WorldWideScience

Sample records for chi minh city

  1. Consumer Acceptance of Functional Foods in Ho Chi Minh City

    Directory of Open Access Journals (Sweden)

    Duy Tung BUI

    2015-11-01

    Full Text Available The aim of this paper is to identify and evaluate the underlying factors affecting consumer acceptance of functional foods. The contribution of this study is to better understand customer willingness to buy such products in Ho Chi Minh City by shedding light on how socio-demographic, cognitive and attitudinal determinants affect consumer's choices of foods. We conducted a survey using 217 respondents from Ho Chi Minh City. Next, we develop a binary-probit model to quantify the impact of each factor on consumer acceptance. The results show that having a sick relative, beliefs in health benefits positively affect acceptance level. Other than that, old people in Ho Chi Minh City tend to reject the use of functional foods. However, when they are provided with enough knowledge, they are the most intensive buyers of these products. Implications and further researches are also discussed.

  2. Programme Note: Realities and Opportunities in Ho Chi Minh City.

    Science.gov (United States)

    Franchet, Chi Nguyen

    1996-01-01

    The current status of street children in Ho Chi Minh City, Vietnam, is characterized by marginalization from society through street vending, begging, theft, and prostitution. Evaluation of a drop-in center serving children without family linkages indicates need for needs assessments, follow-up activities, measurement of individual child progress,…

  3. Consumer Behaviour. Case: iPhone Ho Chi Minh City

    OpenAIRE

    Tran, Thi Xuan Oanh

    2016-01-01

    The main aim of this thesis is to figure out the factors that have influenced consumer behaviour of young iPhone users in Ho Chi Minh City. In this study, the author draw a conclusion based on the data collected from the survey and proposed some feasible recommendations for Apple and other high-end smartphone companies to understand their consumers and enhance brand equity. For the secondary data, a variety of theories, including consumers’ characteristics, promotion and the decision mak...

  4. The challenges of water governance in Ho Chi Minh City.

    Science.gov (United States)

    van Leeuwen, Cornelis J; Dan, Nguyen P; Dieperink, Carel

    2016-04-01

    Population growth, urbanization, pollution, and climate change pose urgent water challenges in cities. In this study, the sustainability of integrated water resources management in Ho Chi Minh City (HCMC) was evaluated using the City Blueprint approach. The City Blueprint is a set of 24 dedicated indicators divided over 8 categories (i.e., water security, water quality, drinking water, sanitation, infrastructure, climate robustness, biodiversity and attractiveness, and governance including public participation). The analysis showed that the rapid increase of water use for urban, industrial, and agricultural activities in HCMC has resulted in depletion of groundwater and severe pollution of both groundwater and surface water. Surface water quality, groundwater quality, biodiversity, and the sanitation of domestic and industrial wastewater are matters that need serious improvement. Current and future water supply in HCMC is at risk. HCMC can cope with it, but the 7 governance gaps as described by the Organisation for Economic Co-operation and Development (OECD) are major obstacles for HCMC. Rainwater harvesting, pollution reduction, as well as wastewater reuse are among the practical options. Wastewater reuse could lower the water stress index to 10%. The window to do this is narrow and rapidly closing as a result of the unprecedented urbanization and economic growth of this region. PMID:26009880

  5. City networks and commodity chains: identifying global flows and local connections in Ho Chi Minh City

    DEFF Research Database (Denmark)

    Vind, Ingeborg; Fold, Niels

    2010-01-01

    Any analytical framework for understanding actual forms of the intensified incorporation of cities into the world economy needs to go beyond the exclusive focus on advanced producer services, which is characteristic of most of the World City Network (WCN) approach. Simultaneously, an account of t...... electronics industry located in Ho Chi Minh City and the agricultural sector in its rural hinterland, the Mekong Delta....

  6. Towards the Reuse of Municipal Biowastes in Vietnam: a case study about Ho Chi Minh City

    NARCIS (Netherlands)

    Buuren, van J.C.L.; Thi, Le K.O.

    2006-01-01

    Table of contents: 1. Solid waste segragation at source in Ho Chi Minh City. 2. Survey of technical efficiency and economic viability of existing composting ventures and survey of the institutional and regulatory framework regarding composting in Vietnam. 3. Demand analysis of urban waste compost. 4

  7. Diabetes Control among Vietnamese Patients in Ho Chi Minh City: An Observational Cross-Sectional Study

    Science.gov (United States)

    Yokokawa, Hirohide; Khue, Nguyen Thy; Goto, Aya; Nam, Tran Quang; Trung, Tran The; Khoa, Vo Tuan; Ngoc, Nguyen Thi Boi; Minh, Pham Nghiem; Vinh, Nguyen Quang; Okayama, Akira; Yasumura, Seiji

    2010-01-01

    The objective of this study was to assess the extent of diabetic control and its associated factors among Vietnamese patients with diabetes mellitus (DM). The study was conducted among 652 outpatients who were recruited at a public general hospital (People Hospital 115) and a private clinic (Medic Center) in Ho Chi Minh City, Vietnam. Median age…

  8. Global Climate Change and Solutions for Urban Sustainability of Ho Chi Minh City, Vietnam

    Directory of Open Access Journals (Sweden)

    Dao Phan

    2015-03-01

    Full Text Available Ho Chi Minh City (HCMC, the largest city in Vietnam, is steadily growing, certainly towards a mega city in the near future. Like other mega cities at the boom stage, it has to face with serious environmental matters insolvable for many years. The situation may be worse under the effects of global climate change, geological subsidence due to non-standard construction and sea level rise. The situation of HCMC can be damaged or even broken by resonant effects of unsolved environmental matters and latent impacts of climate change. This article shows the challenges to the urban sustainable development under the duo effect of urban environmental matters and climate change in Ho Chi Minh City. Opportunities and strategic directions to overcome the challenges are also analyzed and recommended.

  9. Modelling and evaluating municipal solid waste management strategies in a mega-city: The case of Ho Chi Minh City

    NARCIS (Netherlands)

    ThiKimOanh, L.; Bloemhof-Ruwaard, J.M.; Buuren, van J.C.L.; Vorst, van der J.G.A.J.; Rulkens, W.H.

    2015-01-01

    Ho Chi Minh City is a large city that will become a mega-city in the near future. The city struggles with a rapidly increasing flow of municipal solid waste and a foreseeable scarcity of land to continue landfilling, the main treatment of municipal solid waste up to now. Therefore, additional munici

  10. Frog value chain case study in Ho Chi Minh City Vietnam

    OpenAIRE

    Le, Minh Quoc

    2012-01-01

    Frog is valuable product in Vietnam but the natural frogs are overexploited thus, the new model to raising frog is desired. Many species of frogs are cultured in Vietnam, especially in Ho Chi Minh City, for trial of the adaptive ability of exotic species in Vietnam condition. Recently, the frogs’ species from Thailand and Taiwan are prepotent and spread out Vietnam. Nowadays, frog culture becomes one of the newest industries in Vietnam. With a short life cycle, frog culture is farming as econ...

  11. Users' Searching Behaviour in Using Online Databases at Vietnam National University - Ho Chi Minh City

    OpenAIRE

    Hong Sinh, Nguyen; Hong Nhung, Hoang Thi

    2012-01-01

    Purpose: This paper focuses on identifying the searching behaviors of the users, their difficulties as well as their expectations from library supports while using online databases at the Central Library of Vietnam National University – Ho Chi Minh city. Methods: Usage Reports of six online databases subscribed by the Central Library were analyzed and a survey by emailing users a questionnaire was conducted. Findings: The amount of usage increases yearly, however it is still low in comp...

  12. Energy and macronutrient intakes in preschool children in urban areas of Ho Chi Minh City, Vietnam

    OpenAIRE

    Sibbritt David W; Dibley Michael J; Huynh Dieu TT; Tran Hanh TM

    2008-01-01

    Abstract Background An increasing prevalence of overweight and obesity has been documented in preschool children in Ho Chi Minh City (HCMC), Vietnam. However, little is known about what preschool children in HCMC eat or how well their nutrient intake meets nutrient recommendations. This study aims to describe the energy and macronutrient intake and compare these nutrient intakes with the recommendations for Vietnamese children aged four to five years. Methods The data comes from the baseline ...

  13. Breastfeeding among Vietnamese women in Ho Chi Minh City: Attitudes and confidence

    OpenAIRE

    Mogensen, Hanna; Westin, Frida

    2009-01-01

    Breastfeeding has several advantages for both mother and child. A woman’s attitude to breastfeeding is a good predictor for infant feeding method and her confidence in breastfeeding has an impact on her breastfeeding duration. Aim:The aim of the study was to assess the attitude to and confidence in breastfeeding among Vietnamese women in Ho Chi Minh City. The aim was also to investigate if the type of family, nuclear and extended, influences the Vietnamese women’s attitude to and confidence i...

  14. SURMAT : decision support tool to select municipal solid waste treatment technologies : case study in Ho Chi Minh City, Viet Nam

    OpenAIRE

    Thi, Le, K.O.

    2012-01-01

    The aim of this thesis is to enable taking more sustainable and cost-effective decisions on MSW management in developing cities. For this purpose, a tool named SURMAT was developed and applied using data of Ho Chi Minh City, Viet Nam (chapter 6). In order to prepare the tool for modeling of the MSW management in Ho Chi Minh City, an analysis of the current MSW management system (chapter 2), a selection of technologies (chapter 3, 4) and a costs analysis of the selected technologies (chapter 5...

  15. SURMAT : decision support tool to select municipal solid waste treatment technologies : case study in Ho Chi Minh City, Viet Nam

    NARCIS (Netherlands)

    Thi, Le K.O.

    2012-01-01

    The aim of this thesis is to enable taking more sustainable and cost-effective decisions on MSW management in developing cities. For this purpose, a tool named SURMAT was developed and applied using data of Ho Chi Minh City, Viet Nam (chapter 6). In order to prepare the tool for modeling of the MSW

  16. Business plan for a european style coffee shop in Ho Chi Minh city : case: AT Ltd. Company

    OpenAIRE

    Tran, Vu Ai

    2013-01-01

    This thesis is aimed to assist AT Company in its venture of running a European style coffee shop in Ho Chi Minh City. Hence, based on an analysis of the potential of the Vietnamese coffee industry with a focus on the Ho Chi Minh City market, its creative business idea is formulated together with new concepts. Correspondingly, a business plan is generated to describe an appropriate direction for the venture. In the sphere of the thesis, the author only concentrates on the process of implementi...

  17. Ho Chi Minh City adaptation to increasing risk of coastal and fluvial floods

    Science.gov (United States)

    Scussolini, Paolo; Lasage, Ralph

    2016-04-01

    Coastal megacities in southeast Asia are a hotspot of vulnerability to floods. In such contexts, the combination of fast socio-economic development and of climate change impacts on precipitation and sea level generates concerns about the flood damage to people and assets. This work focuses on Ho Chi Minh City, Vietnam, for which we estimate the present and future direct risk from river and coastal floods. A model cascade is used that comprises the Saigon river basin and the urban network, plus the land-use-dependent damaging process. Changes in discharge for five return periods are simulated, enabling the probabilistic calculation of the expected annual economic damage to assets, for differnt scenarios of global emissions, local socio-economic growth, and land subsidence, up to year 2100. The implementation of a range of adaptation strategies is simulated, including building dykes, elevating, creating reservoirs, managing water and sediment upstream, flood-proofing, halting groundwater abstraction. Results are presented on 1) the relative weight of each future driver in determining the flood risk of Ho Chi Minh, and 2) the efficiency and feasibility of each adaptation strategy.

  18. Learning to See the City Again: Ethnographic Visions of Gender, Class, and Space in Ho Chi Minh City

    Directory of Open Access Journals (Sweden)

    Erik Harms

    2015-06-01

    Full Text Available Ann Marie Leshkowich. Essential Trade: Vietnamese Women in a Changing Marketplace. University of Hawai'i Press, 2014. 272 pp. $55 (cloth, $25 (paper. Kimberly Kay Hoang. Dealing in Desire: Asian Ascendancy, Western Decline, and the Hidden Currencies of Global Sex Work. University of California Press, 2015. 248 pp. $65 (cloth, $30 (paper/ebook. Catherine Earl. Vietnam’s New Middle Classes: Gender, Career, City. NIAS Press, 2014. 320 pp. £50 (cloth, £18 (paper. Annette Miae Kim. Sidewalk City: Remapping Public Space in Ho Chi Minh City. University of Chicago Press, 2015. 264 pp. $45 (cloth, $7–$36 (ebook. In addition to looking at gendered space, then, understanding a city requires considering the dynamic relationship between the seen and the unseen. And in order to understand this relationship, we need more than preconceived pronouncements about how the city works, or about how gender and class work on space. Rather, we need rich, fine-grained ethnography that traces the dynamic intersections of gender, space, and class in a city. To do such ethnography properly requires peering beyond the surface appearances of the city and listening intently to the everyday lives lived within it. The four new ethnographic perspectives on gender, class, and space in Ho Chi Minh City discussed in this essay all offer ways to see the city again. Three of them do this by looking at class and gender, and one does it by rethinking how we make maps; two of them are by anthropologists, one by a sociologist, and one by an urban planner. But they share one thing in common: all of them hone their keen vision with the aid of ethnography...

  19. Application of groundwater sustainability indicators to the Upper Pliocene aquifer in Ho Chi Minh city, Viet Nam

    Science.gov (United States)

    Ngo, T. M.; Lee, J.; Lee, H.; Woo, N. C.

    2013-12-01

    Groundwater plays an importance role for domestic, industrial, and agricultural uses in Ho Chi Minh city, Viet Nam. This study is objected to evaluate the sustainability of groundwater by using groundwater sustainability indicators (GWSIs) defined by UNESCO/IAEA/IAH Working Group on Groundwater Indicators at aquifer scale (the Upper Pliocene aquifer). There are four main indicators selected and one new indicator designed for the particular characteristic of Ho Chi Minh city which is under influence of by saline-water intrusion. The results indicated groundwater of the Upper Pliocene aquifer, the main groundwater supply source, is generally in the unsustainable state. The abstraction of groundwater, which was much greater than its capability, is probably causing the serious state of annual groundwater depletion and saline-water intrusion. The GWSIs, which expressed in such a simple way but scientifically-based and policy-relevant, proved its usefulness in evaluating the sustainability of groundwater at the aquifer scale in Ho Chi Minh city, and subsequently should be incorporated in water resource management practices.

  20. Energy and macronutrient intakes in preschool children in urban areas of Ho Chi Minh City, Vietnam

    Directory of Open Access Journals (Sweden)

    Sibbritt David W

    2008-10-01

    Full Text Available Abstract Background An increasing prevalence of overweight and obesity has been documented in preschool children in Ho Chi Minh City (HCMC, Vietnam. However, little is known about what preschool children in HCMC eat or how well their nutrient intake meets nutrient recommendations. This study aims to describe the energy and macronutrient intake and compare these nutrient intakes with the recommendations for Vietnamese children aged four to five years. Methods The data comes from the baseline measurement of a one year follow-up study on obesity in 670 children attending kindergartens in HCMC. Dietary information for each child at the school and home settings was collected using Food Frequency Questionnaires (FFQs, by interviewing teachers and parents or main caregivers. The average energy and nutrient intake in a day was calculated. The proportion of children with energy intake from macronutrients meeting or exceeding the recommendations was estimated based on the 2006 recommended daily allowance (RDA for Vietnamese children in this age group. Results The dietary intake of the participants contained more energy from protein and fat, particularly animal protein and fat, and less energy from carbohydrates, than the RDA. Most children (98.1% had mean energy intake from protein greater than the recommended level of 15%, and no child obtained energy from animal fat that was in accordance with the recommendation of less than 30% of the total fat intake. Nearly one half of children (46.5% consumed less than the advised range of mean energy intake from carbohydrate (60%–70%. Conclusion In this preschool child population in HCMC, in which obesity is emerging as major public health problem, there is an imbalance in dietary intake. Healthy eating programs need to be developed as a part of an obesity prevention program for young children in HCMC.

