trials with longer follow-up are needed to provide more reliable evidence. PMID:25793000

  10. Tai Chi Chuan Exercise for Patients with Breast Cancer: A Systematic Review and Meta-Analysis

    Directory of Open Access Journals (Sweden)

    Yuanqing Pan


    Full Text Available Objective. Tai Chi Chuan (TCC is a form of aerobic exercise that may be an effective therapy for improving psychosomatic capacity among breast cancer survivors. This meta-analysis analyzed the available randomized controlled trials (RCTs on the effects of TCC in relieving treatment-related side effects and quality of life in women with breast cancer. Methods. RCTs were searched in PubMed, Embase, Web of Science, and Cochrane Library through April 2014. Data were analyzed on pathology (pain, interleukin-6, and insulin-like growth factor 1, physical capacity (handgrip, limb physical fitness, and BMI, and well-being (physical, social, emotional, and general quality of life. Results. Nine RCTs, including a total of 322 breast cancer patients, were examined. Compared with control therapies, the pooled results suggested that TCC showed significant effects in improving handgrip dynamometer strength, limb elbow flexion (elbow extension, abduction, and horizontal adduction. No significant differences were observed in pain, interleukin-6, insulin-like growth factor, BMI, physical well-being, social or emotional well-being, or general health-related quality of life. Conclusion. The short-term effects of TCC may have potential benefits in upper limb functional mobility in patients with breast cancer. Additional randomized controlled trials with longer follow-up are needed to provide more reliable evidence.

  11. An Efficient Algorithm for Auto Upload and Chi-Square Test on Application Software

    Directory of Open Access Journals (Sweden)

    Sampada Kembhavi


    Full Text Available In this paper we proposed a novel algorithm for auto uploading the data in the cloud environment without any license consideration and suggest a novel framework where data is auto upload after a proper authentication and processing their task (gathering and sharing in the cloud environment. Here we present the authentication process with auto uploading process. We also use the traditional method of data uploading, data gathering and sharing. So that we compare our statistics. We use object oriented programing (OOP programs as a data which is used for data sharing and gathering. We use java programs for comparison. Then we apply Chi-Square test, to test the hypothesis for correctness. Then we check the program capability under three parameters; first is F-measure (FM, second is odds ratio (OR and third is power (PO. Based on the three parameters we can find the better application software as a service approach. Based on the above phenomena we can compare the execution time in different operating application with the help of software quality metrics.

  12. The pragmatic import of pronominal usage in chiShona discourse

    Directory of Open Access Journals (Sweden)

    Pedzisai Mashiri


    Full Text Available This article discusses the pragmatic significance of chiShona pronouns by examining the use of different pronouns: personal, enumerative, and demonstrative, and by demonstrating their address and referential value and social meanings. Two important issues are addressed.  First, we demonstrate that a purely grammatical analysis of pronouns, which emphasise the internal analysis and the anaphoric function of pronouns, fails to capture the complexity of pronominal usage in ordinary conversations. Second, the discourses that we analyse in this article demonstrate how in particular communicational contexts, specific speakers use pronouns to index referents other than the ones conventionally associated with a particular pronominal form in an analysis based on grammatical analysis. For example, besides its generic self-reference, the first person pronoun may be used to refer to a second or third person. The second person pronoun, apart from having a second person reference, can, be used as a second first or third person reference. The third person may, apart from its conventional reference, be used to mean either the first or second person. The pronoun switches also involve indirectness, reflecting a wide range of social meanings which have politeness  implications.

  13. Performance test of RM CLEAN and its evaluation with chi-square value

    CERN Document Server

    Miyashita, Yoshimitsu; Takahashi, Keitaro


    RM CLEAN is a standard method to reconstruct the distribution of cosmic magnetic fields and polarized sources along the line of sight (LOS) from observed polarization spectrum. This method is similar to the CLEAN algorithm for aperture synthesis radio telescope images but it is rather unclear in what cases RM CLEAN works well. In this paper, we evaluate the performance of RM CLEAN by simulating spectro-polarimetric observations of two compact sources located in the same LOS, varying the relative initial polarization angle and Faraday depth systematically. Especially, we focus on if the two polarized sources can be resolved in the Faraday depth space and how well the source parameters can be estimated. We confirm the previous studies that two sources cannot be resolved when they are closely located in the Faraday depth space for specific values of the relative initial polarization angle. Further, we calculate the chi-square value for the fit between the mock data of polarization spectrum and the one from RM CL...

  14. Numerical investigation and optimization of multi-pulse CHI spheromak performance (United States)

    O'Bryan, J. B.; Romero-Talamas, C. A.; Woodruff, S.


    Nonlinear extended-MHD computation with the NIMROD code is used to explore spheromak formation and sustainment with multi-pulse coaxial helicity injection (CHI). The goal of this research is to optimize spheromak performance in order to find candidate modes of operation for future experimental studies. We are modeling multiple specific shots from the Sustained Spheromak Physics eXperiment (SSPX) to both diagnose the parameters that affect efficiency--in particular, how the injector current and bias flux affect plasma confinement and magnetic helicity content relative to injected power--and to validate the numerical model. Preliminary results show quantitative agreement between several synthetic and experimental diagnostic measurements. The results also find--in addition to changing the magnetic topology and being the mechanism for poloidal flux amplification [E.B. Hooper et al. PPCF 2012]--the non-axisymmetric column mode decreases the decay rate of magnetic helicity relative to the injected current. Operational regimes will eventually be extended beyond those achieved in SSPX. We are also exploring the effect of the flux conserver and injector geometries on spheromak performance. This work is supported by DARPA under grant no. N66001-14-1-4044.

  15. A Deep Spitzer Survey of Circumstellar Disks in the Young Double Cluster, h and chi Persei

    CERN Document Server

    Cloutier, Ryan; Rieke, George; Kenyon, Scott J; Balog, Zoltan; Jayawardhana, Ray


    We analyze very deep IRAC and MIPS photometry of $\\sim$ 12,500 members of the 14 Myr old Double Cluster, h and $\\chi$ Persei, building upon on our earlier, shallower Spitzer studies (Currie et al. 2007a, 2008a). Numerous likely members show infrared (IR) excesses at 8 {\\mu}m and 24 $\\mu$m indicative of circumstellar dust. The frequency of stars with 8 $\\mu$m excess is at least 2% for our entire sample, slightly lower (higher) for B/A stars (later type, lower-mass stars). Optical spectroscopy also identifies gas in about 2% of systems but with no clear trend between the presence of dust and gas. Spectral energy distribution (SED) modeling of 18 sources with detections at optical wavelengths through MIPS 24 $\\mu m$ reveals a diverse set of disk evolutionary states, including a high fraction of transitional disks, although similar data for all disk-bearing members would provide better constraints. We combine our results with those for other young clusters to study the global evolution of dust/gas disks. For nomi...

  16. A chi-squared-transformed subspace of LBP histogram for visual recognition. (United States)

    Ren, Jianfeng; Jiang, Xudong; Yuan, Junsong


    Local binary pattern (LBP) and its variants have been widely used in many recognition tasks. Subspace approaches are often applied to the LBP feature in order to remove unreliable dimensions, or to derive a compact feature representation. It is well-known that subspace approaches utilizing up to the second-order statistics are optimal only when the underlying distribution is Gaussian. However, due to its nonnegative and simplex constraints, the LBP feature deviates significantly from Gaussian distribution. To alleviate this problem, we propose a chi-squared transformation (CST) to transfer the LBP feature to a feature that fits better to Gaussian distribution. The proposed CST leads to the formulation of a two-class classification problem. Due to its asymmetric nature, we apply asymmetric principal component analysis (APCA) to better remove the unreliable dimensions in the CST feature space. The proposed CST-APCA is evaluated extensively on spatial LBP for face recognition, protein cellular classification, and spatial-temporal LBP for dynamic texture recognition. All experiments show that the proposed feature transformation significantly enhances the recognition accuracy. PMID:25769153


    Directory of Open Access Journals (Sweden)



    Full Text Available ABSTRACT: Syringomyelia is an unusual neurological condition characterised by the the presence of cystic cavity in the spinal cord resultin g in neurological manifestations. Here, we report a safe anesthetic management of patient with Arnold-Ch iari malformation type I and syringomyelia posted for foramen magnum decompression . INTRODUCTION: Arnold-Chiari malformation (ACM is a developmental malformation characterised by downward displacement of cerebellar tonsils into spinal canal due to reduced capacity of the posterior fossa. ACM may be complicate d by other malformations like Platybasia, basilar invagination and occipitalization although S yringomyelia (SM is most commonly seen. [1] There are four types of ACM; types I – IV. Type I ACM manifests with headaches, neck pain, and mild co-ordination problems mostly asymptomatic a nd discovered on brain or cervical spine MRI scans. It has adult onset characterised by downward displacement of cerebellar tonsils and medulla through the foramen magnum. [2] Syringomyelia is an unusual neurological condition characterised by the presence of fluid filled cystic cavity or syrinx within the spin al cord. Ollivies d’ Angers (1827 coined the term syringomyelia from two greek words meaning “ch annel” and “marroin”. [3] It has a prevalence of 8.4 per 100,000 and occurs more frequen tly in men than in women in the third or fourth decade of life. Rarely, it may develop in chi ldhood or late adulthood. [4

  18. Tai Chi Chuan modulates heart rate variability during abdominal breathing in elderly adults. (United States)

    Wei, Gao-Xia; Li, You-Fa; Yue, Xiao-Lin; Ma, Xiao; Chang, Yu-Kai; Yi, Long-Yan; Li, Jing-Cheng; Zuo, Xi-Nian


    Tai Chi Chuan (TCC) practice is currently intentionally applied in clinical populations, especially those with cardiovascular diseases because of its potential benefits on the autonomic nervous system. The long-term effect of TCC practice on heart rate variability (HRV) remains largely unknown. In this study, we recruited 23 TCC practitioners whose experience averaged approximately 21 years and 19 controls matched by age, sex and education to examine the effect of TCC practice on the autonomic nervous system during a resting state and during an abdominal breathing state. HRV was measured by traditional electrocardiogram (ECG) recording. The results showed that the low frequency, total power frequency, and normalized low frequency components and the low-frequency/high-frequency ratio were significantly higher, whereas the normalized high frequency was significantly lower in the TCC practitioners relative to controls during the abdominal breathing state. However, we did not detect any significant difference in the HRV measures during the resting state between the two groups. Additionally, TCC experience did not correlate with HRV components either in the abdominal state or the resting state in the TCC group. Considering all of these findings, we suggest that TCC improves vagal activity and the balance between sympathetic and parasympathetic activity during the relaxation state. This study also provides direct physiological evidence for the role of TCC practice in relaxation. PMID:26377754

  19. High Resolution Rapid Response Observations of Compact Radio Sources with the Ceduna Hobart Interferometer (CHI) (United States)

    Blanchard, Jay M.; Lovell, James E. J.; Ojha, Roopesh; Kadler, Matthias; Dickey, John M.; Edwards, Philip G.


    Context. Frequent, simultaneous observations across the electromagnetic spectrum are essential to the study of a range of astrophysical phenomena including Active Galactic Nuclei. A key tool of such studies is the ability to observe an object when it flares i.e. exhibits a rapid and significant increase in its flux density. Aims. We describe the specific observational procedures and the calibration techniques that have been developed and tested to create a single baseline radio interferometer. that can rapidly observe a flaring object. This is the only facility that is dedicated to rapid high resolution radio observations of an object south of -30 degrees declination. An immediate application is to provide rapid contemporaneous radio coverage of AGN flaring at y-ray frequencies detected by the Fermi Gamma-ray Space Telescope. Methods. A single baseline interferometer was formed with radio telescopes in Hobart, Tasmania and Ceduna, South Australia. A software correlator was set up at the University of Tasmania to correlate these data. Results. Measurements of the flux densities of flaring objects can be made using our observing strategy within half an hour of a triggering event. These observations can be calibrated with amplitude errors better than 20%. Lower limits to the brightness temperatures of the sources can also be calculated using CHI. Key words. instrumentation:interferometers - galaxies:active - galaxies:jets - galaxies:nuclei quasars:general gamma rays:galaxies- 1.

  20. Minimally non-local nucleon-nucleon potentials in $\\chi$EFT at order $Q^4$

    CERN Document Server

    Piarulli, M; Schiavilla, R; Pérez, R Navarro; Amaro, J E; Arriola, E Ruiz


    We construct a coordinate-space chiral potential, including $\\Delta$-isobar intermediate states in its two-pion-exchange component. The contact interactions entering at next-to-leading and next-to-next-to-next-to-leading orders ($Q^2$ and $Q^4$, respectively, $Q$ denoting generically the low momentum scale) are rearranged by Fierz transformations to yield terms at most quadratic in the relative momentum operator of the two nucleons. The low-energy constants multiplying these contact interactions are fitted to the 2013 Granada database, consisting of 2309 $pp$ and 2982 $np$ data (including, respectively, 148 and 218 normalizations) in the laboratory-energy range 0--300 MeV. For the total 5291 $pp$ and $np$ data in this range, we obtain a $\\chi^2$/datum of roughly 1.3 for a set of three models characterized by long- and short-range cutoffs, $R_{\\rm L}$ and $R_{\\rm S}$ respectively, ranging from $(R_{\\rm L},R_{\\rm S})=(1.2,0.8)$ fm down to $(0.8,0.6)$ fm. The long-range (short-range) cutoff regularizes the one- ...

  1. Effects of Tai Chi Training on Antioxidant Capacity in Pre- and Postmenopausal Women

    Directory of Open Access Journals (Sweden)

    Attakorn Palasuwan


    Full Text Available The risk of oxidative stress-related metabolic diseases increases with menopause and physical inactivity. We hypothesized that an 8-week Tai Chi (TC training program (2 sessions in class; 2 sessions at home; 1-1:15/session would improve antioxidant capacity and reduce cardiovascular risks in both pre- (n=8 and postmenopausal (n=7 sedentary women. Selected measures of physical fitness and blood parameters were analyzed before and after the program. Besides the well-known effects of TC on balance, flexibility, and maximum leg extensor strength, TC (1 increased erythrocyte glutathione peroxidase activity—an aerobic training-responsive antioxidant enzyme—and plasma total antioxidant status and (2 decreased plasma total homocysteine, a cardiovascular risk marker. In addition to being a low-velocity, low-impact, and relatively safe, TC is a suitable physical activity design for pre- and postmenopausal women to increase antioxidant defenses. Investigating breathing effects during TC movements would be an interesting area for further research in diseases prevention.

  2. Changes in heart-rate variability of survivors of nasopharyngeal cancer during Tai Chi Qigong practice. (United States)

    Fong, Shirley S M; Wong, Janet Y H; Chung, Louisa M Y; Yam, Timothy T T; Chung, Joanne W Y; Lee, Y M; Chow, Lina P Y; Luk, W S; Ng, Shamay S M


    [Purpose] To explore the changes in heart-rate variability (HRV) of survivors of nasopharyngeal cancer (NPC) before, during, and after a Tai Chi (TC) Qigong exercise. [Subjects and Methods] Eleven survivors of NPC participated voluntarily in the study. The heart rate of each participant was measured continuously for 1 minute before the TC Qigong intervention, during the 5-minute TC Qigong intervention, and for 1 minute after the intervention, using a Polar heart-rate monitor. Spectral HRV was expressed in terms of normalised low frequency (LF) power, normalised high frequency (HF) power, and the low frequency/high frequency (LF/HF) power ratio. [Results] Both the LF-power and the HF-power components had significant time effects. However, the time effect of the LF/HF power ratio was not significant. Post hoc contrast analysis revealed a significant decrease in LF power and a concomitant increase in HF power during the 4th minute and 5th minute of the TC Qigong exercise. [Conclusion] Five minutes of TC Qigong exercise was found to improve HRV by increasing HF power and decreasing LF power, but these effects were transient. TC Qigong might be an appropriate exercise for improving the ANS function and psychological and cardiac health of survivors of NPC. PMID:26157266

  3. Perspectives for the measurement of the {chi}{sub c} radiative decay in the ALICE experiment at the LHC

    Energy Technology Data Exchange (ETDEWEB)

    Marin, Ana [GSI, Darmstadt (Germany); Gonzalez, Pedro; Ladron de Guevara, Pedro; Serradilla, Eulogio [Centro de Investigaciones Energeticas, Medioambientales y Tecnologicas, Madrid (Spain); Lopez Torres, Ernesto [CEADEN, Ciudad Habana (Cuba)


    Heavy quarkonia are considered as very promising probes for the deconfinement of the hot and dense matter formed in relativistic heavy-ion collisions. J/{psi} suppression in central heavy-ion collisions beyond expectations from a pure nuclear absorption scenario has been observed at CERN SPS and RHIC energies. Measuring the fraction of J/{psi} resulting from {chi}{sub c} and {psi}{sup '} decays in pp and in heavy-ion collisions would help further understanding the mechanism for the suppression. The LHC will provide pp (PbPb) collisions up to {radical}(s)=14 TeV ({radical}(s{sub NN})= 5.5 TeV). The three experiments (ATLAS, CMS and ALICE) have a large program devoted to quarkonia measurements (J/{psi}, {psi}{sup '}, {upsilon}). Moreover, Monte Carlo studies demonstrate that, with the ALICE detector, it should be possible to reconstruct and separate the {chi}{sub c1} and {chi}{sub c2} in the radiative channel J/{psi}+{gamma}, as two separated peaks. The low momentum photon from the decay is measured by reconstructing in the central barrel the e{sup +}e{sup -} pairs from photons converted mainly in the ITS material. The overall efficiency expected for {chi}{sub c} reconstruction is about 0.9%. For pp collisions, the rate of observable {chi}{sub c}'s is expected to be 1.2 x 10{sup -3} per second, assuming a luminosity of 10{sup 30} cm{sup -2}s{sup -1} and a perfect trigger. An overview of the reconstruction method as well as expected results in pp collisions at LHC is presented.

  4. Resonant Nucleation

    CERN Document Server

    Gleiser, M; Gleiser, Marcelo; Howell, Rafael


    We investigate the role played by fast quenching on the decay of metastable (or false vacuum) states. Instead of the exponentially-slow decay rate per unit volume, $\\Gamma_{\\rm HN} \\sim \\exp[-E_b/k_BT]$ ($E_b$ is the free energy of the critical bubble), predicted by Homogeneous Nucleation theory, we show that under fast enough quenching the decay rate is, in fact, a power law $\\Gamma_{\\rm RN} \\sim [E_b/k_BT]^{-B}$, where $B$ is weakly sensitive to the temperature. We argue that the fast quench generates large-amplitude fluctuations about the metastable state which promote its rapid decay via parametric resonance. Possible decay mechanisms and their dependence on $E_b$ are proposed and illustrated in a (2+1)-dimensional scalar field model with an asymmetric double-well potential.

  5. Applied neutron resonance theory

    International Nuclear Information System (INIS)

    Utilisation of resonance theory in basic and applications-oriented neutron cross section work is reviewed. The technically important resonance formalisms, principal concepts and methods as well as representative computer programs for resonance parameter extraction from measured data, evaluation of resonance data, calculation of Doppler-broadened cross sections and estimation of level-statistical quantities from resonance parameters are described. (orig.)

  6. Resonant optical rectification in bacteriorhodopsin. (United States)

    Groma, Géza I; Colonna, Anne; Lambry, Jean-Christophe; Petrich, Jacob W; Váró, György; Joffre, Manuel; Vos, Marten H; Martin, Jean-Louis


    The relative role of retinal isomerization and microscopic polarization in the phototransduction process of bacteriorhodopsin is still an open question. It is known that both processes occur on an ultrafast time scale. The retinal trans-->cis photoisomerization takes place on the time scale of a few hundred femtoseconds. On the other hand, it has been proposed that the primary light-induced event is a sudden polarization of the retinal environment, although there is no direct experimental evidence for femtosecond charge displacements, because photovoltaic techniques cannot be used to detect charge movements faster than picoseconds. Making use of the known high second-order susceptibility chi(2) of retinal in proteins, we have used a nonlinear technique, interferometric detection of coherent infrared emission, to study macroscopically oriented bacteriorhodopsin-containing purple membranes. We report and characterize impulsive macroscopic polarization of these films by optical rectification of an 11-fs visible light pulse in resonance with the optical transition. This finding provides direct evidence for charge separation as a precursor event for subsequent functional processes. A simple two-level model incorporating the resonant second-order optical properties of retinal, which are known to be a requirement for functioning of bacteriorhodopsin, is used to describe the observations. In addition to the electronic response, long-lived infrared emission at specific frequencies was observed, reflecting charge movements associated with vibrational motions. The simultaneous and phase-sensitive observation of both the electronic and vibrational signals opens the way to study the transduction of the initial polarization into structural dynamics. PMID:15148391

  7. MRI (Magnetic Resonance Imaging) (United States)

    ... Procedures Medical Imaging MRI (Magnetic Resonance Imaging) MRI (Magnetic Resonance Imaging) Share Tweet Linkedin Pin it More sharing options ... 8 MB) Also available in Other Language versions . Magnetic Resonance Imaging (MRI) is a medical imaging procedure for making ...

  8. CLARITY – ChiLdhood Arthritis Risk factor Identification sTudY

    Directory of Open Access Journals (Sweden)

    Ellis Justine A


    Full Text Available Abstract Background The aetiology of juvenile idiopathic arthritis (JIA is largely unknown. We have established a JIA biobank in Melbourne, Australia called CLARITY – ChiLdhood Arthritis Risk factor Identification sTudY, with the broad aim of identifying genomic and environmental disease risk factors. We present here study protocols, and a comparison of socio-demographic, pregnancy, birth and early life characteristics of cases and controls collected over the first 3 years of the study. Methods Cases are children aged ≤18 years with a diagnosis of JIA by 16 years. Controls are healthy children aged ≤18 years, born in the state of Victoria, undergoing a minor elective surgical procedure. Participant families provide clinical, epidemiological and environmental data via questionnaire, and a blood sample is collected. Results Clinical characteristics of cases (n = 262 are similar to those previously reported. Demographically, cases were from families of higher socio-economic status. After taking this into account, the residual pregnancy and perinatal profiles of cases were similar to control children. No case-control differences in breastfeeding commencement or duration were detected, nor was there evidence of increased case exposure to tobacco smoke in utero. At interview, cases were less likely to be exposed to active parental smoking, but disease-related changes to parent behaviour may partly underlie this. Conclusions We show that, after taking into account socio-economic status, CLARITY cases and controls are well matched on basic epidemiological characteristics. CLARITY represents a new study platform with which to generate new knowledge as to the environmental and biological risk factors for JIA.

  9. Energy and macronutrient intakes in preschool children in urban areas of Ho Chi Minh City, Vietnam

    Directory of Open Access Journals (Sweden)

    Sibbritt David W


    Full Text Available Abstract Background An increasing prevalence of overweight and obesity has been documented in preschool children in Ho Chi Minh City (HCMC, Vietnam. However, little is known about what preschool children in HCMC eat or how well their nutrient intake meets nutrient recommendations. This study aims to describe the energy and macronutrient intake and compare these nutrient intakes with the recommendations for Vietnamese children aged four to five years. Methods The data comes from the baseline measurement of a one year follow-up study on obesity in 670 children attending kindergartens in HCMC. Dietary information for each child at the school and home settings was collected using Food Frequency Questionnaires (FFQs, by interviewing teachers and parents or main caregivers. The average energy and nutrient intake in a day was calculated. The proportion of children with energy intake from macronutrients meeting or exceeding the recommendations was estimated based on the 2006 recommended daily allowance (RDA for Vietnamese children in this age group. Results The dietary intake of the participants contained more energy from protein and fat, particularly animal protein and fat, and less energy from carbohydrates, than the RDA. Most children (98.1% had mean energy intake from protein greater than the recommended level of 15%, and no child obtained energy from animal fat that was in accordance with the recommendation of less than 30% of the total fat intake. Nearly one half of children (46.5% consumed less than the advised range of mean energy intake from carbohydrate (60%–70%. Conclusion In this preschool child population in HCMC, in which obesity is emerging as major public health problem, there is an imbalance in dietary intake. Healthy eating programs need to be developed as a part of an obesity prevention program for young children in HCMC.

  10. Os efeitos do método Ai Chi em pacientes portadoras da síndrome fibromiálgica The effect of Ai Chi method in fybromialgic patients

    Directory of Open Access Journals (Sweden)

    Jacqueline Soares de Santana


    Full Text Available O objetivo do estudo é demonstrar os efeitos do método Ai Chi como forma alternativa de abordagem hidroterapêutica em pacientes portadoras da síndrome fibromiálgica. Foram estudados dez pacientes; quatro fizeram parte do grupo experimento e cinco, do grupo controle, com uma desistência. As pacientes foram avaliadas através do Questionário de Impacto da Fibromialgia (QIF e da Escala de Intensidade e Índice de dor nos Pontos Sensíveis. Foram realizadas duas avaliações, uma antes e outra após o tratamento. As pacientes foram submetidas a dez sessões do método Ai Chi, com duração de quarenta minutos. Houve melhora na intensidade da dor, de acordo com a escala da intensidade de dor nos pontos sensíveis, após a intervenção; já a qualidade de vida manteve-se sem alteração. Na qualidade de vida, observou-se que os grupos obtiveram resultados semelhantes; isso se deve ao fato que as pacientes não apresentaram melhora no seu estado depressivo. No índice dos pontos sensíveis, verificou-se diferença entre os grupos. A explicação para essa diferença deve-se possivelmente aos benefícios da imersão em água aquecida e aos efeitos do método Ai Chi. Não houve diferença significativa entre os grupos, o que pode ser atribuído às limitações do estudo. Desta forma, torna-se relevante a realização de novos estudos referentes à aplicação do método Ai Chi em pacientes portadoras da síndrome fibromiálgica.The objective of this article is to show the effect of the Ai Chi method, as an alternative form of hydrotherapeutic approach in fibromyalgia syndrome patients. Ten patients were studied, four were part of the experiment group and five of the control group, with one desistance. The patients were evaluated through the Fibromyalgia Impact Questionnaire (QIF and Scale of Intensity and Index of pain in Sensible Points. Two evaluations were performed, before and after the treatment. The patients were submitted to ten sessions

  11. Resonances, resonance functions and spectral deformations

    International Nuclear Information System (INIS)

    The present paper is aimed at an analysis of resonances and resonance states from a mathematical point of view. Resonances are characterized as singular points of the analytically continued Lippman-Schwinger equation, as complex eigenvalues of the Hamiltonian with a purely outgoing, exponentially growing eigenfunction, and as poles of the S-matrix. (orig./HSI)

  12. Magnetic resonance angiography (United States)

    MRA; Angiography - magnetic resonance ... Kwong RY. Cardiovascular Magnetic Resonance Imaging. In: Bonow RO, Mann DL, Zipes DP, Libby P, eds. Braunwald's Heart Disease: A Textbook of Cardiovascular Medicine . ...

  13. There is the second virus that causes tobacco leaf curl disease (not TbLCV-CHI) in the field

    Institute of Scientific and Technical Information of China (English)


    Sequence analysis of virus isolation DNA of tobacco leaf curl disease shows that there is the second geminivirus (not Chinese Tobacco Leaf Curl Virus, TbLCV-CHI) that causes tobacco leaf curl disease in the field in the Guangxi Zhuang Autonomous Region, China. This virus DNA-A contains 2 734 nt. Large intergenic region (LIR) contains 269 nt, the virus sense strand contains 2 open reading frames (ORFs): AV1 (115 aa) and AV2 (coat protein gene, CP, 256 aa), and the complementary sense strand contains 4 ORFs: AC1 (replicase gene, 361 aa), AC2 (transactivator, 134 aa), AC3 (134 aa) and AC4 (97 aa). The virus belongs to one kind of subgroup Ⅲ gemini- viruses from old world, and could be the Chinese tomato yellow leaf curl virus (TYLCV-CHI).

  14. The Impact of New Execution Venues on European Equity Markets' Liquidity - The Case of Chi-X (United States)

    Chlistalla, Michael; Lutat, Marco

    With the Markets in Financial Instruments Directive in effect since November 2007, new trading venues have emerged in European equities trading, among them Chi-X. This paper analyzes the impact of this new market entrant on the home market as well as on consolidated liquidity of French blue chip equities, newly tradable on Chi-X. Our findings suggest that owing to this new competition the home market’s liquidity has enhanced. This is apparently due to the battle for order flow which results in narrower spreads and increased market depth. These results imply that overall liquidity in a virtually consolidated order book is in the French case higher than without the new competitor.

  15. Personal exposure to benzene of selected population groups and impact of commuting modes in Ho Chi Minh, Vietnam. (United States)

    Lan, Tran Thi Ngoc; Liem, Ngo Quang; Binh, Nguyen Thi Thanh


    Personal exposure to benzene of selected population groups, and impacts of traffic on commuters in Ho Chi Minh City were investigated. The study was carried out in June, July and November 2010. The preliminary data showed that on average, personal exposure to benzene for non-occupational people in Ho Chi Minh is ~18 μg/m(3) and most of the exposure is due to commuting. Benzene exposure during travelling by bus, taxi and motorcycle is, respectively, 22-30, 22-39 and 185-240 μg/m(3). Motorcycle-taxi drivers, petrol filling employees and street vendors suffer high daily exposures at 116, 52, 32 μg/m(3), respectively. Further measurements are needed for a better risk assessment and finding effective measures to reduce exposure. PMID:23334286

  16. $\\chi^{\\vphantom\\dagger}_{c0}(3915)$ As the Lightest $c\\bar c s \\bar s$ State

    CERN Document Server

    Lebed, Richard F


    The state $\\chi^{\\vphantom\\dagger}_{c0}(3915)$ has recently been demoted by the Particle Data Group from its previous status as the conventional $c\\bar c$ $2 {}^3P_0$ state, largely due to the absence of expected $D\\bar D$ decays. We propose that $\\chi^{\\vphantom\\dagger}_{c0}(3915)$ is actually the lightest $c\\bar c s \\bar s$ state, and calculate the spectrum of such states using the diquark model, identifying many of the observed charmoniumlike states that lack open-charm decay modes as $c\\bar c s \\bar s$. Among other results, we argue that $Y(4140)$ is a $J^{PC} = 1^{++}$ $c\\bar c s \\bar s$ state that has been not been seen in two-photon fusion largely as a consequence of the Landau-Yang theorem.

  17. Validation of Chinese Version of Polycystic Ovary Syndrome Health-Related Quality of Life Questionnaire (Chi-PCOSQ)


    Lin, Chung-Ying; Ou, Huang-tz; Wu, Meng-Hsing; Chen, Pei-Chi


    Objectives To evaluate the responsiveness, longitudinal validity, and measurement invariance of the Chinese version of the Polycystic Ovary Syndrome Health-related Quality of Life Questionnaire (Chi-PCOSQ). Research Design and Method This prospective study was conducted in a medical center in southern Taiwan. 102 women aged 18–45 years and diagnosed with PCOS were enrolled. Objective indicators for clinical changes of PCOS included assessing the 2-hour glucose and insulin levels before and af...

  18. Toward a Holistic Development : The Effects of Tzu Chi Foundation's Charity Aid in a Relocation Project in Jarkata


    HSU, Mutsu; HO, Yunchi


    Much contemporary psychological anthropology is concerned with the ethnic stereotypes and interactions between the majority and minority groups. What relatively absent in the literature is how these ethnic phenomena could be affected by charity aids, in particular the relocation of illegal settlements. By adopting the anthropological methods of interviews and observation in the community, this paper highlights the effects of a river cleaning project activated in 2002 by Indonesia Tzu Chi Foun...

  19. LiCHy: The CAF’s LiDAR, CCD and Hyperspectral Integrated Airborne Observation System


    Yong Pang; Zengyuan Li; Hongbo Ju; Hao Lu; Wen Jia; Lin Si; Ying Guo; Qingwang Liu; Shiming Li; Luxia Liu; Binbin Xie; Bingxiang Tan; Yuanyong Dian


    We describe the design, implementation and performance of a novel airborne system, which integrates commercial waveform LiDAR, CCD (Charge-Coupled Device) camera and hyperspectral sensors into a common platform system. CAF’s (The Chinese Academy of Forestry) LiCHy (LiDAR, CCD and Hyperspectral) Airborne Observation System is a unique system that permits simultaneous measurements of vegetation vertical structure, horizontal pattern, and foliar spectra from different view angles at very high sp...

  20. Tai chi mind-body exercise in patients with COPD: study protocol for a randomized controlled trial


    Yeh, Gloria Y.; Wayne, Peter M.; Litrownik, Daniel; Roberts, David H.; Davis, Roger B.; Moy, Marilyn L.


    Background: Chronic obstructive pulmonary disease (COPD) is a chronic, progressively debilitating condition that is prevalent in the US and worldwide. Patients suffer from progressive dyspnea and exercise intolerance. Physical exercise is beneficial, but conventional pulmonary rehabilitation programs are underutilized. There remains a need for novel interventions that improve symptoms, quality-of-life, and functional capacity. Tai chi is an increasingly popular mind-body exercise that include...

  1. Children’s body composition and stress, the ChiBS study: aims, design, methods, population and participation characteristics


    Michels, Nathalie; Vanaelst, Barbara; Vyncke, Krishna; Sioen, Isabelle; Huybrechts, Inge; De Vriendt, Tineke; De Henauw, Stefaan


    Background The last decades, the prevalence of childhood obesity has increased. Apart from other lifestyle factors, the effect of chronic psychosocial stress on the development of obesity has been recognized. However, more research is needed into the influence of chronic stress on appetite regulation, energy balance and body composition, as well as on the interaction with physical activity/sedentary behavior, diet and sleep in children. In this regard, the ChiBS study (Children’s Body composi...

  2. Chemical dampening of Ly6Chi monocytes in the periphery produces anti-depressant effects in mice


    Xiao Zheng; Sijing Ma; An Kang; Mengqiu Wu; Lin Wang; Qiong Wang; Guangji Wang; Haiping Hao


    The involvement of systemic immunity in depression pathogenesis promises a periphery-targeting paradigm in novel anti-depressant discovery. However, relatively little is known about druggable targets in the periphery for mental and behavioral control. Here we report that targeting Ly6Chi monocytes in blood can serve as a strategy for anti-depressant purpose. A natural compound, ginsenoside Rg1 (Rg1), was firstly validated as a periphery-restricted chemical probe. Rg1 selectively suppressed Ly...

  3. Comparison of higher order spectra in heart rate signals during two techniques of meditation: Chi and Kundalini meditation


    Ateke GOSHVARPOUR; Goshvarpour, Atefeh


    The human heartbeat is one of the important examples of complex physiologic fluctuations. For the first time in this study higher order spectra of heart rate signals during meditation have explored. Specifically, the aim of this study was to analysis and compares the contribution of quadratic phase coupling of human heart rate variability during two forms of meditation: (1) Chinese Chi (or Qigong) meditation and (2) Kundalini Yoga meditation. For this purpose, Bispectrum was estimated by usin...

  4. Effectiveness of Tai Chi on Physical and Psychological Health of College Students: Results of a Randomized Controlled Trial


    Zheng, Guohua; Lan, Xiulu; Li, Moyi; Ling, Kun; Lin, Hui; Chen, Lidian; Tao, Jing; Li, Junzhe; Zheng, Xin; Chen, Bai; Fang, Qianying


    Objective To investigate the effectiveness and safety of Tai Chi Chuan (TCC) on physical and psychological health of college students. Methods Two hundred six college students were recruited and randomly allocated to a control group or a TCC exercise group in an equal ratio. Participants in the control group were instructed to maintain their original activity level and those in the TCC exercise group received 12 weeks of TCC exercise training based on their original activity level. Physical a...

  5. Shoulder Mobility, Muscular Strength, and Quality of Life in Breast Cancer Survivors with and without Tai Chi Qigong Training


    Fong, Shirley S.M.; Ng, Shamay S.M.; Luk, W. S.; Chung, Joanne W. Y.; Chung, Louisa M. Y.; Tsang, William W. N.; Chow, Lina P. Y.


    Objectives. To compare the shoulder mobility, muscular strength, and quality of life (QOL) among breast cancer survivors with and without Tai Chi (TC) Qigong training to those of healthy individuals and to explore the associations between shoulder impairments and QOL in breast cancer survivors with regular TC Qigong training. Methods. Eleven breast cancer survivors with regular TC Qigong training, 12 sedentary breast cancer survivors, and 16 healthy participants completed the study. Shoulder ...

  6. Vacuum stability in the $U(1)_\\chi$ extended model with vanishing scalar potential at the Planck scale

    CERN Document Server

    Haba, Naoyuki


    We investigate the vacuum stability in a scale invariant local $U(1)_\\chi$ model with vanishing scalar potential at the Planck scale. We find that it is impossible to realize the Higgs mass of 125\\,GeV while keeping the Higgs quartic coupling $\\lambda_H$ to be positive in all energy scale, that is the same as the standard model. Once one allows $\\lambda_H0$ gives the upper bound in $N_\

  7. A small RNA controls expression of the chitinase ChiA in Listeria monocytogenes

    DEFF Research Database (Denmark)

    Nielsen, Jesper S; Larsen, Marianne Halberg; Lillebæk, Eva Maria Sternkopf;


    In recent years, more than 60 small RNAs (sRNAs) have been identified in the gram-positive human pathogen Listeria monocytogenes, but their putative roles and mechanisms of action remain largely unknown. The sRNA LhrA was recently shown to be a post-transcriptional regulator of a single gene, lmo...... role of LhrA in L. monocytogenes. To this end, we determined the effects of LhrA on global-wide gene expression. We observed that nearly 300 genes in L. monocytogenes are either positively or negatively affected by LhrA. Among these genes, we identified lmo0302 and chiA as direct targets of LhrA, thus...... establishing LhrA as a multiple target regulator. Lmo0302 encodes a hypothetical protein with no known function, whereas chiA encodes one of two chitinases present in L. monocytogenes. We show here that LhrA acts as a post-transcriptional regulator of lmo0302 and chiA by interfering with ribosome recruitment...

  8. Chi Shi-Ying and the “Time and Tide” Magazine That Resisted the Trend(1959-1967)

    Directory of Open Access Journals (Sweden)

    Eve Chiu


    Full Text Available This thesis focuses on “Time and Tide” magazine that was published by Mr. Chi Shi-Ying during 1959 to 1967 in Taiwan, and how its content related to Chi’s critical political activities at that time. The plan is to clarify and marshal those main issues about democracy, legalization as well as press freedom on the one hand; therefore to reveal the riddle why Chi did became an opponent of KMT after being its faithful cadre for so many years. Chi devoted himself to the “New party-building” movement that against KMT, and was one of the pilot “wishenjen”(外省人) who got in the “Out of the party”(黨外) movement in Taiwan. Chi’s “Time and Tide” shared the same “structure of feeling” with the “Free China” published by Lei Zhen and with the readers of these two magazines. The “structure of feeling” once dived into the deep water of history, but is going to rise again after twenty years later.

  9. Application of groundwater sustainability indicators to the Upper Pliocene aquifer in Ho Chi Minh city, Viet Nam (United States)

    Ngo, T. M.; Lee, J.; Lee, H.; Woo, N. C.


    Groundwater plays an importance role for domestic, industrial, and agricultural uses in Ho Chi Minh city, Viet Nam. This study is objected to evaluate the sustainability of groundwater by using groundwater sustainability indicators (GWSIs) defined by UNESCO/IAEA/IAH Working Group on Groundwater Indicators at aquifer scale (the Upper Pliocene aquifer). There are four main indicators selected and one new indicator designed for the particular characteristic of Ho Chi Minh city which is under influence of by saline-water intrusion. The results indicated groundwater of the Upper Pliocene aquifer, the main groundwater supply source, is generally in the unsustainable state. The abstraction of groundwater, which was much greater than its capability, is probably causing the serious state of annual groundwater depletion and saline-water intrusion. The GWSIs, which expressed in such a simple way but scientifically-based and policy-relevant, proved its usefulness in evaluating the sustainability of groundwater at the aquifer scale in Ho Chi Minh city, and subsequently should be incorporated in water resource management practices.

  10. Bottomonium spectroscopy and radiative transitions involving the chi_bJ(1P,2P) states at BABAR

    CERN Document Server

    Lees, J P


    We use $(121\\pm1)$ million $\\Upsilon(3S)$ and $(98\\pm1)$ million $\\Upsilon(2S)$ mesons recorded by the BABAR detector at the PEP-II $e^+e^-$ collider at SLAC to perform a study of radiative transitions involving the $\\chi_{b\\mathrm{J}}(1P,2P)$ states in exclusive decays with $\\mu^+\\mu^-\\gamma\\gamma$ final states. We reconstruct twelve channels in four cascades using two complementary methods. In the first we identify both signal photon candidates in the Electromagnetic Calorimeter (EMC), employ a calorimeter timing-based technique to reduce backgrounds, and determine branching-ratio products and fine mass splittings. These results include the best observational significance yet for the $\\chi_{b0}(2P)\\rightarrow\\gamma\\Upsilon(2S)$ and $\\chi_{b0}(1P)\\rightarrow\\gamma\\Upsilon(1S)$ transitions. In the second method, we identify one photon candidate in the EMC and one which has converted into an $e^+e^-$ pair due to interaction with detector material, and we measure absolute product branching fractions. This metho...

  11. Use of isotope hydrology for groundwater resources study in Upper Chi river basin

    International Nuclear Information System (INIS)

    The Upper Chi river basin is located in the vicinity of Chaiyaphum province, northeastern Thailand. Groundwater management in the drought affected area of fractured Mesozoic siliciclastic rocks groundwater system was challenged by the approaches of isotope and chemical techniques. The local meteoric water line (LMWL) of the study area provide lower slope (δD = 6.8508δ18O -0.8013) and more depleted average annual rainfall (δ18O = -7.6 %ο) when compare to LMWL of Bangkok due to higher evaporation. The surface water mainly exhibits an evaporation effect and can be clearly divided into two groups, the upper reaches and the downstream areas, with approximate separated in δ18O by -4.0 %ο. The groundwater system in the area can be divided into seven subareas based on the stable isotope characteristics and groundwater dating by radiocarbon and tritium methods. Nong Bua Deang subarea, Kang Kro subarea, and Thep Satit subarea, the most upstream system which were separated by thick aquitards of Phra Wihan sandstones, are classified as the upper reach area. The groundwater samples are characterized in two traits: the upstream group shows older groundwater ages (<80.0 % modern carbon, PMC) because of less interaction with surface water and the downstream group, near main channels and reservoirs, exhibit younger groundwater ages because of contribution of surface water in the recharge area. Bamnet Narong subarea and Muang Chaiyaphum subarea are classified as the middle reach area. The groundwater shows rapidly recharge from rainfall, the results of radiocarbon provide younger ages. The downstream characteristic which is closely interaction of extremely evaporated surface, were found in Kon Sawan-Mancha Kiri subarea and Ban Phai subarea. Almost all the groundwater samples are related to younger ages except the wells near the upper tributaries. The groundwater management can be proposed by attending to conservation policy in the upper reach area, and some parts of Ban Phai

  12. The Effects of Tai Chi Practice on Intermuscular Beta Coherence and the Rubber Hand Illusion. (United States)

    Kerr, Catherine E; Agrawal, Uday; Nayak, Sandeep


    Tai Chi (TC) is a slow-motion contemplative exercise that is associated with improvements in sensorimotor measures, including decreased force variability, enhanced tactile acuity, and improved proprioception, especially in elderly populations. Here, we carried out two studies evaluating the effect of TC practice on measures associated with sensorimotor processing. In study 1, we evaluated TC's effects on an oscillatory parameter associated with motor function, beta rhythm (15-30 Hz) coherence, focusing specifically on beta rhythm intermuscular coherence (IMC), which is tightly coupled to beta corticomuscular coherence (CMC). We utilized electromyography (EMG) to compare beta IMC in older TC practitioners with age-matched controls, as well as novices with advanced TC practitioners. Given previous findings of elevated, maladaptive beta coherence in older subjects, we hypothesized that increased TC practice would be associated with a monotonic decrease in beta IMC, but rather discovered that novice practitioners manifested higher beta IMC than both controls and advanced practitioners, forming an inverted U-shaped practice curve. This finding suggests that TC practice elicits complex changes in sensory and motor processes over the developmental lifespan of TC training. In study 2, we focused on somatosensory (e.g., tactile and proprioceptive) responses to the rubber hand illusion (RHI) in a middle-aged TC group, assessing whether responses to the illusion became dampened with greater cumulative practice. As hypothesized, TC practice was associated with decreased likelihood to misattribute tactile stimulation during the RHI to the rubber hand, although there was no effect of TC practice on measures of proprioception or on subjective reports of ownership. These studies provide preliminary evidence that TC practice both modulates beta network coherence in a non-linear fashion, perhaps as a result of the focus on not only efferent motor but also afferent sensory activity

  13. Nanoparticle formulation by Büchi B-90 Nano Spray Dryer for oral mucoadhesion

    Directory of Open Access Journals (Sweden)

    Harsha SN


    temperature. The amount of vildagliptin retained was 1.6% within 3 hours, and in comparison with the gelatin vildagliptin nanoparticles formulation, the percentage that was retained was much higher (98.2% in 12 hours. Keywords: nanospheres, vildagliptin, Büchi Nano Spray Dryer, diabetes

  14. The prevalence and correlates of physical inactivity among adults in Ho Chi Minh City

    Directory of Open Access Journals (Sweden)

    Phongsavan Philayrath


    Full Text Available Abstract Background Socioeconomic changes have led to profound changes in individuals' lifestyles, including the adoption of unhealthy food consumption patterns, prevalent tobacco use, alcohol abuse and physical inactivity, especially in large cities like Ho Chi Minh City (HCMC. The Stepwise Approach to Surveillance of Non-communicable Disease Risk Factors survey was conducted to identify physical activity patterns and factors associated with 'insufficient' levels of physical activity for health in adults in HCMC. Methods A cross-sectional survey was conducted in 2005 among 1906 adults aged 25–64 years using a probability proportional to size cluster sampling method to estimate the prevalence of non-communicable disease risk factors including physical inactivity. Data on socioeconomic status, health behaviours, and time spent in physical activity during work, commuting and leisure time were collected. Physical activity was measured using the validated Global Physical Activity Questionnaire (GPAQ. Responders were classified as 'sufficiently active' or 'insufficiently active' using the GPAQ protocol. Correlates of insufficient physical activity were identified using multivariable logistic regression. Results A high proportion of adults were physically inactive, with only 56.2% (95% CI = 52.1–60.4 aged 25–64 years in HCMC achieving the minimum recommendation of 'doing 30 minutes moderate-intensity physical activity for at least 5 days per week'. The main contributors to total physical activity among adults were from working and active commuting. Leisure-time physical activity represented a very small proportion (9.4% of individuals' total activity level. Some differences in the pattern of physical activity between men and women were noted, with insufficient activity levels decreasing with age among women, but not among men. Physical inactivity was positively associated with high income (OR = 1.77, 95% CI = 1.05–2.97 and high household

  15. Regulation of natural competence by the orphan two-component system sensor kinase ChiS involves a non-canonical transmembrane regulator in Vibrio cholerae. (United States)

    Yamamoto, Shouji; Mitobe, Jiro; Ishikawa, Takahiko; Wai, Sun Nyunt; Ohnishi, Makoto; Watanabe, Haruo; Izumiya, Hidemasa


    In Vibrio cholerae, 41 chitin-inducible genes, including the genes involved in natural competence for DNA uptake, are governed by the orphan two-component system (TCS) sensor kinase ChiS. However, the mechanism by which ChiS controls the expression of these genes is currently unknown. Here, we report the involvement of a novel transcription factor termed 'TfoS' in this process. TfoS is a transmembrane protein that contains a large periplasmic domain and a cytoplasmic AraC-type DNA-binding domain, but lacks TCS signature domains. Inactivation of tfoS abolished natural competence as well as transcription of the tfoR gene encoding a chitin-induced small RNA essential for competence gene expression. A TfoS fragment containing the DNA-binding domain specifically bound to and activated transcription from the tfoR promoter. Intracellular TfoS levels were unaffected by disruption of chiS and coexpression of TfoS and ChiS in Escherichia coli recovered transcription of the chromosomally integrated tfoR::lacZ gene, suggesting that TfoS is post-translationally modulated by ChiS during transcriptional activation; however, this regulation persisted when the canonical phosphorelay residues of ChiS were mutated. The results presented here suggest that ChiS operates a chitin-induced non-canonical signal transduction cascade through TfoS, leading to transcriptional activation of tfoR. PMID:24236404

  16. Development of Chinese Version of Polycystic Ovary Syndrome Health-Related Quality of Life Questionnaire (Chi-PCOSQ.

    Directory of Open Access Journals (Sweden)

    Huang-tz Ou

    Full Text Available To develop the Chinese version of the Polycystic Ovary Syndrome Health-related Quality of Life Questionnaire (Chi-PCOSQ.This cross-sectional study was conducted in a medical center in Taiwan. Eighty women who met the criteria were enrolled: female, age range of 18-45 years, competent in the Chinese language, had been diagnosed with polycystic ovary syndrome (PCOS, and were regularly followed at outpatient clinics (defined as at least two outpatient visits before enrollment. The PCOSQ was translated and culturally adapted according to standard procedures. A semi-structured interview was applied to assess face validity. Exploratory factor analysis (EFA was applied to determine scale constructs. Measurements of internal consistency via Cronbach's α, test-retest reliability via intraclass correlation coefficient (ICC, construct validity, and discriminative validity were performed.Five additional items, representing the issues of acne, hair loss, and fear of getting diabetes, were incorporated into the original scale. A six-factor structure emerged as a result of the EFA, explaining 71.9% of the variance observed. The reliability analyses demonstrated satisfactory results for Cronbach's α ranging from 0.78-0.96, and for ICC ranging from 0.73-0.86. Construct validity was confirmed by significant correlation between the domains of the Chi-PCOSQ and generic health-related quality of life (HRQoL measures (WHOQOL-BREF, EQ-5D and clinical parameters (body mass index, waist-hip ratio, blood pressure. The known-group analysis indicated that the Chi-PCOSQ is a discriminative tool that differentiates patients according to their HRQoL.The Chi-PCOSQ seems internally consistent, culturally acceptable, and our preliminary evidence suggests that it may be reliable and valid. The Chi-PCOSQ is a promising assessment tool to address the HRQoL of women affected by PCOS in Chinese-speaking countries and to further identify ethnic/cultural differences in the HRQoL of

  17. Cavity- and waveguide-resonators in electron paramagnetic resonance, nuclear magnetic resonance, and magnetic resonance imaging. (United States)

    Webb, Andrew


    Cavity resonators are widely used in electron paramagnetic resonance, very high field magnetic resonance microimaging and also in high field human imaging. The basic principles and designs of different forms of cavity resonators including rectangular, cylindrical, re-entrant, cavity magnetrons, toroidal cavities and dielectric resonators are reviewed. Applications in EPR and MRI are summarized, and finally the topic of traveling wave MRI using the magnet bore as a waveguide is discussed. PMID:25456314

  18. Resonant second generation slepton production at the Tevatron

    Energy Technology Data Exchange (ETDEWEB)

    Autermann, C.T.


    In this thesis a search for R-parity violating supersymmetry is presented. Two different approaches, determined by the event topologies, are chosen to search for resonant slepton production and for the pair and associated production of gauginos. To the resonant slepton production three different signal channels contribute; {mu}{yields}{chi}{sub 1}{sup 0}{mu}, {mu}{yields}{chi}{sup 0}{sub 2,(3,4)}{mu} and {nu}{sub m}u{yields}{chi}{sup {+-}}{sub 1,(2)}{mu}. These three channels are analyzed separately. The slepton-mass -- gaugino-mass plane ist scanned systematically for an excess in the data. Effective 2-dimensional cuts have been developed, to separate signal-like events from background. The analysis profits from the ability to reconstruct the neutralino as well as the slepton mass. The 2D cuts must be very flexible, to account for the different event topologies in the three channels, while scanning the slepton- and gaugino-masses from a few GeV to several hundred GeV. The pair and associated production of gauginos and their decay via any LQ anti d coupling {lambda}{sup '}{sub 2ij} with j=1,2 and k=1,,3 does not comprise a resonance. Therefore the search is not able to benefit from a mass reconstruction. The two muon charges are not correlated, so that the selection of only like-sign di-muon final states is the chosen method to suppress Standard Model background processes. No indication of RPV supersymmetry production or any disagreement between data and Standard Model expectation have been found. Therefore exclusion limits with 95% confidence level (CL) have been calculated. Model independent limits on cross section times branching ratio are given. These limits only depend on the masses of the contributing particles of the process. The predicted cross section of any given model can be compared to these cross section limits to determine the exclusion contour in that model. The three resonant slepton production channels {mu}{yields}{chi}{sub 1}{sup 0}{mu}, {mu}{yields}{chi

  19. Planar Resonators for Metamaterials

    Directory of Open Access Journals (Sweden)

    M. Blaha


    Full Text Available This paper presents the results of an investigation into a combination of electric and magnetic planar resonators in order to design the building element of a volumetric metamaterial showing simultaneously negative electric and magnetic polarizabilities under irradiation by an electromagnetic wave. Two combinations of particular planar resonators are taken into consideration. These planar resonators are an electric dipole, a split ring resonator and a double H-shaped resonator. The response of the single resonant particle composed of a resonator with an electric response and a resonator with a magnetic response is strongly anisotropic. Proper spatial arrangement of these particles can make the response isotropic. This is obtained by proper placement of six planar resonators on the surface of a cube that now represents a metamaterial unit cell. The cells are distributed in space with 3D periodicity.

  20. Efeitos do Tai Chi Chuan na força dos músculos extensores dos joelhos e no equilíbrio em idosas Effects of Tai Chi Chuan on knee extensor muscle strength and balance in elderly women


    MM Pereira; RJ Oliveira; MAF Silva; LHR Souza; LG Vianna


    CONTEXTUALIZAÇÃO: Alguns estudos têm indicado que o Tai Chi Chuan (TCC) é capaz de melhorar o condicionamento físico, a força muscular e o equilíbrio entre os praticantes idosos, prevenindo quedas, fraturas e dependência física. OBJETIVO: Verificar os efeitos do TCC no equilíbrio (EQ) e na força dos músculos extensores dos joelhos (F) em mulheres idosas. MATERIAIS E MÉTODOS: Participaram do estudo 77 mulheres saudáveis, não praticantes de atividade física orientada. No Grupo Experimental (G1)...

  1. Ly6C(hi) Monocytes Provide a Link between Antibiotic-Induced Changes in Gut Microbiota and Adult Hippocampal Neurogenesis. (United States)

    Möhle, Luisa; Mattei, Daniele; Heimesaat, Markus M; Bereswill, Stefan; Fischer, André; Alutis, Marie; French, Timothy; Hambardzumyan, Dolores; Matzinger, Polly; Dunay, Ildiko R; Wolf, Susanne A


    Antibiotics, though remarkably useful, can also cause certain adverse effects. We detected that treatment of adult mice with antibiotics decreases hippocampal neurogenesis and memory retention. Reconstitution with normal gut flora (SPF) did not completely reverse the deficits in neurogenesis unless the mice also had access to a running wheel or received probiotics. In parallel to an increase in neurogenesis and memory retention, both SPF-reconstituted mice that ran and mice supplemented with probiotics exhibited higher numbers of Ly6C(hi) monocytes in the brain than antibiotic-treated mice. Elimination of Ly6C(hi) monocytes by antibody depletion or the use of knockout mice resulted in decreased neurogenesis, whereas adoptive transfer of Ly6C(hi) monocytes rescued neurogenesis after antibiotic treatment. We propose that the rescue of neurogenesis and behavior deficits in antibiotic-treated mice by exercise and probiotics is partially mediated by Ly6C(hi) monocytes. PMID:27210745

  2. Transgenic Indian Cotton (Gossypium hirsutum Harboring Rice Chitinase Gene (Chi II Confers Resistance to Two Fungal Pathogens

    Directory of Open Access Journals (Sweden)

    M. Ganesan


    Full Text Available Problem statement: The present investigation described a simple and reproducible protocol for transgenic cotton regeneration and characterization of chitinase (Chi II gene expression against two different fungal pathogens in cotton. Approach: Transgenic cotton (Gossypium hirsutum cv. SVPR2 plants were produced by pCambia-bar-Chi II (13.8 kb under the control of the CaMV 35S promoter, harbored in the strain LBA 4404 Agrobacterium tumefaciens by using shoot tip explants. Results: Finally, from the 10 experiments, 21.8% of transformation frequency was recorded. Segregation ratio of 3:1 was recorded in the T0 plant seeds. Polymerase chain reaction and southern blotting analysis were used to confirm the integration of Chi II transgene in the T0 plants genome of putative transgenics. Quantitiave and qualitative (SDS-PAGE analyses were also carried out to confirm the expression of chitinase enzyme in T0 plants. Further, randomly selected transgenic plants (T0 were analyzed for disease tolerance by evaluating them with spores of Fusarium oxysporum and Alternaria macrospora. All the selected PCR positive plants showed enhanced disease resistance against Fusarium wilt. The plants selected randomly showed an enhanced survival rate compared with the control when they were grown in earthen pots inoculated with 1×105 spores 100-1 g of soil mixture. Another four randomly selected plantlets were sprayed with spores of Alternaria macrospora in order to test their tolerance to Alternaria leaf spot disease. After 20 days of culture, the number of lesions per leaf and the lesion length per leaf spot in non-transferred leaves increased. In the case of transgenic plantlets, lesion formation was completely absent. Conclusion: The disease resistance against Fusarium wilt and Alternaria leaf spot in cotton strains would serve as good breeding materials for producing fungal disease resistant cotton varieties.

  3. Landslide susceptibility mapping using decision-tree based CHi-squared automatic interaction detection (CHAID) and Logistic regression (LR) integration

    International Nuclear Information System (INIS)

    This article uses methodology based on chi-squared automatic interaction detection (CHAID), as a multivariate method that has an automatic classification capacity to analyse large numbers of landslide conditioning factors. This new algorithm was developed to overcome the subjectivity of the manual categorization of scale data of landslide conditioning factors, and to predict rainfall-induced susceptibility map in Kuala Lumpur city and surrounding areas using geographic information system (GIS). The main objective of this article is to use CHi-squared automatic interaction detection (CHAID) method to perform the best classification fit for each conditioning factor, then, combining it with logistic regression (LR). LR model was used to find the corresponding coefficients of best fitting function that assess the optimal terminal nodes. A cluster pattern of landslide locations was extracted in previous study using nearest neighbor index (NNI), which were then used to identify the clustered landslide locations range. Clustered locations were used as model training data with 14 landslide conditioning factors such as; topographic derived parameters, lithology, NDVI, land use and land cover maps. Pearson chi-squared value was used to find the best classification fit between the dependent variable and conditioning factors. Finally the relationship between conditioning factors were assessed and the landslide susceptibility map (LSM) was produced. An area under the curve (AUC) was used to test the model reliability and prediction capability with the training and validation landslide locations respectively. This study proved the efficiency and reliability of decision tree (DT) model in landslide susceptibility mapping. Also it provided a valuable scientific basis for spatial decision making in planning and urban management studies

  4. The effects of Tai Chi exercise on cognitive function in older adults:A meta-analysis

    Institute of Scientific and Technical Information of China (English)

    Yin; Wu; Yongtai; Wang; Elisabeth; O.Burgess; Jerry; Wu


    Background:Cognitive impairment is prevalent among older adults and results in degraded quality of life for older adults.As the population ages,this may cause a huge burden to society.Research has demonstrated that physical exercise is beneficial to cognitive function.The purpose of this meta-analysis was to critically assess the effect of Tai Chi exercise on global cognitive,executive,and memory functions in older adults.Methods:After a thorough electronic search and selection,eight studies were included in this meta-analysis with two cross-sectional and six intervention studies.Nine variables included in this meta-analysis were:mini mental status examination(MMSE),Alzheimer’s disease assessment scale-cognitive subscale(ADAS-cog),trailmaking test part A(TMA),trailmaking test part B(TMB),digit span test forward(DSF),digit span test backward(DSB),visual span test backward(VSB),verbal fluency test(VFT),and word delay recall test(WDR).The effect sizes and forest plots of these nine variables were generated.Results:Four(MMSE,DSB,VSB,and VFT)out of nine variables were significantly improved after Tai Chi exercise with the effect sizes ranged from 0.20 to 0.46(small to medium).MMSE represented global cognitive function,and DSB,VSB,and VFT represented memory function.Conclusion:Tai Chi as a mind-body exercise has the positive effects on global cognitive and memory functions,and more consistent positive effects were found on memory function,especially verbal working memory.

  5. LiCHy: The CAF’s LiDAR, CCD and Hyperspectral Integrated Airborne Observation System

    Directory of Open Access Journals (Sweden)

    Yong Pang


    Full Text Available We describe the design, implementation and performance of a novel airborne system, which integrates commercial waveform LiDAR, CCD (Charge-Coupled Device camera and hyperspectral sensors into a common platform system. CAF’s (The Chinese Academy of Forestry LiCHy (LiDAR, CCD and Hyperspectral Airborne Observation System is a unique system that permits simultaneous measurements of vegetation vertical structure, horizontal pattern, and foliar spectra from different view angles at very high spatial resolution (~1 m on a wide range of airborne platforms. The horizontal geo-location accuracy of LiDAR and CCD is about 0.5 m, with LiDAR vertical resolution and accuracy 0.15 m and 0.3 m, respectively. The geo-location accuracy of hyperspectral image is within 2 pixels for nadir view observations and 5–7 pixels for large off-nadir observations of 55° with multi-angle modular when comparing to LiDAR product. The complementary nature of LiCHy’s sensors makes it an effective and comprehensive system for forest inventory, change detection, biodiversity monitoring, carbon accounting and ecosystem service evaluation. The LiCHy system has acquired more than 8000 km2 of data over typical forests across China. These data are being used to investigate potential LiDAR and optical remote sensing applications in forest management, forest carbon accounting, biodiversity evaluation, and to aid in the development of similar satellite configurations. This paper describes the integration of the LiCHy system, the instrument performance and data processing workflow. We also demonstrate LiCHy’s data characteristics, current coverage, and potential vegetation applications.

  6. Measurement of chi(cj) decaying into p(n)over-bar pi(-) and p(n)over-bar pi(-)pi(0)

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Albayrak, O.; Ambrose, D. J.; An, F. F.; An, Q.; Bai, J. Z.; Ban, Y.; Becker, J.; Bennett, J. V.; Bertani, M.; Bian, J. M.; Boger, E.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Bytev, V.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, X.; Chen, Y. B.; Cheng, H. P.; Chu, Y. P.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefani, M.; Ding, W. M.; Ding, Y.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Fang, J.; Fang, S. S.; Fava, L.; Feldbauer, F.; Feng, C. Q.; Ferroli, R. B.; Fu, C. D.; Fu, J. L.; Gao, Y.; Geng, C.; Goetzen, K.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y. P.; Han, Y. L.; Harris, F. A.; He, K. L.; He, M.; He, Z. Y.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, H. M.; Hu, T.; Huang, G. M.; Huang, G. S.; Huang, J. S.; Huang, X. T.; Huang, Y. P.; Hussain, T.; Ji, C. S.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, L. L.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jing, F. F.; Kalantar-Nayestanaki, N.; Kavatsyuk, M.; Kuehn, W.; Lai, W.; Lange, J. S.; Li, C. H.; Li, Cheng; Li, Cui; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, K.; Li, Lei; Li, Q. J.; Li, S. L.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, X. R.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Liao, X. T.; Liu, B. J.; Liu, C. L.; Liu, C. X.; Liu, C. Y.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H.; Liu, H. H.; Liu, H. M.; Liu, H. W.; Liu, J. P.; Liu, K. Y.; Liu, Kai; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H.; Lu, G. R.; Lu, H. J.; Lu, J. G.; Lu, Q. W.; Lu, X. R.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lv, M.; Ma, C. L.; Ma, F. C.; Ma, H. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X. Y.; Ma, Y.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Morales, C. Morales; Motzko, C.; Muchnoi, N. Yu.; Muramatsu, H.; Nefedov, Y.; Nicholson, C.; Nikolaev, I. B.; Ning, Z.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Park, J. W.; Pelizaeus, M.; Peng, H. P.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Prencipe, E.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, X. S.; Qin, Y.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Rong, G.; Ruan, X. D.; Sarantsev, A.; Schaefer, B. D.; Schulze, J.; Shao, M.; Shen, C. P.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, X. Y.; Spataro, S.; Spruck, B.; Sun, D. H.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tapan, I.; Thorndike, E. H.; Toth, D.; Ullrich, M.; Varner, G. S.; Wang, B.; Wang, B. Q.; Wang, D.; Wang, D. Y.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q.; Wang, Q. J.; Wang, S. G.; Wang, X. L.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. Y.; Wei, D. H.; Wei, J. B.; Weidenkaff, P.; Wen, Q. G.; Wen, S. P.; Wiedner, U.; Wu, L. H.; Wu, N.; Wu, S. X.; Wu, W.; Wu, Z.; Xia, L. G.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, G. M.; Xu, H.; Xu, Q. J.; Xu, X. P.; Xu, Z. R.; Xue, F.; Xue, Z.; Yan, L.; Yan, W. B.; Yan, Y. H.; Yang, H. X.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yu, B. X.; Yu, C. X.; Yu, H. W.; Yu, J. S.; Yu, S. P.; Yuan, C. Z.; Yuan, Y.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, S. H.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. S.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, H. S.; Zhao, J. W.; Zhao, K. X.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, Q. Z.; Zhao, S. J.; Zhao, T. C.; Zhao, X. H.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, Y. H.; Zhong, B.; Zhong, J.; Zhong, Z.; Zhou, L.; Zhou, X. K.; Zhou, X. R.; Zhu, C.; Zhu, K.; Zhu, K. J.; Zhu, S. H.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. M.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Werner, M.J.; Zheng, J.P.


    Using a data sample of 1.06 x 10(8) psi' events collected with the BESIII detector in 2009, the branching fractions of chi(cJ) -> p (n) over bar pi(-) and chi(cJ) -> p (n) over bar pi(-)pi(0) (J = 0, 1, 2) are measured. (Throughout the text, inclusion of charge conjugate modes is implied if not stat

  7. Measurements of lambda and chi parameters for excitation of the 21P state of helium at 80 eV

    International Nuclear Information System (INIS)

    Electron-photon angular correlations have been measured for excitation of the 21P state of helium at an incident energy of 80 eV over the range 10-1150 of electron scattering angles. analysis of the data yields values for the alignment and orientation parameters lambda and |chi| which are in excellent agreement with data of Hollywood et al (J. Phys. B.; 12: 819 (1979)) but the data for lambda are in marked disagreement with the results of Steph and Golden (preprint. Univ. of Oklahoma (1979)) at electron scattering angles thetasub(c)> 700. (author)

  8. Finzioni ed emozioni: riflessioni intorno a Chi ha paura di Mr. Hyde? Oggetti fittizi, emozioni reali di Carola Barbero


    Alessandra Diazzi


    L’articolo propone una sintetica panoramica e una breve recensione del testo di Carola Barbero, Chi ha paura di Mr Hyde. Oggetti fittizi, emozioni reali, seguite da una riflessione intorno ai temi trattati. Il paradosso della finzione (come è possibile provare emozioni reali per enti non esistenti nella realtà?) viene analizzato dal punto di vista dell’ontologia e di un ripensamento dell’investimento emotivo da parte del fruitore. La riflessione filosofica sulle opere artistiche è accompagnat...

  9. Is Tai Chi Chuan effective in improving lower limb response time to prevent backward falls in the elderly?


    Alice M.K. Wong; Pei, Yu-Cheng; Lan, Ching; Huang, Shu-Chun; Lin, Yin-Chou; Chou, Shih-Wei


    To evaluate the training effect of Tai Chi Chuan (TCC) in postural control and backward fall prevention in the elderly, balance assessment and visually guided lower limb response time were analyzed in a case-control study conducted in a community setting. Thirty-one elderly subjects (mean age: 68.2 ± 6.8 years) participated in the TCC group, 30 community-dwelling elderly subjects with matched age and body composition served as the elderly control group, with 13 young adults (mean age: 27.5 ± ...