  1. The prevalence and correlates of physical inactivity among adults in Ho Chi Minh City

    Directory of Open Access Journals (Sweden)

    Phongsavan Philayrath

    2008-06-01

    Full Text Available Abstract Background Socioeconomic changes have led to profound changes in individuals' lifestyles, including the adoption of unhealthy food consumption patterns, prevalent tobacco use, alcohol abuse and physical inactivity, especially in large cities like Ho Chi Minh City (HCMC. The Stepwise Approach to Surveillance of Non-communicable Disease Risk Factors survey was conducted to identify physical activity patterns and factors associated with 'insufficient' levels of physical activity for health in adults in HCMC. Methods A cross-sectional survey was conducted in 2005 among 1906 adults aged 25–64 years using a probability proportional to size cluster sampling method to estimate the prevalence of non-communicable disease risk factors including physical inactivity. Data on socioeconomic status, health behaviours, and time spent in physical activity during work, commuting and leisure time were collected. Physical activity was measured using the validated Global Physical Activity Questionnaire (GPAQ. Responders were classified as 'sufficiently active' or 'insufficiently active' using the GPAQ protocol. Correlates of insufficient physical activity were identified using multivariable logistic regression. Results A high proportion of adults were physically inactive, with only 56.2% (95% CI = 52.1–60.4 aged 25–64 years in HCMC achieving the minimum recommendation of 'doing 30 minutes moderate-intensity physical activity for at least 5 days per week'. The main contributors to total physical activity among adults were from working and active commuting. Leisure-time physical activity represented a very small proportion (9.4% of individuals' total activity level. Some differences in the pattern of physical activity between men and women were noted, with insufficient activity levels decreasing with age among women, but not among men. Physical inactivity was positively associated with high income (OR = 1.77, 95% CI = 1.05–2.97 and high household

  2. The concentration of manufacturing industries in Vietnam with particular reference to Ho Chi Minh City and its surrounding.

    OpenAIRE

    Ercole, Roberto

    2014-01-01

    The research aims to invesDgate the economic agglomeration and concentration of manufacturing industries in Vietnam with particular reference to Ho Chi Minh and its surrounding provinces using a-spatial and spatial statistics.

  3. Mapping Ground Subsidence Phenomena in Ho Chi Minh City through the Radar Interferometry Technique Using ALOS PALSAR Data

    Directory of Open Access Journals (Sweden)

    Dinh Ho Tong Minh

    2015-07-01

    Full Text Available The rapidly developing urbanization since the last decade of the 20th century has led to extensive groundwater extraction, resulting in subsidence in Ho Chi Minh City, Vietnam. Recent advances in multi-temporal spaceborne SAR interferometry, especially with a persistent scatters interferometry (PSI approach, has made this a robust remote sensing technique for measuring large-scale ground subsidence with millimetric accuracy. This work has presented an advanced PSI analysis, to provide an unprecedented spatial extent and continuous temporal coverage of the subsidence in Ho Chi Minh City from 2006 to 2010. The study shows that subsidence is most severe in the Holocene silt loam areas along the Sai Gon River and in the southwest of the city. The groundwater extraction resulting from urbanization and urban growth is mainly responsible for the subsidence. Subsidence in turn leads to more flooding and water nuisance. The correlation between the reference leveling velocity and the estimated PSI result is R2 = 0.88, and the root mean square error is 4.3 (mm/year, confirming their good agreement. From 2006 to 2010, the estimation of the average subsidence rate is -8.0 mm/year, with the maximum value up to -70 mm/year. After four years, in regions along Sai Gon River and in the southwest of the city, the land has sunk up to -12 cm. If not addressed, subsidence leads to the increase of inundation, both in frequency and spatial extent. Finally, regarding climate change, the effects of subsidence should be considered as appreciably greater than those resulting from rising sea level. It is essential to consider these two factors, because the city is inhabited by more than 7.5 million people, where subsidence directly impacts urban structures and infrastructure.

  4. Preliminary study on arsenic concentration in groundwater in usual exploited aquifer in Ho Chi Minh City (pleistocene aquifer QIm)

    International Nuclear Information System (INIS)

    Recent days, As in groundwater is a hot spot in some countries in Asia (e.g India, Bangladesh, Myanmar, Thailand) that was revealed through Executive Meetings of RAS/8/084. In Vietnam, some reports on groundwater quality in Red River Delta and Mekong Delta (with few random groundwater samples selected to analyse randomly) brought an opinion that groundwater in some region in Vietnam contains a quantity of As is over WHO Limit to As concentration in drinking water. This project hat been carrying out in Ho Chi Minh City in order to survey and make a preliminary assessment on As content in groundwater in shallow aquifer which is usual exploited in one of important social-economic centers of Vietnam. (author)

  5. Clinical features of HIV/AIDS patients presenting to an inner city clinic in Ho Chi Minh City, Vietnam.

    Science.gov (United States)

    Klotz, Stephen A; Nguyen, Hao Cong; Van Pham, Tam; Nguyen, Liem Thanh; Ngo, Dong Thi Anh; Vu, Son Nhoc

    2007-07-01

    An outpatient HIV clinic was opened in March 2005 in Binh Thanh District, a poor section of Ho Chi Minh City, Vietnam. Over 1500 patients were seen in the first year. The average age of patients was 27 years. Men represented 77% of the clinic population, women, 23% and children under the age of 16 years of age, 5% of the population. The most common risk factor among men was being an injecting drug user (IDU), 76%, and among women, being married to an IDU HIV-positive man, 35%. Physical signs of disease were uncommon: lymphadenopathy in 24% and hepatomegaly and splenomegaly in 4% and 3%, respectively. Men and women were anaemic at presentation, with a mean haemoglobin of 11.9 g/dL and 11.1 g/dL, respectively. An overwhelming majority of patients had profound immunodeficiency. The mean CD4+ cell count was 164 cells/mL and the median was 69 cells/mL. No correlation was found between the World Health Organization's stage of disease and the CD4+ cell count. Thus, the former is a poor predictor of immunity in this population. Data regarding opportunistic infections diagnosed at the first visit were studied. Candidiasis of the oral pharynx, oesophagus or vagina was found in 34.5% of the patients, and pulmonary and extrapulmonary tuberculosis was found in 32% of the patients. Pneumocystis carinii pneumonia (PCP) was diagnosed in only 3% of the patients. Cotrimoxazole prophylaxis is advocated for HIV-infected Vietnamese, but the incidence of PCP is negligible and resources could be spent elsewhere. The various opportunistic infections seen in this resource-poor clinic setting is likely to be a pattern of presentation of HIV-infected Vietnamese for some time to come. PMID:17623507

  6. Monitoring land subsidence process in the urban area of Ho Chi Minh city, Vietnam using multi-temporal SAR Interferometry

    Science.gov (United States)

    Nguyen, Xuan; Chang, Chung-Pai; Le, Tuan

    2016-04-01

    Land subsidence has become the most common hazard in urban area that could led to cracking buildings and infrastructures, extending the flooding area or even change the river path. Despite deriving precise information, conventional subsidence monitoring techniques are considered as costly, man-power consuming and lack of comprehensive information. Recently, SAR Interferometry (InSAR) has become a widely used geodetic technique for monitoring the deformation of the Earth's surface, especially methods based on the use of a multi-temporal dataset. In this study, we use a stack of 18 SAR images acquired from L-band PALSAR sensor onboard the ALOS satellite to derive the subsidence information of Ho Chi Minh city, Vietnam over the period of December 2006 to December 2010. The Stanford Method for Persistent Scatterers (StaMPS) Multi-Temporal Interferometry (MTI) approach is chosen to take advantages of both the persistent scatterers and the distributed scatterers, which could be used as monitoring points to measure the subsidence process. Assume the subsidence in this area mostly corresponds to vertical components, we found subsidence patterns along Saigon river and in the South of the city. Maximum subsidence rate reaches up to -66 mm/year in vertical direction. Finally, InSAR derived result and previous levelling data are taken into comparison to find the correlation between the two results.

  7. Customer Satisfaction in Online Banking : A Comparative Study of Local and Foreign Commercial Banks in the South of Vietnam, Ho Chi Minh City

    OpenAIRE

    Nguyen, Le Ngoc Diep

    2014-01-01

    The purpose of this research is to construct a conceptual model with related instruments that affect customer satisfaction in using online banking in Ho Chi Minh City and Southern Vietnam. An important task of this work is the comparison of customer satisfaction in using online banking between customers of Vietnamese local banks and customers of foreign banks. Further discussions of the relationship among online service quality, perceived value, e-trust, relationship quality, customer satisfa...

  8. Backyard Living – Integrative Policies Towards Migrant Workers: Housing Microfinance in Greater Ho Chi Minh City, Vietnam

    Directory of Open Access Journals (Sweden)

    Martin Noltze

    2008-01-01

    Full Text Available The urban agglomeration of the Vietnamese southeast industrial driving force Ho Chi Minh City (HCMC has become the most outstanding benefi ciary of the remarkable economic growth and foreign investments in the Vietnamese economy since the start of a comprehensive economic reform process in the mid 1980s. The notable development towards the foremost economic centre led to a high influx of migrant workers. In the course of an ongoing expansion process towards a megacity of tomorrow, the defi cient provision of adequate housing remains one of the most challenging problems of rural migrants in Greater HCMC. However, a future-oriented sustainable megacity concept is strongly dependent on the successful integration of migrants into the urban society. Within this context, the housing market is considered to be a key aspect of comprehensive urban planning. Hereby, housing microfinance (HMF will be presented as an alternative housing finance scheme meeting the demand of a noteworthy number of poor and low-income people. Thereby HMF can do both: focus on specifi c needs of migrants with respect to their current life situation and enhance its outreach to a potential target group.

  9. The Prospects of Rainwater Harvesting in the Ho Chi Minh City

    Directory of Open Access Journals (Sweden)

    Chi Nguyen Thuy Lan

    2015-12-01

    Full Text Available Wisely using natural water resources to serve human needs plays a decisive role in ensuring water and food security. In the natural water cycle, rainwater is considered as a valuable renewable resource. Rainwater harvesting (RWH for daily life and production is a simple but effective and also environmentally sound measure. It is also a positive solution in a climate change adaptation strategy. However, this resource is being wasted in our country in general and in the HCM City in particular. This paper provides an overview of the status of rainwater use in the world; the general situation, the potential of rainwater collection and a number of issues related to the potential of rainwater harvesting in the city. Some solutions to enhance the use of rainwater and improve water supply for city residents are also suggested in this discussion.

  10. Groundwater salinization mechanism of aquifers beneath Ho Chi Minh City area (Viet Nam)

    International Nuclear Information System (INIS)

    Water supplying for domestic and product activities in Hochiminh City is being taken from two both sources: surface water and groundwater. Environmental isotopes technique is emphasized to determine the salinisation mechanism of groundwater. The objectives studied are groundwater of two aquifers mainly being exploited in Hochiminh City area. Based on the national water monitoring wells existing in the studied area and the hydrogeological setting a network of 70 sampling points for both two aquifers was set up. Water samples were collected two times (in rainy season of 2001 and in the end of dry season of 2002). All collected samples were analyzed for hydrochemical and stable isotopes. 30 of them were analyzed for tritium and 15 of them were done for 14C. Analyzing hydrochemical results of collected samples show that the quality of groundwater varies from fresh to saline, soft to very hard and high iron contents in some regions. The analyses of cations and anions by Piper Trilinear Diagram show that in aquifers where saline groundwater distributed the cations are mainly sodium, calcium, and magnesium type while the anions are mainly chloride and sulfate type but in the part where fresh groundwater the cations are mainly sodium, calcium, and type while the anions are mainly bicarbonate, carbonate and nitrate type. According to TDS values the distribution of fresh and saline groundwater in studied aquifers is mapped and fresh-saline groundwater boundaries in 1990 and 2000 is also demonstrated. The distribution of groundwater samples collected along the GMWL show that groundwater in this area is recharged directly by rainfall and surface water. High tritium contents and 14C relative radioactivity of groundwater in the area also support this process. Delta values of 18O and Chloride contents plot show that it exists two main salinisation mechanism. The first one is the leaching process and the second one is mixing with seawater process and both these mechanisms are

  11. Knowledge and practices regarding foot care among patients with Type 2 diabetes in Ho Chi Minh City, Vietnam : A quantitative study

    OpenAIRE

    Thunberg, Stina; Hellenberg, Sofia

    2013-01-01

    Introduction: Previous research shows that knowledge and practice was low in type 2 diabetes patients and that women had better practice/self-care than men. Aim: The aim of this study was to investigate the knowledge and practices regarding foot-care among patients with type 2 diabetes in Ho Chi Minh City, Vietnam, and also investigate if there was any difference between genders in knowledge and practicing of foot care. Method: This study was a descriptive and cross-sectional design with quan...

  12. A Group-Based Sexual Risk Reduction Intervention for Men Who Have Sex With Men in Ho Chi Minh City, Vietnam: Feasibility, Acceptability, and Preliminary Efficacy.

    Science.gov (United States)

    Mimiaga, Matthew J; Closson, Elizabeth F; Biello, Katie B; Nguyen, Huyen; Nguyen, Quan Hoang; Oldenburg, Catherine E; Lan, Hang Thi Xuan; Safren, Steven A; Mayer, Kenneth H; Colby, Donn J

    2016-08-01

    An emerging HIV epidemic can be seen among men who have sex with men (MSM) in Vietnam. There are currently no evidence-based behavioral sexual risk reduction interventions for MSM in this setting. Between October 2012 and June 2013, 100 high-risk MSM from Ho Chi Minh City were enrolled in an open pilot trial to assess feasibility and acceptability of a group-based, manualized sexual risk reduction intervention, and to preliminarily examine changes in primary and secondary outcomes. Participants completed a behavioral assessment battery and HIV testing at baseline, 3, and 6 months post-baseline. Over 80.0 % of the sample was sexual risk behavior among MSM in Vietnam in a randomized controlled efficacy trial. PMID:26721662

  13. Willingness to Use the Internet to Seek Information on HIV Prevention and Care among Men Who Have Sex with Men in Ho Chi Minh City, Vietnam

    Science.gov (United States)

    Justumus, Pauline; Colby, Donn; Mai Doan Anh, Thi; Balestre, Eric

    2013-01-01

    Background In Vietnam, men who have sex with men (MSM) are highly affected by HIV and need new targeted HIV prevention strategies. Objectives To assess the willingness to use the Internet to seek information on HIV prevention and care and associated factors among MSM in Ho Chi Minh City. Methods A descriptive cross-sectional study was conducted in 2012. Participants were recruited using a convenience sampling method in venues most frequented by MSM and completed a self-administered questionnaire. Logistic regression models were performed to estimate factors associated with the willingness to use the Internet to seek information on HIV prevention and care. Results A total of 358 MSM were approached for the survey and 222 questionnaires (62.0%) were eligible for analyses. Overall, 76.1% of the respondents reported that they were willing to use the Internet to seek information on HIV prevention and care. A number of male partners in last year less than or equal to 3 (Adjusted Odds Ratio: 3.07, 95% Confidence interval: 1.40–6.73), a history of STI screening (4.10, 1.02–16.48) and HIV testing (3.23, 1.20–8.64) and having ever sought a male sexual partner through the Internet (3.56, 1.55–8.18) were significantly positively associated with the willingness to use the Internet to seek information on HIV prevention and care. Conclusion The MSM interviewed in Ho Chi Minh City reported a high willingness to use the Internet to seek information on HIV prevention and care. In a context where new media are increasingly considered as promising options for reaching this HIV risk group, further research should be conducted on developing and testing tailored online tools adapted to the needs of Vietnamese MSM. PMID:23977048

  14. Learning to See the City Again: Ethnographic Visions of Gender, Class, and Space in Ho Chi Minh City

    OpenAIRE

    Erik Harms

    2015-01-01

    Ann Marie Leshkowich. Essential Trade: Vietnamese Women in a Changing Marketplace. University of Hawai'i Press, 2014. 272 pp. $55 (cloth), $25 (paper). Kimberly Kay Hoang. Dealing in Desire: Asian Ascendancy, Western Decline, and the Hidden Currencies of Global Sex Work. University of California Press, 2015. 248 pp. $65 (cloth), $30 (paper/ebook). Catherine Earl. Vietnam’s New Middle Classes: Gender, Career, City. NIAS Press, 2014. 320 pp. £50 (cloth), £18 (paper). Annette Miae Ki...

  15. Economic-Environmental Impact Analysis Based on a Bi-region Interregional I-O Model for Vietnam, between HoChiMinh City (HCMC) and the rest of Vietnam (ROV), 2000

    OpenAIRE

    Bui Trinh; Francisco T. Secretario; Kim Kwangmun; Le Ha Thanh; Pham Huong Giang

    2008-01-01

    From time to time, Input - Output model systems have been applied in estimating economic - environment linkages. Further, the economic interregional input output model system can be applied in analysis impacts on residuals generated by interregional economic activities. In this paper will processed with case study of HoChiMinh City and Rest of Vietnam based on inter-regional input - output approach. The first part of this paper presents the conceptual and accounting framework of the IRIO mode...

  16. Flood risk analysis and adaptive strategy in context of uncertainties: a case study of Nhieu Loc Thi Nghe Basin, Ho Chi Minh City

    Science.gov (United States)

    Ho, Long-Phi; Chau, Nguyen-Xuan-Quang; Nguyen, Hong-Quan

    2013-04-01

    The Nhieu Loc - Thi Nghe basin is the most important administrative and business area of Ho Chi Minh City. Due to system complexity of the basin such as the increasing trend of rainfall intensity, (tidal) water level and land subsidence, the simulation of hydrological, hydraulic variables for flooding prediction seems rather not adequate in practical projects. The basin is still highly vulnerable despite of multi-million USD investment for urban drainage improvement projects since the last decade. In this paper, an integrated system analysis in both spatial and temporal aspects based on statistical, GIS and modelling approaches has been conducted in order to: (1) Analyse risks before and after projects, (2) Foresee water-related risk under uncertainties of unfavourable driving factors and (3) Develop a sustainable flood risk management strategy for the basin. The results show that given the framework of risk analysis and adaptive strategy, certain urban developing plans in the basin must be carefully revised and/or checked in order to reduce the highly unexpected loss in the future

  17. Characterization of hospital and community-acquired respiratory syncytial virus in children with severe lower respiratory tract infections in Ho Chi Minh City, Vietnam, 2010

    Science.gov (United States)

    Tuan, Tran Anh; Thanh, Tran Tan; Hai, Nguyen thi Thanh; Tinh, Le Binh Bao; Kim, Le thi Ngoc; Do, Lien Anh Ha; Chinh B'Krong, Nguyen thi Thuy; Tham, Nguyen thi; Hang, Vu thi Ty; Merson, Laura; Farrar, Jeremy; Thuong, Tang Chi; de Jong, Menno D; Schultsz, Constance; van Doorn, H Rogier

    2015-01-01

    Background Human respiratory syncytial virus (RSV) is an important community and nosocomial pathogen in developed countries but data regarding the importance of RSV in developing countries are relatively scarce. Methods During a 1-year surveillance study in 2010, we took serial samples from children admitted to the Emergency Unit of the Respiratory Ward of Children's Hospital 1 in Ho Chi Minh City, Vietnam. RSV was detected within 72 hours of admission to the ward in 26% (376/1439; RSV A: n = 320; RSV B: n = 54; and RSV A and B: n = 2). Among those negative in the first 72 hours after admission, 6·6% (25/377) acquired nosocomial RSV infection during hospitalization (RSV A: n = 22; and RSV B: n = 3). Results Children with nosocomial RSV infection were younger (P = 0·001) and had a longer duration of hospitalization (P < 0·001). The rate of incomplete recovery among children with nosocomial RSV infection was significantly higher than among those without (P < 0·001). Phylogenetic analysis of partial G gene sequences obtained from 79% (316/401) of positive specimens revealed the co-circulation of multiple genotypes with RSV A NA1 being predominant (A NA1: n = 275; A GA5: n = 5; B BA3: n = 3; B BA9: n = 26; and B BA10: n = 7). The RSV A GA5 and RSV B BA3 genotypes have not been reported from Vietnam, previously. Conclusion Besides emphasizing the importance of RSV as a cause of respiratory infection leading to hospitalization in young children and as a nosocomial pathogen, data from this study extend our knowledge on the genetic diversity of RSV circulating in Vietnam. PMID:25702707

  18. Self-perceived HIV risk and the use of risk reduction strategies among men who engage in transactional sex with other men in Ho Chi Minh City, Vietnam.

    Science.gov (United States)

    Mimiaga, Matthew J; Reisner, Sari L; Closson, Elizabeth F; Perry, Nicholas; Perkovich, Brandon; Nguyen, Thi; Trang, Nguyen N N; Lan, Hang X; Thien, Dinh Duc; Mayer, Kenneth H; Colby, Donn

    2013-08-01

    An emerging HIV epidemic can be seen among men who have sex with men (MSM) in Vietnam, with prevalence as high as 18%. Transactional sex represents a risk factor for HIV transmission/acquisition among MSM globally, particularly in urban contexts, but remains largely underinvestigated in Ho Chi Minh City (HCMC), Vietnam. In 2010, 23 MSM who reported exchanging sex for money in the last month completed a brief survey and semistructured qualitative interview at The Life Centre, a non-governmental organization in HCMC, to assess sociodemographics, individual- and structural-level HIV risk factors and explore acceptable future prevention interventions. Participants' mean age was 24 years. Equal proportions of respondents self-identified as heterosexual/straight, homosexual/gay, and bisexual. Participants had a mean of 158 male clients in the past year, with a median of 60 male clients in the past year (interquartile range [IQR]=70) and reported inconsistent condom use and inaccurate perceptions of HIV risk. Nearly half of the sample reported engaging in unprotected anal sex with a male partner in the past 12 months and one-third with a male client. Major themes that emerged for HIV prevention interventions with male sex workers were those that: (1) focused on individual factors (drug and alcohol use, barriers to condom use, knowledge of asymptomatic STIs, enhancement of behavioral risk-reduction skills, and addressing concomitant mental health issues); (2) incorporated interpersonal and relational contexts (led by peer educators, built interpersonal skills, attended to partner type and intimacy dynamics); and (3) considered the exogenous environments in which individual choices/relationships operate (stigma of being MSM in Vietnam, availability of alternative economic opportunities, and varied sexual venues). HIV prevention efforts are needed that address the specific needs of MSM who engage in transactional sex in HCMC. Universally, MSM endorsed HIV prevention

  19. Quality of private nursery school in ho chi minh city, Vietnam – actual state, social issues and management solutions

    Directory of Open Access Journals (Sweden)

    Le Thi Thu B.

    2014-06-01

    Full Text Available The advent and rapid development of system of educational institutions of private preschool has an important contribution in meeting the diverse needs of residents for problems in large cities about care and education of children. However, the educational institutions of private preschool has posed many problems for management education. On the basis of the actual quality of research, teaching conditions in these facilities and the associated social problems, we propose appropriates management solutions.

  20. Dissemination of Extended-Spectrum β-Lactamase- and AmpC β-Lactamase-Producing Escherichia coli within the Food Distribution System of Ho Chi Minh City, Vietnam

    OpenAIRE

    Do Phuc Nguyen; Thi Anh Dao Nguyen; Thi Hien Le; Nguyen Minh Doan Tran; Thanh Phong Ngo; Van Chinh Dang; Takao Kawai; Masashi Kanki; Ryuji Kawahara; Michio Jinnai; Shinya Yonogi; Yuji Hirai; Yoshimasa Yamamoto; Yuko Kumeda

    2016-01-01

    To investigate the dissemination of ESBL/pAmpC-producing E. coli within the food distribution system of Ho Chi Minh City (HCMC), Vietnam, the prevalence of ESBL/pAmpC-producing E. coli strains in chicken meat, pork, beef, and fish/shrimp samples obtained from slaughterhouses, a wholesale market, and supermarkets was examined. Among the total of 330 collected food samples, ESBL/pAmpC-producing E. coli was detected in 150 samples (45.5%). The highest prevalence of these isolates was in chicken ...

  1. Influences of Seasoned Equity Offerings on Stock Return of Ho Chi Minh Market

    Directory of Open Access Journals (Sweden)

    Ho Viet Tien

    2013-01-01

    Full Text Available This paper investigated the impact of seasoned equity offerings (SEO on stock return of listed companies in Ho Chi Minh City market using the method “event study” which has been basically formed by Campbell, Lo, and MacKinlay (1997. The sample includes 332 SEOs from 2007 to 2010. The main findings show evidence that the Ho Chi Minh City market was not efficient in terms of the semi-strong form because the price has increased significantly on the ex-right date, day 0. In an opposite way, the market also reacted significantly negatively from T-4 to T-2. There are some significant impacts of timing on issue methods – equity right issues were in priority for favorable time and issues as “dividend by stocks” were chosen during unfavorable time.

  2. Effects of short-term exposure to air pollution on hospital admissions of young children for acute lower respiratory infections in Ho Chi Minh City, Vietnam.

    Science.gov (United States)

    Le, Truong Giang; Ngo, Long; Mehta, Sumi; Do, Van Dzung; Thach, T Q; Vu, Xuan Dan; Nguyen, Dinh Tuan; Cohen, Aaron

    2012-06-01

    There is emerging evidence, largely from studies in Europe and North America, that economic deprivation increases the magnitude of morbidity and mortality related to air pollution. Two major reasons why this may be true are that the poor experience higher levels of exposure to air pollution, and they are more vulnerable to its effects--in other words, due to poorer nutrition, less access to medical care, and other factors, they experience more health impact per unit of exposure. The relations among health, air pollution, and poverty are likely to have important implications for public health and social policy, especially in areas such as the developing countries of Asia where air pollution levels are high and many live in poverty. The aims of this study were to estimate the effect of exposure to air pollution on hospital admissions of young children for acute lower respiratory infection (ALRI*) and to explore whether such effects differed between poor children and other children. ALRI, which comprises pneumonia and bronchiolitis, is the largest single cause of mortality among young children worldwide and is responsible for a substantial burden of disease among young children in developing countries. To the best of our knowledge, this is the first study of the health effects of air pollution in Ho Chi Minh City (HCMC), Vietnam. For these reasons, the results of this study have the potential to make an important contribution to the growing literature on the health effects of air pollution in Asia. The study focused on the short-term effects of daily average exposure to air pollutants on hospital admissions of children less than 5 years of age for ALRI, defined as pneumonia or bronchiolitis, in HCMC during 2003, 2004, and 2005. Admissions data were obtained from computerized records of Children's Hospital 1 and Children's Hospital 2 (CH1 and CH2) in HCMC. Nearly all children hospitalized for respiratory illnesses in the city are admitted to one of these two pediatric

  3. Studying The Contamination Status And The Sources Of Nitrogen Compounds In Groundwater In Ho Chi Minh City Area Using The Isotope Hydrology Techniques

    International Nuclear Information System (INIS)

    The obtained data on nitrate, ammonium and total nitrogen concentration of 100 groundwater samples collected from 3 main aquifers show that although the nitrate concentration is still lower than the authorized limit of this compound in groundwater but the concentration and, specially the distribution of nitrate in shallow aquifer (Pleistocene) shows the increasing tendency in pollution level while ammonium and also total nitrogen content exceeded the authorized limit of these compounds in groundwater. For deeper aquifers (Upper and Lower Pliocene) groundwater is less polluted by nitrogen compounds. Analysis data on isotopic composition δ15N and δ18O of nitrate of the collected groundwater samples in compiling with other environmental isotopes data as δ2H, δ18O of water and natural radioactive isotopes in groundwater (3H and 14C) show that nitrate in Pleistocene groundwater is derived from both sources, geogenic source such as organic matter buried in aquifer soil layers and anthropogenic source like fertilizers, manure and septic wastes with the dominance of anthropogenic source. At the same time, obtained isotopic data proved the geogenic source of nitrate in water of the deeper aquifers. Study results on infiltration rate and infiltration depth of fertilizers and water using tracer techniques in the zone specializing in legume cultivation of the study area show the possible infiltration into shallow groundwater of water and also fertilizers. The obtained results prove the need of better management of the use of fertilizers for cultivation activities in the study area and to apply the advanced cultural manners for minimizing amount of fertilizers used. At the same time to strengthen wastes management and treatment in whole study area, especially in the zones which intake rain water as a recharge source to shallow groundwater such as Cu Chi, Hoc Mon and also inner city districts. (author)

  4. Personal exposure to benzene of selected population groups and impact of commuting modes in Ho Chi Minh, Vietnam.

    Science.gov (United States)

    Lan, Tran Thi Ngoc; Liem, Ngo Quang; Binh, Nguyen Thi Thanh

    2013-04-01

    Personal exposure to benzene of selected population groups, and impacts of traffic on commuters in Ho Chi Minh City were investigated. The study was carried out in June, July and November 2010. The preliminary data showed that on average, personal exposure to benzene for non-occupational people in Ho Chi Minh is ~18 μg/m(3) and most of the exposure is due to commuting. Benzene exposure during travelling by bus, taxi and motorcycle is, respectively, 22-30, 22-39 and 185-240 μg/m(3). Motorcycle-taxi drivers, petrol filling employees and street vendors suffer high daily exposures at 116, 52, 32 μg/m(3), respectively. Further measurements are needed for a better risk assessment and finding effective measures to reduce exposure. PMID:23334286

  5. Dissemination of Extended-Spectrum β-Lactamase- and AmpC β-Lactamase-Producing Escherichia coli within the Food Distribution System of Ho Chi Minh City, Vietnam

    Science.gov (United States)

    Nguyen, Do Phuc; Nguyen, Thi Anh Dao; Le, Thi Hien; Tran, Nguyen Minh Doan; Ngo, Thanh Phong; Dang, Van Chinh; Kawai, Takao; Kanki, Masashi; Kawahara, Ryuji; Jinnai, Michio; Yonogi, Shinya; Hirai, Yuji; Yamamoto, Yoshimasa; Kumeda, Yuko

    2016-01-01

    To investigate the dissemination of ESBL/pAmpC-producing E. coli within the food distribution system of Ho Chi Minh City (HCMC), Vietnam, the prevalence of ESBL/pAmpC-producing E. coli strains in chicken meat, pork, beef, and fish/shrimp samples obtained from slaughterhouses, a wholesale market, and supermarkets was examined. Among the total of 330 collected food samples, ESBL/pAmpC-producing E. coli was detected in 150 samples (45.5%). The highest prevalence of these isolates was in chicken meat (76/82, 92.7%), followed by pork (32/92, 34.8%), beef (18/74, 34.3%), and fish/shrimp (24/82, 29.3%). A total of 342 strains of ESBL/pAmpC-producing E. coli were isolated from 150 positive food samples. The most prevalent genes responsible for ESBL or pAmpC activity belonged to the CTX-M-9 (110/342, 31.2%), CTX-M-1 (102/342, 29.8%), and CIT (118/342, 34.5%) groups. To our knowledge, this is the first report of the high occurrence of pAmpC (37.1%) in animal-based food in Vietnam. Among the 342 total ESBL/pAmpC-producing E. coli isolates, 276 (80.7%) were resistant to at least 6 antibiotic agents. Notably, high percentages of resistance to ciprofloxacin and fosfomycin were found in isolates from chicken (80.5% and 50.8%, resp.). These findings demonstrate that animal-based food products in HCMC represent a major reservoir of ESBL/pAmpC-producing E. coli. PMID:26989692

  6. Dissemination of Extended-Spectrum β-Lactamase- and AmpC β-Lactamase-Producing Escherichia coli within the Food Distribution System of Ho Chi Minh City, Vietnam

    Directory of Open Access Journals (Sweden)

    Do Phuc Nguyen

    2016-01-01

    Full Text Available To investigate the dissemination of ESBL/pAmpC-producing E. coli within the food distribution system of Ho Chi Minh City (HCMC, Vietnam, the prevalence of ESBL/pAmpC-producing E. coli strains in chicken meat, pork, beef, and fish/shrimp samples obtained from slaughterhouses, a wholesale market, and supermarkets was examined. Among the total of 330 collected food samples, ESBL/pAmpC-producing E. coli was detected in 150 samples (45.5%. The highest prevalence of these isolates was in chicken meat (76/82, 92.7%, followed by pork (32/92, 34.8%, beef (18/74, 34.3%, and fish/shrimp (24/82, 29.3%. A total of 342 strains of ESBL/pAmpC-producing E. coli were isolated from 150 positive food samples. The most prevalent genes responsible for ESBL or pAmpC activity belonged to the CTX-M-9 (110/342, 31.2%, CTX-M-1 (102/342, 29.8%, and CIT (118/342, 34.5% groups. To our knowledge, this is the first report of the high occurrence of pAmpC (37.1% in animal-based food in Vietnam. Among the 342 total ESBL/pAmpC-producing E. coli isolates, 276 (80.7% were resistant to at least 6 antibiotic agents. Notably, high percentages of resistance to ciprofloxacin and fosfomycin were found in isolates from chicken (80.5% and 50.8%, resp.. These findings demonstrate that animal-based food products in HCMC represent a major reservoir of ESBL/pAmpC-producing E. coli.