  10. Evaluation of the Effectiveness of Tai Chi versus Brisk Walking in Reducing Cardiovascular Risk Factors: Protocol for a Ranomized Controlled Trial. (United States)

    Chan, Aileen W K; Sit, Janet W H; Chair, Sek Ying; Leung, Doris Y P; Lee, Diana T F; Wong, Eliza M L; Fung, Lawrence C W


    Physical inactivity is one of the major modifiable lifestyle risk factors for cardiovascular disease (CVD). This protocol aims to evaluate the effectiveness of Tai Chi versus brisk walking in reducing CVD risk factors. This is a randomized controlled trial with three arms, namely, Tai Chi group, walking group, and control group. The Tai Chi group will receive Tai Chi training, which consists of two 60-min sessions each week for three months, and self-practice for 30 min every day. The walking group will perform brisk walking for 30 min every day. The control group will receive their usual care. 246 subjects with CVD risk factors will be recruited from two outpatient clinics. The primary outcome is blood pressure. Secondary outcomes include fasting blood for lipid profile, sugar and glycated haemoglobin (HbA1c); body mass index, waist circumference, body fat percentage; perceived stress level and quality of life. Data collections will be conducted at baseline, 3-month, 6-month and 9-month. Generalized estimating equations model will be used to compare the changes in outcomes across time between groups. It is expected that both the Tai Chi and walking groups could maintain better health and have improved quality of life, and that Tai Chi will be more effective than brisk walking in reducing CVD risk factors. PMID:27399735

  11. The P450-type carotene hydroxylase PuCHY1 from Porphyra suggests the evolution of carotenoid metabolism in red algae

    Institute of Scientific and Technical Information of China (English)

    Li-En Yang; Xing-Qi Huang; Yu Hang; Yin-Yin Deng; Qin-Qin Lu; Shan Lu


    Carotene hydroxylases catalyze the hydroxylation of a-and b-carotene hydrocarbons into xanthophylls. In red algae, b-carotene is a ubiquitously distributed carotenoid, and hydroxylated carotenoids such as zeaxanthin and lutein are also found. However, no enzyme with carotene hydroxy-lase activity had been previously identified in red algae. Here, we report the isolation of a gene encoding a cytochrome P450-type carotene hydroxylase (PuCHY1) from Porphyra umbilicalis, a red alga with an ancient origin. Sequence comparisons found PuCHY1 belongs to the CYP97B subfamily, which has members from different photosynthetic organisms ranging from red algae to land plants. Functional comple-mentation in Escherichia coli suggested that PuCHY1 catalyzed the conversion from b-carotene to zeaxanthin. When we overexpressed PuCHY1 in the Arabidopsis thaliana chy2 mutant, pigment analysis showed a significant accumu-lation of hydroxylated carotenoids, including neoxanthin, violaxanthin, and lutein in the leaves of transgenic plants. These results confirmed a b-hydroxylation activity of PuCHY1, and also suggested a possible e-hydroxylation function. The pigment profile and gene expression analyses of the algal thallus under high-light stress suggested that P. umbilicalis is unlikely to operate a partial xanthophyll cycle for photoprotection.

  12. Evaluation of the Effectiveness of Tai Chi versus Brisk Walking in Reducing Cardiovascular Risk Factors: Protocol for a Randomized Controlled Trial

    Directory of Open Access Journals (Sweden)

    Aileen W. K. Chan


    Full Text Available Physical inactivity is one of the major modifiable lifestyle risk factors for cardiovascular disease (CVD. This protocol aims to evaluate the effectiveness of Tai Chi versus brisk walking in reducing CVD risk factors. This is a randomized controlled trial with three arms, namely, Tai Chi group, walking group, and control group. The Tai Chi group will receive Tai Chi training, which consists of two 60-min sessions each week for three months, and self-practice for 30 min every day. The walking group will perform brisk walking for 30 min every day. The control group will receive their usual care. 246 subjects with CVD risk factors will be recruited from two outpatient clinics. The primary outcome is blood pressure. Secondary outcomes include fasting blood for lipid profile, sugar and glycated haemoglobin (HbA1c; body mass index, waist circumference, body fat percentage; perceived stress level and quality of life. Data collections will be conducted at baseline, 3-month, 6-month and 9-month. Generalized estimating equations model will be used to compare the changes in outcomes across time between groups. It is expected that both the Tai Chi and walking groups could maintain better health and have improved quality of life, and that Tai Chi will be more effective than brisk walking in reducing CVD risk factors.

  13. Crossing simple resonances

    International Nuclear Information System (INIS)

    A simple criterion governs the beam distortion and/or loss of protons on a fast resonance crossing. Results from numerical integrations are illustrated for simple sextupole, octupole, and 10-pole resonances

  14. Modulation gamma resonance spectroscopy

    International Nuclear Information System (INIS)

    Possibility to control dynamic processes in a matter through gamma-resonance modulation by high-frequency external variable fields in excess of inverse lifetimes of the Moessbauer nuclei excited states, that is, within the megahertz frequency range lies in the heart of the modulation gamma-resonance spectroscopy. Through the use of the gamma-resonance process theoretical analysis methods and of the equation solution method for the density matrix with the secondary quantization of gamma-radiation field one attacks the problems dealing with the effect of both variable fields and relaxation on gamma-resonance. One has studied the gamma-radiation ultrasound modulation stages. One points out a peculiar role of the gamma-magnetic resonance effect in modulation gamma resonance spectroscopy formation. One forecasts development of the modulation gamma-resonance spectroscopy into the nonlinear gamma-resonance spectroscopy

  15. Magnetic Resonance Imaging (MRI) (United States)

    ... Resonance Imaging (MRI) What is an MRI? MRI stands for Magnetic Resonance Imaging. It is an important ... MRI is often used for diagnosis or for monitoring disease. For example, if someone is having severe ...

  16. Neutron resonance averaging

    International Nuclear Information System (INIS)

    The principles of resonance averaging as applied to neutron capture reactions are described. Several illustrations of resonance averaging to problems of nuclear structure and the distribution of radiative strength in nuclei are provided. 30 refs., 12 figs

  17. Plasmon resonances in nanoparticles

    CERN Document Server

    Mayergoyz, Isaak D


    This unique volume provides a broad introduction to plasmon resonances in nanoparticles and their novel applications. Here, plasmon resonances are treated as an eigenvalue problem for specific boundary integral equations and general physical properties of plasmon spectrum are studied in detail. The coupling of incident radiation to specific plasmon modes, the time dynamics of their excitation and dephasing are also analytically treated. Finally, the applications of plasmon resonances to SERS, light controllability (gating) of plasmon resonances in semiconductor nanoparticles, the use of plasmo

  18. Danza ed erotismo. Di chi? Per chi?

    Directory of Open Access Journals (Sweden)

    José Sasportes


    Full Text Available Through the centuries, theatrical dance has been labeled an erotic art, the adjective erotic being applied in a negative sense. The present article tries a synthetic view on how the successive choreographic practices have dealt with the erotisation of dance, and on the public perception of such practices. To the ballerina had long been assigned the role of seducer, but in the XX century a homosexual approach to dance gave the male dancer the possibility of taking over her place. In the meantime, many choreographers went on considering the stage as the right place for the explicit expression of sexual behaviors, developing some kind of exhibitionism, with a violent exploitation of dancers’ bodies. Nonetheless, dance never stopped showing dramatizations of heterosexual attractions and conflicts, such as in the works of Pina Bausch.

  19. Magnetic Resonance Imaging (MRI) (United States)

    ... How Can I Help a Friend Who Cuts? Magnetic Resonance Imaging (MRI) KidsHealth > For Teens > Magnetic Resonance Imaging (MRI) Print A A A Text Size What's ... Exam Safety Getting Your Results What Is MRI? Magnetic resonance imaging (MRI) is a type of safe, painless testing ...

  20. First observations of $\\psi(2S)$ and $\\chi_{cJ}(1P)$ decays to four-body final states $h^+h^- K^0_S K^0_S$

    CERN Document Server

    Ablikim, M; Ban, Y; Bian, J G; Cai, X; Chang, J F; Chen, H F; Chen, H S; Chen, H X; Chen, J C; Chen, M L; Chen, Y B; Chi, S P; Chu, Y P; Cui, X Z; Dai, H L; Dai, Y S; Deng, Z Y; Dong, L Y; Dong, Q F; Du, S X; Du, Z Z; Fang, J; Fang, S S; Fu, C D; Fu, H Y; Gao, C S; Gao, Y N; Gong, M Y; Gong, W X; Gu, S D; Guo, Y N; Guo, Y Q; He, K L; He, M; He, X; Heng, Y K; Hu, H M; Hu, T; Huang, X P; Huang, X T; Ji, X B; Jiang, C H; Jiang, X S; Jin, D P; Jin, S; Jin, Y; Yi Jin; Lai, Y F; Li, F; Li, G; Li, H H; Li, J; Li, J C; Li, Q J; Li, R Y; Li, S M; Li, W D; Li, W G; Li, X L; Li, X Q; Li, Y L; Liang, Y F; Liao, H B; Liu, C X; Liu, F; Liu, H H; Liu, H M; Liu, J; Liu, J B; Liu, J P; Liu, R G; Liu, Z A; Liu, Z X; Lu, F; Lu, G R; Lu, H J; Lu, J G; Luo, C L; Luo, L X; Luo, X L; Ma, F C; Ma, H L; Ma, J M; Ma, L L; Ma, Q M; Ma, X B; Ma, X Y; Mao, Z P; Mo, X H; Nie, J; Nie, Z D; Peng, H P; Qi, N D; Qian, C D; Qin, H; Qiu, J F; Ren, Z Y; Rong, G; Shan, L Y; Shang, L; Shen, D L; Shen, X Y; Sheng, H Y; Shi, F; Shi, X; Sun, H S; Sun, J F; Sun, S S; Sun, Y Z; Sun, Z J; Tang, X; Tao, N; Tian, Y R; Tong, G L; Wang, D Y; Wang, J Z; Wang, K; Wang, L; Wang, L S; Wang, M; Wang, P; Wang, P L; Wang, S Z; Wang, W F; Wang, Y F; Wang, Z; Wang, Z Y; Wei, C L; Wei, D H; Wu, N; Wu, Y M; Xia, X M; Xie, X X; Xin, B; Xu, G F; Xu, H; Xue, S T; Yan, M L; Yang, F; Yang, H X; Yang, J; Yang, Y X; Ye, M; Ye, M H; Ye, Y X; Yi, L H; Yi, Z Y; Yu, C S; Yu, G W; Yuan, C Z; Yuan, J M; Yuan, Y; Zang, S L; Zeng, Y; Zhang, B X; Zhang, B Y; Zhang, C C; Zhang, D H; Zhang, H Y; Zhang, J; Zhang, J W; Zhang, J Y; Zhang, Q J; Zhang, S Q; Zhang Xiao Min; Zhang, X Y; Zhang, Y Y; Zhang, Z P; Zhang, Z Q; Zhao, D X; Zhao, J B; Zhao, J W; Zhao, M G; Zhao, P P; Zhao, W R; Zhao, X J; Zhao, Y B; Zheng, H Q; Zheng, J P; Zheng, L S; Zheng, Z P; Zhong, X C; Zhou, B Q; Zhou, G M; Zhou, L; Zhou, N F; Zhu, K J; Zhu, Q M; Zhu, Y C; Zhu, Y S; Zhu, Z A; Zhuang, B A; Zhuang, X A; Zou, B S


    First observations of $\\chi_{c0}$, $\\chi_{c1}$ and $\\chi_{c2}$ decays to $\\pi^+\\pi^-K^0_SK^0_S$ and $K^+K^-K^0_SK^0_S$, as well as $\\psi(2S)$ decay to $\\pi^+\\pi^-K^0_SK^0_S$ are presented. The branching fractions of these decay channels are determined using $14\\times 10^6$ $\\psi(2S)$ events collected at BESII/BEPC. The branching fractions of $\\chi_{c0},\\chi_{c2}\\to K^0_SK^0_S$ are measured with higher statistics.

  1. Statistics of the Chi-Square Type, with Application to the Analysis of Multiple Time-Series Power Spectra

    CERN Document Server

    Sturrock, P A


    It is often necessary to compare the power spectra of two or more time series: one may, for instance, wish to estimate what the power spectrum of the combined data sets might have been, or one may wish to estimate the significance of a particular peak that shows up in two or more power spectra. Also, one may occasionally need to search for a complex of peaks in a single power spectrum, such as a fundamental and one or more harmonics, or a fundamental plus sidebands, etc. Visual inspection can be revealing, but it can also be misleading. This leads one to look for one or more ways of forming statistics, which readily lend themselves to significance estimation, from two or more power spectra. The familiar chi-square statistic provides a convenient mechanism for combining variables drawn from normal distributions, and one may generalize the chi-square statistic to be any function of any number of variables with arbitrary distributions. In dealing with power spectra, we are interested mainly in exponential distri...

  2. The Combined Effects of Tai Chi, Resistance Training, and Diet on Physical Function and Body Composition in Obese Older Women

    Directory of Open Access Journals (Sweden)

    S. A. Maris


    Full Text Available Obesity is a major health problem in the USA, especially in minority populations over the age of 60 years, and the aging process can cause adverse effects on physical function. Previous research has shown that Tai Chi, resistance training (RT, and diet result in overall health improvements. However, the combination of these specific interventions has yet to be translated to obese older women in an urban setting. The purpose of this study was to examine a combined intervention on the primary outcomes of physical function and body composition. Using a nonrandomized design, 26 obese women (65.2±8.1 years completed a 12-week intervention; participants were assigned to an intervention (EXD group or a control (CON group. The EXD group (n=17 participated in Tai Chi, RT, and a dietary session. The CON group (n=9 was asked to continue their normal lifestyle. Timed up and go (TUG time was reduced by 0.64±2.1 seconds (P=0.04 in the EXD group while the CON group saw a borderline significant increase of 0.71 sec (P=0.051. The combined intervention helped improve performance on TUG time, but there were no significant increases in other body composition or function measures.

  3. The degeneracy between the dust colour temperature and the spectral index. The problem of multiple chi^2 minima

    CERN Document Server

    Juvela, M


    Because of the Herschel and Planck satellite missions, there is strong interest in the interpretation the sub-millimetre dust spectra from interstellar clouds. Much work has been done to understand the dependence between the spectral index beta_Obs and the colour temperature T_C that is partly caused by the noise. The (T_C, beta_Obs) confidence regions are elongated, banana-shaped structures. We studied under which conditions these exhibit anomalous, strongly non-Gaussian behaviour that could affect the interpretation of the observed (T_C, beta_Obs) relations. We examined modified black body spectra and spectra calculated from radiative transfer models of filamentary clouds at wavelengths 100um-850um. We performed modified black body fits and examined the structure of the chi^2(T_, beta_Obs) function. We show cases where, when the signal-to-noise ratio is low, the chi^2 has multiple local minima in the (T_C, beta_Obs) plane. A small change in the weighting of the data points can cause the solution to jump to ...

  4. Nanoparticles by spray drying using innovative new technology: the Büchi nano spray dryer B-90. (United States)

    Li, Xiang; Anton, Nicolas; Arpagaus, Cordin; Belleteix, Fabrice; Vandamme, Thierry F


    Spray drying technology is widely known and used to transform liquids (solutions, emulsions, suspension, slurries, pastes or even melts) into solid powders. Its main applications are found in the food, chemical and materials industries to enhance ingredient conservation, particle properties, powder handling and storage etc. However, spray drying can also be used for specific applications in the formulation of pharmaceuticals for drug delivery (e.g. particles for pulmonary delivery). Büchi is a reference in the development of spray drying technology, notably for laboratory scale devices. This study presents the Nano Spray Dryer B-90, a revolutionary new sprayer developed by Büchi, use of which can lower the size of the produced dried particles by an order of magnitude attaining submicron sizes. In this paper, results are presented with a panel of five representative polymeric wall materials (arabic gum, whey protein, polyvinyl alcohol, modified starch, and maltodextrin) and the potentials to encapsulate nano-emulsions, or to formulate nano-crystals (e.g. from furosemide) are also shown. PMID:20659510

  5. Ovenized microelectromechanical system (MEMS) resonator (United States)

    Olsson, Roy H; Wojciechowski, Kenneth; Kim, Bongsang


    An ovenized micro-electro-mechanical system (MEMS) resonator including: a substantially thermally isolated mechanical resonator cavity; a mechanical oscillator coupled to the mechanical resonator cavity; and a heating element formed on the mechanical resonator cavity.

  6. Study design for a randomised controlled trial to explore the modality and mechanism of Tai Chi in the pulmonary rehabilitation of chronic obstructive pulmonary disease (United States)

    Fu, Juan-Juan; Min, Jie; Yu, Peng-Ming; McDonald, Vanessa M; Mao, Bing


    Introduction Although pulmonary rehabilitation (PR) is associated with significant clinical benefits in chronic obstructive pulmonary disease (COPD) and has been recommended by guidelines, PR with conventional exercise training has not been widely applied in the clinic because of its inherent limitations. Alternative exercise such as Tai Chi has been investigated and the results are promising. However, the strengths and weaknesses of the exercise modality of Tai Chi, conventional PR and a combination of Tai Chi and conventional PR and the possible mechanisms underlying Tai Chi exercise remain unclear. This study aims to address the above research gaps in a well-designed clinical trial. Methods and analysis This study is a single-blind, randomised controlled trial. Participants with stable COPD will be recruited and randomly assigned to one of four groups receiving Tai Chi exercise, conventional PR using a total body recumbent stepper (TBRS), combined Tai Chi and TBRS, or usual care (control) in a 1:1:1:1 ratio. Participants will perform 30 min of supervised exercise three times a week for 8 weeks; they will receive sequential follow-ups until 12 months after recruitment. The primary outcome will be health-related quality of life as measured by the St George's Respiratory Questionnaire. Secondary outcomes will include 6 min walking distance, pulmonary function, the modified Medical Research Council Dyspnoea Scale, the COPD Assessment Test, the Hospital Anxiety and Depression Scale, the Berg Balance Scale, exacerbation frequency during the study period, and systemic inflammatory and immune markers. Ethics and dissemination Ethics approval has been granted by the Clinical Trial and Biomedical Ethics Committee of West China Hospital of Sichuan University (No TCM-2015-82). Written informed consent will be obtained from each participant before any procedures are performed. The study findings will be published in peer-reviewed journals and presented at national

  7. Magnetic resonance energy and topological resonance energy. (United States)

    Aihara, Jun-Ichi


    Ring-current diamagnetism of a polycyclic π-system is closely associated with thermodynamic stability due to the individual circuits. Magnetic resonance energy (MRE), derived from the ring-current diamagnetic susceptibility, was explored in conjunction with graph-theoretically defined topological resonance energy (TRE). For many aromatic molecules, MRE is highly correlative with TRE with a correlation coefficient of 0.996. For all π-systems studied, MRE has the same sign as TRE. The only trouble with MRE may be that some antiaromatic and non-alternant species exhibit unusually large MRE-to-TRE ratios. This kind of difficulty can in principle be overcome by prior geometry-optimisation or by changing spin multiplicity. Apart from the semi-empirical resonance-theory resonance energy, MRE is considered as the first aromatic stabilisation energy (ASE) defined without referring to any hypothetical polyene reference. PMID:26878709

  8. Resonance splitting in gyrotropic ring resonators. (United States)

    Jalas, Dirk; Petrov, Alexander; Krause, Michael; Hampe, Jan; Eich, Manfred


    We present the theoretical concept of an optical isolator based on resonance splitting in a silicon ring resonator covered with a magneto-optical polymer cladding. For this task, a perturbation method is derived for the modes in the cylindrical coordinate system. A polymer magneto-optical cladding causing a 0.01 amplitude of the off-diagonal element of the dielectric tensor is assumed. It is shown that the derived resonance splitting of the clockwise and counterclockwise modes increases for smaller ring radii. For the ring with a radius of approximately 1.5μm, a 29GHz splitting is demonstrated. An integrated optical isolator with a 10μm geometrical footprint is proposed based on a critically coupled ring resonator. PMID:20967092

  9. Sitting tai chi improves the balance control and muscle strength of community-dwelling persons with spinal cord injuries: a pilot study. (United States)

    Tsang, William W N; Gao, Kelly L; Chan, K M; Purves, Sheila; Macfarlane, Duncan J; Fong, Shirley S M


    Objective. To investigate the effects of sitting Tai Chi on muscle strength, balance control, and quality of life (QOL) among survivors with spinal cord injuries (SCI). Methods. Eleven SCI survivors participated in the sitting Tai Chi training (90 minutes/session, 2 times/week for 12 weeks) and eight SCI survivors acted as controls. Dynamic sitting balance was evaluated using limits of stability test and a sequential weight shifting test in sitting. Handgrip strength was also tested using a hand-held dynamometer. QOL was measured using the World Health Organization's Quality of Life Scale. Results. Tai Chi practitioners achieved significant improvements in their reaction time (P = 0.042); maximum excursion (P = 0.016); and directional control (P = 0.025) in the limits of stability test after training. In the sequential weight shifting test, they significantly improved their total time to sequentially hit the 12 targets (P = 0.035). Significant improvement in handgrip strength was also found among the Tai Chi practitioners (P = 0.049). However, no significant within and between-group differences were found in the QOL outcomes (P > 0.05). Conclusions. Twelve weeks of sitting Tai Chi training could improve the dynamic sitting balance and handgrip strength, but not QOL, of the SCI survivors. PMID:25688276

  10. Sitting Tai Chi Improves the Balance Control and Muscle Strength of Community-Dwelling Persons with Spinal Cord Injuries: A Pilot Study

    Directory of Open Access Journals (Sweden)

    William W. N. Tsang


    Full Text Available Objective. To investigate the effects of sitting Tai Chi on muscle strength, balance control, and quality of life (QOL among survivors with spinal cord injuries (SCI. Methods. Eleven SCI survivors participated in the sitting Tai Chi training (90 minutes/session, 2 times/week for 12 weeks and eight SCI survivors acted as controls. Dynamic sitting balance was evaluated using limits of stability test and a sequential weight shifting test in sitting. Handgrip strength was also tested using a hand-held dynamometer. QOL was measured using the World Health Organization’s Quality of Life Scale. Results. Tai Chi practitioners achieved significant improvements in their reaction time (P=0.042; maximum excursion (P=0.016; and directional control (P=0.025 in the limits of stability test after training. In the sequential weight shifting test, they significantly improved their total time to sequentially hit the 12 targets (P=0.035. Significant improvement in handgrip strength was also found among the Tai Chi practitioners (P=0.049. However, no significant within and between-group differences were found in the QOL outcomes (P>0.05. Conclusions. Twelve weeks of sitting Tai Chi training could improve the dynamic sitting balance and handgrip strength, but not QOL, of the SCI survivors.

  11. The Effects of Tai Chi on Peripheral Somatosensation, Balance, and Fitness in Hispanic Older Adults with Type 2 Diabetes: A Pilot and Feasibility Study

    Directory of Open Access Journals (Sweden)

    Elisabeth I. Cavegn


    Full Text Available Peripheral neuropathy and loss of somatosensation in older adults with type 2 diabetes can increase risk of falls and disability. In nondiabetic older adult population Tai Chi has been shown to enhance balance and fitness through improvements in somatosensation and neuromuscular control, and it is unclear if Tai Chi would elicit similar benefits in older adults with diabetes. Therefore, the purpose of this study was to investigate the effects of an 8-week, three-hour-per-week Tai Chi intervention on peripheral somatosensation in older adults with type 2 diabetes. Participants were eight Hispanic older adults with type 2 diabetes who participated in the Tai Chi intervention and a convenience sample of Hispanic older adults as a referent group. Baseline and postintervention assessments included ankle proprioception, foot tactile sense, plantar pressure distribution, balance, and fitness. After intervention, older adults with type 2 diabetes showed significant improvements in ankle proprioception and fitness and decreased plantar pressure in the forefoot, with no statistical effect noted in balance or tactile sensation. Study results suggest that Tai Chi may be beneficial for older adults with diabetes as it improves ankle proprioception; however, study findings need to be confirmed in a larger sample size randomized controlled trial.

  12. An Efficacious Sage of Traditional Medicine in Modern Times——interview with Dr.Chi Wai Wong

    Institute of Scientific and Technical Information of China (English)


    @@ Dr.Chi Wai Wong is a licensed Traditional Chinese Medicine (TCM) practitioner in New York who focuses on the healing modalities of acupuncture,herbology,Qi Gong and medical massage (Tui Na).He is a native from Shen Zhen of Guang Dong province in China.He received his Medical Degree in China and became a surgeon where he learned acupuncture anesthesia.When he immigrated to United States,he established his family-run herbal dispensary called Zhong Guo Yao Chai Inc.Since the development of his practices in New York City and Long Island,he has specialized in the research and advancement of utilizing Chinese medicinal modalities for modern clinical application.

  13. Finzioni ed emozioni: riflessioni intorno a Chi ha paura di Mr. Hyde? Oggetti fittizi, emozioni reali di Carola Barbero

    Directory of Open Access Journals (Sweden)

    Alessandra Diazzi


    Full Text Available L’articolo propone una sintetica panoramica e una breve recensione del testo di Carola Barbero, Chi ha paura di Mr Hyde. Oggetti fittizi, emozioni reali, seguite da una riflessione intorno ai temi trattati. Il paradosso della finzione (come è possibile provare emozioni reali per enti non esistenti nella realtà? viene analizzato dal punto di vista dell’ontologia e di un ripensamento dell’investimento emotivo da parte del fruitore. La riflessione filosofica sulle opere artistiche è accompagnata da uno sguardo analitico sui prodotti di fruizione contemporanei, sulle modalità comunicative e sulcomplesso rapporto tra realtà e finzione.

  14. The two-nucleon electromagnetic charge operator in chiral effective field theory ($\\chi$EFT) up to one loop

    Energy Technology Data Exchange (ETDEWEB)

    S. Pastore,L. Girlanda,R. Schiavilla,M. Viviani,S. Pastore,L. Girlanda,R. Schiavilla,M. Viviani


    The electromagnetic charge operator in a two-nucleon system is derived in chiral effective field theory ($\\chi$EFT) up to order $e\\, Q$ (or N4LO), where $Q$ denotes the low-momentum scale and $e$ is the electric charge. The specific form of the N3LO and N4LO corrections from, respectively, one-pion-exchange and two-pion-exchange depends on the off-the-energy-shell prescriptions adopted for the non-static terms in the corresponding potentials. We show that different prescriptions lead to unitarily equivalent potentials and accompanying charge operators. Thus, provided a consistent set is adopted, predictions for physical observables will remain unaffected by the non-uniqueness associated with these off-the-energy-shell effects.

  15. Digital cultural heritage and its applications: case studies of Digital Mogao Grottos and Chi Lin Nunnery reconstruction (United States)

    Li, Deren; Du, Zhiqiang; Zhu, Yixuan; Wang, Tingsong


    Considerable damage has been done to the cultural heritage sites around the world ranging from natural erosion to artificial destruction. With the development of information sciences, frontier technologies are actively introduced to help protect cultural heritage sites. The new concept of a Digital Cultural Heritage has been presented for culture protection and is gradually becoming an efficient method to solve or to remit various difficult problems. This paper puts forward a digitalization method for cultural heritage sites which rationally integrates and utilizes multiform surveying measurements. These techniques have been successfully implemented into two projects, namely the Digital Mogao Grottos and the Chi Lin Nunnery reconstruction. Our results prove that the concept of and the techniques utilized in Digital Cultural Heritage can not only contribute to research, preservation, management, interpretation, and representation of cultural heritages but can also help resolve the conflicts between tourism and protection.

  16. The Tzu Chi Silent Mentor Program: Application of Buddhist Ethics to Teach Student Physicians Empathy, Compassion, and Self-Sacrifice. (United States)

    Santibañez, Scott; Boudreaux, Debra; Tseng, Guo-Fang; Konkel, Kimberly


    The Buddhist Tzu Chi Silent Mentor Program promotes the donation of one's body to science as a selfless act by appealing to the Buddhist ethics of compassion and self-sacrifice. Together, faculty, families, and donors help medical students to learn the technical, spiritual, emotional, and psychological aspects of medicine. Students assigned to each "Silent Mentor" visit the family to learn about the donor's life. They see photos and hear family members' stories. Afterwards, students write a brief biography of the donor which is posted on the program website, in the medical school, and on the dissection table. In this paper, we: (1) summarize the Silent Mentor Program; (2) describe findings from an assessment of medical students who recently completed a new version of the program in Malaysia; and (3) explore how healthcare settings could benefit from this innovative program. PMID:26311054

  17. Preliminary study on arsenic concentration in groundwater in usual exploited aquifer in Ho Chi Minh City (pleistocene aquifer QIm)

    International Nuclear Information System (INIS)

    Recent days, As in groundwater is a hot spot in some countries in Asia (e.g India, Bangladesh, Myanmar, Thailand) that was revealed through Executive Meetings of RAS/8/084. In Vietnam, some reports on groundwater quality in Red River Delta and Mekong Delta (with few random groundwater samples selected to analyse randomly) brought an opinion that groundwater in some region in Vietnam contains a quantity of As is over WHO Limit to As concentration in drinking water. This project hat been carrying out in Ho Chi Minh City in order to survey and make a preliminary assessment on As content in groundwater in shallow aquifer which is usual exploited in one of important social-economic centers of Vietnam. (author)

  18. Mapping Ground Subsidence Phenomena in Ho Chi Minh City through the Radar Interferometry Technique Using ALOS PALSAR Data

    Directory of Open Access Journals (Sweden)

    Dinh Ho Tong Minh


    Full Text Available The rapidly developing urbanization since the last decade of the 20th century has led to extensive groundwater extraction, resulting in subsidence in Ho Chi Minh City, Vietnam. Recent advances in multi-temporal spaceborne SAR interferometry, especially with a persistent scatters interferometry (PSI approach, has made this a robust remote sensing technique for measuring large-scale ground subsidence with millimetric accuracy. This work has presented an advanced PSI analysis, to provide an unprecedented spatial extent and continuous temporal coverage of the subsidence in Ho Chi Minh City from 2006 to 2010. The study shows that subsidence is most severe in the Holocene silt loam areas along the Sai Gon River and in the southwest of the city. The groundwater extraction resulting from urbanization and urban growth is mainly responsible for the subsidence. Subsidence in turn leads to more flooding and water nuisance. The correlation between the reference leveling velocity and the estimated PSI result is R2 = 0.88, and the root mean square error is 4.3 (mm/year, confirming their good agreement. From 2006 to 2010, the estimation of the average subsidence rate is -8.0 mm/year, with the maximum value up to -70 mm/year. After four years, in regions along Sai Gon River and in the southwest of the city, the land has sunk up to -12 cm. If not addressed, subsidence leads to the increase of inundation, both in frequency and spatial extent. Finally, regarding climate change, the effects of subsidence should be considered as appreciably greater than those resulting from rising sea level. It is essential to consider these two factors, because the city is inhabited by more than 7.5 million people, where subsidence directly impacts urban structures and infrastructure.

  19. Learning to See the City Again: Ethnographic Visions of Gender, Class, and Space in Ho Chi Minh City

    Directory of Open Access Journals (Sweden)

    Erik Harms


    Full Text Available Ann Marie Leshkowich. Essential Trade: Vietnamese Women in a Changing Marketplace. University of Hawai'i Press, 2014. 272 pp. $55 (cloth, $25 (paper. Kimberly Kay Hoang. Dealing in Desire: Asian Ascendancy, Western Decline, and the Hidden Currencies of Global Sex Work. University of California Press, 2015. 248 pp. $65 (cloth, $30 (paper/ebook. Catherine Earl. Vietnam’s New Middle Classes: Gender, Career, City. NIAS Press, 2014. 320 pp. £50 (cloth, £18 (paper. Annette Miae Kim. Sidewalk City: Remapping Public Space in Ho Chi Minh City. University of Chicago Press, 2015. 264 pp. $45 (cloth, $7–$36 (ebook. In addition to looking at gendered space, then, understanding a city requires considering the dynamic relationship between the seen and the unseen. And in order to understand this relationship, we need more than preconceived pronouncements about how the city works, or about how gender and class work on space. Rather, we need rich, fine-grained ethnography that traces the dynamic intersections of gender, space, and class in a city. To do such ethnography properly requires peering beyond the surface appearances of the city and listening intently to the everyday lives lived within it. The four new ethnographic perspectives on gender, class, and space in Ho Chi Minh City discussed in this essay all offer ways to see the city again. Three of them do this by looking at class and gender, and one does it by rethinking how we make maps; two of them are by anthropologists, one by a sociologist, and one by an urban planner. But they share one thing in common: all of them hone their keen vision with the aid of ethnography...

  20. Excitonic surface lattice resonances (United States)

    Humphrey, A. D.; Gentile, M. J.; Barnes, W. L.


    Electromagnetic resonances are important in controlling light at the nanoscale. The most studied such resonance is the surface plasmon resonance that is associated with metallic nanostructures. Here we explore an alternative resonance, the surface exciton-polariton resonance, one based on excitonic molecular materials. Our study is based on analytical and numerical modelling. We show that periodic arrays of suitable molecular nanoparticles may support surface lattice resonances that arise as a result of coherent interactions between the particles. Our results demonstrate that excitonic molecular materials are an interesting alternative to metals for nanophotonics; they offer the prospect of both fabrication based on supramolecular chemistry and optical functionality arising from the way the properties of such materials may be controlled with light.

  1. Resonance ionization spectroscopy 1986

    International Nuclear Information System (INIS)

    The paper presents the proceedings of the Third International Symposium on Resonance Ionization Spectroscopy and its Applications, held at the University College of Swansea, Wales, 1986. The Symposium is divided into eight main sections entitled: photophysics and spectroscopy, noble gas atom counting, resonance ionization mass spectrometry, materials and surface analysis, small molecules, medical and environmental applications, resonance ionization and materials separation, and elementary particles and nuclear physics. Thirty papers were chosen for INIS and indexed separately. (U.K.)

  2. Scattering resonances in graphene


    Nazarov, V. U.; Silkin, V. M.; Krasovskii, E. E.


    We address the two-dimensional band-structure of graphene above the vacuum level in the context of discrete states immersed in the three-dimensional continuum. Scattering resonances are discovered that originate from the coupling of the in-plane and perpendicular motions, as elucidated by the analysis of an exactly solvable model. Some of the resonances turn into true bound states at high-symmetry $\\kv$ vectors. {\\it Ab initio} scattering theory verifies the existence of the resonances in rea...

  3. ChiMS: Open-source instrument control software platform on LabVIEW for imaging/depth profiling mass spectrometers (United States)

    Cui, Yang; Hanley, Luke


    ChiMS is an open-source data acquisition and control software program written within LabVIEW for high speed imaging and depth profiling mass spectrometers. ChiMS can also transfer large datasets from a digitizer to computer memory at high repetition rate, save data to hard disk at high throughput, and perform high speed data processing. The data acquisition mode generally simulates a digital oscilloscope, but with peripheral devices integrated for control as well as advanced data sorting and processing capabilities. Customized user-designed experiments can be easily written based on several included templates. ChiMS is additionally well suited to non-laser based mass spectrometers imaging and various other experiments in laser physics, physical chemistry, and surface science.