  7. Dissemination of Extended-Spectrum β-Lactamase- and AmpC β-Lactamase-Producing Escherichia coli within the Food Distribution System of Ho Chi Minh City, Vietnam.

    Science.gov (United States)

    Nguyen, Do Phuc; Nguyen, Thi Anh Dao; Le, Thi Hien; Tran, Nguyen Minh Doan; Ngo, Thanh Phong; Dang, Van Chinh; Kawai, Takao; Kanki, Masashi; Kawahara, Ryuji; Jinnai, Michio; Yonogi, Shinya; Hirai, Yuji; Yamamoto, Yoshimasa; Kumeda, Yuko

    2016-01-01

    To investigate the dissemination of ESBL/pAmpC-producing E. coli within the food distribution system of Ho Chi Minh City (HCMC), Vietnam, the prevalence of ESBL/pAmpC-producing E. coli strains in chicken meat, pork, beef, and fish/shrimp samples obtained from slaughterhouses, a wholesale market, and supermarkets was examined. Among the total of 330 collected food samples, ESBL/pAmpC-producing E. coli was detected in 150 samples (45.5%). The highest prevalence of these isolates was in chicken meat (76/82, 92.7%), followed by pork (32/92, 34.8%), beef (18/74, 34.3%), and fish/shrimp (24/82, 29.3%). A total of 342 strains of ESBL/pAmpC-producing E. coli were isolated from 150 positive food samples. The most prevalent genes responsible for ESBL or pAmpC activity belonged to the CTX-M-9 (110/342, 31.2%), CTX-M-1 (102/342, 29.8%), and CIT (118/342, 34.5%) groups. To our knowledge, this is the first report of the high occurrence of pAmpC (37.1%) in animal-based food in Vietnam. Among the 342 total ESBL/pAmpC-producing E. coli isolates, 276 (80.7%) were resistant to at least 6 antibiotic agents. Notably, high percentages of resistance to ciprofloxacin and fosfomycin were found in isolates from chicken (80.5% and 50.8%, resp.). These findings demonstrate that animal-based food products in HCMC represent a major reservoir of ESBL/pAmpC-producing E. coli. PMID:26989692

  8. Production porcine dans les fermes d'Etat à Ho-Chi-Minh Ville/Viet-nam

    Directory of Open Access Journals (Sweden)

    Franceschetto, ML.

    1983-01-01

    Full Text Available Pig production in State farms at Ho-Chi-Minh Ville. Vietnam. An inquiry carried out in Guinea has revealed that the disappearance of trypanotolerance within some local N'Dama cattle can not be attributed to the vaccination campaign initiated against infectious bovine pleuropneumonia but to diverse environmental and animal management factors prevalant in these areas.

  9. Métropolisation, habitat précaire et relogement forcé: entre phénomènes d'exclusion et tactiques populaires d'intégration: le cas du canal Nhieu Loc-Thi Nghe à Ho Chi Minh-Ville, Vietnam

    OpenAIRE

    Wust, Sébastien

    2001-01-01

    This work was carried out within the interdisciplinary scientific program named "Sustainable Development, Metropolisation and Pollution of Natural Resources in Ho Chi Minh-City, Vietnam". This program, launched in 1994, is financed by the Swiss National Science Foundation (Priority Program Environment, Module 7 "Environment and development"). The main goal of this thesis is to grasp the social, economic and spatial dimensions at stake of involuntary ...

  10. Fatal Wound Infection Caused by Chromobacterium violaceum in Ho Chi Minh City, Vietnam▿

    OpenAIRE

    Baker, Stephen; Campbell, James I.; Stabler, Richard; Nguyen, Hoang V. M.; To, Diep S.; Dung V. Nguyen; Farrar, Jeremy

    2008-01-01

    Chromobacterium violaceum is a proteobacterium found in soil and water in tropical regions which rarely causes infection in humans. Here, we report a fatal bacteremia caused by Chromobacterium violaceum in Vietnam. We describe a number of clinical, microbiological, and molecular aspects associated with this bacterial infection.

  11. Young Sex-Workers in Ho Chi Minh City Telling Their Life Stories

    Science.gov (United States)

    Rubenson, Birgitta; Hanh, Le Thi; Hojer, Bengt; Johansson, Eva

    2005-01-01

    In this study the life stories of 22 sex-workers (age 15-18 years) in Vietnam are organized into three thematic narratives depicting how the girls presented their lives. Poverty, lack of job alternatives and the responsibility to share in the support of their families led the girls into prostitution. Strong family ties gave many girls…

  12. Linking watershed protection and water consumption: WTP by domestic water users in Ho Chi Minh City

    OpenAIRE

    Ha, Dang Thanh

    2008-01-01

    In many watersheds of Asia, the demand for water is increasing while the supply of water is challenging due to on-going deforestation and watershed degradation. To ensure a stable supply of water for satisfying this growing demand, the protection of watershed is critical. Vietnam also faces similar situation, particularly in the Dong Nai watershed where high population growth, rapid industrialization, agricultural production, and economic growth are putting tremendous pressure on this watersh...

  13. Genetic and antigenic characterization of enterovirus 71 in Ho Chi Minh City, Vietnam, 2011.

    Directory of Open Access Journals (Sweden)

    Le Phan Kim Thoa

    Full Text Available Enterovirus 71 (EV71 frequently causes fatal infections in young children in Asia. In 2011, EV71 epidemics occurred in southern Vietnam. We conducted genetic and antigenic analysis of the EV71 isolates and found that 94% of them were genotype C4a related to two lineages circulating in China and 6% were genotype C5 which have circulated in Vietnam since 2003. Antigenic variants were not detected. EV71 vaccines are being developed. Longitudinal enterovirus surveillance data are critical to formulate vaccination policy in Vietnam.

  14. Report of the Fifth AREB Meeting Ho Chi Minh City, Vietnam, 17-20 November 2008.

    Science.gov (United States)

    Dodet, B

    2009-04-21

    The fifth annual Asian Rabies Expert Bureau (AREB) meeting, held in Vietnam, addressed how to increase rabies awareness and to improve rabies prevention and control. Active participation of Ministries of Health and Education was identified as crucial for the success of rabies programs, and World Rabies Day was considered as one of the best opportunities to increase rabies awareness. AREB strongly recommend implementation of pre-exposure prophylaxis for children living in rabies endemic areas. A review of national and international guidelines concerning rabies prophylaxis and their application in the Asian situation showed that some issues require further evaluation or clarification. PMID:19368779

  15. Positioning the Häagen-Dazs Ice cream Franchise in Ho Chi Minh City for selected target markets

    OpenAIRE

    Kieu, Nhung

    2012-01-01

    Vietnam in recent years, with stable growth rates and a dynamic population, has shown great potential for foreign investments, encouraging entry of in-ternational brands, especially in the Food and Beverage sectors through franchising methods. International Lifestyle JSC, a Food and Beverage managing company, has realized the market’s attractiveness and decided to bring Häagen-Dazs, a well-known ice cream brand from America into the market. In order to attain customers, compete with existing ...

  16. Measles Epidemics Among Children in Vietnam: Genomic Characterization of Virus Responsible for Measles Outbreak in Ho Chi Minh City, 2014

    Directory of Open Access Journals (Sweden)

    Van H. Pham

    2014-12-01

    Conclusions: Measles viruses responsible for outbreaks in Southern Vietnam belonged to a genotype D8 variant group which had unique amino acid sequences in the N gene. Our report provides important genomic information about the virus for measles elimination in Southeast Asia.

  17. SANitation CHoice Involving Stakeholders : a participatory multi-criteria method for drainage and sanitation system selection in developing cities applied in Ho Chi Minh City, Vietnam

    NARCIS (Netherlands)

    Buuren, van J.C.L.

    2010-01-01

    Keywords: sanitation; drainage; planning; multi-criteria decision analysis; stakeholder dialogues, developing countries The poor living in slums and other unplanned urban areas in developing countries have no access to adequate drainage and sanitation provisions with grave consequences to their he

  18. SANitation CHoice Involving Stakeholders : a participatory multi-criteria method for drainage and sanitation system selection in developing cities applied in Ho Chi Minh City, Vietnam

    OpenAIRE

    Buuren, van, S.

    2010-01-01

    Keywords: sanitation; drainage; planning; multi-criteria decision analysis; stakeholder dialogues, developing countries The poor living in slums and other unplanned urban areas in developing countries have no access to adequate drainage and sanitation provisions with grave consequences to their health and living conditions. This thesis takes an analysis of the causes and consequences of that provision deficit as point of departure and seeks more effective mechanisms for inclusive and environm...

  19. From Understanding and Absorption to Practice: Ho Chi Minh and Sun Yat-sen' s New Three People' s Principles%从认识、吸收到践行:胡志明与孙中山的新三民主义

    Institute of Scientific and Technical Information of China (English)

    张皓; 黎德黄[越南

    2012-01-01

    The main theoretical source of Ho Chi Minh Thought is Marxism-Leninism, supplemented by Sun Yatsen' s new Three People' s Principles. Ho Chi Minh' s understanding of the new Three People' s Principles experienced a process of gradual deepening and sublimation : treating it as "a program of reform" before November 1924 and then summarizing it as the three principles of national independence, civil liberties and public well-being and taking this as the program of Vietnamese democratic revolution. Before 1927, Ho Chi Minh' s studies on the new Three People's Principles focused on the theoretical level and then, from 1927 to 1945, he applied it to the revolutionary movement for national liberation in Vietnam. Furthermore, he developed it into the Three Peo- ple' s Principles with Vietnamese national characteristics, namely, national independence, freedom of the people and improving people' s lives, with national independence being the core. Following the August Revolution in 1945, he applied these three principles in the national Program to strive for national reunification of Vietnam, expand civil rights and improve people' s livelihood. With dramatic changes in the Vietnamese history, Ho Chi Minh shifted his studies on and absorptions from foreign theories gradually from Sun Yat-sen' s new Three People' s Principles to Mao Zedong Thought.%胡志明思想的理论来源主要是马列主义,孙中山的新三民主义是其重要补充。胡志明对新三民主义的认识有一个逐渐升华和提高的过程。1924年11月前,他认为新三民主义是“一个改革的纲领”,之后把新三民主义概括为民族独立、民权自由、民生幸福三个原则,并以此作为越南的民主革命纲领。1927年前,他对新三民主义的研究主要集中于理论层面。1927年至1945年间,他将新三民主义运用到越南民族解放革命运动中,并发展成为具有越南民族特点的三民主义,

  20. How deep was the impact of the economic crisis in Vietnam ? A focus on the informal sector in Hanoi and Ho Chi Minh City

    OpenAIRE

    Cling, Jean-Pierre; Hữu Chí, Nguyen; Razafindrakoto, Mireille; Roubaud, François

    2010-01-01

    Vietnam is one of the only South East Asian emerging economies not to have gone into recession in 2009 in the wake of the world crisis. Nonetheless, it has been affected deeply by the crisis, as shown by all macro-economic indicators. The yearly growth rate of Gross Domestic Product (GDP) has been slowing down from 8.5 percent in 2007 to 6.3 percent in 2008 then 5.3 percent in 2009, before recovering to 6.5 percent in 2010. Overall, because of productivity gains and rapid growth of the labour...

  1. Factors influencing the results of tissue and organ donation: a survey from Cho Ray hospital Mortuary in Ho Chi Minh City, Vietnam

    International Nuclear Information System (INIS)

    The study was carried out on next-of-kins of the deceased one to identify factors affecting the final results of organ donation. Among 225 interviewers (67.1% men), 80 people (35.6%) would be willing to give consent for donation of their relative's tissue and organ. When faced with the beloved death, only 8 cases were procured in reality. The obstacles that limited the organ procurement are due to: consent with some conditions (26/80); not the right relative available to make consent (25/80); initial consent subsequently withdrawn (12/80); exclusion criteria by Tissue Bank (7/80) and interview too late (2/80). There were 62.2% of respondents heard about tissue and organ transplantation, but only 50.3% were aware of transplantation operations possible in Viet Nam. Awareness of transplantation and donation revealed the statistically significant association with the consent for organ donation. It is important that these all such factors need to be considered in their cultural, ethical, religious and legislative environment

  2. Can I afford free treatment?: Perceived consequences of health care provider choices among people with tuberculosis in Ho Chi Minh City, Vietnam.

    Science.gov (United States)

    Lönnroth, K; Tran, T U; Thuong, L M; Quy, H T; Diwan, V

    2001-03-01

    Vietnam has a well-organised National TB Control Programme (NTP) with outstanding treatment results. Excellent prospect of cure is provided free of charge. Still, some people prefer to pay for their TB treatment themselves in private clinics. This is a potential threat to TB control since no notification of cases treated in the private sector occurs, and there is no control of the effectiveness of treatment provided in private clinics. Using a qualitative approach within a grounded theory framework, this study explores health-seeking behaviour among people with TB, applying a specific focus on reasons for choices of private versus pubic health care providers. The study identifies a number of characteristics of private TB care, which both seem attractive to patients and at the same time contrast sharply with the structure of the NTP strategy. These include flexible diagnostic procedures, no administrative procedures to establish eligibility for treatment, flexible choices of drug regimens, non-supervised treatment (no DOT), no tracing of defaulters in the household, no official registration of TB cases and thus less threat to personal integrity. A possibility to demand individualised service through the use of fee-for-service payments directly to physicians also seems attractive to many patients. A number of the components of the NTP strategy that have been put in place in order to secure optimal public health outcomes are lacking in the private sector. A dilemma for TB control is that this seems to be an important reason for why many people with TB opt for private providers where quality of care is virtually uncontrolled. The global threat of TB has led to calls for forceful measures to control TB. However, based on the findings in this study it is argued that the use of rigid approaches to TB control that do not encompass a strong component of responsiveness towards the needs of individuals may be counterproductive for public health. PMID:11234866

  3. Sinking coastal cities

    Science.gov (United States)

    Erkens, G.; Bucx, T.; Dam, R.; de Lange, G.; Lambert, J.

    2015-11-01

    In many coastal and delta cities land subsidence now exceeds absolute sea level rise up to a factor of ten. A major cause for severe land subsidence is excessive groundwater extraction related to rapid urbanization and population growth. Without action, parts of Jakarta, Ho Chi Minh City, Bangkok and numerous other coastal cities will sink below sea level. Land subsidence increases flood vulnerability (frequency, inundation depth and duration of floods), with floods causing major economic damage and loss of lives. In addition, differential land movement causes significant economic losses in the form of structural damage and high maintenance costs for (infra)structure. The total damage worldwide is estimated at billions of dollars annually. As subsidence is often spatially variable and can be caused by multiple processes, an assessment of subsidence in delta cities needs to answer questions such as: what are the main causes? What is the current subsidence rate and what are future scenarios (and interaction with other major environmental issues)? Where are the vulnerable areas? What are the impacts and risks? How can adverse impacts be mitigated or compensated for? Who is involved and responsible to act? In this study a quick-assessment of subsidence is performed on the following mega-cities: Jakarta, Ho Chi Minh City, Dhaka, New Orleans and Bangkok. Results of these case studies will be presented and compared, and a (generic) approach how to deal with subsidence in current and future subsidence-prone areas is provided.

  4. Trinh T. Minh-ha

    DEFF Research Database (Denmark)

    Nelund, Sidsel; Trinh T, Minh-ha

    2012-01-01

    documentary or fictional stage of her films. 
Trinh T. Minh-ha’s early films, Reassemblage (1982) and Naked Spaces - Living is Round (1985) questioned the ethnographic eye in representing reality, whereas the later Surname Viet Given Name Nam (1989) challenged the genre of documentary, while exposing the...

  5. 对胡志明市和越南南部地区结核病的认识%Tuberculosis Awareness Campaign for Ho Chi Minh City &Southern Region of Vietnam

    Institute of Scientific and Technical Information of China (English)

    Warren Jones

    2002-01-01

    @@ Objective To assess the effectiveness of a public education campaign for tuberculosis awareness raising in the general community, in respect of case detection rates and public awareness of the disease. To explore possible interventions in other countries in the region.