  4. Observation of a new $\\chi_b$ state in radiative transitions to $\\Upsilon$(1S) and $\\Upsilon$(2S) at ATLAS

    CERN Document Server

    Aad, Georges; Abdallah, Jalal; Abdelalim, Ahmed Ali; Abdesselam, Abdelouahab; Abdinov, Ovsat; Abi, Babak; Abolins, Maris; AbouZeid, Ossama; Abramowicz, Halina; Abreu, Henso; Acerbi, Emilio; Acharya, Bobby Samir; Adamczyk, Leszek; Adams, David; Addy, Tetteh; Adelman, Jahred; Aderholz, Michael; Adomeit, Stefanie; Adragna, Paolo; Adye, Tim; Aefsky, Scott; Aguilar-Saavedra, Juan Antonio; Aharrouche, Mohamed; Ahlen, Steven; Ahles, Florian; Ahmad, Ashfaq; Ahsan, Mahsana; Aielli, Giulio; Akdogan, Taylan; Åkesson, Torsten Paul Ake; Akimoto, Ginga; Akimov, Andrei; Akiyama, Kunihiro; Alam, Mohammad; Alam, Muhammad Aftab; Albert, Justin; Albrand, Solveig; Aleksa, Martin; Aleksandrov, Igor; Alessandria, Franco; Alexa, Calin; Alexander, Gideon; Alexandre, Gauthier; Alexopoulos, Theodoros; Alhroob, Muhammad; Aliev, Malik; Alimonti, Gianluca; Alison, John; Aliyev, Magsud; Allbrooke, Benedict; Allport, Phillip; Allwood-Spiers, Sarah; Almond, John; Aloisio, Alberto; Alon, Raz; Alonso, Alejandro; Alvarez Gonzalez, Barbara; Alviggi, Mariagrazia; Amako, Katsuya; Amaral, Pedro; Amelung, Christoph; Ammosov, Vladimir; Amorim, Antonio; Amorós, Gabriel; Amram, Nir; Anastopoulos, Christos; Ancu, Lucian Stefan; Andari, Nansi; Andeen, Timothy; Anders, Christoph Falk; Anders, Gabriel; Anderson, Kelby; Andreazza, Attilio; Andrei, George Victor; Andrieux, Marie-Laure; Anduaga, Xabier; Angerami, Aaron; Anghinolfi, Francis; Anisenkov, Alexey; Anjos, Nuno; Annovi, Alberto; Antonaki, Ariadni; Antonelli, Mario; Antonov, Alexey; Antos, Jaroslav; Anulli, Fabio; Aoun, Sahar; Aperio Bella, Ludovica; Apolle, Rudi; Arabidze, Giorgi; Aracena, Ignacio; Arai, Yasuo; Arce, Ayana; Arfaoui, Samir; Arguin, Jean-Francois; Arik, Engin; Arik, Metin; Armbruster, Aaron James; Arnaez, Olivier; Arnault, Christian; Artamonov, Andrei; Artoni, Giacomo; Arutinov, David; Asai, Shoji; Asfandiyarov, Ruslan; Ask, Stefan; Å sman, Barbro; Asquith, Lily; Assamagan, Ketevi; Astbury, Alan; Astvatsatourov, Anatoli; Aubert, Bernard; Auge, Etienne; Augsten, Kamil; Aurousseau, Mathieu; Avolio, Giuseppe; Avramidou, Rachel Maria; Axen, David; Ay, Cano; Azuelos, Georges; Azuma, Yuya; Baak, Max; Baccaglioni, Giuseppe; Bacci, Cesare; Bach, Andre; Bachacou, Henri; Bachas, Konstantinos; Backes, Moritz; Backhaus, Malte; Badescu, Elisabeta; Bagnaia, Paolo; Bahinipati, Seema; Bai, Yu; Bailey, David; Bain, Travis; Baines, John; Baker, Oliver Keith; Baker, Mark; Baker, Sarah; Banas, Elzbieta; Banerjee, Piyali; Banerjee, Swagato; Banfi, Danilo; Bangert, Andrea Michelle; Bansal, Vikas; Bansil, Hardeep Singh; Barak, Liron; Baranov, Sergei; Barashkou, Andrei; Barbaro Galtieri, Angela; Barber, Tom; Barberio, Elisabetta Luigia; Barberis, Dario; Barbero, Marlon; Bardin, Dmitri; Barillari, Teresa; Barisonzi, Marcello; Barklow, Timothy; Barlow, Nick; Barnett, Bruce; Barnett, Michael; Baroncelli, Antonio; Barone, Gaetano; Barr, Alan; Barreiro, Fernando; Barreiro Guimarães da Costa, João; Barrillon, Pierre; Bartoldus, Rainer; Barton, Adam Edward; Bartsch, Valeria; Bates, Richard; Batkova, Lucia; Batley, Richard; Battaglia, Andreas; Battistin, Michele; Bauer, Florian; Bawa, Harinder Singh; Beale, Steven; Beau, Tristan; Beauchemin, Pierre-Hugues; Beccherle, Roberto; Bechtle, Philip; Beck, Hans Peter; Becker, Sebastian; Beckingham, Matthew; Becks, Karl-Heinz; Beddall, Andrew; Beddall, Ayda; Bedikian, Sourpouhi; Bednyakov, Vadim; Bee, Christopher; Begel, Michael; Behar Harpaz, Silvia; Behera, Prafulla; Beimforde, Michael; Belanger-Champagne, Camille; Bell, Paul; Bell, William; Bella, Gideon; Bellagamba, Lorenzo; Bellina, Francesco; Bellomo, Massimiliano; Belloni, Alberto; Beloborodova, Olga; Belotskiy, Konstantin; Beltramello, Olga; Ben Ami, Sagi; Benary, Odette; Benchekroun, Driss; Benchouk, Chafik; Bendel, Markus; Benekos, Nektarios; Benhammou, Yan; Benhar Noccioli, Eleonora; Benitez Garcia, Jorge-Armando; Benjamin, Douglas; Benoit, Mathieu; Bensinger, James; Benslama, Kamal; Bentvelsen, Stan; Berge, David; Bergeaas Kuutmann, Elin; Berger, Nicolas; Berghaus, Frank; Berglund, Elina; Beringer, Jürg; Bernat, Pauline; Bernhard, Ralf; Bernius, Catrin; Berry, Tracey; Bertella, Claudia; Bertin, Antonio; Bertinelli, Francesco; Bertolucci, Federico; Besana, Maria Ilaria; Besson, Nathalie; Bethke, Siegfried; Bhimji, Wahid; Bianchi, Riccardo-Maria; Bianco, Michele; Biebel, Otmar; Bieniek, Stephen Paul; Bierwagen, Katharina; Biesiada, Jed; Biglietti, Michela; Bilokon, Halina; Bindi, Marcello; Binet, Sebastien; Bingul, Ahmet; Bini, Cesare; Biscarat, Catherine; Bitenc, Urban; Black, Kevin; Blair, Robert; Blanchard, Jean-Baptiste; Blanchot, Georges; Blazek, Tomas; Blocker, Craig; Blocki, Jacek; Blondel, Alain; Blum, Walter; Blumenschein, Ulrike; Bobbink, Gerjan; Bobrovnikov, Victor; Bocchetta, Simona Serena; Bocci, Andrea; Boddy, Christopher Richard; Boehler, Michael; Boek, Jennifer; Boelaert, Nele; Bogaerts, Joannes Andreas; Bogdanchikov, Alexander; Bogouch, Andrei; Bohm, Christian; Boisvert, Veronique; Bold, Tomasz; Boldea, Venera; Bolnet, Nayanka Myriam; Bona, Marcella; Bondarenko, Valery; Bondioli, Mario; Boonekamp, Maarten; Booth, Chris; Bordoni, Stefania; Borer, Claudia; Borisov, Anatoly; Borissov, Guennadi; Borjanovic, Iris; Borri, Marcello; Borroni, Sara; Bortolotto, Valerio; Bos, Kors; Boscherini, Davide; Bosman, Martine; Boterenbrood, Hendrik; Botterill, David; Bouchami, Jihene; Boudreau, Joseph; Bouhova-Thacker, Evelina Vassileva; Boumediene, Djamel Eddine; Bourdarios, Claire; Bousson, Nicolas; Boveia, Antonio; Boyd, James; Boyko, Igor; Bozhko, Nikolay; Bozovic-Jelisavcic, Ivanka; Bracinik, Juraj; Braem, André; Branchini, Paolo; Brandenburg, George; Brandt, Andrew; Brandt, Gerhard; Brandt, Oleg; Bratzler, Uwe; Brau, Benjamin; Brau, James; Braun, Helmut; Brelier, Bertrand; Bremer, Johan; Brenner, Richard; Bressler, Shikma; Britton, Dave; Brochu, Frederic; Brock, Ian; Brock, Raymond; Brodbeck, Timothy; Brodet, Eyal; Broggi, Francesco; Bromberg, Carl; Bronner, Johanna; Brooijmans, Gustaaf; Brooks, William; Brown, Gareth; Brown, Heather; Bruckman de Renstrom, Pawel; Bruncko, Dusan; Bruneliere, Renaud; Brunet, Sylvie; Bruni, Alessia; Bruni, Graziano; Bruschi, Marco; Buanes, Trygve; Buat, Quentin; Bucci, Francesca; Buchanan, James; Buchanan, Norman; Buchholz, Peter; Buckingham, Ryan; Buckley, Andrew; Buda, Stelian Ioan; Budagov, Ioulian; Budick, Burton; Büscher, Volker; Bugge, Lars; Bulekov, Oleg; Bunse, Moritz; Buran, Torleiv; Burckhart, Helfried; Burdin, Sergey; Burgess, Thomas; Burke, Stephen; Busato, Emmanuel; Bussey, Peter; Buszello, Claus-Peter; Butin, François; Butler, Bart; Butler, John; Buttar, Craig; Butterworth, Jonathan; Buttinger, William; Cabrera Urbán, Susana; Caforio, Davide; Cakir, Orhan; Calafiura, Paolo; Calderini, Giovanni; Calfayan, Philippe; Calkins, Robert; Caloba, Luiz; Caloi, Rita; Calvet, David; Calvet, Samuel; Camacho Toro, Reina; Camarri, Paolo; Cambiaghi, Mario; Cameron, David; Caminada, Lea Michaela; Campana, Simone; Campanelli, Mario; Canale, Vincenzo; Canelli, Florencia; Canepa, Anadi; Cantero, Josu; Capasso, Luciano; Capeans Garrido, Maria Del Mar; Caprini, Irinel; Caprini, Mihai; Capriotti, Daniele; Capua, Marcella; Caputo, Regina; Caramarcu, Costin; Cardarelli, Roberto; Carli, Tancredi; Carlino, Gianpaolo; Carminati, Leonardo; Caron, Bryan; Caron, Sascha; Carrillo Montoya, German D; Carter, Antony; Carter, Janet; Carvalho, João; Casadei, Diego; Casado, Maria Pilar; Cascella, Michele; Caso, Carlo; Castaneda Hernandez, Alfredo Martin; Castaneda-Miranda, Elizabeth; Castillo Gimenez, Victoria; Castro, Nuno Filipe; Cataldi, Gabriella; Cataneo, Fernando; Catinaccio, Andrea; Catmore, James; Cattai, Ariella; Cattani, Giordano; Caughron, Seth; Cauz, Diego; Cavalleri, Pietro; Cavalli, Donatella; Cavalli-Sforza, Matteo; Cavasinni, Vincenzo; Ceradini, Filippo; Cerqueira, Augusto Santiago; Cerri, Alessandro; Cerrito, Lucio; Cerutti, Fabio; Cetin, Serkant Ali; Cevenini, Francesco; Chafaq, Aziz; Chakraborty, Dhiman; Chan, Kevin; Chapleau, Bertrand; Chapman, John Derek; Chapman, John Wehrley; Chareyre, Eve; Charlton, Dave; Chavda, Vikash; Chavez Barajas, Carlos Alberto; Cheatham, Susan; Chekanov, Sergei; Chekulaev, Sergey; Chelkov, Gueorgui; Chelstowska, Magda Anna; Chen, Chunhui; Chen, Hucheng; Chen, Shenjian; Chen, Tingyang; Chen, Xin; Cheng, Shaochen; Cheplakov, Alexander; Chepurnov, Vladimir; Cherkaoui El Moursli, Rajaa; Chernyatin, Valeriy; Cheu, Elliott; Cheung, Sing-Leung; Chevalier, Laurent; Chiefari, Giovanni; Chikovani, Leila; Childers, John Taylor; Chilingarov, Alexandre; Chiodini, Gabriele; Chisholm, Andrew; Chizhov, Mihail; Choudalakis, Georgios; Chouridou, Sofia; Christidi, Illectra-Athanasia; Christov, Asen; Chromek-Burckhart, Doris; Chu, Ming-Lee; Chudoba, Jiri; Ciapetti, Guido; Ciba, Krzysztof; Ciftci, Abbas Kenan; Ciftci, Rena; Cinca, Diane; Cindro, Vladimir; Ciobotaru, Matei Dan; Ciocca, Claudia; Ciocio, Alessandra; Cirilli, Manuela; Citterio, Mauro; Ciubancan, Mihai; Clark, Allan G; Clark, Philip James; Cleland, Bill; Clemens, Jean-Claude; Clement, Benoit; Clement, Christophe; Clifft, Roger; Coadou, Yann; Cobal, Marina; Coccaro, Andrea; Cochran, James H; Coe, Paul; Cogan, Joshua Godfrey; Coggeshall, James; Cogneras, Eric; Colas, Jacques; Colijn, Auke-Pieter; Collins, Neil; Collins-Tooth, Christopher; Collot, Johann; Colon, German; Conde Muiño, Patricia; Coniavitis, Elias; Conidi, Maria Chiara; Consonni, Michele; Consorti, Valerio; Constantinescu, Serban; Conta, Claudio; Conventi, Francesco; Cook, James; Cooke, Mark; Cooper, Ben; Cooper-Sarkar, Amanda; Copic, Katherine; Cornelissen, Thijs; Corradi, Massimo; Corriveau, Francois; Cortes-Gonzalez, Arely; Cortiana, Giorgio; Costa, Giuseppe; Costa, María José; Costanzo, Davide; Costin, Tudor; Côté, David; Coura Torres, Rodrigo; Courneyea, Lorraine; Cowan, Glen; Cowden, Christopher; Cox, Brian; Cranmer, Kyle; Crescioli, Francesco; Cristinziani, Markus; Crosetti, Giovanni; Crupi, Roberto; Crépé-Renaudin, Sabine; Cuciuc, Constantin-Mihai; Cuenca Almenar, Cristóbal; Cuhadar Donszelmann, Tulay; Curatolo, Maria; Curtis, Chris; Cuthbert, Cameron; Cwetanski, Peter; Czirr, Hendrik; Czodrowski, Patrick; Czyczula, Zofia; D'Auria, Saverio; D'Onofrio, Monica; D'Orazio, Alessia; Da Silva, Paulo Vitor; Da Via, Cinzia; Dabrowski, Wladyslaw; Dai, Tiesheng; Dallapiccola, Carlo; Dam, Mogens; Dameri, Mauro; Damiani, Daniel; Danielsson, Hans Olof; Dannheim, Dominik; Dao, Valerio; Darbo, Giovanni; Darlea, Georgiana Lavinia; Davey, Will; Davidek, Tomas; Davidson, Nadia; Davidson, Ruth; Davies, Eleanor; Davies, Merlin; Davison, Adam; Davygora, Yuriy; Dawe, Edmund; Dawson, Ian; Dawson, John; Daya-Ishmukhametova, Rozmin; De, Kaushik; de Asmundis, Riccardo; De Castro, Stefano; De Castro Faria Salgado, Pedro; De Cecco, Sandro; de Graat, Julien; De Groot, Nicolo; de Jong, Paul; De La Taille, Christophe; De la Torre, Hector; De Lotto, Barbara; de Mora, Lee; De Nooij, Lucie; De Pedis, Daniele; De Salvo, Alessandro; De Sanctis, Umberto; De Santo, Antonella; De Vivie De Regie, Jean-Baptiste; Dean, Simon; Dearnaley, William James; Debbe, Ramiro; Debenedetti, Chiara; Dedovich, Dmitri; Degenhardt, James; Dehchar, Mohamed; Del Papa, Carlo; Del Peso, Jose; Del Prete, Tarcisio; Delemontex, Thomas; Deliyergiyev, Maksym; Dell'Acqua, Andrea; Dell'Asta, Lidia; Della Pietra, Massimo; della Volpe, Domenico; Delmastro, Marco; Delruelle, Nicolas; Delsart, Pierre-Antoine; Deluca, Carolina; Demers, Sarah; Demichev, Mikhail; Demirkoz, Bilge; Deng, Jianrong; Denisov, Sergey; Derendarz, Dominik; Derkaoui, Jamal Eddine; Derue, Frederic; Dervan, Paul; Desch, Klaus Kurt; Devetak, Erik; Deviveiros, Pier-Olivier; Dewhurst, Alastair; DeWilde, Burton; Dhaliwal, Saminder; Dhullipudi, Ramasudhakar; Di Ciaccio, Anna; Di Ciaccio, Lucia; Di Girolamo, Alessandro; Di Girolamo, Beniamino; Di Luise, Silvestro; Di Mattia, Alessandro; Di Micco, Biagio; Di Nardo, Roberto; Di Simone, Andrea; Di Sipio, Riccardo; Diaz, Marco Aurelio; Diblen, Faruk; Diehl, Edward; Dietrich, Janet; Dietzsch, Thorsten; Diglio, Sara; Dindar Yagci, Kamile; Dingfelder, Jochen; Dionisi, Carlo; Dita, Petre; Dita, Sanda; Dittus, Fridolin; Djama, Fares; Djobava, Tamar; do Vale, Maria Aline Barros; Do Valle Wemans, André; Doan, Thi Kieu Oanh; Dobbs, Matt; Dobinson, Robert; Dobos, Daniel; Dobson, Ellie; Dodd, Jeremy; Doglioni, Caterina; Doherty, Tom; Doi, Yoshikuni; Dolejsi, Jiri; Dolenc, Irena; Dolezal, Zdenek; Dolgoshein, Boris; Dohmae, Takeshi; Donadelli, Marisilvia; Donega, Mauro; Donini, Julien; Dopke, Jens; Doria, Alessandra; Dos Anjos, Andre; Dosil, Mireia; Dotti, Andrea; Dova, Maria-Teresa; Dowell, John; Doxiadis, Alexander; Doyle, Tony; Drasal, Zbynek; Drees, Jürgen; Dressnandt, Nandor; Drevermann, Hans; Driouichi, Chafik; Dris, Manolis; Dubbert, Jörg; Dube, Sourabh; Duchovni, Ehud; Duckeck, Guenter; Dudarev, Alexey; Dudziak, Fanny; Dührssen, Michael; Duerdoth, Ian; Duflot, Laurent; Dufour, Marc-Andre; Dunford, Monica; Duran Yildiz, Hatice; Duxfield, Robert; Dwuznik, Michal; Dydak, Friedrich; Düren, Michael; Ebenstein, William; Ebke, Johannes; Eckweiler, Sebastian; Edmonds, Keith; Edwards, Clive; Edwards, Nicholas Charles; Ehrenfeld, Wolfgang; Ehrich, Thies; Eifert, Till; Eigen, Gerald; Einsweiler, Kevin; Eisenhandler, Eric; Ekelof, Tord; El Kacimi, Mohamed; Ellert, Mattias; Elles, Sabine; Ellinghaus, Frank; Ellis, Katherine; Ellis, Nicolas; Elmsheuser, Johannes; Elsing, Markus; Emeliyanov, Dmitry; Engelmann, Roderich; Engl, Albert; Epp, Brigitte; Eppig, Andrew; Erdmann, Johannes; Ereditato, Antonio; Eriksson, Daniel; Ernst, Jesse; Ernst, Michael; Ernwein, Jean; Errede, Deborah; Errede, Steven; Ertel, Eugen; Escalier, Marc; Escobar, Carlos; Espinal Curull, Xavier; Esposito, Bellisario; Etienne, Francois; Etienvre, Anne-Isabelle; Etzion, Erez; Evangelakou, Despoina; Evans, Hal; Fabbri, Laura; Fabre, Caroline; Fakhrutdinov, Rinat; Falciano, Speranza; Fang, Yaquan; Fanti, Marcello; Farbin, Amir; Farilla, Addolorata; Farley, Jason; Farooque, Trisha; Farrington, Sinead; Farthouat, Philippe; Fassnacht, Patrick; Fassouliotis, Dimitrios; Fatholahzadeh, Baharak; Favareto, Andrea; Fayard, Louis; Fazio, Salvatore; Febbraro, Renato; Federic, Pavol; Fedin, Oleg; Fedorko, Woiciech; Fehling-Kaschek, Mirjam; Feligioni, Lorenzo; Fellmann, Denis; Feng, Cunfeng; Feng, Eric; Fenyuk, Alexander; Ferencei, Jozef; Ferland, Jonathan; Fernando, Waruna; Ferrag, Samir; Ferrando, James; Ferrara, Valentina; Ferrari, Arnaud; Ferrari, Pamela; Ferrari, Roberto; Ferreira de Lima, Danilo Enoque; Ferrer, Antonio; Ferrer, Maria Lorenza; Ferrere, Didier; Ferretti, Claudio; Ferretto Parodi, Andrea; Fiascaris, Maria; Fiedler, Frank; Filipčič, Andrej; Filippas, Anastasios; Filthaut, Frank; Fincke-Keeler, Margret; Fiolhais, Miguel; Fiorini, Luca; Firan, Ana; Fischer, Gordon; Fischer, Peter; Fisher, Matthew; Flechl, Martin; Fleck, Ivor; Fleckner, Johanna; Fleischmann, Philipp; Fleischmann, Sebastian; Flick, Tobias; Floderus, Anders; Flores Castillo, Luis; Flowerdew, Michael; Fokitis, Manolis; Fonseca Martin, Teresa; Forbush, David Alan; Formica, Andrea; Forti, Alessandra; Fortin, Dominique; Foster, Joe; Fournier, Daniel; Foussat, Arnaud; Fowler, Andrew; Fowler, Ken; Fox, Harald; Francavilla, Paolo; Franchino, Silvia; Francis, David; Frank, Tal; Franklin, Melissa; Franz, Sebastien; Fraternali, Marco; Fratina, Sasa; French, Sky; Friedrich, Felix; Froeschl, Robert; Froidevaux, Daniel; Frost, James; Fukunaga, Chikara; Fullana Torregrosa, Esteban; Fuster, Juan; Gabaldon, Carolina; Gabizon, Ofir; Gadfort, Thomas; Gadomski, Szymon; Gagliardi, Guido; Gagnon, Pauline; Galea, Cristina; Gallas, Elizabeth; Gallo, Valentina Santina; Gallop, Bruce; Gallus, Petr; Gan, KK; Gao, Yongsheng; Gapienko, Vladimir; Gaponenko, Andrei; Garberson, Ford; Garcia-Sciveres, Maurice; García, Carmen; García Navarro, José Enrique; Gardner, Robert; Garelli, Nicoletta; Garitaonandia, Hegoi; Garonne, Vincent; Garvey, John; Gatti, Claudio; Gaudio, Gabriella; Gaur, Bakul; Gauthier, Lea; Gavrilenko, Igor; Gay, Colin; Gaycken, Goetz; Gayde, Jean-Christophe; Gazis, Evangelos; Ge, Peng; Gee, Norman; Geerts, Daniël Alphonsus Adrianus; Geich-Gimbel, Christoph; Gellerstedt, Karl; Gemme, Claudia; Gemmell, Alistair; Genest, Marie-Hélène; Gentile, Simonetta; George, Matthias; George, Simon; Gerlach, Peter; Gershon, Avi; Geweniger, Christoph; Ghazlane, Hamid; Ghodbane, Nabil; Giacobbe, Benedetto; Giagu, Stefano; Giakoumopoulou, Victoria; Giangiobbe, Vincent; Gianotti, Fabiola; Gibbard, Bruce; Gibson, Adam; Gibson, Stephen; Gilbert, Laura; Gilewsky, Valentin; Gillberg, Dag; Gillman, Tony; Gingrich, Douglas; Ginzburg, Jonatan; Giokaris, Nikos; Giordani, MarioPaolo; Giordano, Raffaele; Giorgi, Francesco Michelangelo; Giovannini, Paola; Giraud, Pierre-Francois; Giugni, Danilo; Giunta, Michele; Giusti, Paolo; Gjelsten, Bø rge Kile; Gladilin, Leonid; Glasman, Claudia; Glatzer, Julian; Glazov, Alexandre; Glitza, Karl-Walter; Glonti, George; Goddard, Jack Robert; Godfrey, Jennifer; Godlewski, Jan; Goebel, Martin; Göpfert, Thomas; Goeringer, Christian; Gössling, Claus; Göttfert, Tobias; Goldfarb, Steven; Golling, Tobias; Gomes, Agostinho; Gomez Fajardo, Luz Stella; Gonçalo, Ricardo; Goncalves Pinto Firmino Da Costa, Joao; Gonella, Laura; Gonidec, Allain; Gonzalez, Saul; González de la Hoz, Santiago; Gonzalez Parra, Garoe; Gonzalez Silva, Laura; Gonzalez-Sevilla, Sergio; Goodson, Jeremiah Jet; Goossens, Luc; Gorbounov, Petr Andreevich; Gordon, Howard; Gorelov, Igor; Gorfine, Grant; Gorini, Benedetto; Gorini, Edoardo; Gorišek, Andrej; Gornicki, Edward; Gorokhov, Serguei; Goryachev, Vladimir; Gosdzik, Bjoern; Gosselink, Martijn; Gostkin, Mikhail Ivanovitch; Gough Eschrich, Ivo; Gouighri, Mohamed; Goujdami, Driss; Goulette, Marc Phillippe; Goussiou, Anna; Goy, Corinne; Gozpinar, Serdar; Grabowska-Bold, Iwona; Grafström, Per; Grahn, Karl-Johan; Grancagnolo, Francesco; Grancagnolo, Sergio; Grassi, Valerio; Gratchev, Vadim; Grau, Nathan; Gray, Heather; Gray, Julia Ann; Graziani, Enrico; Grebenyuk, Oleg; Greenshaw, Timothy; Greenwood, Zeno Dixon; Gregersen, Kristian; Gregor, Ingrid-Maria; Grenier, Philippe; Griffiths, Justin; Grigalashvili, Nugzar; Grillo, Alexander; Grinstein, Sebastian; Grishkevich, Yaroslav; Grivaz, Jean-Francois; Groh, Manfred; Gross, Eilam; Grosse-Knetter, Joern; Groth-Jensen, Jacob; Grybel, Kai; Guarino, Victor; Guest, Daniel; Guicheney, Christophe; Guida, Angelo; Guindon, Stefan; Guler, Hulya; Gunther, Jaroslav; Guo, Bin; Guo, Jun; Gupta, Ambreesh; Gusakov, Yury; Gushchin, Vladimir; Gutierrez, Phillip; Guttman, Nir; Gutzwiller, Olivier; Guyot, Claude; Gwenlan, Claire; Gwilliam, Carl; Haas, Andy; Haas, Stefan; Haber, Carl; Hadavand, Haleh Khani; Hadley, David; Haefner, Petra; Hahn, Ferdinand; Haider, Stefan; Hajduk, Zbigniew; Hakobyan, Hrachya; Hall, David; Haller, Johannes; Hamacher, Klaus; Hamal, Petr; Hamer, Matthias; Hamilton, Andrew; Hamilton, Samuel; Han, Hongguang; Han, Liang; Hanagaki, Kazunori; Hanawa, Keita; Hance, Michael; Handel, Carsten; Hanke, Paul; Hansen, John Renner; Hansen, Jø rgen Beck; Hansen, Jorn Dines; Hansen, Peter Henrik; Hansson, Per; Hara, Kazuhiko; Hare, Gabriel; Harenberg, Torsten; Harkusha, Siarhei; Harper, Devin; Harrington, Robert; Harris, Orin; Harrison, Karl; Hartert, Jochen; Hartjes, Fred; Haruyama, Tomiyoshi; Harvey, Alex; Hasegawa, Satoshi; Hasegawa, Yoji; Hassani, Samira; Hatch, Mark; Hauff, Dieter; Haug, Sigve; Hauschild, Michael; Hauser, Reiner; Havranek, Miroslav; Hawes, Brian; Hawkes, Christopher; Hawkings, Richard John; Hawkins, Anthony David; Hawkins, Donovan; Hayakawa, Takashi; Hayashi, Takayasu; Hayden, Daniel; Hayward, Helen; Haywood, Stephen; Hazen, Eric; He, Mao; Head, Simon; Hedberg, Vincent; Heelan, Louise; Heim, Sarah; Heinemann, Beate; Heisterkamp, Simon; Helary, Louis; Heller, Claudio; Heller, Matthieu; Hellman, Sten; Hellmich, Dennis; Helsens, Clement; Henderson, Robert; Henke, Michael; Henrichs, Anna; Henriques Correia, Ana Maria; Henrot-Versille, Sophie; Henry-Couannier, Frédéric; Hensel, Carsten; Henß, Tobias; Hernandez, Carlos Medina; Hernández Jiménez, Yesenia; Herrberg, Ruth; Hershenhorn, Alon David; Herten, Gregor; Hertenberger, Ralf; Hervas, Luis; Hesketh, Gavin Grant; Hessey, Nigel; Higón-Rodriguez, Emilio; Hill, Daniel; Hill, John; Hill, Norman; Hiller, Karl Heinz; Hillert, Sonja; Hillier, Stephen; Hinchliffe, Ian; Hines, Elizabeth; Hirose, Minoru; Hirsch, Florian; Hirschbuehl, Dominic; Hobbs, John; Hod, Noam; Hodgkinson, Mark; Hodgson, Paul; Hoecker, Andreas; Hoeferkamp, Martin; Hoffman, Julia; Hoffmann, Dirk; Hohlfeld, Marc; Holder, Martin; Holmgren, Sven-Olof; Holy, Tomas; Holzbauer, Jenny; Homma, Yasuhiro; Hong, Tae Min; Hooft van Huysduynen, Loek; Horazdovsky, Tomas; Horn, Claus; Horner, Stephan; Hostachy, Jean-Yves; Hou, Suen; Houlden, Michael; Hoummada, Abdeslam; Howarth, James; Howell, David; Hristova, Ivana; Hrivnac, Julius; Hruska, Ivan; Hryn'ova, Tetiana; Hsu, Pai-hsien Jennifer; Hsu, Shih-Chieh; Huang, Guang Shun; Hubacek, Zdenek; Hubaut, Fabrice; Huegging, Fabian; Huettmann, Antje; Huffman, Todd Brian; Hughes, Emlyn; Hughes, Gareth; Hughes-Jones, Richard; Huhtinen, Mika; Hurst, Peter; Hurwitz, Martina; Husemann, Ulrich; Huseynov, Nazim; Huston, Joey; Huth, John; Iacobucci, Giuseppe; Iakovidis, Georgios; Ibbotson, Michael; Ibragimov, Iskander; Ichimiya, Ryo; Iconomidou-Fayard, Lydia; Idarraga, John; Iengo, Paolo; Igonkina, Olga; Ikegami, Yoichi; Ikeno, Masahiro; Ilchenko, Yuri; Iliadis, Dimitrios; Ilic, Nikolina; Imori, Masatoshi; Ince, Tayfun; Inigo-Golfin, Joaquin; Ioannou, Pavlos; Iodice, Mauro; Ippolito, Valerio; Irles Quiles, Adrian; Isaksson, Charlie; Ishikawa, Akimasa; Ishino, Masaya; Ishmukhametov, Renat; Issever, Cigdem; Istin, Serhat; Ivashin, Anton; Iwanski, Wieslaw; Iwasaki, Hiroyuki; Izen, Joseph; Izzo, Vincenzo; Jackson, Brett; Jackson, John; Jackson, Paul; Jaekel, Martin; Jain, Vivek; Jakobs, Karl; Jakobsen, Sune; Jakubek, Jan; Jana, Dilip; Jankowski, Ernest; Jansen, Eric; Jansen, Hendrik; Jantsch, Andreas; Janus, Michel; Jarlskog, Göran; Jeanty, Laura; Jelen, Kazimierz; Jen-La Plante, Imai; Jenni, Peter; Jeremie, Andrea; Jež, Pavel; Jézéquel, Stéphane; Jha, Manoj Kumar; Ji, Haoshuang; Ji, Weina; Jia, Jiangyong; Jiang, Yi; Jimenez Belenguer, Marcos; Jin, Ge; Jin, Shan; Jinnouchi, Osamu; Joergensen, Morten Dam; Joffe, David; Johansen, Lars; Johansen, Marianne; Johansson, Erik; Johansson, Per; Johnert, Sebastian; Johns, Kenneth; Jon-And, Kerstin; Jones, Graham; Jones, Roger; Jones, Tegid; Jones, Tim; Jonsson, Ove; Joram, Christian; Jorge, Pedro; Joseph, John; Jovicevic, Jelena; Jovin, Tatjana; Ju, Xiangyang; Jung, Christian; Jungst, Ralph Markus; Juranek, Vojtech; Jussel, Patrick; Juste Rozas, Aurelio; Kabachenko, Vasily; Kabana, Sonja; Kaci, Mohammed; Kaczmarska, Anna; Kadlecik, Peter; Kado, Marumi; Kagan, Harris; Kagan, Michael; Kaiser, Steffen; Kajomovitz, Enrique; Kalinin, Sergey; Kalinovskaya, Lidia; Kama, Sami; Kanaya, Naoko; Kaneda, Michiru; Kaneti, Steven; Kanno, Takayuki; Kantserov, Vadim; Kanzaki, Junichi; Kaplan, Benjamin; Kapliy, Anton; Kaplon, Jan; Kar, Deepak; Karagounis, Michael; Karagoz, Muge; Karnevskiy, Mikhail; Karr, Kristo; Kartvelishvili, Vakhtang; Karyukhin, Andrey; Kashif, Lashkar; Kasieczka, Gregor; Kass, Richard; Kastanas, Alex; Kataoka, Mayuko; Kataoka, Yousuke; Katsoufis, Elias; Katzy, Judith; Kaushik, Venkatesh; Kawagoe, Kiyotomo; Kawamoto, Tatsuo; Kawamura, Gen; Kayl, Manuel; Kazanin, Vassili; Kazarinov, Makhail; Keeler, Richard; Kehoe, Robert; Keil, Markus; Kekelidze, George; Kennedy, John; Kenney, Christopher John; Kenyon, Mike; Kepka, Oldrich; Kerschen, Nicolas; Kerševan, Borut Paul; Kersten, Susanne; Kessoku, Kohei; Keung, Justin; Khalil-zada, Farkhad; Khandanyan, Hovhannes; Khanov, Alexander; Kharchenko, Dmitri; Khodinov, Alexander; Kholodenko, Anatoli; Khomich, Andrei; Khoo, Teng Jian; Khoriauli, Gia; Khoroshilov, Andrey; Khovanskiy, Nikolai; Khovanskiy, Valery; Khramov, Evgeniy; Khubua, Jemal; Kim, Hyeon Jin; Kim, Min Suk; Kim, Shinhong; Kimura, Naoki; Kind, Oliver; King, Barry; King, Matthew; King, Robert Steven Beaufoy; Kirk, Julie; Kirsch, Lawrence; Kiryunin, Andrey; Kishimoto, Tomoe; Kisielewska, Danuta; Kittelmann, Thomas; Kiver, Andrey; Kladiva, Eduard; Klaiber-Lodewigs, Jonas; Klein, Max; Klein, Uta; Kleinknecht, Konrad; Klemetti, Miika; Klier, Amit; Klimek, Pawel; Klimentov, Alexei; Klingenberg, Reiner; Klinger, Joel Alexander; Klinkby, Esben; Klioutchnikova, Tatiana; Klok, Peter; Klous, Sander; Kluge, Eike-Erik; Kluge, Thomas; Kluit, Peter; Kluth, Stefan; Knecht, Neil; Kneringer, Emmerich; Knobloch, Juergen; Knoops, Edith; Knue, Andrea; Ko, Byeong Rok; Kobayashi, Tomio; Kobel, Michael; Kocian, Martin; Kodys, Peter; Köneke, Karsten; König, Adriaan; Koenig, Sebastian; Köpke, Lutz; Koetsveld, Folkert; Koevesarki, Peter; Koffas, Thomas; Koffeman, Els; Kogan, Lucy Anne; Kohn, Fabian; Kohout, Zdenek; Kohriki, Takashi; Koi, Tatsumi; Kokott, Thomas; Kolachev, Guennady; Kolanoski, Hermann; Kolesnikov, Vladimir; Koletsou, Iro; Koll, James; Kollefrath, Michael; Kolya, Scott; Komar, Aston; Komori, Yuto; Kondo, Takahiko; Kono, Takanori; Kononov, Anatoly; Konoplich, Rostislav; Konstantinidis, Nikolaos; Kootz, Andreas; Koperny, Stefan; Korcyl, Krzysztof; Kordas, Kostantinos; Koreshev, Victor; Korn, Andreas; Korol, Aleksandr; Korolkov, Ilya; Korolkova, Elena; Korotkov, Vladislav; Kortner, Oliver; Kortner, Sandra; Kostyukhin, Vadim; Kotamäki, Miikka Juhani; Kotov, Sergey; Kotov, Vladislav; Kotwal, Ashutosh; Kourkoumelis, Christine; Kouskoura, Vasiliki; Koutsman, Alex; Kowalewski, Robert Victor; Kowalski, Tadeusz; Kozanecki, Witold; Kozhin, Anatoly; Kral, Vlastimil; Kramarenko, Viktor; Kramberger, Gregor; Krasny, Mieczyslaw Witold; Krasznahorkay, Attila; Kraus, James; Kraus, Jana; Kreisel, Arik; Krejci, Frantisek; Kretzschmar, Jan; Krieger, Nina; Krieger, Peter; Kroeninger, Kevin; Kroha, Hubert; Kroll, Joe; Kroseberg, Juergen; Krstic, Jelena; Kruchonak, Uladzimir; Krüger, Hans; Kruker, Tobias; Krumnack, Nils; Krumshteyn, Zinovii; Kruth, Andre; Kubota, Takashi; Kuday, Sinan; Kuehn, Susanne; Kugel, Andreas; Kuhl, Thorsten; Kuhn, Dietmar; Kukhtin, Victor; Kulchitsky, Yuri; Kuleshov, Sergey; Kummer, Christian; Kuna, Marine; Kundu, Nikhil; Kunkle, Joshua; Kupco, Alexander; Kurashige, Hisaya; Kurata, Masakazu; Kurochkin, Yurii; Kus, Vlastimil; Kuwertz, Emma Sian; Kuze, Masahiro; Kvita, Jiri; Kwee, Regina; La Rosa, Alessandro; La Rotonda, Laura; Labarga, Luis; Labbe, Julien; Lablak, Said; Lacasta, Carlos; Lacava, Francesco; Lacker, Heiko; Lacour, Didier; Lacuesta, Vicente Ramón; Ladygin, Evgueni; Lafaye, Remi; Laforge, Bertrand; Lagouri, Theodota; Lai, Stanley; Laisne, Emmanuel; Lamanna, Massimo; Lampen, Caleb; Lampl, Walter; Lancon, Eric; Landgraf, Ulrich; Landon, Murrough; Lane, Jenna; Lange, Clemens; Lankford, Andrew; Lanni, Francesco; Lantzsch, Kerstin; Laplace, Sandrine; Lapoire, Cecile; Laporte, Jean-Francois; Lari, Tommaso; Larionov, Anatoly; Larner, Aimee; Lasseur, Christian; Lassnig, Mario; Laurelli, Paolo; Lavorini, Vincenzo; Lavrijsen, Wim; Laycock, Paul; Lazarev, Alexandre; Le Dortz, Olivier; Le Guirriec, Emmanuel; Le Maner, Christophe; Le Menedeu, Eve; Lebel, Céline; LeCompte, Thomas; Ledroit-Guillon, Fabienne Agnes Marie; Lee, Hurng-Chun; Lee, Jason; Lee, Shih-Chang; Lee, Lawrence; Lefebvre, Michel; Legendre, Marie; Leger, Annie; LeGeyt, Benjamin; Legger, Federica; Leggett, Charles; Lehmacher, Marc; Lehmann Miotto, Giovanna; Lei, Xiaowen; Leite, Marco Aurelio Lisboa; Leitner, Rupert; Lellouch, Daniel; Leltchouk, Mikhail; Lemmer, Boris; Lendermann, Victor; Leney, Katharine; Lenz, Tatiana; Lenzen, Georg; Lenzi, Bruno; Leonhardt, Kathrin; Leontsinis, Stefanos; Leroy, Claude; Lessard, Jean-Raphael; Lesser, Jonas; Lester, Christopher; Leung Fook Cheong, Annabelle; Levêque, Jessica; Levin, Daniel; Levinson, Lorne; Levitski, Mikhail; Lewis, Adrian; Lewis, George; Leyko, Agnieszka; Leyton, Michael; Li, Bo; Li, Haifeng; Li, Shu; Li, Xuefei; Liang, Zhijun; Liao, Hongbo; Liberti, Barbara; Lichard, Peter; Lichtnecker, Markus; Lie, Ki; Liebig, Wolfgang; Lifshitz, Ronen; Limbach, Christian; Limosani, Antonio; Limper, Maaike; Lin, Simon; Linde, Frank; Linnemann, James; Lipeles, Elliot; Lipinsky, Lukas; Lipniacka, Anna; Liss, Tony; Lissauer, David; Lister, Alison; Litke, Alan; Liu, Chuanlei; Liu, Dong; Liu, Hao; Liu, Jianbei; Liu, Minghui; Liu, Yanwen; Livan, Michele; Livermore, Sarah; Lleres, Annick; Llorente Merino, Javier; Lloyd, Stephen; Lobodzinska, Ewelina; Loch, Peter; Lockman, William; Loddenkoetter, Thomas; Loebinger, Fred; Loginov, Andrey; Loh, Chang Wei; Lohse, Thomas; Lohwasser, Kristin; Lokajicek, Milos; Loken, James; Lombardo, Vincenzo Paolo; Long, Robin Eamonn; Lopes, Lourenco; Lopez Mateos, David; Lorenz, Jeanette; Lorenzo Martinez, Narei; Losada, Marta; Loscutoff, Peter; Lo Sterzo, Francesco; Losty, Michael; Lou, Xinchou; Lounis, Abdenour; Loureiro, Karina; Love, Jeremy; Love, Peter; Lowe, Andrew; Lu, Feng; Lubatti, Henry; Luci, Claudio; Lucotte, Arnaud; Ludwig, Andreas; Ludwig, Dörthe; Ludwig, Inga; Ludwig, Jens; Luehring, Frederick; Luijckx, Guy; Lumb, Debra; Luminari, Lamberto; Lund, Esben; Lund-Jensen, Bengt; Lundberg, Björn; Lundberg, Johan; Lundquist, Johan; Lungwitz, Matthias; Lutz, Gerhard; Lynn, David; Lys, Jeremy; Lytken, Else; Ma, Hong; Ma, Lian Liang; Macana Goia, Jorge Andres; Maccarrone, Giovanni; Macchiolo, Anna; Maček, Boštjan; Machado Miguens, Joana; Mackeprang, Rasmus; Madaras, Ronald; Mader, Wolfgang; Maenner, Reinhard; Maeno, Tadashi; Mättig, Peter; Mättig, Stefan; Magnoni, Luca; Magradze, Erekle; Mahalalel, Yair; Mahboubi, Kambiz; Mahout, Gilles; Maiani, Camilla; Maidantchik, Carmen; Maio, Amélia; Majewski, Stephanie; Makida, Yasuhiro; Makovec, Nikola; Mal, Prolay; Malaescu, Bogdan; Malecki, Pawel; Malecki, Piotr; Maleev, Victor; Malek, Fairouz; Mallik, Usha; Malon, David; Malone, Caitlin; Maltezos, Stavros; Malyshev, Vladimir; Malyukov, Sergei; Mameghani, Raphael; Mamuzic, Judita; Manabe, Atsushi; Mandelli, Luciano; Mandić, Igor; Mandrysch, Rocco; Maneira, José; Mangeard, Pierre-Simon; Manhaes de Andrade Filho, Luciano; Manjavidze, Ioseb; Mann, Alexander; Manning, Peter; Manousakis-Katsikakis, Arkadios; Mansoulie, Bruno; Manz, Andreas; Mapelli, Alessandro; Mapelli, Livio; March, Luis; Marchand, Jean-Francois; Marchese, Fabrizio; Marchiori, Giovanni; Marcisovsky, Michal; Marin, Alexandru; Marino, Christopher; Marroquim, Fernando; Marshall, Robin; Marshall, Zach; Martens, Kalen; Marti-Garcia, Salvador; Martin, Andrew; Martin, Brian; Martin, Brian; Martin, Franck Francois; Martin, Jean-Pierre; Martin, Philippe; Martin, Tim; Martin, Victoria Jane; Martin dit Latour, Bertrand; Martin-Haugh, Stewart; Martinez, Mario; Martinez Outschoorn, Verena; Martyniuk, Alex; Marx, Marilyn; Marzano, Francesco; Marzin, Antoine; Masetti, Lucia; Mashimo, Tetsuro; Mashinistov, Ruslan; Masik, Jiri; Maslennikov, Alexey; Massa, Ignazio; Massaro, Graziano; Massol, Nicolas; Mastrandrea, Paolo; Mastroberardino, Anna; Masubuchi, Tatsuya; Mathes, Markus; Matricon, Pierre; Matsumoto, Hiroshi; Matsunaga, Hiroyuki; Matsushita, Takashi; Mattravers, Carly; Maugain, Jean-Marie; Maurer, Julien; Maxfield, Stephen; Maximov, Dmitriy; May, Edward; Mayne, Anna; Mazini, Rachid; Mazur, Michael; Mazzanti, Marcello; Mazzoni, Enrico; Mc Kee, Shawn Patrick; McCarn, Allison; McCarthy, Robert; McCarthy, Tom; McCubbin, Norman; McFarlane, Kenneth; Mcfayden, Josh; McGlone, Helen; Mchedlidze, Gvantsa; McLaren, Robert Andrew; Mclaughlan, Tom; McMahon, Steve; McPherson, Robert; Meade, Andrew; Mechnich, Joerg; Mechtel, Markus; Medinnis, Mike; Meera-Lebbai, Razzak; Meguro, Tatsuma; Mehdiyev, Rashid; Mehlhase, Sascha; Mehta, Andrew; Meier, Karlheinz; Meirose, Bernhard; Melachrinos, Constantinos; Mellado Garcia, Bruce Rafael; Mendoza Navas, Luis; Meng, Zhaoxia; Mengarelli, Alberto; Menke, Sven; Menot, Claude; Meoni, Evelin; Mercurio, Kevin Michael; Mermod, Philippe; Merola, Leonardo; Meroni, Chiara; Merritt, Frank; Merritt, Hayes; Messina, Andrea; Metcalfe, Jessica; Mete, Alaettin Serhan; Meyer, Carsten; Meyer, Christopher; Meyer, Jean-Pierre; Meyer, Jochen; Meyer, Joerg; Meyer, Thomas Christian; Meyer, W Thomas; Miao, Jiayuan; Michal, Sebastien; Micu, Liliana; Middleton, Robin; Migas, Sylwia; Mijović, Liza; Mikenberg, Giora; Mikestikova, Marcela; Mikuž, Marko; Miller, David; Miller, Robert; Mills, Bill; Mills, Corrinne; Milov, Alexander; Milstead, David; Milstein, Dmitry; Minaenko, Andrey; Miñano Moya, Mercedes; Minashvili, Irakli; Mincer, Allen; Mindur, Bartosz; Mineev, Mikhail; Ming, Yao; Mir, Lluisa-Maria; Mirabelli, Giovanni; Miralles Verge, Lluis; Misiejuk, Andrzej; Mitrevski, Jovan; Mitrofanov, Gennady; Mitsou, Vasiliki A; Mitsui, Shingo; Miyagawa, Paul; Miyazaki, Kazuki; Mjörnmark, Jan-Ulf; Moa, Torbjoern; Mockett, Paul; Moed, Shulamit; Moeller, Victoria; Mönig, Klaus; Möser, Nicolas; Mohapatra, Soumya; Mohr, Wolfgang; Mohrdieck-Möck, Susanne; Moisseev, Artemy; Moles-Valls, Regina; Molina-Perez, Jorge; Monk, James; Monnier, Emmanuel; Montesano, Simone; Monticelli, Fernando; Monzani, Simone; Moore, Roger; Moorhead, Gareth; Mora Herrera, Clemencia; Moraes, Arthur; Morange, Nicolas; Morel, Julien; Morello, Gianfranco; Moreno, Deywis; Moreno Llácer, María; Morettini, Paolo; Morgenstern, Marcus; Morii, Masahiro; Morin, Jerome; Morley, Anthony Keith; Mornacchi, Giuseppe; Morozov, Sergey; Morris, John; Morvaj, Ljiljana; Moser, Hans-Guenther; Mosidze, Maia; Moss, Josh; Mount, Richard; Mountricha, Eleni; Mouraviev, Sergei; Moyse, Edward; Mudrinic, Mihajlo; Mueller, Felix; Mueller, James; Mueller, Klemens; Müller, Thomas; Mueller, Timo; Muenstermann, Daniel; Muir, Alex; Munwes, Yonathan; Murray, Bill; Mussche, Ido; Musto, Elisa; Myagkov, Alexey; Myska, Miroslav; Nadal, Jordi; Nagai, Koichi; Nagano, Kunihiro; Nagarkar, Advait; Nagasaka, Yasushi; Nagel, Martin; Nairz, Armin Michael; Nakahama, Yu; Nakamura, Koji; Nakamura, Tomoaki; Nakano, Itsuo; Nanava, Gizo; Napier, Austin; Narayan, Rohin; Nash, Michael; Nation, Nigel; Nattermann, Till; Naumann, Thomas; Navarro, Gabriela; Neal, Homer; Nebot, Eduardo; Nechaeva, Polina; Neep, Thomas James; Negri, Andrea; Negri, Guido; Nektarijevic, Snezana; Nelson, Andrew; Nelson, Silke; Nelson, Timothy Knight; Nemecek, Stanislav; Nemethy, Peter; Nepomuceno, Andre Asevedo; Nessi, Marzio; Neubauer, Mark; Neusiedl, Andrea; Neves, Ricardo; Nevski, Pavel; Newman, Paul; Nguyen Thi Hong, Van; Nickerson, Richard; Nicolaidou, Rosy; Nicolas, Ludovic; Nicquevert, Bertrand; Niedercorn, Francois; Nielsen, Jason; Niinikoski, Tapio; Nikiforou, Nikiforos; Nikiforov, Andriy; Nikolaenko, Vladimir; Nikolaev, Kirill; Nikolic-Audit, Irena; Nikolics, Katalin; Nikolopoulos, Konstantinos; Nilsen, Henrik; Nilsson, Paul; Ninomiya, Yoichi; Nisati, Aleandro; Nishiyama, Tomonori; Nisius, Richard; Nodulman, Lawrence; Nomachi, Masaharu; Nomidis, Ioannis; Nordberg, Markus; Nordkvist, Bjoern; Norton, Peter; Novakova, Jana; Nozaki, Mitsuaki; Nozka, Libor; Nugent, Ian Michael; Nuncio-Quiroz, Adriana-Elizabeth; Nunes Hanninger, Guilherme; Nunnemann, Thomas; Nurse, Emily; O'Brien, Brendan Joseph; O'Neale, Steve; O'Neil, Dugan; O'Shea, Val; Oakes, Louise Beth; Oakham, Gerald; Oberlack, Horst; Ocariz, Jose; Ochi, Atsuhiko; Oda, Susumu; Odaka, Shigeru; Odier, Jerome; Ogren, Harold; Oh, Alexander; Oh, Seog; Ohm, Christian; Ohshima, Takayoshi; Ohshita, Hidetoshi; Okada, Shogo; Okawa, Hideki; Okumura, Yasuyuki; Okuyama, Toyonobu; Olariu, Albert; Olcese, Marco; Olchevski, Alexander; Olivares Pino, Sebastian Andres; Oliveira, Miguel Alfonso; Oliveira Damazio, Denis; Oliver Garcia, Elena; Olivito, Dominick; Olszewski, Andrzej; Olszowska, Jolanta; Omachi, Chihiro; Onofre, António; Onyisi, Peter; Oram, Christopher; Oreglia, Mark; Oren, Yona; Orestano, Domizia; Orlov, Iliya; Oropeza Barrera, Cristina; Orr, Robert; Osculati, Bianca; Ospanov, Rustem; Osuna, Carlos; Otero y Garzon, Gustavo; Ottersbach, John; Ouchrif, Mohamed; Ouellette, Eric; Ould-Saada, Farid; Ouraou, Ahmimed; Ouyang, Qun; Ovcharova, Ana; Owen, Mark; Owen, Simon; Ozcan, Veysi Erkcan; Ozturk, Nurcan; Pacheco Pages, Andres; Padilla Aranda, Cristobal; Pagan Griso, Simone; Paganis, Efstathios; Paige, Frank; Pais, Preema; Pajchel, Katarina; Palacino, Gabriel; Paleari, Chiara; Palestini, Sandro; Pallin, Dominique; Palma, Alberto; Palmer, Jody; Pan, Yibin; Panagiotopoulou, Evgenia; Panes, Boris; Panikashvili, Natalia; Panitkin, Sergey; Pantea, Dan; Panuskova, Monika; Paolone, Vittorio; Papadelis, Aras; Papadopoulou, Theodora; Paramonov, Alexander; Paredes Hernandez, Daniela; Park, Woochun; Parker, Andy; Parodi, Fabrizio; Parsons, John; Parzefall, Ulrich; Pasqualucci, Enrico; Passaggio, Stefano; Passeri, Antonio; Pastore, Fernanda; Pastore, Francesca; Pásztor, Gabriella; Pataraia, Sophio; Patel, Nikhul; Pater, Joleen; Patricelli, Sergio; Pauly, Thilo; Pecsy, Martin; Pedraza Morales, Maria Isabel; Peleganchuk, Sergey; Peng, Haiping; Pengo, Ruggero; Penson, Alexander; Penwell, John; Perantoni, Marcelo; Perez, Kerstin; Perez Cavalcanti, Tiago; Perez Codina, Estel; Pérez García-Estañ, María Teresa; Perez Reale, Valeria; Perini, Laura; Pernegger, Heinz; Perrino, Roberto; Perrodo, Pascal; Persembe, Seda; Perus, Antoine; Peshekhonov, Vladimir; Peters, Krisztian; Petersen, Brian; Petersen, Jorgen; Petersen, Troels; Petit, Elisabeth; Petridis, Andreas; Petridou, Chariclia; Petrolo, Emilio; Petrucci, Fabrizio; Petschull, Dennis; Petteni, Michele; Pezoa, Raquel; Phan, Anna; Phillips, Peter William; Piacquadio, Giacinto; Piccaro, Elisa; Piccinini, Maurizio; Piec, Sebastian Marcin; Piegaia, Ricardo; Pignotti, David; Pilcher, James; Pilkington, Andrew; Pina, João Antonio; Pinamonti, Michele; Pinder, Alex; Pinfold, James; Ping, Jialun; Pinto, Belmiro; Pirotte, Olivier; Pizio, Caterina; Plamondon, Mathieu; Pleier, Marc-Andre; Pleskach, Anatoly; Poblaguev, Andrei; Poddar, Sahill; Podlyski, Fabrice; Poggioli, Luc; Poghosyan, Tatevik; Pohl, Martin; Polci, Francesco; Polesello, Giacomo; Policicchio, Antonio; Polini, Alessandro; Poll, James; Polychronakos, Venetios; Pomarede, Daniel Marc; Pomeroy, Daniel; Pommès, Kathy; Pontecorvo, Ludovico; Pope, Bernard; Popeneciu, Gabriel Alexandru; Popovic, Dragan; Poppleton, Alan; Portell Bueso, Xavier; Posch, Christoph; Pospelov, Guennady; Pospisil, Stanislav; Potrap, Igor; Potter, Christina; Potter, Christopher; Poulard, Gilbert; Poveda, Joaquin; Prabhu, Robindra; Pralavorio, Pascal; Pranko, Aliaksandr; Prasad, Srivas; Pravahan, Rishiraj; Prell, Soeren; Pretzl, Klaus Peter; Pribyl, Lukas; Price, Darren; Price, Joe; Price, Lawrence; Price, Michael John; Prieur, Damien; Primavera, Margherita; Prokofiev, Kirill; Prokoshin, Fedor; Protopopescu, Serban; Proudfoot, James; Prudent, Xavier; Przybycien, Mariusz; Przysiezniak, Helenka; Psoroulas, Serena; Ptacek, Elizabeth; Pueschel, Elisa; Purdham, John; Purohit, Milind; Puzo, Patrick; Pylypchenko, Yuriy; Qian, Jianming; Qian, Zuxuan; Qin, Zhonghua; Quadt, Arnulf; Quarrie, David; Quayle, William; Quinonez, Fernando; Raas, Marcel; Radescu, Voica; Radics, Balint; Radloff, Peter; Rador, Tonguc; Ragusa, Francesco; Rahal, Ghita; Rahimi, Amir; Rahm, David; Rajagopalan, Srinivasan; Rammensee, Michael; Rammes, Marcus; Randle-Conde, Aidan Sean; Randrianarivony, Koloina; Ratoff, Peter; Rauscher, Felix; Rave, Tobias Christian; Raymond, Michel; Read, Alexander Lincoln; Rebuzzi, Daniela; Redelbach, Andreas; Redlinger, George; Reece, Ryan; Reeves, Kendall; Reichold, Armin; Reinherz-Aronis, Erez; Reinsch, Andreas; Reisinger, Ingo; Rembser, Christoph; Ren, Zhongliang; Renaud, Adrien; Renkel, Peter; Rescigno, Marco; Resconi, Silvia; Resende, Bernardo; Reznicek, Pavel; Rezvani, Reyhaneh; Richards, Alexander; Richter, Robert; Richter-Was, Elzbieta; Ridel, Melissa; Rijpstra, Manouk; Rijssenbeek, Michael; Rimoldi, Adele; Rinaldi, Lorenzo; Rios, Ryan Randy; Riu, Imma; Rivoltella, Giancesare; Rizatdinova, Flera; Rizvi, Eram; Robertson, Steven; Robichaud-Veronneau, Andree; Robinson, Dave; Robinson, James; Robinson, Mary; Robson, Aidan; Rocha de Lima, Jose Guilherme; Roda, Chiara; Roda Dos Santos, Denis; Rodriguez, Diego; Roe, Adam; Roe, Shaun; Røhne, Ole; Rojo, Victoria; Rolli, Simona; Romaniouk, Anatoli; Romano, Marino; Romanov, Victor; Romeo, Gaston; Romero Adam, Elena; Roos, Lydia; Ros, Eduardo; Rosati, Stefano; Rosbach, Kilian; Rose, Anthony; Rose, Matthew; Rosenbaum, Gabriel; Rosenberg, Eli; Rosendahl, Peter Lundgaard; Rosenthal, Oliver; Rosselet, Laurent; Rossetti, Valerio; Rossi, Elvira; Rossi, Leonardo Paolo; Rotaru, Marina; Roth, Itamar; Rothberg, Joseph; Rousseau, David; Royon, Christophe; Rozanov, Alexander; Rozen, Yoram; Ruan, Xifeng; Rubinskiy, Igor; Ruckert, Benjamin; Ruckstuhl, Nicole; Rud, Viacheslav; Rudolph, Christian; Rudolph, Gerald; Rühr, Frederik; Ruggieri, Federico; Ruiz-Martinez, Aranzazu; Rumiantsev, Viktor; Rumyantsev, Leonid; Runge, Kay; Rurikova, Zuzana; Rusakovich, Nikolai; Rust, Dave; Rutherfoord, John; Ruwiedel, Christoph; Ruzicka, Pavel; Ryabov, Yury; Ryadovikov, Vasily; Ryan, Patrick; Rybar, Martin; Rybkin, Grigori; Ryder, Nick; Rzaeva, Sevda; Saavedra, Aldo; Sadeh, Iftach; Sadrozinski, Hartmut; Sadykov, Renat; Safai Tehrani, Francesco; Sakamoto, Hiroshi; Salamanna, Giuseppe; Salamon, Andrea; Saleem, Muhammad; Salihagic, Denis; Salnikov, Andrei; Salt, José; Salvachua Ferrando, Belén; Salvatore, Daniela; Salvatore, Pasquale Fabrizio; Salvucci, Antonio; Salzburger, Andreas; Sampsonidis, Dimitrios; Samset, Björn Hallvard; Sanchez, Arturo; Sanchez Martinez, Victoria; Sandaker, Heidi; Sander, Heinz Georg; Sanders, Michiel; Sandhoff, Marisa; Sandoval, Tanya; Sandoval, Carlos; Sandstroem, Rikard; Sandvoss, Stephan; Sankey, Dave; Sansoni, Andrea; Santamarina Rios, Cibran; Santoni, Claudio; Santonico, Rinaldo; Santos, Helena; Saraiva, João; Sarangi, Tapas; Sarkisyan-Grinbaum, Edward; Sarri, Francesca; Sartisohn, Georg; Sasaki, Osamu; Sasao, Noboru; Satsounkevitch, Igor; Sauvage, Gilles; Sauvan, Emmanuel; Sauvan, Jean-Baptiste; Savard, Pierre; Savinov, Vladimir; Savu, Dan Octavian; Sawyer, Lee; Saxon, David; Says, Louis-Pierre; Sbarra, Carla; Sbrizzi, Antonio; Scallon, Olivia; Scannicchio, Diana; Scarcella, Mark; Schaarschmidt, Jana; Schacht, Peter; Schäfer, Uli; Schaepe, Steffen; Schaetzel, Sebastian; Schaffer, Arthur; Schaile, Dorothee; Schamberger, R~Dean; Schamov, Andrey; Scharf, Veit; Schegelsky, Valery; Scheirich, Daniel; Schernau, Michael; Scherzer, Max; Schiavi, Carlo; Schieck, Jochen; Schioppa, Marco; Schlenker, Stefan; Schlereth, James; Schmidt, Evelyn; Schmieden, Kristof; Schmitt, Christian; Schmitt, Sebastian; Schmitz, Martin; Schöning, André; Schott, Matthias; Schouten, Doug; Schovancova, Jaroslava; Schram, Malachi; Schroeder, Christian; Schroer, Nicolai; Schuh, Silvia; Schuler, Georges; Schultens, Martin Johannes; Schultes, Joachim; Schultz-Coulon, Hans-Christian; Schulz, Holger; Schumacher, Jan; Schumacher, Markus; Schumm, Bruce; Schune, Philippe; Schwanenberger, Christian; Schwartzman, Ariel; Schwemling, Philippe; Schwienhorst, Reinhard; Schwierz, Rainer; Schwindling, Jerome; Schwindt, Thomas; Schwoerer, Maud; Scott, Bill; Searcy, Jacob; Sedov, George; Sedykh, Evgeny; Segura, Ester; Seidel, Sally; Seiden, Abraham; Seifert, Frank; Seixas, José; Sekhniaidze, Givi; Selbach, Karoline Elfriede; Seliverstov, Dmitry; Sellden, Bjoern; Sellers, Graham; Seman, Michal; Semprini-Cesari, Nicola; Serfon, Cedric; Serin, Laurent; Serkin, Leonid; Seuster, Rolf; Severini, Horst; Sevior, Martin; Sfyrla, Anna; Shabalina, Elizaveta; Shamim, Mansoora; Shan, Lianyou; Shank, James; Shao, Qi Tao; Shapiro, Marjorie; Shatalov, Pavel; Shaver, Leif; Shaw, Kate; Sherman, Daniel; Sherwood, Peter; Shibata, Akira; Shichi, Hideharu; Shimizu, Shima; Shimojima, Makoto; Shin, Taeksu; Shiyakova, Maria; Shmeleva, Alevtina; Shochet, Mel; Short, Daniel; Shrestha, Suyog; Shulga, Evgeny; Shupe, Michael; Sicho, Petr; Sidoti, Antonio; Siegert, Frank; Sijacki, Djordje; Silbert, Ohad; Silva, José; Silver, Yiftah; Silverstein, Daniel; Silverstein, Samuel; Simak, Vladislav; Simard, Olivier; Simic, Ljiljana; Simion, Stefan; Simmons, Brinick; Simonyan, Margar; Sinervo, Pekka; Sinev, Nikolai; Sipica, Valentin; Siragusa, Giovanni; Sircar, Anirvan; Sisakyan, Alexei; Sivoklokov, Serguei; Sjölin, Jörgen; Sjursen, Therese; Skinnari, Louise Anastasia; Skottowe, Hugh Philip; Skovpen, Kirill; Skubic, Patrick; Skvorodnev, Nikolai; Slater, Mark; Slavicek, Tomas; Sliwa, Krzysztof; Sloper, John erik; Smakhtin, Vladimir; Smart, Ben; Smirnov, Sergei; Smirnov, Yury; Smirnova, Lidia; Smirnova, Oxana; Smith, Ben Campbell; Smith, Douglas; Smith, Kenway; Smizanska, Maria; Smolek, Karel; Snesarev, Andrei; Snow, Steve; Snow, Joel; Snuverink, Jochem; Snyder, Scott; Soares, Mara; Sobie, Randall; Sodomka, Jaromir; Soffer, Abner; Solans, Carlos; Solar, Michael; Solc, Jaroslav; Soldatov, Evgeny; Soldevila, Urmila; Solfaroli Camillocci, Elena; Solodkov, Alexander; Solovyanov, Oleg; Soni, Nitesh; Sopko, Vit; Sopko, Bruno; Sosebee, Mark; Soualah, Rachik; Soukharev, Andrey; Spagnolo, Stefania; Spanò, Francesco; Spighi, Roberto; Spigo, Giancarlo; Spila, Federico; Spiwoks, Ralf; Spousta, Martin; Spreitzer, Teresa; Spurlock, Barry; St Denis, Richard Dante; Stahlman, Jonathan; Stamen, Rainer; Stanecka, Ewa; Stanek, Robert; Stanescu, Cristian; Stapnes, Steinar; Starchenko, Evgeny; Stark, Jan; Staroba, Pavel; Starovoitov, Pavel; Staude, Arnold; Stavina, Pavel; Stavropoulos, Georgios; Steele, Genevieve; Steinbach, Peter; Steinberg, Peter; Stekl, Ivan; Stelzer, Bernd; Stelzer, Harald Joerg; Stelzer-Chilton, Oliver; Stenzel, Hasko; Stern, Sebastian; Stevenson, Kyle; Stewart, Graeme; Stillings, Jan Andre; Stockton, Mark; Stoerig, Kathrin; Stoicea, Gabriel; Stonjek, Stefan; Strachota, Pavel; Stradling, Alden; Straessner, Arno; Strandberg, Jonas; Strandberg, Sara; Strandlie, Are; Strang, Michael; Strauss, Emanuel; Strauss, Michael; Strizenec, Pavol; Ströhmer, Raimund; Strom, David; Strong, John; Stroynowski, Ryszard; Strube, Jan; Stugu, Bjarne; Stumer, Iuliu; Stupak, John; Sturm, Philipp; Styles, Nicholas Adam; Soh, Dart-yin; Su, Dong; Subramania, Halasya Siva; Succurro, Antonella; Sugaya, Yorihito; Sugimoto, Takuya; Suhr, Chad; Suita, Koichi; Suk, Michal; Sulin, Vladimir; Sultansoy, Saleh; Sumida, Toshi; Sun, Xiaohu; Sundermann, Jan Erik; Suruliz, Kerim; Sushkov, Serge; Susinno, Giancarlo; Sutton, Mark; Suzuki, Yu; Suzuki, Yuta; Svatos, Michal; Sviridov, Yuri; Swedish, Stephen; Sykora, Ivan; Sykora, Tomas; Szeless, Balazs; Sánchez, Javier; Ta, Duc; Tackmann, Kerstin; Taffard, Anyes; Tafirout, Reda; Taiblum, Nimrod; Takahashi, Yuta; Takai, Helio; Takashima, Ryuichi; Takeda, Hiroshi; Takeshita, Tohru; Takubo, Yosuke; Talby, Mossadek; Talyshev, Alexey; Tamsett, Matthew; Tanaka, Junichi; Tanaka, Reisaburo; Tanaka, Satoshi; Tanaka, Shuji; Tanaka, Yoshito; Tanasijczuk, Andres Jorge; Tani, Kazutoshi; Tannoury, Nancy; Tappern, Geoffrey; Tapprogge, Stefan; Tardif, Dominique; Tarem, Shlomit; Tarrade, Fabien; Tartarelli, Giuseppe Francesco; Tas, Petr; Tasevsky, Marek; Tassi, Enrico; Tatarkhanov, Mous; Tayalati, Yahya; Taylor, Christopher; Taylor, Frank; Taylor, Geoffrey; Taylor, Wendy; Teinturier, Marthe; Teixeira Dias Castanheira, Matilde; Teixeira-Dias, Pedro; Temming, Kim Katrin; Ten Kate, Herman; Teng, Ping-Kun; Terada, Susumu; Terashi, Koji; Terron, Juan; Testa, Marianna; Teuscher, Richard; Thadome, Jocelyn; Therhaag, Jan; Theveneaux-Pelzer, Timothée; Thioye, Moustapha; Thoma, Sascha; Thomas, Juergen; Thompson, Emily; Thompson, Paul; Thompson, Peter; Thompson, Stan; Thomsen, Lotte Ansgaard; Thomson, Evelyn; Thomson, Mark; Thun, Rudolf; Tian, Feng; Tibbetts, Mark James; Tic, Tomáš; Tikhomirov, Vladimir; Tikhonov, Yury; Timoshenko, Sergey; Tipton, Paul; Tique Aires Viegas, Florbela De Jes; Tisserant, Sylvain; Toczek, Barbara; Todorov, Theodore; Todorova-Nova, Sharka; Toggerson, Brokk; Tojo, Junji; Tokár, Stanislav; Tokunaga, Kaoru; Tokushuku, Katsuo; Tollefson, Kirsten; Tomoto, Makoto; Tompkins, Lauren; Toms, Konstantin; Tong, Guoliang; Tonoyan, Arshak; Topfel, Cyril; Topilin, Nikolai; Torchiani, Ingo; Torrence, Eric; Torres, Heberth; Torró Pastor, Emma; Toth, Jozsef; Touchard, Francois; Tovey, Daniel; Trefzger, Thomas; Tremblet, Louis; Tricoli, Alesandro; Trigger, Isabel Marian; Trincaz-Duvoid, Sophie; Trinh, Thi Nguyet; Tripiana, Martin; Trischuk, William; Trivedi, Arjun; Trocmé, Benjamin; Troncon, Clara; Trottier-McDonald, Michel; Trzebinski, Maciej; Trzupek, Adam; Tsarouchas, Charilaos; Tseng, Jeffrey; Tsiakiris, Menelaos; Tsiareshka, Pavel; Tsionou, Dimitra; Tsipolitis, Georgios; Tsiskaridze, Vakhtang; Tskhadadze, Edisher; Tsukerman, Ilya; Tsulaia, Vakhtang; Tsung, Jieh-Wen; Tsuno, Soshi; Tsybychev, Dmitri; Tua, Alan; Tudorache, Alexandra; Tudorache, Valentina; Tuggle, Joseph; Turala, Michal; Turecek, Daniel; Turk Cakir, Ilkay; Turlay, Emmanuel; Turra, Ruggero; Tuts, Michael; Tykhonov, Andrii; Tylmad, Maja; Tyndel, Mike; Tzanakos, George; Uchida, Kirika; Ueda, Ikuo; Ueno, Ryuichi; Ugland, Maren; Uhlenbrock, Mathias; Uhrmacher, Michael; Ukegawa, Fumihiko; Unal, Guillaume; Underwood, David; Undrus, Alexander; Unel, Gokhan; Unno, Yoshinobu; Urbaniec, Dustin; Usai, Giulio; Uslenghi, Massimiliano; Vacavant, Laurent; Vacek, Vaclav; Vachon, Brigitte; Vahsen, Sven; Valenta, Jan; Valente, Paolo; Valentinetti, Sara; Valkar, Stefan; Valladolid Gallego, Eva; Vallecorsa, Sofia; Valls Ferrer, Juan Antonio; van der Graaf, Harry; van der Kraaij, Erik; Van Der Leeuw, Robin; van der Poel, Egge; van der Ster, Daniel; van Eldik, Niels; van Gemmeren, Peter; van Kesteren, Zdenko; van Vulpen, Ivo; Vanadia, Marco; Vandelli, Wainer; Vandoni, Giovanna; Vaniachine, Alexandre; Vankov, Peter; Vannucci, Francois; Varela Rodriguez, Fernando; Vari, Riccardo; Varnes, Erich; Varouchas, Dimitris; Vartapetian, Armen; Varvell, Kevin; Vassilakopoulos, Vassilios; Vazeille, Francois; Vegni, Guido; Veillet, Jean-Jacques; Vellidis, Constantine; Veloso, Filipe; Veness, Raymond; Veneziano, Stefano; Ventura, Andrea; Ventura, Daniel; Venturi, Manuela; Venturi, Nicola; Vercesi, Valerio; Verducci, Monica; Verkerke, Wouter; Vermeulen, Jos; Vest, Anja; Vetterli, Michel; Vichou, Irene; Vickey, Trevor; Vickey Boeriu, Oana Elena; Viehhauser, Georg; Viel, Simon; Villa, Mauro; Villaplana Perez, Miguel; Vilucchi, Elisabetta; Vincter, Manuella; Vinek, Elisabeth; Vinogradov, Vladimir; Virchaux, Marc; Virzi, Joseph; Vitells, Ofer; Viti, Michele; Vivarelli, Iacopo; Vives Vaque, Francesc; Vlachos, Sotirios; Vladoiu, Dan; Vlasak, Michal; Vlasov, Nikolai; Vogel, Adrian; Vokac, Petr; Volpi, Guido; Volpi, Matteo; Volpini, Giovanni; von der Schmitt, Hans; von Loeben, Joerg; von Radziewski, Holger; von Toerne, Eckhard; Vorobel, Vit; Vorobiev, Alexander; Vorwerk, Volker; Vos, Marcel; Voss, Rudiger; Voss, Thorsten Tobias; Vossebeld, Joost; Vranjes, Nenad; Vranjes Milosavljevic, Marija; Vrba, Vaclav; Vreeswijk, Marcel; Vu Anh, Tuan; Vuillermet, Raphael; Vukotic, Ilija; Wagner, Wolfgang; Wagner, Peter; Wahlen, Helmut; Wakabayashi, Jun; Walbersloh, Jorg; Walch, Shannon; Walder, James; Walker, Rodney; Walkowiak, Wolfgang; Wall, Richard; Waller, Peter; Wang, Chiho; Wang, Haichen; Wang, Hulin; Wang, Jike; Wang, Jin; Wang, Joshua C; Wang, Rui; Wang, Song-Ming; Warburton, Andreas; Ward, Patricia; Warsinsky, Markus; Watkins, Peter; Watson, Alan; Watson, Ian; Watson, Miriam; Watts, Gordon; Watts, Stephen; Waugh, Anthony; Waugh, Ben; Weber, Marc; Weber, Michele; Weber, Pavel; Weidberg, Anthony; Weigell, Philipp; Weingarten, Jens; Weiser, Christian; Wellenstein, Hermann; Wells, Phillippa; Wen, Mei; Wenaus, Torre; Wendler, Shanti; Weng, Zhili; Wengler, Thorsten; Wenig, Siegfried; Wermes, Norbert; Werner, Matthias; Werner, Per; Werth, Michael; Wessels, Martin; Weydert, Carole; Whalen, Kathleen; Wheeler-Ellis, Sarah Jane; Whitaker, Scott; White, Andrew; White, Martin; Whitehead, Samuel Robert; Whiteson, Daniel; Whittington, Denver; Wicek, Francois; Wicke, Daniel; Wickens, Fred; Wiedenmann, Werner; Wielers, Monika; Wienemann, Peter; Wiglesworth, Craig; Wiik-Fuchs, Liv Antje Mari; Wijeratne, Peter Alexander; Wildauer, Andreas; Wildt, Martin Andre; Wilhelm, Ivan; Wilkens, Henric George; Will, Jonas Zacharias; Williams, Eric; Williams, Hugh; Willis, William; Willocq, Stephane; Wilson, John; Wilson, Michael Galante; Wilson, Alan; Wingerter-Seez, Isabelle; Winkelmann, Stefan; Winklmeier, Frank; Wittgen, Matthias; Wolter, Marcin Wladyslaw; Wolters, Helmut; Wong, Wei-Cheng; Wooden, Gemma; Wosiek, Barbara; Wotschack, Jorg; Woudstra, Martin; Wozniak, Krzysztof; Wraight, Kenneth; Wright, Catherine; Wright, Michael; Wrona, Bozydar; Wu, Sau Lan; Wu, Xin; Wu, Yusheng; Wulf, Evan; Wunstorf, Renate; Wynne, Benjamin; Xella, Stefania; Xiao, Meng; Xie, Song; Xie, Yigang; Xu, Chao; Xu, Da; Xu, Guofa; Yabsley, Bruce; Yacoob, Sahal; Yamada, Miho; Yamaguchi, Hiroshi; Yamamoto, Akira; Yamamoto, Kyoko; Yamamoto, Shimpei; Yamamura, Taiki; Yamanaka, Takashi; Yamaoka, Jared; Yamazaki, Takayuki; Yamazaki, Yuji; Yan, Zhen; Yang, Haijun; Yang, Un-Ki; Yang, Yi; Yang, Yi; Yang, Zhaoyu; Yanush, Serguei; Yao, Yushu; Yasu, Yoshiji; Ybeles Smit, Gabriel Valentijn; Ye, Jingbo; Ye, Shuwei; Yilmaz, Metin; Yoosoofmiya, Reza; Yorita, Kohei; Yoshida, Riktura; Young, Charles; Youssef, Saul; Yu, Dantong; Yu, Jaehoon; Yu, Jie; Yuan, Li; Yurkewicz, Adam; Zabinski, Bartlomiej; Zaets, Vassilli; Zaidan, Remi; Zaitsev, Alexander; Zajacova, Zuzana; Zanello, Lucia; Zarzhitsky, Pavel; Zaytsev, Alexander; Zeitnitz, Christian; Zeller, Michael; Zeman, Martin; Zemla, Andrzej; Zendler, Carolin; Zenin, Oleg; Ženiš, Tibor; Zinonos, Zinonas; Zenz, Seth; Zerwas, Dirk; Zevi della Porta, Giovanni; Zhan, Zhichao; Zhang, Dongliang; Zhang, Huaqiao; Zhang, Jinlong; Zhang, Xueyao; Zhang, Zhiqing; Zhao, Long; Zhao, Tianchi; Zhao, Zhengguo; Zhemchugov, Alexey; Zheng, Shuchen; Zhong, Jiahang; Zhou, Bing; Zhou, Ning; Zhou, Yue; Zhu, Cheng Guang; Zhu, Hongbo; Zhu, Junjie; Zhu, Yingchun; Zhuang, Xuai; Zhuravlov, Vadym; Zieminska, Daria; Zimmermann, Robert; Zimmermann, Simone; Zimmermann, Stephanie; Ziolkowski, Michael; Zitoun, Robert; Živković, Lidija; Zmouchko, Viatcheslav; Zobernig, Georg; Zoccoli, Antonio; Zolnierowski, Yves; Zsenei, Andras; zur Nedden, Martin; Zutshi, Vishnu; Zwalinski, Lukasz