  6. Qinghai Jiading Ferroalloy Group Co., Ltd. Founded in Minhe

    Institute of Scientific and Technical Information of China (English)

    2013-01-01

    <正>Recently,Qinghai Jiading Ferroalloy Group Co.,Ltd.was founded in Minhe County by private enterprises including Tianli Silicon Co.,Ltd.and Xinyu Silicon Co.,Ltd.,which symbolizes a substantial step of the county’s ferroalloy industry in integration of resources,promoting enterprises’independent innovation ability and competitiveness,as well as in sustainable development.

  7. The determinants of household energy-saving behavior: Survey and comparison in five major Asian cities

    International Nuclear Information System (INIS)

    It is difficult to control household energy consumption through regulation. From a policy standpoint, it is particularly challenging to identify the factors that influence people’s actions. Moreover, whatever these factors are, they are unlikely to uniformly span multiple cities in the Asian region. In this paper, we conduct a survey of energy-saving behavior to clarify the differences among such factors across five major Asian cities. The results from these surveys in Dalian, Chongqing, Fukuoka, Bangkok, and Ho Chi Minh indicate that global warming consciousness, environmental behavior, and social interaction significantly affect energy-saving behavior. Income and age also had weak positive effects on energy-saving behaviors. Social interaction was strongly linked to energy-saving behaviors, particularly in the rural areas of Dalian and Chongqing. This result indicates that community-based activities impact energy-saving behaviors. - Highlights: ► We conduct a survey of energy saving behavior in household in major Asian cities. ► We identify the factors that influence people's actions. ► Global warming consciousness and social interaction affect people behavior. ► This indicates community-based activities impact energy-saving behaviors in Asia.

  8. Use of a chiA probe for detection of chitinase genes in bacteria from the Chesapeake Bay

    Digital Repository Service at National Institute of Oceanography (India)

    Ramaiah, N.; Hill, R.T.; Chun, J.; Ravel, J.; Matte, M.H.; Straube, W.L.; Colwell, R.R.

    from several distantly re- lated bacteria facilitated selection of highly conserved re- gions of the chiA gene for design of PCR primers expected to have broad speci¢city for detection of chiA in a wide range of bacteria. Our aims were to construct a...,34]. In the present study, chiA gene-speci¢c PCR primers and a chiA gene probe were developed and their speci¢city veri¢ed using a large assemblage of reference strains. The chiA frag- ments ampli¢ed by PCR from representative strains were sequenced to con...

  9. CHY formula and MHV amplitudes

    CERN Document Server

    Du, Yi-jian; Wu, Yong-shi

    2016-01-01

    In this paper, we study the relation between the Cachazo-He-Yuan (CHY) formula and the maximal-helicity-violating (MHV) amplitudes of Yang-Mills and gravity in four dimensions. We prove that only one special rational solution of the scattering equations found by Weinzierl support the MHV amplitudes. Namely, localized at this solution, the integrated CHY formula reproduces the Parke-Taylor formula for Yang-Mills amplitudes as well as the Hodges formula for gravitational amplitudes. This is achieved by developing techniques, in a manifestly M\\"obius covariant formalism, to explicitly compute relevant reduced Pfaffians/determinants. We observe and prove two interesting properties (or identities), which facilitate the computations. We also check that all the other $(n-3)!-1$ solutions to the scattering equations do not support the MHV amplitudes, and prove analytically that this is indeed true for the other special rational solution proposed by Weinzierl, that actually supports the anti-MHV amplitudes.

  10. The CHI 2013 interactive schedule

    DEFF Research Database (Denmark)

    Satyanarayan, Arvind; Strazzulla, Daniel; Klokmose, Clemens Nylandsted;

    2013-01-01

    available. The CHI'13 Interactive Schedule helps attendees navigate this wealth of video content in order to identify events they would like to attend. It consists of a number of large display screens throughout the conference venue which cycle through a video playlist of events. Attendees can interact with...... these displays using their mobile devices by either constructing custom video playlists or adding on-screen content to their personal schedule....

  11. CHY formula and MHV amplitudes

    Science.gov (United States)

    Du, Yi-Jian; Teng, Fei; Wu, Yong-Shi

    2016-05-01

    In this paper, we study the relation between the Cachazo-He-Yuan (CHY) formula and the maximal-helicity-violating (MHV) amplitudes of Yang-Mills and gravity in four dimensions. We prove that only one special rational solution of the scattering equations found by Weinzierl supports the MHV amplitudes. Namely, localized at this solution, the integrated CHY formula produces the Parke-Taylor formula for MHV Yang-Mills amplitudes as well as the Hodges formula for MHV gravitational amplitudes, with an arbitrary number of external gluons/gravitons. This is achieved by developing techniques, in a manifestly Möbius covariant formalism, to explicitly compute relevant reduced Pfaffians/determinants. We observe and prove two interesting properties (or identities), which facilitate the computations. We also check that all the other ( n - 3)! - 1 solutions to the scattering equations do not support the MHV amplitudes, and prove analytically that this is indeed true for the other special rational solution proposed by Weinzierl, that actually supports the anti-MHV amplitudes. Our results reveal a mysterious feature of the CHY formalism that in Yang-Mills and gravity theory, solutions of scattering equations, involving only external momenta, somehow know about the configuration of external polarizations of the scattering amplitudes.

  12. Comparative Analysis of Passenger Traffic Fleets in Asian Cities: Technology, Driving Activities, and Emission

    Science.gov (United States)

    KIM Oanh, N. T.; Huynh, H. V.; Saikawa, E.

    2015-12-01

    The road transport sector is the major emission source of toxic air pollutants and greenhouse gases (GHGs) in large Asian cities. This paper comparatively analyzed on-road passenger traffic fleets (cars, buses, taxis, motorcycles), using local data collected in cities of Bangkok (BKK), Kathmandu, Hanoi, Ho Chi Minh City (HCMC), and Yangon. Surveys were done in 2010-2014 to obtain information on vehicle technology, driving activities (speed, distance, number, and types of starts), traffic density, and fuel characteristics. Large shares of pre-Euro vehicles were still observed, especially for public buses. The most advanced technology was Euro4, which was observed in small shares (traffic jams. Natural gas and LPG had considerable shares in BKK and Yangon while for other cities diesel and gasoline were still the two major fuels used in transportation. Running emission factors (EF) of buses and taxis in Kathmandu were considerably higher than other cities due to its hilly topography, low speeds, high mileage, and less advanced vehicle technologies. The number of passenger vehicles per 1000 people were 400-500 in HCMC and Hanoi (mainly by MC) and in BKK (also by cars), moderate in Kathmandu (200) and the lowest in Yangon (40) because of the MC ban. Annual emissions of the passenger fleets were calculated for each city using the International Vehicle Emission (IVE) for 14 species. BC and OC emissions were estimated using their fractions of PM10 emission. Annual emission per capita of toxic air pollutants and GHGs was analyzed. For example, the emission in kg/year/person for CO, VOC, NOx and PM10 in these cities was 24-150 for CO, 0.9-23 for VOC, 2.1-8.2 for NOx and 0.2-1.1 for PM10. The highest per capita emissions of CO and VOC were found for HCMC and the lowest for Yangon, which showed the influence of MC fleet. The per capita emission of Kathmandu was ranked second among the cities. Our results were also analyzed in comparison with the per capita emission estimated

  13. Tai Chi: Rx for Arthritic Knees

    Science.gov (United States)

    ... that tai chi can be effective in helping sleep, while reducing stress, anxiety and depression. "The mind component [of tai chi] promotes psychological well-being, life satisfaction, and improved perceptions of health," said Wang. Dr. Matthew Hepinstall, an ...

  14. Biomedical wellness by tai chi and sports

    Science.gov (United States)

    Chin, Daniel C.; Chin, Amita G.

    2011-06-01

    Tai-chi chuan is popular worldwide especially in China. People practice tai-chi chuan daily with faith believing that they will be rewarded with health and varieties of other rewords. The Tai Chi Chuan Theory by Master Chang and the Tai Chi Chuan Theory by Master Wang are translated to be the baseline of the tai-chi chuan. The theory described in these two papers clearly shows that the tai-chi power source is the combination of the two antigravity forces distinction by each foot. The ying, yang and hollowed, solid discussed in the papers are the properties and body relationship of the two antigravity forces. The antigravity forces presented inside of body are as air to the balloon termed chi. However chi could be generated by any muscle pressing; only the antigravity forces from feet are called nature chi that has the maximum strength of the person. When a person is soft, as an infant the nature chi will fulfill entire body with no time and effort. The sequence forms were designed for deploying the nature chi in speed and power. The combination of chi and tai-chi form make tai chi chuan supreme than other kinds of martial art. In the training process chi massages whole body many time for a sequence form practice that stimulate all organs and could lead to cure body diseases, lose weight, postpone aging process, and remove the aging symptoms. For the people practicing in the park daily with proper guidance they will fulfill their wishes. Tai chi exercise could also apply to other sports as in dancing and golfing they are discussed at the end of the paper.

  15. Chi-Chi, Taiwan Earthquake, September 21, 1999

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — On September 21, 1999, at 1:47 AM local time, a magnitude MW 7.6 earthquake was felt throughout the island of Taiwan. A five county area, including the city of...

  16. An Assessment of Tai Chi Exercise on Cognitive Ability in Older Adults

    Directory of Open Access Journals (Sweden)

    Hung Manh NGUYEN

    2015-09-01

    Full Text Available The purpose of this study was to evaluate the effects of Tai Chi exercise on cognitive performance of community - dwelling elderly in Vinh city, Vietnam. It is a controlled trial. One hundred subjected were recruited. Subjects were divided randomly into two groups. Tai Chi group was assigned 6 - months Tai Chi training. Control group was instructed to maintain their routine daily activities. Participants in Tai Chi group reported significant improvement cognitive ability, part A with F(1, 68 = 75.36, p < .001, and in part B with F(1, 68= 172.83, p < .001 in comparison with Control group. Tai Chi is beneficial to improve cognitive performance of the elderly.

  17. Chi activity during transduction-associated recombination.

    OpenAIRE

    Dower, N. A.; Stahl, F. W.

    1981-01-01

    Chi is a genetic element that stimulates phage lambda recombination by the Escherichia coli recBC pathway during lytic infection [Stahl, F. W. (1979) Annu. Rev. Genet. 13, 7--24]. Herein we show that chi in lambda prophage influences exchange distribution in P1 phage-mediated transduction and in conjugation. This demonstration encourages the view that chi may influence genetic exchange in E. coli in the total absence of lambda.

  18. Tai Chi philosophy and nursing epistemology.

    Science.gov (United States)

    Alperson, Sunny Yim

    2008-01-01

    This article analyzes the philosophy underpinning Tai Chi practice in light of nursing epistemology. The first half of the article reviews the general characteristics of major Chinese philosophical traditions that have been merged in Tai Chi: Confucianism, Daoism, and Buddhism. In the second half, themes of integration and praxis in Tai Chi are linked with Carper's fundamental patterns of knowing in nursing. Tai Chi is a practical fusion of humanistic philosophy with an experiential dimension of movement in a nondualistic foundation. The author argues that TC philosophy can be applied to integrated knowledge development and nursing praxis. PMID:20531257

  19. Healing of subsurface damage after the 1999 Chi-Chi earthquake

    Science.gov (United States)

    Chen, K. H.; Rau, R.; Dreger, D. S.

    2009-12-01

    Observation of six M 4.6 repeating earthquakes in eastern Taiwan from 1991 to 2007 reveals a unique temporal and spatial variation in seismic wave character associated with the 1999 Mw 7.6 Chi-Chi earthquakes that occurred ~90 km away. Post-Chi-Chi events have reduced waveform similarity, suggesting a sudden change of seismic wave propagation properties after the Chi-Chi event. The changes in seismic character are widely distributed over Taiwan and remain significant in 5 years after Chi-Chi. Since 2004, the waveform similarity gradually recovered to the pre-Chi-Chi level. The most recent repeating event occurred on 15 November 2007 reveals only a subtle variation in seismic character compared to the pre-Chi-Chi event. This indicates that the damaged rock has been regaining the strength with time. The healing of subsurface damage zone, however, is not fully complete even 8 yr after the Chi-Chi earthquake. Using cross correlation function derived time-lag between the pre- and post- Chi-Chi events, we also identify a ~1 sec delay for the 2001 repeating event at a number of stations. Such a large delay shown in different parts of seismograms for different stations may indicate a broad range of fluid-filled scatterers along the travel path. For the station with the longest distance from the M 4.6 event (~200 km), PNG station on Penghu island off the western coast of Taiwan, the 1sec delay appears on early P wave coda. This suggests that the scatterers are likely located down to a depth of at least 20 km.

  20. CHI: A General Agent Communication Framework

    Energy Technology Data Exchange (ETDEWEB)

    Goldsmith, S.Y.; Phillips, L.R.; Spires, S.V.

    1998-12-17

    We have completed and exercised a communication framework called CHI (CLOS to HTML Interface) by which agents can communicate with humans. CHI follows HTTP (HyperText Transfer Protocol) and produces HTML (HyperText Markup Language) for use by WWW (World-Wide Web) browsers. CHI enables the rapid and dynamic construction of interface mechanisms. The essence of CHI is automatic registration of dynamically generated interface elements to named objects in the agent's internal environment. The agent can access information in these objects at will. State is preserved, so an agent can pursue branching interaction sequences, activate failure recovery behaviors, and otherwise act opportunistically to maintain a conversation. The CHI mechanism remains transparent in multi-agent, multi-user environments because of automatically generated unique identifiers built into the CHI mechanism. In this paper we discuss design, language, implementation, and extension issues, and, by way of illustration, examine the use of the general CHI/HCHI mechanism in a specific international electronic commerce system. We conclude that the CHI mechanism is an effective, efficient, and extensible means of the agent/human communication.

  1. Chi-Nu Level 2 Review

    Energy Technology Data Exchange (ETDEWEB)

    Haight, Robert Cameron [Los Alamos National Laboratory; Lee, Hye Young [Los Alamos National Laboratory; Mosby, Shea Morgan [Los Alamos National Laboratory; O' Donnell, John M. [Los Alamos National Laboratory; Solomon, Clell Jeffrey Jr. [Los Alamos National Laboratory; Taddeucci, Terry Nicholas [Los Alamos National Laboratory; Fotiadis, Nikolaos [Los Alamos National Laboratory; Devlin, Matthew James [Los Alamos National Laboratory; Ullmann, John Leonard [Los Alamos National Laboratory; Bredeweg, Todd Allen [Los Alamos National Laboratory; Jandel, Marian [Los Alamos National Laboratory; Nelson, Ronald Owen [Los Alamos National Laboratory; Wender, Stephen Arthur [Los Alamos National Laboratory; Neudecker, Denise [Los Alamos National Laboratory; Rising, Michael Evan [Los Alamos National Laboratory; White, Morgan Curtis [Los Alamos National Laboratory; Wu, Ching-Yen [Los Alamos National Laboratory; Bucher, Brian Michael [Los Alamos National Laboratory; Buckner, Matthew Quinn [Los Alamos National Laboratory; Henderson, Roger Alan [Los Alamos National Laboratory

    2015-09-18

    This series of slides presents information on Chi-Nu measurements and analysis of prompt fission neutron spectra (PFNS) for neutron energy below 1 MeV for 235U. A key focus of the Chi-Nu measurement is to address the energy dependence of the low-energy emissions. The 235U PFNS evaluation is in progress. Chi-Nu delivered preliminary experimental data and input for part of the old experimental data base. The 239Pu PFNS evaluation is finalized and submitted for testing. Data from 252Cf spontaneous fission will also be obtained.

  2. Effective Field Theory and $\\chi$pt

    OpenAIRE

    Holstein, Barry R.

    2000-01-01

    A brief introduction to the subject of chiral perturbation theory ($\\chi$pt) is given, including a discussion of effective field theory and application to the upcoming Bates virtual Compton scattering measurement.

  3. $\\chi_{c1}$ and $\\chi_{c2}$ production at $e^+e^-$ colliders

    CERN Document Server

    Czyz, Henryk; Tracz, Szymon

    2016-01-01

    Direct, resonant production of the charmonium states $\\chi_{c1}$ and $\\chi_{c2}$ in electron-positron annihilation is investigated. Depending on details of the model, a sizeable variation of the prediction for the production cross section is anticipated. It is demonstrated that resonant production could be observed under favorable circumstances.