    The $\\chi_b$(nP) quarkonium states are produced in proton-proton collisions at the Large Hadron Collider (LHC) at $\\sqrt{s}$ = 7 TeV and recorded by the ATLAS detector. Using a data sample corresponding to an integrated luminosity of 4.4 fb$^{-1}$, these states are reconstructed through their radiative decays to $\\Upsilon$(1S,2S) with $\\Upsilon \\to \\mu^+ \\mu^-$. In addition to the mass peaks corresponding to the decay modes $\\chi_b(1P,2P) \\to \\Upsilon(1S)\\gamma$, a new structure centered at a mass of 10.539+/-0.004 (stat.)+/-0.008 (syst.) GeV is also observed, in both the $\\Upsilon(1S)\\gamma$ and $\\Upsilon(2S)\\gamma$ decay modes. This is interpreted as the $\\chi_b$(3P) system.

  5. Music in Spain in the 1670s through the eyes of Sébastien Chièze and Constantijn Huygens

    Directory of Open Access Journals (Sweden)

    Rasch, Rudolf A.


    Full Text Available In this contribution the various remarks about music in Spain that can be found in the correspondence between Sébastien Chièze (envoy on behalf of the Prince of Orange in Madrid and Constantijn Huygens (The Hague from 1672 to 1679 are discussed. Huygens asked Chièze to find for him a copy of Salinas’s De musica (1577, as well as Spanish airs and pieces for guitar. It took Chièze two years to find a copy of De musica in Spain and have it sent safely to Holland. Huygens did not like the Spanish airs sent by Chièze, by composers such as Juan del Vado, José Marín, Cristóbal Galán, and Juan Hidalgo. He found them too “African”. Nor did he like the guitar tablature, which turned the notation as he was used to seeing it upside down. Chièze also had a guitar made for Huygens in Madrid, but this instrument also met with disapproval. In the end, Chièze asked two Bolognese acquaintances, Giulio and Guido Bovio, to search for a suitable lute for Huygens in Bologna. They found two, but it is unknown whether these ever arrived in Holland. The contribution shows the importance of foreign (diplomatic contacts in the acquisition of musical articles, such as books about music, musical compositions and musical instruments.

    Este artículo trata de las diversas observaciones a propósito de la música en España, que se encuentran en la correspondencia entre Sébastien Chièze (embajador del Príncipe de Orange en Madrid y Constantijn Huygens (La Haya, entre 1672 y 1679. Huygens pidió a Chièze que le encontrara un ejemplar del De musica de Salinas (1577, así como tonadas españolas y piezas para guitarra. A Chièze le llevó dos años hallar una copia del De musica en territorio español y hacer que el libro llegara a Holanda sano y salvo. Las tonadas remitidas por Chièze (de compositores tales como Juan del Vado, José Marín, Cristóbal Galán y Juan Hidalgo, no gustaron nada a Huygens, que las halló demasiado “africanas”. Como

  6. Electron paramagnetic resonance

    CERN Document Server

    Al'tshuler, S A


    Electron Paramagnetic Resonance is a comprehensive text on the field of electron paramagnetic resonance, covering both the theoretical background and the results of experiment. This book is composed of eight chapters that cover theoretical materials and experimental data on ionic crystals, since these are the materials that have been most extensively studied by the methods of paramagnetic resonance. The opening chapters provide an introduction to the basic principles of electron paramagnetic resonance and the methods of its measurement. The next chapters are devoted to the theory of spectra an

  7. Effective resonance levels

    International Nuclear Information System (INIS)

    Two models indended for calculation of neutron resonance absorption in reactor cells are considered. A method, by which resonance absorption on a certain system of levels is represented by absorption at a level with effective parameters, is suggested. Two models are considered. The first one is based on conservation of resonance integrals: infinite dilution in approximation of narrow resonances and infinite mass. The second one is based on coservation of resonance integrals for some values of dilution cross section and temperature applying thetheory of intermediate resonances with temperature dependence. Parameters of effective resonance level have universal character and they can be applied for calculation of resonance absorption in homogeneous and heterogeneous systems. Results of the calculations for 8 uranium-water cells using parameters of effective levels in the groups 15, 16, 17 of the BNAB system reveal that the attained accuracy complies with requirements placed upon the calculation of resonance absorption of 238U. The method can be applied to other isotopes as well

  8. Controlling Parametric Resonance

    DEFF Research Database (Denmark)

    Galeazzi, Roberto; Pettersen, Kristin Ytterstad


    system undergoing it could transform the large amplitude motion into, for example, energy. Therefore the development of control strategies to induce parametric resonance into a system can be as valuable as those which aim at stabilizing the resonant oscillations. By means of a mechanical equivalent the...... authors review the conditions for the onset of parametric resonance, and propose a nonlinear control strategy in order to both induce the resonant oscillations and to stabilize the unstable motion. Lagrange’s theory is used to derive the dynamics of the system and input–output feedback linearization is...

  9. Electrically detected ferromagnetic resonance

    International Nuclear Information System (INIS)

    We study the magnetoresistance properties of thin ferromagnetic CrO2 and Fe3O4 films under microwave irradiation. Both the sheet resistance ρ and the Hall voltage VHall characteristically change when a ferromagnetic resonance (FMR) occurs in the film. The electrically detected ferromagnetic resonance (EDFMR) signals closely match the conventional FMR, measured simultaneously, in both resonance fields and line shapes. The sign and the magnitude of the resonant changes Δρ/ρ and ΔVHall/VHall can be consistently described in terms of a Joule heating effect. Bolometric EDFMR thus is a powerful tool for the investigation of magnetic anisotropy and magnetoresistive phenomena in ferromagnetic micro- or nanostructures

  10. Controlling Parametric Resonance

    DEFF Research Database (Denmark)

    Galeazzi, Roberto; Pettersen, Kristin Ytterstad

    system undergoing it could transform the large amplitude motion into, for example, energy. Therefore the development of control strategies to induce parametric resonance into a system can be as valuable as those which aim at stabilizing the resonant oscillations. By means of a mechanical equivalent the...... authors review the conditions for the onset of parametric resonance, and propose a nonlinear control strategy in order to both induce the resonant oscillations and to stabilize the unstable motion. Lagrange’s theory is used to derive the dynamics of the system and input–output feedback linearization is...

  11. Application of Tai Chi in Modern Dance%论太极元素在现代舞中的运用

    Institute of Scientific and Technical Information of China (English)

    肖灿; 刘德欢


    太极当中有着很多现代舞中追求自然、刚柔结合的动作特点。而现代舞舞蹈韵律与太极形韵也存在一定的异同点。本文论述太极与现代舞之间的关系和太极韵律对现代舞训练过程中的影响与发展,如通过现代舞的动作与太极之“形”、现代舞的气息与太极之“气”、现代舞的表现力与太极之“神”等多方面深入分析其自然、人体与情感之美,阐明太极拳在现代舞训练与表演中的运用有助于舞蹈演员的训练与现代舞的发展。%There is a lot of Tai Chi movement characteristics of modern dance in the pursuit of natural, flexible joint.But the modern dance rhythm and rhyme of Tai Chi form also has some similarities and differ-ences.This paper discusses the relationship between Taijiquan and modern dance and Tai Chi rhythm of mod-ern dance in the process of training and development,such as through the modern dance movements and Tai Chi"form",the modern dance breath and Tai Chi of the"gas",modern dance performance and Tai Chi"God"and other aspects of in-depth analysis of its natural,human and emotional beauty,how to use the development of Taijiquan in modern dance training and performance in the training and modern dance helps dancers.

  12. Production of $\\Upsilon(1S)$ Mesons from $_{\\chi}_{b}$ Decays in $p\\overline{p}$ Collisions at $sqrt{s}$ = 1.8 TeV

    CERN Document Server

    Affolder, T; Akopian, A M; Albrow, Michael G; Amaral, P; Amendolia, S R; Amidei, D; Antos, J; Apollinari, G; Arisawa, T; Asakawa, T; Ashmanskas, W J; Atac, Muzaffer; Azfar, F; Azzi-Bacchetta, P; Bacchetta, N; Bailey, M W; Bailey, S; De Barbaro, P; Barbaro-Galtieri, A; Barnes, Virgil E; Barnett, B A; Barone, M; Bauer, G; Bedeschi, F; Belforte, S; Bellettini, Giorgio; Bellinger, J; Benjamin, D; Bensinger, J; Beretvas, A; Bergé, J P; Berryhill, J W; Bertolucci, Sergio; Bevensee, B; Bhatti, A A; Bigongiari, C; Binkley, M; Bisello, D; Blair, R E; Blocker, C A; Bloom, K; Blumenfeld, B; Blusk, B S; Bocci, A; Bodek, Arie; Bokhari, W; Bölla, G; Bonushkin, Yu; Bortoletto, Daniela; Boudreau, J; Brandl, A; van den Brink, S C; Bromberg, C; Bruner, N L; Buckley-Geer, E; Budagov, Yu A; Budd, H S; Burkett, K; Busetto, G; Byon-Wagner, A; Byrum, K L; Campbell, M; Caner, A; Carithers, W C; Carlson, J; Carlsmith, D; Cassada, J A; Castro, A; Cauz, D; Cerri, A; Chan, A W; Chang, P S; Chang, P T; Chapman, J; Chen, C; Chen, Y C; Cheng, M T; Chertok, M; Chiarelli, G; Chirikov-Zorin, I E; Chlachidze, G; Chlebana, F S; Christofek, L S; Chu, M L; Cihangir, S; Ciobanu, C I; Clark, A G; Cobal, M; Cocca, E; Connolly, A; Conway, J; Cooper, J; Cordelli, M; Costanzo, D; Cranshaw, J; Cronin-Hennessy, D; Cropp, R; Culbertson, R J; Dagenhart, D; De Jongh, F; Dell'Agnello, S; Dell'Orso, Mauro; Demina, R; Demortier, L; Deninno, M M; Derwent, P F; Devlin, T; Dittmann, J R; Donati, S; Done, J; Dorigo, T; Eddy, N; Einsweiler, Kevin F; Elias, J E; Engels, E; Erdmann, W; Errede, D; Errede, S; Fan, Q; Feild, R G; Ferretti, C; Fiori, I; Flaugher, B L; Foster, G W; Franklin, M; Freeman, J; Friedman, J; Fukui, Y; Gadomski, S; Galeotti, S; Gallinaro, M; Gao, T; García-Sciveres, M; Garfinkel, A F; Gatti, P; Gay, C; Geer, S; Gerdes, D W; Giannetti, P; Giromini, P; Glagolev, V; Gold, M; Goldstein, J; Gordon, A; Goshaw, A T; Gotra, Yu; Goulianos, K; Grassmann, H; Green, C; Groer, L S; Grosso-Pilcher, C; Günther, M; Guillian, G; Guimarães da Costa, J; Guo, R S; Haber, C; Hafen, E S; Hahn, S R; Hall, C; Handa, T; Handler, R; Hao, W; Happacher, F; Hara, K; Hardman, A D; Harris, R M; Hartmann, F; Hatakeyama, K; Hauser, J; Heinrich, J; Heiss, A; Hinrichsen, B; Hoffman, K D; Holck, C; Hollebeek, R J; Holloway, L E; Hughes, R; Huston, J; Huth, J E; Ikeda, H; Incagli, M; Incandela, J R; Introzzi, G; Iwai, J; Iwata, Y; James, E; Jensen, H; Jones, M; Joshi, U; Kambara, H; Kamon, T; Kaneko, T; Karr, K M; Kasha, H; Kato, Y; Keaffaber, T A; Kelley, K F; Kelly, M; Kennedy, R D; Kephart, R D; Khazins, D M; Kikuchi, T; Kirk, M; Kim, B J; Kim, H S; Kim, S H; Kim, Y K; Kirsch, L; Klimenko, S; Knoblauch, D; Koehn, P; Köngeter, A; Kondo, K; Konigsberg, J; Kordas, K; Korytov, A V; Kovács, E; Kroll, J; Kruse, M; Kuhlmann, S E; Kurino, K; Kuwabara, T; Laasanen, A T; Lai, N; Lami, S; Lammel, S; Lamoureux, J I; Lancaster, M; Latino, G; LeCompte, T J; Lee, A M; Leone, S; Lewis, J D; Lindgren, M; Liss, T M; Liu, J B; Liu, Y C; Lockyer, N; Loken, J G; Loreti, M; Lucchesi, D; Lukens, P; Lusin, S; Lyons, L; Lys, J; Madrak, R; Maeshima, K; Maksimovic, P; Malferrari, L; Mangano, Michelangelo L; Mariotti, M; Martignon, G; Martin, A; Matthews, J A J; Mazzanti, P; McFarland, K S; McIntyre, P; McKigney, E A; Menguzzato, M; Menzione, A; Meschi, E; Mesropian, C; Miao, C; Miao, T; Miller, R; Miller, J S; Minato, H; Miscetti, S; Mishina, M; Moggi, N; Moore, E; Moore, R; Morita, Y; Mukherjee, A; Müller, T; Munar, A; Murat, P; Murgia, S; Musy, M; Nachtman, J; Nahn, S; Nakada, H; Nakaya, T; Nakano, I; Nelson, C; Neuberger, D; Newman-Holmes, C; Ngan, C Y P; Nicolaidi, P; Niu, H; Nodulman, L; Nomerotski, A; Oh, S H; Ohmoto, T; Ohsugi, T; Oishi, R; Okusawa, T; Olsen, J; Pagliarone, C; Palmonari, F; Paoletti, R; Papadimitriou, V; Pappas, S P; Parri, A; Partos, D S; Patrick, J; Pauletta, G; Paulini, M; Perazzo, A; Pescara, L; Phillips, T J; Piacentino, G; Pitts, K T; Plunkett, R K; Pompos, A; Pondrom, L; Pope, G; Prokoshin, F; Proudfoot, J; Ptohos, F; Punzi, G; Ragan, K; Reher, D; Reichold, A; Riegler, W; Ribon, A; Rimondi, F; Ristori, L; Robertson, W J; Robinson, A; Rodrigo, T; Rolli, S; Rosenson, L; Roser, R M; Rossin, R; Sakumoto, W K; Saltzberg, D; Sansoni, A; Santi, L; Sato, H; Savard, P; Schlabach, P; Schmidt, E E; Schmidt, M P; Schmitt, M; Scodellaro, L; Scott, A; Scribano, A; Segler, S L; Seidel, S; Seiya, Y; Semenov, A A; Semeria, F; Shah, T; Shapiro, M D; Shepard, P F; Shibayama, T; Shimojima, M; Shochet, M J; Siegrist, J L; Signorelli, G; Sill, A F; Sinervo, P K; Singh, P; Slaughter, A J; Sliwa, K; Smith, C; Snider, F D; Solodsky, A; Spalding, J; Speer, T; Sphicas, Paris; Spinella, F; Spiropulu, M; Spiegel, L; Stanco, L; Steele, J; Stefanini, A; Strologas, J; Strumia, F; Stuart, D; Sumorok, K; Suzuki, T; Takashima, R; Takikawa, K; Tanaka, M; Takano, T; Tannenbaum, B; Taylor, W; Tecchio, M; Teng, P K; Terashi, K; Tether, S; Theriot, D; Thurman-Keup, R M; Tipton, P; Tkaczyk, S M; Tollefson, K; Tollestrup, Alvin V; Toyoda, H; Trischuk, W; De Trocóniz, J F; Truitt, S; Tseng, J; Turini, N; Ukegawa, F; Valls, J; Vejcik, S; Velev, G V; Vidal, R; Vilar, R; Volobuev, I P; Vucinic, D; Wagner, R G; Wagner, R L; Wahl, J; Wallace, N B; Walsh, A M; Wang, C; Wang, C H; Wang, M J; Watanabe, T; Waters, D; Watts, T; Webb, R; Wenzel, H; Wester, W C; Wicklund, A B; Wicklund, E; Williams, H H; Wilson, P; Winer, B L; Winn, D; Wolbers, S; Wolinski, D; Wolinski, J; Worm, S D; Wu, X; Wyss, J; Yagil, A; Yao, W; Yeh, G P; Yeh, P; Yoh, J K; Yosef, C; Yoshida, T; Yu, I; Yu, S; Zanetti, A; Zetti, F; Zucchelli, S


    We have reconstructed the radiative decays $\\chi_{b}(1P) \\to \\Upsilon(1S) at $\\sqrt{s} = 1.8$ TeV, and measured the fraction of $\\Upsilon(1S)$ mesons that originate from these decays. For $\\Upsilon(1S)$ mesons with $p^{\\Upsilon}_{T}>8.0$ GeV/$c$, the fractions that come from $\\chi_{b}(1P)$ and $(10.5\\pm4.4(stat)\\pm1.4(s ys))%$, respectively. We have derived the fraction of directly produced $\\Upsilon(1S)$ mesons to be $(50.9\\pm8.2(stat)\\pm9.0(sys)) %$.

  13. Split ring resonator resonance assisted terahertz antennas

    CERN Document Server

    Galal, Hossam; Vitiello, Miriam S


    We report on the computational development of novel architectures of low impedance broadband antennas, for efficient detection of Terahertz (THz) frequency beams. The conceived Split Ring Resonator Resonance Assisted (SRR RA) antennas are based on both a capacitive and inductive scheme, exploiting a 200 Ohm and 400 Ohm impedance, respectively. Moreover, the impedance is tunable by varying the coupling parameters in the exploited geometry, allowing for better matching with the detector circuit for maximum power extraction. Our simulation results have been obtained by assuming a 1.5 THz operation frequency.

  14. Efficient isotropic magnetic resonators


    Martin, O. J. F.; Gay-Balmaz, P.


    We study experimentally and numerically a novel three-dimensional magnetic resonator structure with high isotropy. It is formed by crossed split-ring resonators and has a response independent of the illumination direction in a specific plane. The utilization of such elements to build a finite left-handed medium is discussed. (C) 2002 American Institute of Physics.

  15. Resonances Do Not Equilibrate


    Kuznetsova, I.; Letessier, J.; Rafelski, J.


    We discuss, in qualitative and quantitative fashion, the yields of hadron resonances. We show that these yields, in general, are not in chemical equilibrium. We evaluate the non-equilibrium abundances in a dynamic model implementing the $1+2\\leftrightarrow 3$ resonance formation reactions. Due to the strength of these reactions, we show the $\\Sigma(1385)$ enhancement, and the $\\Lambda(1520)$ suppression explicitly.

  16. The shape resonance

    International Nuclear Information System (INIS)

    For a class of Schroedinger operators, with potentials having minima embedded in the continuum of the spectrum and non-trapping tails, we show the existence of shape-resonance exponentially close to the real axis as n → ν. The resonant energies are given by a convergent perturbation expansion in powers of a parameter exhibiting the expected exponentially small behaviour for tunneling

  17. Calculating Probability Tables for the Unresolved-Resonance Region Using Monte Carlo Methods

    International Nuclear Information System (INIS)

    A new module, Probability tables for the Unresolved Region using Monte Carlo (PURM), has been developed for the AMPX-2000 cross-section-processing system. PURM uses a Monte Carlo approach to calculate probability tables on an evaluator-defined energy grid in the unresolved-resonance region. For each probability table, PURM samples a Wigner spacing distribution for pairs of resonances surrounding the reference energy (i.e., energy specified in the cross-section evaluation). The resonance distribution is sampled for each spin sequence (i.e., l-J pair), and PURM uses the δ3-statistics test to determine the number of resonances to sample for each spin sequence. For each resonance, PURM samples the resonance widths from a chi-square distribution for a specified number of degrees of freedom. Once the resonance parameters are sampled, PURM calculates the total, capture, fission, and scatter cross sections at the reference energy using the single-level Breit-Wigner formalism with appropriate treatment for temperature effects. Probability tables have been calculated and compared with NJOY. The probability tables and cross-section values that are calculated by PURM and NJOY are in agreement, and the verification studies with NJOY establish the computational capability for generating probability tables using the new AMPX module PURM

  18. Neutrino Production of Resonances

    CERN Document Server

    Paschos, E A; Yu, J Y; Paschos, Emmanuel A.; Sakuda, Makoto; Yu, Ji--Young


    We take a fresh look at the analysis of resonance production by neutrinos. We consider three resonances $P_{33}, P_{11}$ and $S_{11}$ with a detailed discussion of their form factors. The article presents results for free proton and neutron targets and discusses the corrections which appear on nuclear targets. The Pauli suppression factor is derived in the Fermi gas model and shown to apply to resonance production. The importance of the various resonances is demonstrated with numerical calculations. The $\\Delta$-resonance is described by two formfactors and its differential cross sections are compared with experimental data. The article is self-contained and could be helpful to readers who wish to reproduce and use these cross sections.

  19. Fundamentals of nanomechanical resonators

    CERN Document Server

    Schmid, Silvan; Roukes, Michael Lee


    This authoritative book introduces and summarizes the latest models and skills required to design and optimize nanomechanical resonators, taking a top-down approach that uses macroscopic formulas to model the devices. The authors cover the electrical and mechanical aspects of nano electromechanical system (NEMS) devices. The introduced mechanical models are also key to the understanding and optimization of nanomechanical resonators used e.g. in optomechanics. Five comprehensive chapters address: The eigenmodes derived for the most common continuum mechanical structures used as nanomechanical resonators; The main sources of energy loss in nanomechanical resonators; The responsiveness of micro and nanomechanical resonators to mass, forces, and temperature; The most common underlying physical transduction mechanisms; The measurement basics, including amplitude and frequency noise. The applied approach found in this book is appropriate for engineering students and researchers working with micro and nanomechanical...

  20. Photonic Feshbach resonance

    Institute of Scientific and Technical Information of China (English)


    Feshbach resonance is a resonance for two-atom scattering with two or more channels,in which a bound state is achieved in one channel.We show that this resonance phenomenon not only exists during the collisions of massive particles,but also emerges during the coherent transport of massless particles,that is,photons confined in the coupled resonator arrays linked by a separated cavity or a tunable two level system(TLS).When the TLS is coupled to one array to form a bound state in this setup,the vanishing transmission appears to display the photonic Feshbach resonance.This process can be realized through various experimentally feasible solid state systems,such as the couple defected cavities in photonic crystals and the superconducting qubit coupled to the transmission line.The numerical simulation based on the finite-different time-domain(FDTD) method confirms our assumption about the physical implementation.

  1. Resonator having a selection circuit for selecting a resonance mode


    Verhoeven, C.J.


    Resonator provided with a resonating device and with a selection circuit for selecting a resonance mode. The selection circuit is formed by a first-order oscillator which is provided with a synchronization input and whose output is connected to the excitation input of the resonating device, the output of the resonating device being connected to the synchronization input of the first-order oscillator in order to synchronize said oscillator and the output signal of the resonator being derived f...

  2. Cloning and Sequence Analysis of Chalcone Isomerase Gene (CHI) from Brunfelsia acuminata Flowers%鸳鸯茉莉查尔酮异构酶基因(CHI)cDNA的克隆与生物信息学分析

    Institute of Scientific and Technical Information of China (English)

    曹玉婷; 邱栋梁


    采用RT-PCR与RACE技术克隆了鸳鸯茉莉(Brunfelsia acuminata)花瓣中查尔酮异构酶基因(CHI)的全长cDNA,GenBank登录号为JN887637.该基因全长1051 bp,含有1个792 bp的开放阅读框,编码263个氨基酸,为不稳定蛋白.对保守区功能区的分析,推导CHI蛋白具有查尔酮超级家族的保守结构域,二级结构预测显示其主要以α螺旋和β折叠为主.氨基酸同源性分析表明,鸳鸯茉莉CHI蛋白与矮牵牛(Petunia hybrida)、金花茶(Camellia nitidissima)、甜樱桃(Prunus avium)、芍药(Paeonia lactiflora)、牡丹(P.suffruticosa)、菊花(Chry santhemum morifolium)等植物的同源性分别达到90%、89%、84%、85%、84%、80%.因此,CHI基因可能与鸳鸯茉莉的花色形成有关.

  3. Very High Resolution Ultraviolet Spectroscopy of a Chemically Peculiar Star: Results of the chi LUPI Pathfinder Project (United States)

    Leckrone, David S.; Proffitt, Charles R.; Wahlgren, Glenn M.; Johansson, Sveneric G.; Brage, Tomas


    We summarize here the results of a major eight-year investigation of the extraordinarily detailed UV spectrum of the sharp-lined, nonmagnetic, main-sequence, chemically peculiar star chi Lupi (B9.5p HgMn + A2 Vm). The UV observations are composed of 345 Å of the spectrum acquired with the Goddard High Resolution Spectrograph (GHRS) on board the Hubble Space Telescope at an average resolution of 0.023 Å. The complete set of echelle spectrograms is presented as an atlas in a companion paper. These data were supplemented by optical-wavelength spectra obtained at the Anglo-Australian Telescope. Quantitatively accurate analysis and theoretical interpretation of these data required major improvements in the accuracy and completeness of available atomic data-wavelengths, transition probabilities, hyperfine structure, and isotope shifts-for the lowest ionization states of many elements. A large, international group of theoretical and experimental atomic physicists has collaborated in this investigation, and their results are summarized or referenced in this paper. In turn, the GHRS observations of chi Lupi have become a useful source of data for atomic spectroscopy, displaying many transitions that are difficult to observe in a laboratory setting. Measured abundances or upper limits are presented for 72 ions of 51 chemical elements, spanning the periodic table. We have confirmed and refined previously identified isotopic abundance anomalies in mercury and platinum and have discovered similar isotopic anomalies in thallium and, tentatively, in lead. Large discrepancies among the LTE abundances derived, using a chemically homogeneous model atmosphere, from two or three ionization states of the same element are found to be common. In some cases these are due to departures from LTE in the ionization equilibria, but the largest such discrepancies probably result from chemical stratification within the photosphere. We find qualitative trends in the abundances of the elements

  4. Paterno`-Bu¨chi Reaction as a Demonstration of Chemical Kinetics and Synthetic Photochemistry Using a Light Emitting Diode Apparatus (United States)

    Thompson, Matthew P.; Agger, Jonathan; Wong, Lu Shin


    The Paterno`-Bu¨chi photocycloaddition reaction is used as the basis for physical-organic final-year undergraduate laboratory experiments designed to emphasize the multidisciplinary approach to modern-day chemical practice. These reactions are performed using commercially available LED-based light sources, which offer a convenient and safe tool…

  5. Measurements of psi ' -> (p)over-barK(+)Sigma(0) and chi(cJ) -> (p)over-barK(+) Lambda

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Albayrak, O.; Ambrose, D. J.; An, F. F.; An, Q.; Bai, J. Z.; Ban, Y.; Becker, J.; Bennett, J. V.; Bertani, M.; Bian, J. M.; Boger, E.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Bytev, V.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J.C.; Chen, M.L.; Chen, S. J.; Chen, X.; Chen, Y.B.; Cheng, H. P.; Chu, Y. P.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J.P.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; Ding, W. M.; Ding, Y.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Fang, J.; Fang, S. S.; Fava, L.; Feng, C. Q.; Ferroli, R. B.; Friedel, P.; Fu, C. D.; Gao, Y.; Geng, C.; Goetzen, K.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, Q.; Guo, L. B.; Guo, T.; Guo, Y. P.; Han, Y. L.; Harris, F. A.; He, K. L.; He, M.; He, Z. Y.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, C.; Hu, H. M.; Hu, J. F.; Hu, T.; Huang, G. M.; Huang, G. S.; Huang, J.S.; Huang, L.; Huang, X.T.; Huang, Y.; Huang, Y.P.; Hussain, T.; Ji, C. S.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, L.L.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jing, F. F.; Kalantar-Nayestanaki, N.; Kavatsyuk, M.; Kopf, B.; Kornicer, M.; Kuehn, W.; Lai, W.; Lange, J.S.; Leyhe, M.; Li, C. H.; Li, Cheng; Li, Cui; Li, D. M.; Li, F.; Li, G.; Li, H.B.; Li, J. C.; Li, K.; Li, Lei; Li, Q. J.; Li, S.L.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, X. R.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y.T.; Liao, G.R.; Liao, X. T.; Lin, D.; Liu, B. J.; Liu, Cheng; Liu, C.X.; Liu, F.H.; Liu, Fang; Liu, Feng; Liu, H.; Liu, H. B.; Liu, H. H.; Liu, H. M.; Liu, H. W.; Liu, J. P.; Liu, K.; Liu, K.Y.; Liu, Kai; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H.; Lu, G. R.; Lu, H. J.; Lu, J.G.; Lu, Q. W.; Lu, X. R.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X.L.; Lv, M.; Ma, C.L.; Ma, F. C.; Ma, H. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X. Y.; Maas, F.E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Morales, C. Morales; Moriya, K.; Muchnoi, N. Yu.; Muramatsu, H.; Nefedov, Y.; Nicholson, C.; Nikolaev, I. B.; Ning, Z.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Park, J.W.; Pelizaeus, M.; Peng, H. P.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Prencipe, E.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, L. Q.; Qin, X. S.; Qin, Y.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Rong, G.; Ruan, X. D.; Sarantsev, A.; Schaefer, B. D.; Shao, M.; Shen, C. P.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, X. Y.; Spataro, S.; Spruck, B.; Sun, D. H.; Sun, G. X.; Sun, J.F.; Sun, S. S.; Sun, Y.J.; Sun, Y.Z.; Sun, Z.J.; Sun, Z.T.; Tang, C.J.; Tang, X.; Tapan, I.; Thorndike, E. H.; Toth, D.; Ullrich, M.; Varner, G. S.; Wang, B.Q.; Wang, D.; Wang, D.Y.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q. J.; Wang, S. G.; Wang, X. F.; Wang, X. L.; Wang, Y. F.; Wang, Z.; Wang, Z. G.; Wang, Z.Y.; Wei, D. H.; Wei, J.B.; Weidenkaff, P.; Wen, Q. G.; Wen, S. P.; Wiedner, U.; Wu, L.H.; Wu, N.; Wu, S.X.; Wu, W.; Wu, Z.; Xia, L. G.; Xia, Y. X.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, G. M.; Xu, Q.J.; Xu, Q.N.; Xu, X. P.; Xu, Z. R.; Xue, F.; Xue, Z.; Yan, L.; Yan, W. B.; Yan, Y. H.; Yang, H. X.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yu, B. X.; Yu, C. X.; Yu, H. W.; Yu, J. S.; Yu, S. P.; Yuan, C. Z.; Yuan, Y.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, LiLi; Zhang, R.; Zhang, S. H.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhang, Zhenghao; Zhao, G.; Zhao, H. S.; Zhao, J.W.; Zhao, K. X.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, Q. Z.; Zhao, S.J.; Zhao, T.C.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, Y. H.; Zhong, B.; Zhong, Z.; Zhou, L.; Zhou, X. K.; Zhou, X.R.; Zhu, C.; Zhu, K.; Zhu, K. J.; Zhu, S.H.; Zhu, Stuart; Zhu, Y.C.; Zhu, Y.M.; Zhu, Y.S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Werner, M.J.; Zheng, J.P.


    Using a sample of 1.06 x 10(8) psi' mesons collectedwith the BESIII detector at the BEPCII e(+)e(-) collider and chi(cJ) mesons produced via radiative transitions from the psi', we report the first observation for psi' -> (p) over barK(+)Sigma(0) + c.c. (charge conjugate), as well as improved measur

  6. F-Test Alternatives to Fisher's Exact Test and to the Chi-Square Test of Homogeneity in 2x2 Tables. (United States)

    Overall, John E.; Starbuck, Robert R.


    An alternative to Fisher's exact test and the chi-square test for homogeneity in two-by-two tables is developed. The method provides for Type I error rates which are closer to the stated alpha level than either of the alternatives. (JKS)

  7. The Association between Genetic Variations of CHI3L1, Levels of the Encoded Glycoprotein YKL-40 and the Lipid Profile in a Danish Population

    DEFF Research Database (Denmark)

    Thomsen, Stine Brinkløv; Rathcke, Camilla Noelle; Skaaby, Tea;


    The inflammatory biomarker YKL-40 seems to play a role in atherosclerosis and is elevated in patients with obesity, cardiovascular disease and type 2 diabetes. Single nucleotide polymorphisms (SNPs) of the YKL-40 encoding gene, CHI3L1, are associated with inter-individual YKL-40 levels. One study...

  8. 泰山赤鳞鱼的核型研究%The Karyotype of Chi-lin Fish (Varicorhinus macrolepis) from Taishan Mountain

    Institute of Scientific and Technical Information of China (English)

    庞秋香; 赵博生; 姚东方; 李亚楠; 孙欢欢


    [目的]研究泰山赤鳞鱼的核型。[方法]以稀有物种泰山赤鳞鱼的头肾细胞为实验材料对其染色体数目和核型进行了分析。[结果]泰山赤鳞鱼染色体的数目是50,核型是2n=50,16m+14sm+20t,NF=80,没有发现性染色体。[结论]这是首次关于泰山赤磷鱼核型分析的报道。%[Objective] The paper was to study the karyotype of Chi-lin fish (Varicorhi- nus macrolepis) from Taishan mountain. [Method] The chromosome number and karyotype of an endemic Chi-lin fish were studied using the head kidney cells. [Re- sult] The diploid chromosome number (2n) of Chi-lin fish was 50, and the karyotype of V. macrolepis was 2n=50,16m+14sm+20t, NF =80. No sex-chromosome was found in Chi-lin fish. [Conclusion] A detailed karyotype of this endemic cyprinid fish of Taishan Mountain was established for the first time in this study.

  9. Advances in magnetic resonance 10

    CERN Document Server

    Waugh, John S


    Advances in Magnetic Resonance, Volume 10, presents a variety of contributions to the theory and practice of magnetic resonance. The book contains three chapters that examine superoperators in magnetic resonance; ultrasonically modulated paramagnetic resonance; and the utility of electron paramagnetic resonance (EPR) and electron-nuclear double-resonance (ENDOR) techniques for studying low-frequency modes of atomic fluctuations and their significance for understanding the mechanism of structural phase transitions in solids.

  10. Nanoscale mechanical resonators and oscillators


    van Leeuwen, R.


    In this thesis the physics of nanoscale mechanical resonators and oscillators is studied. We discuss two types of resonators. First, a top-down fabricated doubly clamped beam resonator with an integrated piezoelectric actuator is introduced. The second type of resonators are based on layered two-dimensional materials, such as graphene and molybdenum disulphide (MoS2). In chapter 2 we discuss the dynamics of doubly clamped microbeam resonators. These resonators have an integrated piezoelectric...

  11. Anisotropy-induced Fano resonance


    Qiu, Cheng-Wei; Novitsky, Andrey; Gao, Lei; Dong, Jian-Wen; Luk'yanchuk, Boris


    An optical Fano resonance, which is caused by birefringence control rather than frequency selection, is discovered. Such birefringence-induced Fano resonance comes with fast-switching radiation. The resonance condition $\\varepsilon_t< 1/\\varepsilon_r$ is revealed and a tiny perturbation in birefringence is found to result in a giant switch in the principal light pole induced near surface plasmon resonance. The loss and size effects upon the Fano resonance have been studied Fano resonance is s...

  12. LABCOM resonator Phase 3

    Energy Technology Data Exchange (ETDEWEB)

    Keres, L.J.


    The purpose of this project was to develop quartz crystal resonator designs, production processes, and test capabilities for 5-MHz, 6.2-MHz, and 10-MHz resonators for Tactical Miniature Crystal Oscillator (TMXO) applications. GE Neutron Devices (GEND) established and demonstrated the capability to produce and test quartz crystal resonators for use in the TMXO developed by the US Army ERADCOM (now LABCOM). The goals in this project were based on the ERADCOM statement of work. The scope of work indicated that the resonator production facilities for this project would not be completely independent, but that they would be supported in part by equipment and processes in place at GEND used in US Department of Energy (DOE) work. In addition, provisions for production test equipment or or eventual technology transfer costs to a commercial supplier were clearly excluded from the scope of work. The demonstrated technical capability of the deep-etched blank design is feasible and practical. It can be manufactured in quantity with reasonable yield, and its performance is readily predictable. The ceramic flatpack is a very strong package with excellent hermeticity. The four-point mount supports the crystal to reasonable shock levels and does not perturb the resonator's natural frequency-temperature behavior. The package can be sealed with excellent yields. The high-temperature, high-vacuum processing developed for the TMXO resonator, including bonding the piezoid to its mount with conductive polyimide adhesive, is consistent with precision resonator fabrication. 1 fig., 6 tabs.

  13. Monitoring land subsidence process in the urban area of Ho Chi Minh city, Vietnam using multi-temporal SAR Interferometry (United States)

    Nguyen, Xuan; Chang, Chung-Pai; Le, Tuan


    Land subsidence has become the most common hazard in urban area that could led to cracking buildings and infrastructures, extending the flooding area or even change the river path. Despite deriving precise information, conventional subsidence monitoring techniques are considered as costly, man-power consuming and lack of comprehensive information. Recently, SAR Interferometry (InSAR) has become a widely used geodetic technique for monitoring the deformation of the Earth's surface, especially methods based on the use of a multi-temporal dataset. In this study, we use a stack of 18 SAR images acquired from L-band PALSAR sensor onboard the ALOS satellite to derive the subsidence information of Ho Chi Minh city, Vietnam over the period of December 2006 to December 2010. The Stanford Method for Persistent Scatterers (StaMPS) Multi-Temporal Interferometry (MTI) approach is chosen to take advantages of both the persistent scatterers and the distributed scatterers, which could be used as monitoring points to measure the subsidence process. Assume the subsidence in this area mostly corresponds to vertical components, we found subsidence patterns along Saigon river and in the South of the city. Maximum subsidence rate reaches up to -66 mm/year in vertical direction. Finally, InSAR derived result and previous levelling data are taken into comparison to find the correlation between the two results.

  14. Backyard Living – Integrative Policies Towards Migrant Workers: Housing Microfinance in Greater Ho Chi Minh City, Vietnam

    Directory of Open Access Journals (Sweden)

    Martin Noltze


    Full Text Available The urban agglomeration of the Vietnamese southeast industrial driving force Ho Chi Minh City (HCMC has become the most outstanding benefi ciary of the remarkable economic growth and foreign investments in the Vietnamese economy since the start of a comprehensive economic reform process in the mid 1980s. The notable development towards the foremost economic centre led to a high influx of migrant workers. In the course of an ongoing expansion process towards a megacity of tomorrow, the defi cient provision of adequate housing remains one of the most challenging problems of rural migrants in Greater HCMC. However, a future-oriented sustainable megacity concept is strongly dependent on the successful integration of migrants into the urban society. Within this context, the housing market is considered to be a key aspect of comprehensive urban planning. Hereby, housing microfinance (HMF will be presented as an alternative housing finance scheme meeting the demand of a noteworthy number of poor and low-income people. Thereby HMF can do both: focus on specifi c needs of migrants with respect to their current life situation and enhance its outreach to a potential target group.

  15. Effects of 16 - week Tai Chi intervention on postural stability and associated physiological factors in older people

    Institute of Scientific and Technical Information of China (English)



    Objectives :To examine the effects of 16 - week Tai Chi (TC) training on postural stability and associated physiological factors in older subjects,forty elderly individuals (aged ≥ 60 years) living in the community were randomly placed into either the TC intervention group ( n = 22) or the control group (n = 18). The former underwent a supervised TC exercise program for 16 weeks, while the latter received general education for a comparable time period. Measurements:Postural stability was assessed by timed stance tests in single - leg stance with the eyes open (SLO) or closed (SLC), and tandem stance with the eyes closed (TSC). Proprioceptive function was evaluated by measuring ankle and knee kinesthesia. The maximum concentric strength of the knee flexors and extensors,ankle plantarflexors and dorsiflexors was measured by isokinetic dynamometer. Moreover, the reaction time of different muscles in the lower extremity was also examined by measuring the onset latency of the muscles to perturbations on the ankle joint using an electromyography system. Results :After the 16-week TC intervention, significant TC training effects were gained on knee kinesthesia, knee flexor strength, latency of semitendinous muscle, and postural stability in SLO. For the other measures,no significant training effects were found. Conclusions: The 16 - week TC intervention was found to be beneficial for the improvement of postural stability and associated physiological factors. However, there are discrepancies in TC training effects on different factors in the sensorimotor system.

  16. Phytochemicals from Camellia nitidissima Chi inhibited the formation of advanced glycation end-products by scavenging methylglyoxal. (United States)

    Wang, Weixin; Liu, Haiyan; Wang, Zhennan; Qi, Jing; Yuan, Shengtao; Zhang, Weijie; Chen, Hongjuan; Finley, John W; Gu, Liwei; Jia, Ai-Qun


    The objective of this study was to investigate the inhibitory effects of Camellia nitidissima Chi (CNC) on the advanced glycation end-product (AGE) formation. CNC was extracted with ethanol and further separated into dichloromethane, ethyl acetate, n-butanol, and water soluble fractions. Ethyl acetate fraction had the highest total phenolic and quercetin content compared with other fractions. Sixteen phenolic compounds were identified using HPLC Triple TOF MS/MS. Bovine serum albumin (BSA)-glucose assay showed that dichloromethane and ethyl acetate fraction inhibited AGE formation by 88.1% and 87.5% at 2.5mg/mL. BSA-methylglyoxal assay showed that ethyl acetate fraction inhibited 54.1% AGE formation while dichloromethane fraction inhibited 28.1%. Over 96.0% of methylglyoxal was scavenged by different fractions within 12h. Both mono- and di-methylglyoxal quercetin adducts were identified after incubating quercetin with methylglyoxal using HPLC-ESI-MS(n). The results in this study suggest that CNC extracts inhibited AGEs formation in part through scavenging methylglyoxal by phenolic compounds. PMID:27006232

  17. A Lower Bound on the Capacity of the Noncentral Chi Channel with Applications to Soliton Amplitude Modulation

    CERN Document Server

    Shevchenko, Nikita A; Prilepsky, Jaroslaw E; Alvarado, Alex; Bayvel, Polina; Turitsyn, Sergei K


    The channel law for amplitude-modulated solitons transmitted through a nonlinear optical fibre with ideal distributed amplification and a receiver based on the nonlinear Fourier transform is a noncentral chi distribution with $2n$ degrees of freedom, where $n=2$ and $n=3$ correspond to the single- and dual-polarisation cases, respectively. In this paper, we study the capacity of this channel in bits per channel use, and develop a semi-analytic capacity lower bound for arbitrary $n$ and a Rayleigh input distribution. An asymptotic analysis of the bound is also presented, which shows that this lower bound grows logarithmically with signal-to-noise ratio (SNR), independently of the value of $n$. Numerical results for other input distributions are also provided. A half-Gaussian input distribution is shown to give larger rates than a Rayleigh input distribution for $n=1,2,3$. At an effective SNR of 30~dB, the obtained lower bounds are approximately 4 bit per channel use.

  18. AstroSat/LAXPC reveals the high energy variability of GRS 1915+105 in the chi class

    CERN Document Server

    Yadav, J S; Chauhan, Jai Verdhan; Agrawal, P C; Antia, H M; Pahari, Mayukh; Dedhia, Dhiraj; Katoch, Tilak; Madhwani, P; Manchanda, R K; Paul, B; Shah, Parag; Ishwara-Chandra, C H


    We present the first quick look analysis of data from nine {\\it AstroSat}'s LAXPC observations of GRS 1915+105 during March 2016 when the source had the characteristics of being in Radio-quiet $\\chi$ class. We find that a simple empirical model of a disk blackbody emission, with Comptonization and a broad Gaussian Iron line can fit the time averaged 3--80 keV spectrum with a systematic uncertainty of 1.5\\% and a background flux uncertainty of 4\\%. A simple deadtime-corrected Poisson noise level spectrum matches well with the observed high frequency power spectra till 50 kHz and as expected the data show no significant high frequency ($> 20$ Hz) features. Energy dependent power spectra reveal a strong low frequency (2 - 8 Hz) Quasi-periodic oscillation (LFQPO) and its harmonic along with broad band noise. The QPO frequency changes rapidly with flux (nearly 4 Hz in ~ 5 hours). With increasing QPO frequency, an excess noise component appears significantly in the high energy regime (> 8 keV). At the QPO frequenci...

  19. Resonant Neutron Scattering from YBa_2Cu_3O_7 (United States)

    Fong, Hung Fai


    Recently our ( Collaborators: B. Keimer, D. Reznik, P. Bourges, I. Aksay ) study on the 41 meV magnetic resonance in YBa_2Cu_3O7 ( H. F. Fong, B. Keimer, P. W. Anderson, D. Reznik, F. Doğan, I. A. Aksay, Phy. Rev. Lett. \\underbar 75), 316 (1995) has received considerable attention. Evidence for this mode had already been collected by other groups, but our demonstration that the resonance disappears in the normal state has stimulated a large body of theoretical work. We have extended our study in several respects, using both polarized and unpolarized neutron scattering techniques. First, by calibrating the measured magnetic intensity against calculated structure factors of optical phonons and against antiferromagnetic spin waves in the same crystal after deoxygenation to YBa_2Cu_3O_6.2, we have established the absolute scale of its dynamical susceptibility \\chi''(q,ω) in the superconducting state and a limit on its magnitude in the normal state. Second, we have measured the energy and absolute spectral weight of the resonance accurately as a function of temperature. Our experimental results will be discussed in the light of recent theoretical work. Recent measurements of the high energy spin waves in the antiferromagnetic YBa_2Cu_3O_6.2 will also be reported.

  20. Resonant power converters

    CERN Document Server

    Kazimierczuk, Marian K


    This book is devoted to resonant energy conversion in power electronics. It is a practical, systematic guide to the analysis and design of various dc-dc resonant inverters, high-frequency rectifiers, and dc-dc resonant converters that are building blocks of many of today's high-frequency energy processors. Designed to function as both a superior senior-to-graduate level textbook for electrical engineering courses and a valuable professional reference for practicing engineers, it provides students and engineers with a solid grasp of existing high-frequency technology, while acquainting them wit

  1. T'ai Chi (United States)

    ... sometimes have visually descriptive names, such as "white crane spreads its wings," "needle at the bottom of ... I Get Motivated to Exercise? Sports and Exercise Safety Yoga for Stress Relief Kickboxing Pilates Yoga Strength ...

  2. Tai Chi: An Introduction (United States)

    ... tai chi’s effects on: Symptoms of anxiety and sleep quality in young adults Fibromyalgia Knee osteoarthritis. NCCIH currently ... B, et al. Impact of medical qigong on quality of life, fatigue, mood and ... al. Qigong versus exercise versus no therapy for patients with chronic neck ...

  3. Efeitos do Tai Chi Chuan na força dos músculos extensores dos joelhos e no equilíbrio em idosas Effects of Tai Chi Chuan on knee extensor muscle strength and balance in elderly women

    Directory of Open Access Journals (Sweden)

    MM Pereira


    Full Text Available CONTEXTUALIZAÇÃO: Alguns estudos têm indicado que o Tai Chi Chuan (TCC é capaz de melhorar o condicionamento físico, a força muscular e o equilíbrio entre os praticantes idosos, prevenindo quedas, fraturas e dependência física. OBJETIVO: Verificar os efeitos do TCC no equilíbrio (EQ e na força dos músculos extensores dos joelhos (F em mulheres idosas. MATERIAIS E MÉTODOS: Participaram do estudo 77 mulheres saudáveis, não praticantes de atividade física orientada. No Grupo Experimental (G1 foram incluídas 38 voluntárias (68 ± 5 anos e no Grupo Controle (G2, 39 voluntárias (69 ± 7 anos. O G1 praticou o TCC estilo Yang de 24 movimentos durante 12 semanas, três vezes por semana, com duração de 50 minutos. O G2 não realizou atividades físicas orientadas. A força foi mensurada pelo teste de 1-RM na cadeira extensora e o equilíbrio foi avaliado utilizando o teste de apoio unipodal com os olhos fechados. Na análise estatística, utilizou-se teste de normalidade, split-plot análise de variância (ANOVA e correlação de Pearson. RESULTADOS: O Grupo Experimental apresentou incrementos de 17,83% na F e 26,10% no EQ. O Grupo Controle não apresentou alteração significativa em nenhuma variável. Não foi observada correlação significativa entre estas duas variáveis no G1 (r= 0,09; p= 0,554 e no G2 (r= 0,07; p= 0,660. CONCLUSÕES: Estes resultados sugerem que o TCC melhora F e EQ em mulheres idosas. Entretanto, a força dos músculos extensores dos joelhos não está necessariamente ligada ao equilíbrio nesta modalidade.BACKGROUND: Some studies have indicated that Tai Chi Chuan (TCC is capable of improving physical fitness, muscle strength and balance in elderly people. This improvement could prevent falls, fractures and physical dependence. OBJECTIVE: To investigate the effects of TCC on balance and knee extensor muscle strength among elderly women. METHODS: Seventy-seven healthy women who were not engaged in any guided

  4. Resonant Diphoton Phenomenology Simplified

    CERN Document Server

    Panico, Giuliano; Wulzer, Andrea


    A framework is proposed to describe resonant diphoton phenomenology at hadron colliders in full generality. It can be employed for a comprehensive model-independent interpretation of the experimental data. Within the general framework, few benchmark scenarios are defined as representative of the various phenomenological options and/or of motivated new physics scenarios. Their usage is illustrated by performing a characterization of the 750 GeV excess, based on a recast of available experimental results. We also perform an assessment of which properties of the resonance could be inferred, after discovery, by a careful experimental study of the diphoton distributions. These include the spin J of the new particle and its dominant production mode. Partial information on its CP-parity can also be obtained, but only for J >= 2. The complete determination of the resonance CP properties requires studying the pattern of the initial state radiation that accompanies the resonance production.

  5. Resonant Thermoelectric Nanophotonics

    CERN Document Server

    Mauser, Kelly W; Kim, Seyoon; Fleischman, Dagny; Atwater, Harry A


    Photodetectors are typically based on photocurrent generation from electron-hole pairs in semiconductor structures and on bolometry for wavelengths that are below bandgap absorption. In both cases, resonant plasmonic and nanophotonic structures have been successfully used to enhance performance. In this work, we demonstrate subwavelength thermoelectric nanostructures designed for resonant spectrally selective absorption, which creates large enough localized temperature gradients to generate easily measureable thermoelectric voltages. We show that such structures are tunable and are capable of highly wavelength specific detection, with an input power responsivity of up to 119 V/W (referenced to incident illumination), and response times of nearly 3 kHz, by combining resonant absorption and thermoelectric junctions within a single structure, yielding a bandgap-independent photodetection mechanism. We report results for both resonant nanophotonic bismuth telluride-antimony telluride structures and chromel-alumel...

  6. Resonances in QCD (United States)

    Lutz, Matthias F. M.; Lange, Jens Sören; Pennington, Michael; Bettoni, Diego; Brambilla, Nora; Crede, Volker; Eidelman, Simon; Gillitzer, Albrecht; Gradl, Wolfgang; Lang, Christian B.; Metag, Volker; Nakano, Takashi; Nieves, Juan; Neubert, Sebastian; Oka, Makoto; Olsen, Stephen L.; Pappagallo, Marco; Paul, Stephan; Pelizäus, Marc; Pilloni, Alessandro; Prencipe, Elisabetta; Ritman, Jim; Ryan, Sinead; Thoma, Ulrike; Uwer, Ulrich; Weise, Wolfram


    We report on the EMMI Rapid Reaction Task Force meeting 'Resonances in QCD', which took place at GSI October 12-14, 2015. A group of 26 people met to discuss the physics of resonances in QCD. The aim of the meeting was defined by the following three key questions: What is needed to understand the physics of resonances in QCD? Where does QCD lead us to expect resonances with exotic quantum numbers? What experimental efforts are required to arrive at a coherent picture? For light mesons and baryons only those with up, down and strange quark content were considered. For heavy-light and heavy-heavy meson systems, those with charm quarks were the focus. This document summarizes the discussions by the participants, which in turn led to the coherent conclusions we present here.

  7. Lattices of dielectric resonators

    CERN Document Server

    Trubin, Alexander


    This book provides the analytical theory of complex systems composed of a large number of high-Q dielectric resonators. Spherical and cylindrical dielectric resonators with inferior and also whispering gallery oscillations allocated in various lattices are considered. A new approach to S-matrix parameter calculations based on perturbation theory of Maxwell equations, developed for a number of high-Q dielectric bodies, is introduced. All physical relationships are obtained in analytical form and are suitable for further computations. Essential attention is given to a new unified formalism of the description of scattering processes. The general scattering task for coupled eigen oscillations of the whole system of dielectric resonators is described. The equations for the  expansion coefficients are explained in an applicable way. The temporal Green functions for the dielectric resonator are presented. The scattering process of short pulses in dielectric filter structures, dielectric antennas  and lattices of d...

  8. Accidental degeneracy of resonances

    International Nuclear Information System (INIS)

    Full text: It will be shown that a degeneracy of resonances is associated with a second rank pole in the scattering matrix and a Jordan cycle of generalized eigenfunctions of the radial Schrodinger equation. The generalized Gamow-Jordan eigenfunctions are basis elements of an expansion in complex resonance energy eigenfunctions. In this orthonormal basis, the Hamiltonian is represented by a non-diagonal complex matrix with a Jordan block of rank two. Some general properties of the degeneracy of resonances will be exhibited and discussed in an explicit example of degeneracy of resonant states and double poles in the scattering matrix of a double barrier potential. The cross section, scattering wave functions and Jordan-Gamow eigenfunctions are computed at degeneracy and their properties as functions of the control parameters of the system are discussed. (Author)

  9. Accidental degeneracy of resonances

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez, E.; Mondragon, A. [Instituto de Fisica, UNAM (Mexico); Jauregui, A. [Departamento de Fisica, Universidad de Sonora, A.P. 1625, Hermosillo, Sonora (Mexico)


    Full text: It will be shown that a degeneracy of resonances is associated with a second rank pole in the scattering matrix and a Jordan cycle of generalized eigenfunctions of the radial Schrodinger equation. The generalized Gamow-Jordan eigenfunctions are basis elements of an expansion in complex resonance energy eigenfunctions. In this orthonormal basis, the Hamiltonian is represented by a non-diagonal complex matrix with a Jordan block of rank two. Some general properties of the degeneracy of resonances will be exhibited and discussed in an explicit example of degeneracy of resonant states and double poles in the scattering matrix of a double barrier potential. The cross section, scattering wave functions and Jordan-Gamow eigenfunctions are computed at degeneracy and their properties as functions of the control parameters of the system are discussed. (Author)

  10. Resonances in QCD

    Energy Technology Data Exchange (ETDEWEB)

    Lutz, Matthias F. M.; Lange, Jens Sören; Pennington, Michael; Bettoni, Diego; Brambilla, Nora; Crede, Volker; Eidelman, Simon; Gillitzer, Albrecht; Gradl, Wolfgang; Lang, Christian B.; Metag, Volker; Nakano, Takashi; Nieves, Juan; Neubert, Sebastian; Oka, Makoto; Olsen, Stephen L.; Pappagallo, Marco; Paul, Stephan; Pelizäus, Marc; Pilloni, Alessandro; Prencipe, Elisabetta; Ritman, Jim; Ryan, Sinead; Thoma, Ulrike; Uwer, Ulrich; Weise, Wolfram


    We report on the EMMI Rapid Reaction Task Force meeting 'Resonances in QCD', which took place at GSI October 12-14, 2015 (Fig.~1). A group of 26 people met to discuss the physics of resonances in QCD. The aim of the meeting was defined by the following three key questions; what is needed to understand the physics of resonances in QCD?; where does QCD lead us to expect resonances with exotic quantum numbers?; and what experimental efforts are required to arrive at a coherent picture? For light mesons and baryons only those with up, down and strange quark content were considered. For heavy-light and heavy-heavy meson systems, those with charm quarks were the focus.This document summarizes the discussions by the participants, which in turn led to the coherent conclusions we present here.

  11. Resonances in QCD

    CERN Document Server

    Lutz, Matthias F M; Pennington, Michael; Bettoni, Diego; Brambilla, Nora; Crede, Volker; Eidelman, Simon; Gillitzer, Albrecht; Gradl, Wolfgang; Lang, Christian B; Metag, Volker; Nieves, Juan; Neubert, Sebastian; Oka, Makoto; Olsen, Steve L; Pappagallo, Marco; Paul, Stephan; Pelizäus, Marc; Pilloni, Alessandro; Prencipe, Elisabetta; Ritman, Jim; Ryan, Sinead; Thoma, Ulrike; Uwer, Ulrich; Weise, Wolfram


    We report on the EMMI Rapid Reaction Task Force meeting 'Resonances in QCD', which took place at GSI October 12-14, 2015. A group of 26 people met to discuss the physics of resonances in QCD. The aim of the meeting was defined by the following three key questions: What is needed to understand the physics of resonances in QCD? Where does QCD lead us to expect resonances with exotic quantum numbers? What experimental efforts are required to arrive at a coherent picture? For light mesons and baryons only those with ${\\it up}$, ${\\it down}$ and ${\\it strange}$ quark content were considered. For heavy-light and heavy-heavy meson systems, those with ${\\it charm}$ quarks were the focus. This document summarizes the discussions by the participants, which in turn led to the coherent conclusions we present here.

  12. Decay of giant resonances

    International Nuclear Information System (INIS)

    With energies of the order of 10 to 20 MeV giant resonances are the fastest known vibrations of a many-body system. Their typical widths of a few MeV show that these resonances are strongly damped. It is clearly of interest to study the nature of the damping mechanism. For that purpose it is important that excitation energies associated with giant resonances in general are sufficiently high to allow for decay by emission of nucleons or α- particles or -in heavy nuclei- by fission. In other words, giant resonances rank among the few known structures embedded in the nuclear continuum. This makes it possible and interesting to study their properties by coincidence experiments where excitation by inelastic scattering and decay by particle emission are simultaneously registered. It is the purpose of this article to review the brief history of such experiments, their analysis and interpretation. 219 refs, figs and tabs

  13. GPS Satellites Orbits: Resonance

    Directory of Open Access Journals (Sweden)

    Luiz Danilo Damasceno Ferreira


    Full Text Available The effects of perturbations due to resonant geopotential harmonics on the semimajor axis of GPS satellites are analyzed. For some GPS satellites, secular perturbations of about 4 m/day can be obtained by numerical integration of the Lagrange planetary equations considering in the disturbing potential the main secular resonant coefficients. Amplitudes for long-period terms due to resonant coefficients are also exhibited for some hypothetical satellites orbiting in the neighborhood of the GPS satellites orbits. The results are important to perform orbital maneuvers of GPS satellites such that they stay in their nominal orbits. Also, for the GPS satellites that are not active, the long-period effects due to the resonance must be taken into account in the surveillance of the orbital evolutions of such debris.