  4. Gain Shift Corrections at Chi-Nu

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Tristan Brooks [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Univ. of Massachusetts, Lowell, MA (United States). Dept. of Physics and Applied Physics; Devlin, Matthew James [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-08-30

    Ambient conditions have the potential to cause changes in liquid scintillator detector gain that vary with time and temperature. These gain shifts can lead to poor resolution in both energy as well as pulse shape discrimination. In order to correct for these shifts in the Chi-Nu high energy array, a laser system has been developed for calibration of the pulse height signals.

  5. Tai Chi, Qi Gong and Reiki.

    Science.gov (United States)

    Chu, Dennis A

    2004-11-01

    Tai Chi, Qi Gong, and Reiki are complementary therapies that are gaining popularity with patients. Although these therapies seem simple and attractive in their philosophy and are easy to apply,more objective, well-designed research is needed to prove their efficacy and to gain acceptance from the medical community. PMID:15458751

  6. Tai Chi Chuan in Medicine and Health Promotion

    OpenAIRE

    Ching Lan; Ssu-Yuan Chen; Jin-Shin Lai; Alice May-Kuen Wong

    2013-01-01

    Tai Chi Chuan (Tai Chi) is a Chinese traditional mind-body exercise and recently, it becomes popular worldwide. During the practice of Tai Chi, deep diaphragmatic breathing is integrated into body motions to achieve a harmonious balance between body and mind and to facilitate the flow of internal energy (Qi). Participants can choose to perform a complete set of Tai Chi or selected movements according to their needs. Previous research substantiates that Tai Chi has significant benefits to heal...

  7. Effect of near-fault earthquake on bridges: lessons learned from Chi-Chi earthquake

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    The objective of this paper is to describe the lessons learned and actions that have been taken related to the seismicdesign of bridge structures after the Chi-Chi, Taiwan earthquake. Much variable near-fault ground motion data was collected fromthe rupture of Chelungpu fault during the Chi-Chi earthquake, allowing the seismic response of bridge structures subjected to thesenear-fault ground motions to be carefully examined. To study the near-fault ground motion effect on bridge seismic design codes, atwo-level seismic design of bridge structures was developed and implemented. This design code reflects the near-fault factors in theseismic design forces. Finally, a risk assessment methodology, based on bridge vulnerability, is also developed to assist in decisionsfor reducing seismic risk due to failure of bridges.

  8. A precursory ULF signature for the Chi-Chi earthquake in Taiwan

    Directory of Open Access Journals (Sweden)

    Y. Akinaga

    2001-01-01

    Full Text Available ULF emission data at Lunping (epicentral distance, 120 km have been analysed for the Chi-Chi earthquake (with magnitude 7.6 and depth of 11 km in Taiwan which occurred on 21 September 1999. Simple intensity analyses have not yielded any significant results but we have found, based on the analysis of polarization (the ratio of vertical magnetic field component Z to the horizontal component G, that the polarization (Z/G showed a significant enhancement for two months before the earthquake. This kind of temporal evolution of polarization seems to be very similar to previous results, so that it is highly likely that this phenomenon may be associated with the Chi-Chi earthquake. Also, the comparison of the results of polarization analyses, by changing the signal threshold, has given us an approximate intensity of the seismogenic emission of the order of the monthly mean value.

  9. chi_{c1} and chi_{c2} decay angular distributions at the Fermilab Tevatron

    CERN Document Server

    Kniehl, Bernd A; Palisoc, C P

    2003-01-01

    We consider the hadroproduction of chi_{c1} and chi_{c2} mesons and their subsequent radiative decays to J/psi mesons and photons in the factorization formalism of nonrelativistic quantum chromodynamics, and study the decay angular distributions, by means of helicity density matrices, in view of their sensitivity to color-octet processes. We present numerical results appropriate for the Fermilab Tevatron.

  10. Barbed congruence of the asymmetric chi calculus

    Institute of Scientific and Technical Information of China (English)

    DONG Xiao-ju; FU Yu-xi

    2006-01-01

    The chi calculus is a model of mobile processes. It has evolved from the pi-calculus with motivations from simplification and communication-as-cut-elimination. This paper studies the chi calculus in the framework incorporating asymmetric communication. The major feature of the calculus is the identification of two actions:x/x and τ. The investigation on the barbed bisimilarity shows how the property affects the observational theory.Based on the definition of the barbed bisimilarity, the simulation properties of the barbed bisimilarity are studied. It shows that the algebraic properties of the barbed bisimilarity have changed greatly compared with the chi calculus. Although the definition of the barbed bisimilarity is very simple, the property of closeness under contexts makes it difficult to understand the barbed bisimilarity directly. Therefore an open style definition of the barbed bisimilarity is given, which is a context free description of barbed bisimilarity. Its definition is complex,but it is a well-behaved relation for it coincides with the barbed bisimilarity. It also helps to build an axiomatization system for the barbed congruence. Besides the axioms for the strong barbed bisimilarity, the paper proposes a new tau law and four new update laws for the barbed congruence. Both the operational and algebraic properties of the enriched calculus improve the understanding of the bisimulation behaviors of the model.

  11. A randomized controlled trial of Tai chi for balance, sleep quality and cognitive performance in elderly Vietnamese

    Directory of Open Access Journals (Sweden)

    Nguyen MH

    2012-06-01

    Full Text Available Manh Hung Nguyen, Andreas KruseInstitute of Gerontology, Heidelberg University, Heidelberg, GermanyObjective: To evaluate the effects of Tai chi exercise on balance, sleep quality, and cognitive performance in community-dwelling elderly in Vinh city, Vietnam.Design: A randomized controlled trial.Participants: One hundred two subjects were recruited.Intervention: Subjects were divided randomly into two groups. The Tai chi group was assigned 6 months' Tai chi training. The control group was instructed to maintain their routine daily activities.Outcome measures: The Falls Efficacy Scale (FES, Pittsburgh Sleep Quality Index (PSQI, and Trail Making Test (TMT were used as primary outcome measures.Results: Participants in the Tai chi group reported significant improvement in TMT (part A (F [1, 71] = 78.37, P < 0.001 and in TMT (part B, (F [1, 71] = 175.00, P < 0.001 in comparison with the control group. Tai chi participants also reported better scores in FES (F [1, 71] = 96.90, P < 0.001 and in PSQI (F [1,71] = 43.69, P = 0.001 than the control group.Conclusion: Tai chi is beneficial to improve balance, sleep quality, and cognitive performance of the elderly.Keywords: Tai chi, sleep, balance 

  12. Dicty_cDB: CHI518 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI518 (Link to dictyBase) - - - Contig-U11768-1 CHI518P (Link to Original ... CVRY YFKALVYSGKINKANLGMTKLPPPTKKMTKAAREALGSE--- ---skw *rnh*yqtnr*ckr*yfngscsfeccne*rskt*hcls*swscfgssnd*s ...

  13. Dicty_cDB: CHI394 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI394 (Link to dictyBase) - - - Contig-U16405-1 CHI394P (Link to Original ... sntvedctfdasglvyypkvynlkyskktkniw*ryshywlif kiiwws*fpy *fh*ck*tfcc--- ---TTFIGVRSGPSTTLTYIKPMISEIPTIENKIEK ...

  14. Measurement of chi(3510) and chi(3555) production in 190 GeV/c piminus-beryllium interactions

    International Nuclear Information System (INIS)

    Charmonium production in 190 GeV/c π--Be interactions has been observed. The states chi(3510) and chi(3555) are seen through their radiative decay into J/Psi, and are found to correspond to 0.29 +- 0.09 of total J/Psi production for J/Psi's with x/sub f/ > 0.2. The rate of production for the two chi states appears as Bsigma(chi(3555))/Bsigma(chi(3510) = 0.60 +- 0.35. The fraction of J/Psi's produced through chi decay appears to rise with higher x/sub f/. For J/Psi's with x/sub f/ > 0.42, chi decay is responsible for 0.345 +- 0.09 of the total J/Psi sample, with the two states produced at the rate Bsigma(chi(3555))/Bsigma(3510) = 0.82 +- 0.45

  15. Air pollution and risk of respiratory and cardiovascular hospitalizations in the most populous city in Vietnam.

    Science.gov (United States)

    Phung, Dung; Hien, To Thi; Linh, Ho Nhut; Luong, Ly M T; Morawska, Lidia; Chu, Cordia; Binh, Nguyen Duy; Thai, Phong K

    2016-07-01

    Air pollution has become an alarming issue in Vietnam recently; however, there was only one study so far on the effects of ambient air pollution on population health. Our study aimed to investigate the short-term effects of air pollutants including PM10, NO2, SO2, and O3 on respiratory and cardiovascular hospitalizations in Ho Chi Minh City (HCMC), the largest city in Vietnam. Data on hospitalization from the two largest hospitals in HCMC and daily records of PM10, NO2, SO2, O3 and meteorological data were collected from February 2004 to December 2007. A time-series regression analysis with distributed lag model was applied for data analysis. Changes in levels of NO2 and PM10 were strongly associated with hospital admissions for both respiratory and cardiovascular diseases (CVD); whereas levels of SO2 were only moderately associated with respiratory and CVD hospital admissions and O3 concentration was not associated with any of them. For a 10μg/m(3) increase of each air pollutant, the risk of respiratory admissions increased from 0.7% to 8% while the risk of CVD admissions increased from 0.5% to 4%. Females were found to be more sensitive than males to exposure to air pollutants in regard to respiratory diseases. In regard to CVD, females (RR, 1.04, 95% CI, 1.01-1.07) had a slightly higher risk of admissions than males (RR, 1.03, 95% CI, 1-1.06) to exposure to NO2. In contrast, males (RR, 1.007, 95%CI, 1-1.01) had a higher risk of admission than females (RR, 1.004, 95%CI, 1.001-1.007) to exposure to PM10. People in the age group of 5-65year-olds had a slightly higher risk of admissions caused by air pollutants than the elderly (65+years old) except for a significant effect of PM10 on the risk of cardiovascular admissions was found for the elderly only. PMID:27016680

  16. Cities and Sea Level Rise: A Roadmap for Flood Hazard Adaptation

    Science.gov (United States)

    Horn, Diane; Cousins, Ann

    2016-04-01

    Coastal cities will face a range of increasingly severe challenges as sea level rises, and adaptation to future flood risk will require more than structural defences. Many cities will not be able to rely solely on engineering structures for protection and will need to develop a suite of policy responses to increase their resilience to impacts of rising sea level. The tools to promote flood risk adaptation are already within the capacity of most cities, with an assortment of policy tools available to address other land-use problems which can be refashioned and used to adapt to sea level rise. This study reviews approaches for urban adaptation through detailed analyses of case studies of cities which have developed flood adaptation strategies that combine structural defences with innovative approaches to living with flood risk. The aim of the overall project is to produce a 'roadmap' to guide practitioners through the process of analysing coastal flood risk in urban areas. Methodologies and tools to estimate vulnerability to coastal flooding, damages suffered, and the assessment of flood defences and adaptation measures are complemented with a discussion on the essential impact that local policy has on the treatment of coastal flooding and the constraints and opportunities that result from the specific country or locality characteristics in relation to economic, political, social and environmental priorities, which are likely to dictate the approach to coastal flooding and the actions proposed. Case studies of adaptation strategies used by Rotterdam, Bristol, Ho Chi Minh City and Norfolk, Virginia, are used to draw out a range of good practice elements that promote effective adaptation to sea level rise. These can be grouped into risk reduction, governance issues, and insurance, and can be used to provide examples of how other cities could adopt and implement flood adaptation strategies from a relatively limited starting position. Most cities will neither be able to

  17. A Quantitative Study on Paleo—River Environment During Late Jurassic on yaojie Region,Minhe Basin

    Institute of Scientific and Technical Information of China (English)

    邵树勋; 燕永峰; 等

    2000-01-01

    Fluvial Sedimentation of alluvial facies prevailed during the Late Jrassic in the Minhe Basin.On the basis of the study of sedimentary facies of the Upper Jurassic series.this paper focuses on the river types suing the "Architecture Element" analysis method proposed by Miall,and calculated all the quantitative parameters to reflect the characteristics of the stream channel geometry and hydrodynamic conditions of paleo-rivers with the equations of ethrideg,schumm et al.Finally,we discussed the characteristics of environmental evolution of palsorivers on the quantitative basis.Our conclusion indicates that the evolution of paleo-rivers during the Late Jurassic,from early to late,shows such a tendency as alluvial fan river→ braid river→alluvial fan river→mid-sinuoisty river→ high-sinuosity river.

  18. The chitinase C gene PsChiC from Pseudomonas sp. and its synergistic effects on larvicidal activity

    Directory of Open Access Journals (Sweden)

    Wanfang Zhong

    2015-09-01

    Full Text Available Pseudomonas sp. strain TXG6-1, a chitinolytic gram-negative bacterium, was isolated from a vegetable field in Taixing city, Jiangsu Province, China. In this study, a Pseudomonas chitinase C gene (PsChiC was isolated from the chromosomal DNA of this bacterium using a pair of specific primers. The PsChiC gene consisted of an open reading frame of 1443 nucleotides and encoded 480 amino acid residues with a calculated molecular mass of 51.66 kDa. The deduced PsChiC amino acid sequence lacked a signal sequence and consisted of a glycoside hydrolase family 18 catalytic domain responsible for chitinase activity, a fibronectin type III-like domain (FLD and a C-terminal chitin-binding domain (ChBD. The amino acid sequence of PsChiCshowed high sequence homology (> 95% with chitinase C from Serratia marcescens. SDS-PAGE showed that the molecular mass of chitinase PsChiC was 52 kDa. Chitinase assays revealed that the chitobiosidase and endochitinase activities of PsChiCwere 51.6- and 84.1-fold higher than those of pET30a, respectively. Although PsChiC showed little insecticidal activity towards Spodoptera litura larvae, an insecticidal assay indicated that PsChiC increased the insecticidal toxicity of SpltNPV by 1.78-fold at 192 h and hastened death. These results suggest that PsChiC from Pseudomonas sp. could be useful in improving the pathogenicity of baculoviruses.

  19. CHY-Graphs on a Torus

    CERN Document Server

    Cardona, Carlos

    2016-01-01

    Recently, we proposed a new approach using a punctured Elliptic curve in the CHY framework in order to compute one-loop scattering amplitudes. In this note, we further develop this approach by introducing a set of connectors, which become the main ingredient to build integrands on $\\mathfrak{M}_{1,n}$, the moduli space of n-punctured Elliptic curves. As a particular application, we study the $\\Phi^3$ bi-adjoint scalar theory. We propose a set of rules to construct integrands on $\\mathfrak{M}_{1,n}$ from $\\Phi^ 3$ integrands on $\\mathfrak{M}_{0,n}$, the moduli space of n-punctured spheres. We illustrate these rules by computing a variety of $\\Phi^3$ one-loop Feynman diagrams. Conversely, we also provide another set of rules to compute the corresponding CHY-integrand on $\\mathfrak{M}_{1,n}$ by starting instead from a given $\\Phi^ 3$ one-loop Feynman diagram. In addition, our results can easily be extended to higher loops.

  20. A Study on Near-Fault Mortality from the 1999 Chi-Chi, Taiwan Earthquake

    Science.gov (United States)

    Pai, C.; Tien, Y.; Teng, T.

    2004-12-01

    A new approach for estimating the relations between mortality and strong shaking from the 1999 Chi-Chi, Taiwan earthquake is introduced. We have finished the database giving the attributes of victims through a compilation of various after-earthquake survey documents. This survey was a comprehensive filed visit confirming exact locations of victims and their possible cause of death. Among the total 2492 victims of the Chi-Chi earthquake, 2039 victims (81.8% of the total) were located by using GPS. Through the attributive database of victims, digital maps and Geographic Information Systems, we can easily map the spatial distribution and the cause of death data of victims with accuracy of the smallest administrative districts in Taiwan. Moreover, a regression analysis gives correlated equations for the mortality as functions of the distance to the Chelungpu fault. We find that the percentage of the mortality M can be expressed as:\\[M=\\frac{(1.626+0.0007\\timesd)} {(1+0.0125\\timesd)}\\] Here d is the closest distance to the fault in meter. As expected, the shorter distance to the Chelungpu fault causes the higher mortality. We device three disastrous levels and then suggest the orders and scopes of the earthquake disaster rescue according to the regression curve of the mortality and the closest distance to the fault. The difference in mortality between hanging-wall and footwall areas is also discussed and different regression curves of hanging-wall and footwall areas are suggested. In near-fault regions, the mortality for the residents lived in hanging-wall block (1348) is significantly higher than that in the footwall block (557). The death ratio of hanging-wall vs. footwall block is approximately 2.4:1. Finally, we gathered the data of the peak ground acceleration (PGA) data for the mainshock of Chi-Chi earthquake at the 63 seismic stations on both sides of the causal fault. The regression curve of the PGA and mortality as functions of the closest distance to the

  1. Bi-normalized response spectral characteristics of the 1999 Chi-Chi earthquake

    Institute of Scientific and Technical Information of China (English)

    徐龙军; 谢礼立

    2004-01-01

    To develop uniform and seismic environment-dependent design spectrum, common acceleration response spectral characteristics need to be identified. In this paper, a bi-normalized response spectrum (BNRS) is proposed, which is defined as a spectrum of peak response acceleration normalized with respect to peak acceleration of the excitation plotted vs. the natural period of the system normalized with respect to the spectrum predominant period, Tp. Based on a statistical analysis of records from the 1999 Chi-Chi earthquake, the conventionally normalized response spectrum(NRS) and the BNRS are examined to account for the effects of soil conditions, epicentral distance, hanging wall and damping. It is found that compared to the NRS, the BNRS is much less dependent on these factors. Finally, some simple relationships between the BNRS tor a specified damping ratio and that for a damping ratio of 5%, and between the spectra predominant period and epicentral distance for different soil types are provided.

  2. A $\\chi^2$ veto for continuous wave searches

    CERN Document Server

    de la Jordana, Llucia Sancho

    2008-01-01

    $\\chi^2$ vetoes are commonly used in searching for gravitational waves, in particular for broad-band signals, but they can also be applied to narrow-band continuous wave signals, such as those expected from rapidly rotating neutron stars. In this paper we present a $\\chi^2$ veto adapted to the Hough transform searches for continuous gravitational wave signals; we characterize the $\\chi^2$-significance plane for different frequency bands; and discuss the expected performance of this veto in LIGO analysis.

  3. O Tai Chi Chuan na percussão

    OpenAIRE

    Teixeira, Mário Jorge Peixoto

    2013-01-01

    A good motricity and a strong psyche that allow for excellence in performance are essential in musical execution. Since Tai Chi Chuan is an activity that implies a considerable psychomotor and psychological development, it is the aim of this thesis to assess whether the practice of Tai Chi Chuan can be an optimising factor in a percussionist’s performance. Based on the outstanding physical and psychological effects that result from the practice of Tai Chi Chuan and the ce...

  4. Tai Chi Chuan in Medicine and Health Promotion

    Directory of Open Access Journals (Sweden)

    Ching Lan

    2013-01-01

    Full Text Available Tai Chi Chuan (Tai Chi is a Chinese traditional mind-body exercise and recently, it becomes popular worldwide. During the practice of Tai Chi, deep diaphragmatic breathing is integrated into body motions to achieve a harmonious balance between body and mind and to facilitate the flow of internal energy (Qi. Participants can choose to perform a complete set of Tai Chi or selected movements according to their needs. Previous research substantiates that Tai Chi has significant benefits to health promotion, and regularly practicing Tai Chi improves aerobic capacity, muscular strength, balance, health-related quality of life, and psychological well-being. Recent studies also prove that Tai Chi is safe and effective for patients with neurological diseases (e.g., stroke, Parkinson's disease, traumatic brain injury, multiple sclerosis, cognitive dysfunction, rheumatological disease (e.g., rheumatoid arthritis, ankylosing spondylitis, and fibromyalgia, orthopedic diseases (e.g., osteoarthritis, osteoporosis, low-back pain, and musculoskeletal disorder, cardiovascular diseases (e.g., acute myocardial infarction, coronary artery bypass grafting surgery, and heart failure, chronic obstructive pulmonary diseases, and breast cancers. Tai Chi is an aerobic exercise with mild-to-moderate intensity and is appropriate for implementation in the community. This paper reviews the existing literature on Tai Chi and introduces its health-promotion effect and the potential clinical applications.

  5. Dicty_cDB: CHI194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 58.1 V112D8 mTn-3xHA/lacZ Insertion Library, strain Y2278 Saccharomyces cerevisiae genomic 5', genomic survey se...) Frame A: ksnfi*ii*knk*ynikndiisnylmy*gn*ndlktstrsi*kkyknsnkeiisinwfsd nwyifsictsmvfvtnwmdiygysmlwiilcwvcmw...uolar 4.0 %: nuclear 4.0 %: vesicles of secretory system >> prediction for CHI194 is end 5' end seq. ID CHI194F 5' end se...CTTT TAATGGTTTAGTTTATAATCATTCATTTGCTGCTAGAAATTATTTGGATCTTTATAGAGT TGCTTTATTATCAAANNAATAAAATTAAATCATT Length of 3' end se...q. 754 Connected seq. ID CHI194P Connected seq. >CHI194P.Seq AAATCAAA

  6. Graphs with $\\chi=\\Delta$ have big cliques

    OpenAIRE

    Cranston, Daniel W.; Rabern, Landon

    2013-01-01

    Brooks' Theorem states that if a graph has $\\Delta\\ge 3$ and $\\omega \\le \\Delta$, then $\\chi \\le \\Delta$. Borodin and Kostochka conjectured that if $\\Delta\\ge 9$ and $\\omega\\le \\Delta-1$, then $\\chi\\le \\Delta-1$. We show that if $\\Delta\\ge 13$ and $\\omega \\le \\Delta-4$, then $\\chi\\le \\Delta-1$. For a graph $G$, let $\\mathcal{H}$ denote the subgraph of $G$ induced by vertices of degree $\\Delta$. We also show that if $\\omega\\le \\Delta-1$ and $\\omega(\\mathcal{H})\\le \\Delta-6$, then $\\chi\\le \\Del...

  7. Search for B --> chi_c K(*) decays

    CERN Document Server

    Aubert, B; Abrams, G S; Adye, T; Ahmed, S; Alam, M S; Albert, J; Aleksan, Roy; Allison, J; Allmendinger, T; Altenburg, D; Andreotti, M; Angelini, C; Anulli, F; Aston, D; Azzolini, V; Baak, M; Back, J J; Bailey, S; Baldini-Ferroli, R; Band, H R; Banerjee, Sw; Barate, R; Bard, D J; Barlow, N R; Barlow, R J; Barrett, M; Bartoldus, R; Batignani, G; Bauer, J M; Beck, T W; Bellini, F; Benayoun, M; Berger, N; Bernard, D; Berryhill, J W; Best, D; Bettarini, S; Bettoni, D; Bevan, A J; Bhimji, W; Bianchi, F; Biasini, M; Blanc, F; Blaylock, G; Blinov, A E; Blinov, V E; Bloom, P; Bóna, M; Bondioli, M; Bonneaud, G R; Borgland, A W; Bosisio, L; Boutigny, D; Bowerman, D A; Boyarski, A M; Boyd, J T; Bozzi, C; Brandenburg, G; Brandt, T; Brau, J E; Breon, A B; Briand, H; Brochard, F; Brose, J; Brown, C L; Brown, C M; Brown, D; Brown, D N; Bruinsma, M; Brunet, S; Bucci, F; Buchanan, C; Buchmüller, O L; Bulten, H; Burchat, Patricia R; Button-Shafer, J; Buzzo, A; Côté, D; Cahn, R N; Calabrese, R; Calcaterra, A; Calderini, G; Campagnari, C; Capra, R; Carpinelli, M; Cartaro, C; Cavallo, N; Cavoto, G; Chaisanguanthum, K S; Chao, M; Charles, E; Charles, M J; Chauveau, J; Chavez, C A; Chen, A; Chen, E; Chen, J C; Chen, S; Cheng, B; Cheng, C H; Chevalier, N; Christ, S; Cibinetto, G; Clark, P J; Claus, R; Cochran, J; Colecchia, F; Coleman, J P; Contri, R; Convery, M R; Cormack, C M; Cossutti, F; Cottingham, W N; Couderc, F; Covarelli, R; Cowan, G; Crawley, H B; Cremaldi, L M; Cristinziani, M; Crosetti, G; Çuhadar-Dönszelmann, T; Dahmes, B; Dallapiccola, C; Danielson, N; Dasu, S; Datta, M; Dauncey, P D; David, P; Davier, M; Davis, C L; Day, C T; De Groot, N; De Nardo, Gallieno; Del Buono, L; Della Ricca, G; Di Lodovico, F; Dickopp, M; Dittongo, S; Dong, D; Dorfan, J; Dorigo, A; Druzhinin, V P; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W M; Dvoretskii, A; Eckmann, R; Edwards, A J; Egede, U; Eichenbaum, A M; Eigen, G; Eisner, A M; Elmer, P; Elsen, E E; Emery, S; Ernst, J A; Eschenburg, V; Eschrich, I; Fabozzi, F; Faccini, R; Fan, S; Farbin, A; Feltresi, E; Ferrarotto, F; Ferroni, F; Field, R C; Finocchiaro, G; Flack, R L; Flächer, H U; Flood, K T; Ford, K E; Ford, W T; Forster, I J; Forti, F; Fortin, D; Foulkes, S D; Franek, B J; Frey, R; Fritsch, M; Fry, J R; Gabathuler, Erwin; Gaidot, A; Gaillard, J M; Gaillard, J R; Galeazzi, F; Gallo, F; Gamba, D; Gamet, R; Gan, K K; Ganzhur, S F; Gary, J W; Gaspero, M; Gatto, C; Geddes, N I; Gill, M S; Giorgi, M A; Giraud, P F; Giroux, X; Gladney, L; Glanzman, T; Godang, R; Goetzen, K; Golubev, V B; Gopal, G P; Gowdy, S J; Graham, M; Grancagnolo, S; Green, M G; Greene, M G; Grenier, G J; Grenier, P; Gritsan, A V; Grosdidier, G; Groysman, Y; Guo, Q H; Hadavand, H K; Hadig, T; Haire, M; Halyo, V; Hamel de Monchenault, G; Hamon, O; Harrison, P F; Harrison, T J; Hart, A J; Hart, P A; Hartfiel, B L; Harton, J L; Hast, C; Hauke, A; Hawkes, C M; Hearty, C; Held, T; Hertzbach, S S; Heusch, C A; Hicheur, A; Hill, E J; Hitlin, D G; Höcker, A; Hodgkinson, M C; Hollar, J J; Honscheid, K; Hrynóva, T; Hufnagel, D; Hulsbergen, W D; Hutchcroft, D E; Igonkina, O; Innes, W R; Ivanchenko, V N; Izen, J M; Jackson, P D; Jackson, P S; Jacobsen, R G; Jawahery, A; Jayatilleke, S M; Jessop, C P; John, M J J; Johnson, J R; Judd, D; Kadel, R W; Kadyk, J; Kagan, H; Karyotakis, Yu; Kass, R; Kelly, M P; Kelsey, M H; Kerth, L T; Khan, A; Kim, H; Kim, P; Kirkby, D; Kitayama, I; Knecht, N S; Koch, H; Kocian, M L; Kofler, R; Kolomensky, Yu G; Koptchev, V B; Kovalskyi, D; Kowalewski, R V; Kozanecki, Witold; Kravchenko, E A; Krishnamurthy, M; Kroeger, R; Kroseberg, J; Kukartsev, G; Kutter, P E; Kyberd, P; Lacker, H M; Lae, C K; Lafferty, G D; Lamsa, J; Lanceri, L; Lange, D J; Langenegger, U; Lankford, A J; Laplace, S; Latham, T E; Lau, Y P; Lavin, D; Lazzaro, A; Le Diberder, F R; Lees, J P; Legendre, M; Leith, D W G S; Lepeltier, V; Leruste, P; Lewandowski, B; Li Gioi, L; Li, H; Libby, J; Lillard, V; Lista, L; Liu, R; LoSecco, J M; Lo Vetere, M; Lockman, W S; Lombardo, V; London, G W; Long, O; Lou, X C; Lu, A; Lü, C; Luitz, S; Luppi, E; Lusiani, A; Lüth, V; Lutz, A M; Lynch, G; Lynch, H L; Lyon, A J; MacFarlane, D B; Macri, M; Malcles, J; Mallik, U; Mancinelli, G; Mandelkern, M A; Manfredi, P F; Mangeol, D J J; Marchiori, G; Margoni, M; Marsiske, H; Martínez-Vidal, F; Mattison, T S; Mayer, B; Mazur, M A; Mazzoni, M A; McKenna, J A; McMahon, T R; Meadows, B T; Messner, R; Meyer, T I; Meyer, W T; Miftakov, V; Mihályi, A; Mir, L M; Mohanty, G B; Mohapatra, A K; Mommsen, R K; Monge, M R; Monorchio, D; Moore, T B; Morandin, M; Morgan, S E; Morganti, M; Morganti, S; Morii, M; Morton, G W; Muheim, F; Müller, D R; Müller-Pfefferkorn, R; Narsky, I; Nash, J A; Nauenberg, U; Neal, H; Negrini, M; Neri, N; Nesom, G; Nicholson, H; Nikolich, M B; Nogowski, R; O'Grady, C P; Ocariz, J; Oddone, P J; Ofte, I; Olaiya, E O; Olivas, A; Olsen, J; Onuchin, A P; Orimoto, T J; Otto, S; Ozcan, V E; Paar, H P; Paick, K; Palano, A; Palombo, F; Pan, Y; Panetta, J; Panvini, R S; Paoloni, E; Paolucci, P; Parry, R J; Passaggio, S; Patel, P M; Patrignani, C; Patteri, P; Payne, D J; Pelizaeus, M; Perazzo, A; Perl, M; Peruzzi, I M; Petersen, B A; Petersen, T C; Petrak, S; Petzold, A; Piatenko, T; Piccolo, D; Piccolo, M; Piemontese, L; Pierini, M; Pioppi, M; Piredda, G; Pivk, M; Plaszczynski, S; Playfer, S; Pompili, A; Poropat, P; Porter, F C; Posocco, M; Potter, C T; Prell, S; Prepost, R; Pripstein, M; Pulliam, T; Purohit, M V; Qi, N D; Rahatlou, S; Rahimi, A M; Rama, M; Rankin, P; Ratcliff, B N; Raven, G; Re, V; Reidy, J; Ricciardi, S; Richman, J D; Ritchie, J L; Rizzo, G; Roat, C; Roberts, D A; Robertson, S H; Robutti, E; Roe, N A; Röthel, W; Ronan, Michael T; Roney, J M; Rong, G; Roodman, A; Roos, L; Rosenberg, E I; Rotondo, M; Rubin, A E; Ryd, A; Saeed, M A; Safai-Tehrani, F; Saleem, M; Salnikov, A A; Salvatore, F; Samuel, A; Sanders, D A; Sandrelli, F; Santroni, A; Saremi, S; Sarti, A; Satpathy, A; Schalk, T; Schindler, R H; Schott, G; Schrenk, S; Schubert, J; Schubert, Klaus R; Schumm, B A; Schune, M H; Schwiening, J; Schwierz, R; Schwitters, R F; Sciacca, C; Sciolla, G; Seiden, A; Sekula, S J; Serednyakov, S I; Sharma, V; Shelkov, V G; Shen, B C; Simani, M C; Simi, G; Simonetto, F; Sinev, N B; Skovpen, Yu I; Sloane, R J; Smith, A J S; Smith, J G; Snoek, H L; Snyder, A; Sobie, R J; Soffer, A; Soha, A; Sokoloff, M D; Solodov, E P; Spaan, B; Spanier, S M; Spradlin, P; Stängle, H; Steinke, M; Stelzer, J; Stoker, D P; Stroili, R; Strom, D; Stugu, B; Su, D; Sullivan, M K; Summers, D J; Sundermann, J E; T'Jampens, S; Tan, P; Tantot, L; Taras, P; Taylor, F; Taylor, G P; Telnov, A V; Teodorescu, L; Ter-Antonian, R; Therin, G; Thiebaux, C; Thiessen, D; Tiozzo, G; Tisserand, V; Toki, W H; Torrence, E; Tosi, S; Touramanis, C; Treadwell, E; Vasileiadis, G; Vasseur, G; Vavra, J; Verderi, M; Verkerke, W; Vitale, L; Voci, C; Voena, C; Vuagnin, G; Wagner, G; Wagner, S R; Wagoner, D E; Waldi, R; Walsh, J; Wang, K; Wang, P; Wappler, F R; Watson, A T; Weaver, M; Weidemann, A W; Weinstein, A J R; Wenzel, W A; Wilden, L; Williams, D C; Williams, J C; Willocq, S; Wilson, F F; Wilson, J R; Wilson, M G; Wilson, R J; Winter, M A; Wisniewski, W J; Wittgen, M; Won, E; Wong, Q K; Wormser, G; Wright, D H; Wright, D M; Wu, J; Wu, S L; Xie, Y; Yamamoto, R K; Yang, S; Yarritu, A K; Ye, S; Yéche, C; Yi, J; Young, C C; Yu, Z; Yumiceva, F X; Yushkov, A N; Zallo, A; Zeng, Q; Zghiche, A; Zhang, J; Zhang, L; Zhao, H W; Zhu, Y S; Zito, M; De Sangro, R; La Vaissière, C de

    2004-01-01

    We report on the search for the factorization suppressed decays B -> chi_c0 K(*) and B -> chi_c2 K(*), with chi_c0 and chi_c2 decaying into J/psi gamma. We use a sample of 124 million BBbar events collected with the BABAR detector at the PEP-II storage ring at the Stanford Linear Accelerator Center. No significant signal is found and upper bounds for the branching fractions are obtained. All results are preliminary.