  14. Magnetic Resonance Imaging and Magnetic Resonance Spectroscopy in Dementias


    Hsu, Yuan-Yu; Du, An-Tao; Schuff, Norbert; Weiner, Michael W.


    This article reviews recent studies of magnetic resonance imaging and magnetic resonance spectroscopy in dementia, including Alzheimer's disease, frontotemporal dementia, dementia with Lewy bodies, idiopathic Parkinson's disease, Huntington's disease, and vascular dementia. Magnetic resonance imaging and magnetic resonance spectroscopy can detect structural alteration and biochemical abnormalities in the brain of demented subjects and may help in the differential diagnosis and early detection...

  15. Resonant dielectric metamaterials

    Energy Technology Data Exchange (ETDEWEB)

    Loui, Hung; Carroll, James; Clem, Paul G; Sinclair, Michael B


    A resonant dielectric metamaterial comprises a first and a second set of dielectric scattering particles (e.g., spheres) having different permittivities arranged in a cubic array. The array can be an ordered or randomized array of particles. The resonant dielectric metamaterials are low-loss 3D isotropic materials with negative permittivity and permeability. Such isotropic double negative materials offer polarization and direction independent electromagnetic wave propagation.

  16. Infrared Dielectric Resonator Metamaterial

    CERN Document Server

    Ginn, James C; Peters, David W; Wendt, Joel R; Stevens, Jeffrey O; Hines, Paul F; Basilio, Lorena I; Warne, Larry K; Ihlefeld, Jon F; Clem, Paul G; Sinclair, Michael B


    We demonstrate, for the first time, an all-dielectric metamaterial resonator in the mid-wave infrared based on high-index tellurium cubic inclusions. Dielectric resonators are desirable compared to conventional metallo-dielectric metamaterials at optical frequencies as they are largely angular invariant, free of ohmic loss, and easily integrated into three-dimensional volumes. With these low-loss, isotropic elements, disruptive optical metamaterial designs, such as wide-angle lenses and cloaks, can be more easily realized.

  17. Resonance and Fractal Geometry


    Broer, Henk W.


    The phenomenon of resonance will be dealt with from the viewpoint of dynamical systems depending on parameters and their bifurcations. Resonance phenomena are associated to open subsets in the parameter space, while their complement corresponds to quasi-periodicity and chaos. The latter phenomena occur for parameter values in fractal sets of positive measure. We describe a universal phenomenon that plays an important role in modelling. This paper gives a summary of the background theory, vein...

  18. Thermodynamics of Delta resonances


    Weinhold, W; Friman, B.; Nörenberg, W.


    The thermodynamic potential of a system of pions and nucleons is computed including the piN interactions in the P33 channel. A consistent treatment of the width of the resonance in this channel, the Delta(1232) resonance, is explored in detail. In the low-density limit we recover the leading term of the virial expansion for the thermodynamic potential. An instructive diagrammatic interpretation of the contributions to the total baryon number is presented. Furthermore, we examine within a fire...



    Husnija Hasanbegović


    The processes of hearing the sounds and speech are not yet explicable enough, and therefore rehabilitation audiology is continuously facing practical problems of hearing and speech stimulation with heavy out of hearing children. Hearing successes with children who have implanted cochlear apparatus may indicate to resonance problem, rather than damaged nerve cells problem with deaf children, as it is alleged today. This paper presents a new theory (the theory of resonance rehabilit...

  20. Resonance Energy Transfer


    Andrews, David; Bradshaw, David; Dinshaw, Rayomond; Scholes, Gregory


    Resonance energy transfer, also known as Förster- or fluorescence- resonance energy transfer, or electronic energy transfer, is a photonic process whose relevance in many major areas of science is reflected both by a wide prevalence of the effect and through numerous technical applications. The process, operating through an optical near-field mechanism, effects a transport of electronic excitation between physically distinct atomic or molecular components, based on transition dipole-dipole co...

  1. Pygmy resonances and nucleosynthesis


    Tsoneva Nadia; Lenske Horst


    A microscopic theoretical approach based on a self-consistent density functional theory for the nuclear ground state and QRPA formalism extended with multi-phonon degrees of freedom for the nuclear excited states is implemented in investigations of new low-energy modes called pygmy resonances. Advantage of the method is the unified description of low-energy multiphonon excitations, pygmy resonances and core polarization effects. This is found of crucial importance for the understanding of the...

  2. Pygmy resonances and nucleosynthesis


    Tsoneva, Nadia; Lenske, Horst


    A microscopic theoretical approach based on a self-consistent density functional theory for the nuclear ground state and QRPA formalism extended with multi-phonon degrees of freedom for the nuclear excited states is implemented in investigations of new low-energy modes called pygmy resonances. Advantage of the method is the unified description of low-energy multiphonon excitations, pygmy resonances and core polarization effects. This is found of crucial importance for the understanding of the...


    Directory of Open Access Journals (Sweden)

    Pavel Exner


    Full Text Available We discuss resonances for a nonrelativistic and spinless quantum particle confined to a two- or three-dimensional Riemannian manifold to which a finite number of semiinfinite leads is attached. Resolvent and scattering resonances are shown to coincide in this situation. Next we consider the resonances together with embedded eigenvalues and ask about the high-energy asymptotics of such a family. For the case when all the halflines are attached at a single point we prove that all resonances are in the momentum plane confined to a strip parallel to the real axis, in contrast to the analogous asymptotics in some metric quantum graphs; we illustrate this on several simple examples. On the other hand, the resonance behaviour can be influenced by a magnetic field. We provide an example of such a ‘hedgehog’ manifold at which a suitable Aharonov-Bohm flux leads to absence of any true resonance, i.e. that corresponding to a pole outside the real axis.

  4. Thermal Resonance Fusion

    CERN Document Server

    Dong, Bao-Guo


    We first show a possible mechanism to create a new type of nuclear fusion, thermal resonance fusion, i.e. low energy nuclear fusion with thermal resonance of light nuclei or atoms, such as deuterium or tritium. The fusion of two light nuclei has to overcome the Coulomb barrier between these two nuclei to reach up to the interacting region of nuclear force. We found nuclear fusion could be realized with thermal vibrations of crystal lattice atoms coupling with light atoms at low energy by resonance to overcome this Coulomb barrier. Thermal resonances combining with tunnel effects can greatly enhance the probability of the deuterium fusion to the detectable level. Our low energy nuclear fusion mechanism research - thermal resonance fusion mechanism results demonstrate how these light nuclei or atoms, such as deuterium, can be fused in the crystal of metal, such as Ni or alloy, with synthetic thermal vibrations and resonances at different modes and energies experimentally. The probability of tunnel effect at dif...

  5. Cycling and Tai Chi Chuan exercises exert greater immunomodulatory effect on surface antigen expression of human hepatitis B virus

    Institute of Scientific and Technical Information of China (English)

    CHEN Yu-yawn; CHIANG Jasson; CHEN Yu-jen; CHEN Kung-tung; YANG Rong-sen; LIN Jaung-geng


    Background Both athletes with intensive exercise and aged people may have weakened immunity against virus infection.This study aimed to evaluate whether people undergoing aerobic exercises including competitive cyctists with moderate training (CMT) and middle-aged people practicing Tai Chi Chuan (TCC) exercise have higher immunity against hepatitis B virus than age-matched sedentary controls including college students (CSC) and middle-aged people (MSC).Methods Human peripheral blood mononuclear cells from competitive cyclists and sedentary controls were stimulated by phytohemagglutinin (PHA) to prepare conditioned medium (MNC-CM) for the assessment of inhibitory effects on hepatitis B surface antigen (HBsAg) expression in human hepatoma Hep3B cells.Results The inhibitory effects on the relative HBsAg expression of CMT's and TCC's MNC-CM were greater than those of the controls.The CMT's MNC-CM prepared from 5 pg/ml PHA decreased HBsAg expression to 61.5%,whereas that of CSC remained at 83.8%.Similarly,this expression by treatment of TCC group' MNC-CM was 68.4% whereas that of MSC group was 84.3%.The levels of cytokines such as interferon-y (IFN-y),tumor necrosis factor-a (TNF-α),IFN-α and interleukin-1β(1L-1β) in the MNC-CM from the CMT and TCC groups were greater than those in the controls.Antibody neutralization of CMT's MNC-CM and addition of recombinant cytokines into CSC's MNC-CM indicated that IFN-y,TNF-α and IFN-α had synergistic effects against HBsAg expression.Similar blocking effect was noted in TCC versus MSC groups.Conclusion These results suggest that the immunomodulatory response to suppress HBsAg expression in CMT and TCC with moderate aerobic exercise is greater than that in age-matched sedentary controls.

  6. Comparison of the Effects of Swimming and Tai Chi Chuan on Body Fat Composition in Elderly People

    Directory of Open Access Journals (Sweden)

    Tung-Yang Yu


    Full Text Available Background: Accumulation of fat and substantial loss of muscle mass are common phenomenain the elderly. In this study, we observed the effects of Tai ChiChuan (TCC and swimming, two exercises suitable for elderly people, onthe percentage body fat and fat distribution by measuring subcutaneous adiposetissue thickness and body composition.Methods: Subjects were divided into three groups: regular swimmers (n = 20, regularTCC practitioners (n = 32, and age-matched control subjects (n = 31.Subcutaneous adipose tissue thickness was taken using a Lange skinfoldcaliper at the chests, abdomens, and thighs in the men, and the triceps,suprailium, and thighs in the women. Mid-arm circumference (MAC wasmeasured on the non-dominant upper arm using fiberglass tape. Body compositionwas analyzed using the Inbody 3.0 logo, a bioelectrical impedanceanalysis (BIA system.Results: No significant differences were found between the three test groups in relationto total body adiposity and arm muscle circumference in the men andwomen. There was significantly less subcutaneous adipose tissue at theabdomen (p = 0.011 and thigh (p < 0.001 of TCC-group men and at thethighs (p < 0.001 of the swimming group compared with the control group.In women, only the thigh skinfold (p = 0.002 showed a decrease in the TCCgroup compared with the control group.Conclusion: Swimming and TCC may not decrease total fat adiposity in elderly men andwomen, however, they may change body fat distribution due to certain musclegroup usage. The differences observed in the effects of exercise on bodyfat distribution between elderly women and men may be gender-related.

  7. Clinical features of HIV/AIDS patients presenting to an inner city clinic in Ho Chi Minh City, Vietnam. (United States)

    Klotz, Stephen A; Nguyen, Hao Cong; Van Pham, Tam; Nguyen, Liem Thanh; Ngo, Dong Thi Anh; Vu, Son Nhoc


    An outpatient HIV clinic was opened in March 2005 in Binh Thanh District, a poor section of Ho Chi Minh City, Vietnam. Over 1500 patients were seen in the first year. The average age of patients was 27 years. Men represented 77% of the clinic population, women, 23% and children under the age of 16 years of age, 5% of the population. The most common risk factor among men was being an injecting drug user (IDU), 76%, and among women, being married to an IDU HIV-positive man, 35%. Physical signs of disease were uncommon: lymphadenopathy in 24% and hepatomegaly and splenomegaly in 4% and 3%, respectively. Men and women were anaemic at presentation, with a mean haemoglobin of 11.9 g/dL and 11.1 g/dL, respectively. An overwhelming majority of patients had profound immunodeficiency. The mean CD4+ cell count was 164 cells/mL and the median was 69 cells/mL. No correlation was found between the World Health Organization's stage of disease and the CD4+ cell count. Thus, the former is a poor predictor of immunity in this population. Data regarding opportunistic infections diagnosed at the first visit were studied. Candidiasis of the oral pharynx, oesophagus or vagina was found in 34.5% of the patients, and pulmonary and extrapulmonary tuberculosis was found in 32% of the patients. Pneumocystis carinii pneumonia (PCP) was diagnosed in only 3% of the patients. Cotrimoxazole prophylaxis is advocated for HIV-infected Vietnamese, but the incidence of PCP is negligible and resources could be spent elsewhere. The various opportunistic infections seen in this resource-poor clinic setting is likely to be a pattern of presentation of HIV-infected Vietnamese for some time to come. PMID:17623507

  8. Effect of 1-year regular Tai Chi on neuromuscular reaction in elderly women: a randomized controlled study. (United States)

    Sun, Wei; Zhang, Cui; Song, Qipeng; Li, Weiping; Cong, Yan; Chang, Shuwan; Mao, Dewei; Hong, Youlian


    This study assessed the effect of 1-year regular Tai Chi (TC) on neuromuscular reaction in elderly women. A total of 41 elderly women (55 years-68 years) completed the study. The TC group (n = 21) performed the 24-form TC, while the control group (C, n = 20) was instructed to read newspapers or watch television when the TC group practised. Electromyogram measurements were conducted before and after intervention. After a year-long intervention, the post-test results of between-group neuromuscular reaction time showed significant differences in the rectus femoris (t = 3.607, p = 0.001), semitendinosus (t = 2.678, p = 0.011), anterior tibialis (t = 3.455, p = 0.001), and gastrocnemius muscles (t = 4.061, p = 0.000). Within-group results showed that the TC group had significantly shorter neuromuscular reaction time compared to its baseline value in the rectus femoris (t = 3.066, p = 0.006), semitendinosus (t = 2.485, p = 0.022), anterior tibialis (t = 2.311, p = 0.032), and gastrocnemius muscles (t = 2.462, p = 0.023). Results suggested that year-long regular TC can improve neuromuscular reaction function in elderly women. PMID:27161956

  9. The effect of Tai Chi Chuan in reducing falls among elderly people: design of a randomized clinical trial in the Netherlands [ISRCTN98840266

    Directory of Open Access Journals (Sweden)

    van Rossum Erik


    Full Text Available Abstract Background Falls are a significant public health problem. Thirty to fifty percent of the elderly of 65 years and older fall each year. Falls are the most common type of accident in this age group and can result in fractures and subsequent disabilities, increased fear of falling, social isolation, decreased mobility, and even an increased mortality. Several forms of exercise have been associated with a reduced risk of falling and with a wide range of physiological as well as psychosocial health benefits. Tai Chi Chuan seems to be the most promising form of exercise in the elderly, but the evidence is still controversial. In this article the design of a randomized clinical trial is presented. The trial evaluates the effect of Tai Chi Chuan on fall prevention and physical and psychological function in older adults. Methods/Design 270 people of seventy years and older living at home will be identified in the files of the participating general practitioners. People will be asked to participate when meeting the following inclusion criteria: have experienced a fall in the preceding year or suffer from two of the following risk factors: disturbed balance, mobility problems, dizziness, or the use of benzodiazepines or diuretics. People will be randomly allocated to either the Tai Chi Chuan group (13 weeks, twice a week or the no treatment control group. The primary outcome measure is the number of new falls, measured with a diary. The secondary outcome measures are balance, fear of falling, blood pressure, heart rate, lung function parameters, physical activity, functional status, quality of life, mental health, use of walking devices, medication, use of health care services, adjustments to the house, severity of fall incidents and subsequent injuries. Process parameters will be measured to evaluate the Tai Chi Chuan intervention. A cost-effectiveness analysis will be carried out alongside the evaluation of the clinical results. Follow

  10. Searches for Lepton Number Violation and resonances in the $K^{\\pm} \\to \\pi\\mu\\mu$ decays at the NA48/2 experiment

    CERN Document Server

    Massri, Karim


    The NA48/2 experiment at CERN collected a large sample of charged kaon decays into final states with multiple charged particles in 2003--2004. A new upper limit on the rate of the lepton number violating decay $K^{\\pm} \\to \\pi^{\\mp} \\mu^{\\pm} \\mu^{\\pm}$ obtained from this sample is reported: $\\mathcal{B}(K^{\\pm} \\to \\pi^{\\mp} \\mu^{\\pm} \\mu^{\\pm})<8.6 \\times 10^{-11}$ at 90\\% CL. Searches for two-body resonances in the $K^{\\pm} \\to \\pi\\mu\\mu$ decays (including heavy neutral leptons~$N_4$ and inflatons~$\\chi$) in the accessible range of masses and lifetimes are also presented. In the absence of a signal, upper limits are set on the products of branching ratios~$\\mathcal{B}(K^{\\pm} \\to \\mu^{\\pm} N_{4})\\mathcal{B}(N_{4} \\to \\pi^{\\mp}\\mu^{\\pm})$ and $\\mathcal{B}(K^{\\pm} \\to \\pi^{\\pm} \\chi)\\mathcal{B}(\\chi \\to \\mu^{+}\\mu^{-})$ as functions of the resonance mass and lifetime. These limits are in the $10^{-10}-10^{-9}$ range for resonance lifetimes below 100~ps.

  11. Magnetic resonance imaging; Imagerie par resonance magnetique

    Energy Technology Data Exchange (ETDEWEB)

    Fontanel, F. [Centre Hospitalier, 40 - Mont-de -Marsan (France); Clerc, T. [Centre Hospitalier Universitaire, 76 - Rouen (France); Theolier, S. [Hospice Civils de Lyon, 69 - Lyon (France); Verdenet, J. [Centre Hospitalier Universitaire, 25 - Besancon (France)


    The last improvements in nuclear magnetic resonance imaging are detailed here, society by society with an expose of their different devices. In the future the different technological evolutions will be on a faster acquisition, allowing to reduce the examination time, on the development of a more acute cardiac imaging, of a functional neuro-imaging and an interactive imaging for intervention. With the contrast products, staying a longer time in the vascular area, the angiography will find its place. Finally, the studies on magnetic fields should allow to increase the volume to examine. (N.C.).

  12. Hyperbolic Resonances of Metasurface Cavities

    CERN Document Server

    Keene, David


    We propose a new class of optical resonator structures featuring one or two metasurface reflectors or metacavities and predict that such resonators support novel hyperbolic resonances. As an example of such resonances we introduce hyperbolic Tamm plasmons (HTPs) and hyperbolic Fabry-Perot resonances (HFPs). The hyperbolic optical modes feature low-loss incident power re-distribution over TM and TE polarization output channels, clover-leaf anisotropic dispersion, and other unique properties which are tunable and are useful for multiple applications.

  13. Hyperbolic Resonances of Metasurface Cavities


    Keene, David; Durach, Maxim


    We propose a new class of optical resonator structures featuring one or two metasurface reflectors or metacavities and predict that such resonators support novel hyperbolic resonances. As an example of such resonances we introduce hyperbolic Tamm plasmons (HTPs) and hyperbolic Fabry-Perot resonances (HFPs). The hyperbolic optical modes feature low-loss incident power re-distribution over TM and TE polarization output channels, clover-leaf anisotropic dispersion, and other unique properties wh...

  14. The Resonant Transneptunian Populations

    CERN Document Server

    Gladman, B; Petit, J-M; Kavelaars, J; Jones, R L; Parker, J Wm; Van Laerhoven, C; Nicholson, P; Rousselot, P; Bieryla, A; Ashby, M L N


    The transneptunian objects (TNOs) trapped in mean-motion resonances with Neptune were likely emplaced there during planet migration late in the giant-planet formation process. We perform detailed modelling of the resonant objects detected in the Canada-France Ecliptic Plane Survey (CFEPS) in order to provide population estimates and, for some resonances, constrain the complex internal orbital element distribution. Detection biases play a critical role because phase relationships with Neptune make object discovery more likely at certain longitudes. This paper discusses the 3:2, 5:2, 2:1, 3:1, 5:1, 4:3, 5:3, 7:3, 5:4, and 7:4 mean-motion resonances, all of which had CFEPS detections, along with our upper limit on 1:1 Neptune Trojans (which is consistent with their small population estimated elsewhere). For the plutinos (TNOs in the 3:2 resonance) we refine the orbital element distribution given in Kavelaars et al. (2009) and show that steep H-magnitude distributions (N(H) proportional to 10aH, with a=0.8-0.9) a...

  15. Split-ball resonator

    CERN Document Server

    Kuznetsov, Arseniy I; Fu, Yuan Hsing; Viswanathan, Vignesh; Rahmani, Mohsen; Valuckas, Vytautas; Kivshar, Yuri; Pickard, Daniel S; Lukiyanchuk, Boris


    We introduce a new concept of split-ball resonator and demonstrate a strong omnidirectional magnetic dipole response for both gold and silver spherical plasmonic nanoparticles with nanometer-scale cuts. Tunability of the magnetic dipole resonance throughout the visible spectral range is demonstrated by a change of the depth and width of the nanoscale cut. We realize this novel concept experimentally by employing the laser-induced transfer method to produce near-perfect spheres and helium ion beam milling to make cuts with the nanometer resolution. Due to high quality of the spherical particle shape, governed by strong surface tension forces during the laser transfer process, and the clean, straight side walls of the cut made by helium ion milling, magnetic resonance is observed at 600 nm in gold and at 565 nm in silver nanoparticles. Structuring arbitrary features on the surface of ideal spherical resonators with nanoscale dimensions provides new ways of engineering hybrid resonant modes and ultra-high near-f...

  16. Overview of baryon resonances

    Directory of Open Access Journals (Sweden)

    Downie E.J.


    Full Text Available The quest to understand the physics of any system cannot be said to be complete as long as one cannot predict and fully understand its resonance spectrum. Despite this, due to the experimental challenge of the required double polarization measurements and the difficulty in achieving unambiguous, model-independent extraction and interpretation of the nucleon resonance spectrum of many broad and overlapping resonances, understanding of the structure and dynamics of the nucleon has suffered. The recent improvement in statistical quality and kinematic range of the data made available by such full-solid-angle systems as the CB and TAPS constellation at MAMI, coupled with the high flux polarized photon beam provided by the Glasgow Photon Tagger, and the excellent properties of the Mainz Frozen Spin Target, when paired with new developments in Partial Wave Analysis (PWA methodology make this a very exciting and fruitful time in nucleon resonance studies. Here the recent influx of data and PWA developments are summarized, and the requirements for a complete, unambiguous PWA solution over the first and second resonance region are briefly reviewed.

  17. Voix moyenne et variations d'actance : le réfléchi en arabe et en berbère (exemples de Mauritanie)


    Taine-Cheikh, Catherine


    International audience Pour Benveniste (1966), le moyen couvre toute la zone intermédiaire entre l'actif et le passif où l'agent “effectue en s'affectant” — le réfléchi correspondant alors au cas plus restreint où il y a co-référence entre l'agent et le patient. Cette définition permet d'aborder l'étude des langues où le moyen apparaît, non comme une extension du réfléchi prototypique (ou réflexif), mais, au contraire, comme une “hyper-notion”. C'est le cas notamment de l'arabe et du berbè...

  18. Similarity between the Spiral Arms of Galaxy M51 Image and the Interface Curve of Yin-Yang Balance in the Ancient Tai-Chi Diagram

    Institute of Scientific and Technical Information of China (English)

    Sui Lin


    The particle paths of the Lagrangian flow field between two cylinders simulate well the spiral arms of Galaxy M51 image [1] and the interface curve of the Yin-Yang balance in the ancient Tai-Chi diagram [2]. The particle paths of the Lagrangian flow field involve four parameters. The normalization of the system of equations signifi-cantly simplifies the formulation of the flow process and reduces the original four parameters to only one pa-rameter. Furthermore it provides the similarity between the formulation of the spiral arms of Galaxy M51 and that of the interface curve of the Yin-Yang balance in the ancient Tal-Chi diagram.

  19. Customer Satisfaction in Online Banking : A Comparative Study of Local and Foreign Commercial Banks in the South of Vietnam, Ho Chi Minh City


    Nguyen, Le Ngoc Diep


    The purpose of this research is to construct a conceptual model with related instruments that affect customer satisfaction in using online banking in Ho Chi Minh City and Southern Vietnam. An important task of this work is the comparison of customer satisfaction in using online banking between customers of Vietnamese local banks and customers of foreign banks. Further discussions of the relationship among online service quality, perceived value, e-trust, relationship quality, customer satisfa...

  20. Effects of Tai Chi and Walking Exercises on Weight Loss, Metabolic Syndrome Parameters, and Bone Mineral Density: A Cluster Randomized Controlled Trial

    Directory of Open Access Journals (Sweden)

    Stanley Sai-Chuen Hui


    Full Text Available Tai Chi and walking are both moderate-intensity physical activity (PA that can be easily practiced in daily life. The objective of the study was to determine the effects of these two PAs on weight loss, metabolic syndrome parameters, and bone mineral density (BMD in Chinese adults. We randomized 374 middle-aged subjects (45.8 ± 5.3 years into 12-week training (45 minutes per day, 5 days per week of Tai Chi (n=124 or self-paced walking (n=121 or control group (n=129. On average, Tai Chi and walking groups lost 0.50 and 0.76 kg of body weight and 0.47 and 0.59 kg of fat mass after intervention, respectively. The between-group difference of waist circumference (WC and fasting blood glucose (FBG was −3.7 cm and −0.18 mmol/L for Tai Chi versus control and −4.1 cm and −0.22 mmol/L for walking versus control. No significant differences were observed regarding lean mass, blood pressure, triglycerides, total cholesterol, high-density and low-density lipoprotein cholesterol, and BMD compared to control. Change in lean mass, not fat mass or total weight loss, was significantly correlated to the change in BMD. Our results suggest that both of these two PAs can produce moderate weight loss and significantly improve the WC and FBG in Hong Kong Chinese adults, with no additional effects on BMD.


    Directory of Open Access Journals (Sweden)



    determination and independence, and gain a clairvoyance of that females culture existence state and the value conception separately. Chi Li thinks deeply of the meaning of Chinese females life, in search of the culture value of contemporary female throughout the different female images, which figured in the novel, and it revealed the sprits in exploring of culture and the unique aesthetics taste of the author.

  2. The effects of a 6-month Tai Chi Qigong training program on temporomandibular, cervical and shoulder joint mobility and sleep problems in nasopharyngeal cancer survivors


    Fong, SSM; Ng, SSM; Lee, HW; Pang, MYC; Luk, WS; Chung, JWY; Wong, Jyh; Masters, RSW


    Introduction. Nasopharyngeal cancer (NPC) survivors often sustain head–neck–shoulder impairments from conventional treatments, which could disturb sleep. This novel study aimed to examine the efficacy of Tai Chi (TC) Qigong in optimizing temporomandibular joint (TMJ), cervical, and shoulder joint mobility and reducing sleep problems in NPC survivors. Methods. Fifty-two NPC survivors participated in the study. The experimental group (n = 25) received 6 months of TC Qigong training (1.5 h/sessi...

  3. Beneficial effects of tai chi on women's skeletal status assessed by quantitative ultrasound at the hand phalanges - one-year follow-up study

    International Nuclear Information System (INIS)

    Objectives. The advantageous effect of physical exercise on bones has been proven. Quantitative ultrasound (QUS) at different skeletal sites is an accepted method for indirect and noninvasive assessment of bone quality and fracture risk. Earlier, the present authors showed higher values of ultrasound transmission in the hand phalanges of a group of Polish women practicing Tai Chi. The aim of the present study was a prospective assessment of skeletal status in women practicing Tai Chi. Material and Methods. One-year follow-up of skeletal status was assessed using QUS measurements at the hand phalanges in a group of 46 exercising women (mean age: 59.3 ± 8.7 years). Results. At follow-up, increases in the mean amplitude-dependent speed of sound (Ad-SoS) from 1995 ± 80 to 2012 ± 75 m/s (p = 0.001) and mean Z-score from 0.673 ± 1.054 to 1.053 ± 1.178 (p = 0.0005) were observed in the exercising subjects. These changes revealed statistically significant positive correlation with subject age (r = 0.39, p = 0.007 and r = 0.35, p 0.018, respectively). The increase in Ad-SoS exceeded the value of the '' least significant change '' in 19 subjects (41%) of the total group and in 2 (22%) incorporated into medithe pre- and postmenopausal subgroups, respectively. Conclusions. A beneficial effect of regular Tai Chi exercise on skeletal status as assessed by phalangeal QUS is observed in older women. Tai Chi gymnastics may be recommended in the prevention of postmenopausal osteoporosis, especially in older individuals. (authors)

  4. Observation of e(+)e(-) -> omega chi(c1,2) near root s=4.42 and 4.6 GeV

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Ai, X. C.; Albayrak, O.; Albrecht, M.; Ambrose, D. J.; Amoroso, A.; Haddadi, Z.; Kalantar-Nayestanaki, N.; Kavatsyuk, M.; Loehner, H.; Messchendorp, J.G.; Tiemens, M.


    Based on data samples collected with the BESIII detector operating at the BEPCII storage ring at center-of-mass energies root s > 4.4 GeV, the processes e(+)e(-) -> omega chi(c1,2) are observed for the first time. With an integrated luminosity of 1074 pb(-1) near root s = 4.42 GeV, a significant ome

  5. Three-pion resonances (United States)

    Garcilazo, H.; Mathelitsch, L.


    We investigate the continuum three-pion problem within a relativistic three-body model that takes into account the ππ S and P waves. The dynamical input of the two-body subsystem is given by separable potentials, which yield a good fit to the ππ scattering data and resonance parameters up to a two-body invariant mass of 900MeV. We introduce a parameter ν expressing the ambiguity in the reduction of a fully relativistic theory to a three-dimensional one. The masses and widths of the ω, a 1(1260), and π(1300) mesons, which decay predominantly into three pions, are reasonably well described by our model. The h 1(1170) meson, however, which also decays into three pions, cannot be explained as a three-pion resonance. Some πρ Argand diagrams are shown in those channels where resonances exist.

  6. Resonant Non-Gaussianity

    CERN Document Server

    Flauger, Raphael


    We provide a derivation from first principles of the primordial bispectrum of scalar perturbations produced during inflation driven by a canonically normalized scalar field whose potential exhibits small sinusoidal modulations. A potential of this type has been derived in a class of string theory models of inflation based on axion monodromy. We use this model as a concrete example, but we present our derivations and results for a general slow-roll potential with superimposed modulations. We show analytically that a resonance between the oscillations of the background and the oscillations of the fluctuations is responsible for the production of an observably large non-Gaussian signal. We provide an explicit expression for the shape of this resonant non-Gaussianity. We show that there is essentially no overlap between this shape and the local, equilateral, and orthogonal shapes, and we stress that resonant non-Gaussianity is not captured by the simplest version of the effective field theory of inflation. We hop...

  7. Resonance vector mode locking

    CERN Document Server

    Kolpakov, Stanislav A; Loika, Yuri; Tarasov, Nikita; Kalashnikov, Vladimir; Agrawal, Govind P


    A mode locked fibre laser as a source of ultra-stable pulse train has revolutionised a wide range of fundamental and applied research areas by offering high peak powers, high repetition rates, femtosecond range pulse widths and a narrow linewidth. However, further progress in linewidth narrowing seems to be limited by the complexity of the carrier-envelope phase control. Here for the first time we demonstrate experimentally and theoretically a new mechanism of resonance vector self-mode locking where tuning in-cavity birefringence leads to excitation of the longitudinal modes sidebands accompanied by the resonance phase locking of sidebands with the adjacent longitudinal modes. An additional resonance with acoustic phonons provides the repetition rate tunability and linewidth narrowing down to Hz range that drastically reduces the complexity of the carrier-envelope phase control and so will open the way to advance lasers in the context of applications in metrology, spectroscopy, microwave photonics, astronomy...

  8. Superdimensional Metamaterial Resonators

    CERN Document Server

    Greenleaf, Allan; Kurylev, Yaroslav; Lassas, Matti; Uhlmann, Gunther


    We propose a fundamentally new method for the design of metamaterial arrays, valid for any waves modeled by the Helmholtz equation, including scalar optics and acoustics. The design and analysis of these devices is based on eigenvalue and eigenfunction asymptotics of solutions to Schr\\"odinger wave equations with harmonic and degenerate potentials. These resonators behave superdimensionally, with a higher local density of eigenvalues and greater concentration of waves than expected from the physical dimension, e.g., planar resonators function as 3- or higher-dimensional media, and bulk material as effectively of dimension 4 or higher. Applications include antennas with a high density of resonant frequencies and giant focussing, and are potentially broadband.

  9. Resonant optical gun. (United States)

    Maslov, A V; Bakunov, M I


    We propose a concept of a structure-a resonant optical gun-to realize an efficient propulsion of dielectric microparticles by light forces. The structure is based on a waveguide in which a reversal of the electromagnetic momentum flow of the incident mode is realized by exciting a whispering gallery resonance in the microparticle. The propelling force can reach the value up to the theoretical maximum of twice the momentum flow of the initial wave. The force density oscillates along the particle periphery and has very large amplitude. PMID:24784113

  10. Holographic laser resonators


    Hendricks, Jason Mark


    The work presented within this thesis details the development and characterisation of a CW solid-state adaptive resonator that uses phase-conjugation to actively correct for phase distortions present within the resonator loop. It is shown that the phase-conjugate of a given beam can be produced by the process of degenerate four-wave mixing inside a gain medium. In this scheme two mutually coherent beams overlap within a population inverted region of a laser amplifier and the subsequent interf...

  11. Thermal Resonance Fusion


    Dong, Bao-Guo


    We first show a possible mechanism to create a new type of nuclear fusion, thermal resonance fusion, i.e. low energy nuclear fusion with thermal resonance of light nuclei or atoms, such as deuterium or tritium. The fusion of two light nuclei has to overcome the Coulomb barrier between these two nuclei to reach up to the interacting region of nuclear force. We found nuclear fusion could be realized with thermal vibrations of crystal lattice atoms coupling with light atoms at low energy by reso...

  12. Resonant SIMP dark matter


    Soo-Min Choi; Hyun Min Lee


    We consider a resonant SIMP dark matter in models with two singlet complex scalar fields charged under a local dark U(1)D. After the U(1)D is broken down to a Z5 discrete subgroup, the lighter scalar field becomes a SIMP dark matter which has the enhanced 3→2 annihilation cross section near the resonance of the heavier scalar field. Bounds on the SIMP self-scattering cross section and the relic density can be fulfilled at the same time for perturbative couplings of SIMP. A small gauge kinetic...

  13. Time Dependent Resonance Theory


    Soffer, A.; Weinstein, M. I.


    An important class of resonance problems involves the study of perturbations of systems having embedded eigenvalues in their continuous spectrum. Problems with this mathematical structure arise in the study of many physical systems, e.g. the coupling of an atom or molecule to a photon-radiation field, and Auger states of the helium atom, as well as in spectral geometry and number theory. We present a dynamic (time-dependent) theory of such quantum resonances. The key hypotheses are (i) a reso...

  14. Pygmy resonances and nucleosynthesis

    CERN Document Server

    Tsoneva, Nadia


    A microscopic theoretical approach based on a se