  8. chi_c0 and chi_c2 Decays into eta eta, eta eta', and eta' eta' Final States

    CERN Document Server

    Adams, G S; Cummings, J P; Danko, I; Napolitano, J; He, Q; Insler, J; Muramatsu, H; Park, C S; Thorndike, E H; Yang, F; Coan, T E; Gao, Y S; Artuso, M; Blusk, S; Butt, J; Li, J; Menaa, N; Mountain, R; Nisar, S; Randrianarivony, K; Sia, R; Skwarnicki, T; Stone, S; Wang, J C; Zhang, K; Csorna, S E; Bonvicini, G; Cinabro, D; Dubrovin, M; Lincoln, A; Asner, D M; Edwards, K W; Briere, R A; Chen, J; Ferguson, T; Tatishvili, G T; Vogel, H; Watkins, M E; Rosner, J L; Adam, N E; Alexander, J P; Berkelman, K; Cassel, D G; Duboscq, J E; Ecklund, K M; Ehrlich, R; Fields, L; Galik, R S; Gibbons, L; Gray, R; Gray, S W; Hartill, D L; Heltsley, B K; Hertz, D; Jones, C D; Kandaswamy, J; Kreinick, D L; Kuznetsov, V E; Mahlke-Krüger, H; Onyisi, P U E; Patterson, J R; Peterson, D; Pivarski, J; Riley, D; Ryd, A; Sadoff, A J; Schwarthoff, H; Shi, X; Stroiney, S; Sun, W M; Wilksen, T; Weinberger, M; Athar, S B; Patel, R; Potlia, V; Yelton, J; Rubin, P; Cawlfield, C; Eisenstein, B I; Karliner, I; Kim, D; Lowrey, N; Naik, P; Sedlack, C; Selen, M; White, E J; Wiss, J; Mitchell, R E; Shepherd, M R; Besson, D; Pedlar, T K; Cronin-Hennessy, D; Gao, K Y; Hietala, J; Kubota, Y; Klein, T; Lang, B W; Poling, R; Scott, A W; Smith, A; Zweber, P; Dobbs, S; Metreveli, Z V; Seth, K K; Tomaradze, A G; Ernst, J; Severini, H; Dytman, S A; Love, W; Savinov, V; Aquines, O; Li, Z; López, A; Mehrabyan, S S; Méndez, H; Ramírez, J; Huang, G S; Miller, D H; Pavlunin, V; Sanghi, B; Shipsey, I P J; Xin, B; al, et

    2006-01-01

    Using a sample of 3 x 10^6 psi(2S) decays collected by the CLEO III and CLEO_c detector configurations, we present results of a study of \\chi_{c0} and \\chi_{c2} decays into eta-eta, eta-etaprime, and etaprime-etaprime final states. We find B(chi_{c0} -> eta-eta)= (0.31+-0.05+-0.04+-0.02)%, B(chi_{c0} -> eta-etaprime) etaprime-etaprime) = (0.17 +- 0.04 +-0.02 +-0.01)%. We also present upper limits for the decays of \\chi_{c2} into these final states. These results give information on the decay mechanism of \\chi_c states into pseudoscalars.

  9. Community Recovery and Sustainable Development in the Region of Seismic Center in Taiwan after the 1999 CHI-CHI Earthquake

    OpenAIRE

    Hsiu-Jen Jennifer, Yeh

    2006-01-01

    International audience The major purpose of this study is to evaluate the progress of community recovery and sustainable development of the region of seismic centre in Taiwan after the 1999 Chi-Chi Earthquake. Data analyzed in this study were collected from a face-to-face interview survey conducted in the research site of Tzu-Shan Town, Nan-Tau County, an area close to the epicentre of Chi-Chi Town, Nan-Tau County. The analysis of this study indicates that before the earthquake the residen...

  10. Dicty_cDB: CHI458 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI458 (Link to dictyBase) - - - Contig-U15607-1 CHI458P (Link to Original ... n*il nnnnynknnhqkhtlkkhkn*nkkkke*nn*kkiekimfqkv*lk*mis *qnlnh*ikll nlfhqmvivyikqlqtny*likilmkkrvkvmqrn*eq* ...

  11. Vung Tau - Co Gong dam, Vietnam

    NARCIS (Netherlands)

    Dekens, B.; Meerdink, L.; Meijer, G.J.; Sirks, E.; Van Vliet, R.

    2011-01-01

    The area around Ho Chi Minh City (HCMC) faces flooding and salt intrusion problems. Flooding problems are caused by intensive rainfall in the city, high river discharges and high tides on sea. Dr. Hoc, the vice-minister of MARD (Vietnamese Ministry of Agriculture and Rural Development) proposed to c

  12. Model Waveform Accuracy Requirements for the $\\chi^2$ Discriminator

    CERN Document Server

    Lindblom, Lee

    2016-01-01

    This paper derives accuracy standards for model gravitational waveforms required to ensure proper use of the $\\chi^2$ discriminator test in gravitational wave (GW) data analysis. These standards are different from previously established requirements for detection and waveform parameter measurement based on signal-to-noise optimization. We present convenient formulae both for evaluating and interpreting the contribution of model errors to measured $\\chi^2$ values. Motivated by these formula, we also present an enhanced, complexified variant of the standard $\\chi^2$ statistic used in GW searches. While our results are not directly relevant to current searches (which use the $\\chi^2$ test only to veto signal candidates with extremely high $\\chi^2$ values), they could be useful in future GW searches and as figures of merit for model gravitational waveforms.

  13. Metamorphism of the Basement of the Qilian Fold Belt in the Minhe-Ledu Area, Qinghai Province, NW China

    Institute of Scientific and Technical Information of China (English)

    蔡金郎; 魏光华; 王庆树

    2002-01-01

    The basement of the central Qilian fold belt exposed along the Minhe-Ledu highway consists of psammiticschists, metabasitic rocks, and crystalline limestone. Migmatitic rocks occur sporadically among psammitic schist andmetabasitic rocks. The mineral assemblage of psammitic schist is muscovite + biotite + feldspar + quartz + tourmaline ±titanite ± sillimanite and that of metabasitic rocks is amphibole + plagioclase + biotite ± apatite ± magnetite ± pyroxene ±garnet ± quartz. The migmatitic rock consists of leucosome and restite of various volume proportions; the former consistsof muscovite + alkaline feldspar + quartz ± garnet ± plagioclase while the latter is either fragments of psammitic schist orthose of metabasitic rock. The crystalline limestone consists of calcite that has been partly replaced by olivine. The olivinewas subsequently altered to serpentine. Weak deformations as indicated by cleavages and fractures were imposed promi-nently on the psammitic schists, occasionally on metabasitic rocks, but not on migmatitic rocks. The basement experiencedmetamorphism up to temperature 606-778C and pressure 4.8-6.1 kbar (0.48-0.61 GPa), equivalent to amphibolite-granulite facies. The peak of the metamorphism is marked by a migmatization which occurred at several localities alongthe studied route 587-535 Ma ago. The basement also recorded a retrograde metamorphism of greenschist facies, duringwhich biotite, garnet, amphibole, and pyroxene were partly altered to chlorite.

  14. Effects of an Exercise Program with Tai Chi in Older Women

    Directory of Open Access Journals (Sweden)

    Mónica Andrea Silva-Zemanate

    2014-09-01

    Full Text Available Objective: This research was aimed at determining the effects of an exercise program with the art of Tai Chi in older women. Material and Methods: A quasi-experimental study with a longitudinal cutting was conducted; the study population was a group of elderly in the city of Popayan. It consisted of three phases: in the first one, an initial evaluation of physical capacity (walking, balance, daily basic activities was applied, afterward, the scale of Yesavage for signs of depression, and finally the Folstien Mini Mental Test to assess cognitive functions. In the second phase, a program of Tai Chi exercises in one weekly session for a twelve weeks period was implemented. In the third phase, the evaluation of the results of the program through participant re-evaluating was carried out. Results: The functional capacity improved in all the tested aspects, the difference in walking speed and the static and dynamic balance were statistically significant; in the same way, the cognitive ability improved in all the tested items, statistical significance was found in aspects such as memory, attention, calculation and language. All participants achieved full functionality of the daily basic activities. Conclusions: The application of a Tai Chi technique provides significant benefits in the balance and the cognitive ability of the elderly, leading to a breakthrough in their independent behavior and improving their functional capacity, so it could be recommended as an alternative technique of physiotherapeutic intervention in neuronal rehabilitation.

  15. Site responses in the Taipei basin during the 1999 Chi-Chi, Taiwan earthquake sequence

    International Nuclear Information System (INIS)

    On September 20, 1999 a magnitude ML 7.3 earthquake struck Taichung and Nantou in central Taiwan. Taipei basin located more than 100 km from the epicenter but also had many buildings damaged during the earthquake. In this study we use the main shock and aftershocks data of Chi-Chi earthquake to analyze the site effect of Taipei basin. The results show that the dominant low frequency band response is located in the western part of Taipei basin and Songshan area; the main high frequency band response areas are near the edge of basin. Another hand, comparing the results of amplification pattern with the location of damaged buildings found that the tall damaged buildings are located at the high response areas of low frequency band and the low-rise damaged structures are located at the high response areas of higher frequency band. From these results we can find the relationship between the site amplification and damaged structure distribution in the Taipei basin area during earthquakes. (authors)

  16. Tai Chi Chuan Exercise for Patients with Cardiovascular Disease

    Directory of Open Access Journals (Sweden)

    Ching Lan

    2013-01-01

    Full Text Available Exercise training is the cornerstone of rehabilitation for patients with cardiovascular disease (CVD. Although high-intensity exercise has significant cardiovascular benefits, light-to-moderate intensity aerobic exercise also offers health benefits. With lower-intensity workouts, patients may be able to exercise for longer periods of time and increase the acceptance of exercise, particularly in unfit and elderly patients. Tai Chi Chuan (Tai Chi is a traditional Chinese mind-body exercise. The exercise intensity of Tai Chi is light to moderate, depending on its training style, posture, and duration. Previous research has shown that Tai Chi enhances aerobic capacity, muscular strength, balance, and psychological well-being. Additionally, Tai Chi training has significant benefits for common cardiovascular risk factors, such as hypertension, diabetes mellitus, dyslipidemia, poor exercise capacity, endothelial dysfunction, and depression. Tai Chi is safe and effective in patients with acute myocardial infarction (AMI, coronary artery bypass grafting (CABG surgery, congestive heart failure (HF, and stroke. In conclusion, Tai Chi has significant benefits to patients with cardiovascular disease, and it may be prescribed as an alternative exercise program for selected patients with CVD.

  17. Dos and don'ts of reduced chi-squared

    CERN Document Server

    Andrae, Rene; Melchior, Peter

    2010-01-01

    Reduced chi-squared is a very popular method for model assessment, model comparison, convergence diagnostic, and error estimation in astronomy. In this manuscript, we discuss the pitfalls involved in using reduced chi-squared. There are two independent problems: (a) The number of degrees of freedom can only be estimated for linear models. Concerning nonlinear models, the number of degrees of freedom is unknown, i.e., it is not possible to compute the value of reduced chi-squared. (b) Due to random noise in the data, also the value of reduced chi-squared itself is subject to noise, i.e., the value is uncertain. This uncertainty impairs the usefulness of reduced chi-squared for differentiating between models or assessing convergence of a minimisation procedure. The impact of noise on the value of reduced chi-squared is surprisingly large, in particular for small data sets, which are very common in astrophysical problems. We conclude that reduced chi-squared can only be used with due caution for linear models, w...

  18. Dicty_cDB: CHI575 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI575 (Link to dictyBase) - - - Contig-U16427-1 - (Link to Original site) ... yfg*ytlyiyiiq*nviffrtdfrkdgfhr*ry*ihgns*sck*irkryf*ngs ... nl*k*ncykiisins*fsk*csrkcc*mfrfin*ks*rftsnrny*yiik ... n--- Homology vs CSM-cDNA Score E Sequences producing s ignificant alignments: (bits) Value CHI575 (CHI575 ... 003.10. 2 Homology vs DNA Score E Sequences producing s ignificant alignments: (bits) Value N AC116956 |AC ... 12. 7 Homology vs Protein Score E Sequences producing s ignificant alignments: (bits) Value (Q86KD1) RecNa ...

  19. Draped heterogeneity, forced uniformity: when agro-environmental policies drive family development: The U Minh Thượng forest reserve, (Mekong delta, Vietnam)

    OpenAIRE

    Saqalli, Mehdi; Dosso, Mireille

    2011-01-01

    The U Minh Thượng natural reserve was created during the 1990s with a surrounding buffer zone where 3,500 households have been settled between 1992 and 1995, each household on a lot of 4 hectares. From a social point of view, the settlers were selected as 'poor people' or war veterans. A social discrimination was slowly built in favour of the latter. Despite an apparent homogeneity, the environment shows slight variations which has huge effects on the potential of the lots. From 1992 to 1998,...

  20. Use of dipole sum rules to estimate upper and lower bounds for radiative and total widths of chi (3414), chi (3508), and chi (3552)

    International Nuclear Information System (INIS)

    Upper and lower bounds on the widths for chi/sub J/→γpsi (3095) can be estimated by assuming E1 transitions and approximate Russell-Saunders coupling for the cc-bar system. Experimental widths for psi (3684) →γchi/sub J/ the lower bound more restrictive, giving radiative widths of 160→240, 230→400, and 280→480 keV for 3414-, 3508-, and 3552-MeV states, respectively. Cascade branching ratio data permit estimation of the total widths as >1.6, 0.3-1.5, and 0.6-4 MeV, respectively

  1. Tai chi: physiological characteristics and beneficial effects on health

    OpenAIRE

    Li, J.; Hong, Y.; Chan, K.

    2001-01-01

    Objectives—To assess the characteristic effects of Tai Chi Chuan (TCC) exercise on metabolism and cardiorespiratory response, and to measure its effect on cardiorespiratory function, mental control, immune capacity, and the prevention of falls in elderly people.

  2. Dicty_cDB: CHI228 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI228 (Link to dictyBase) - - - Contig-U16517-1 - (Link to Original site) ... *edmqvqv* ekviy*elkiffhlqevllnvvykvfqifilninhyymif*ivf *rtn*kkplihtyqql nqerdhkm*lylwlvvslmkrh*pftllil*ilv ...

  3. Tai Chi Chuan Exercise for Patients with Cardiovascular Disease

    OpenAIRE

    Ching Lan; Ssu-Yuan Chen; May-Kuen Wong; Jin Shin Lai

    2013-01-01

    Exercise training is the cornerstone of rehabilitation for patients with cardiovascular disease (CVD). Although high-intensity exercise has significant cardiovascular benefits, light-to-moderate intensity aerobic exercise also offers health benefits. With lower-intensity workouts, patients may be able to exercise for longer periods of time and increase the acceptance of exercise, particularly in unfit and elderly patients. Tai Chi Chuan (Tai Chi) is a traditional Chinese mind-body exercise. T...

  4. Tai Chi Quan and Stroke Prevention and Rehabilitation

    OpenAIRE

    Yoshinaga, Shuri; Cai, Dingfang

    2013-01-01

    Stroke is a major cause of mortality and disability across the globe and remains the third leading cause of death in China, with the total stroke incidence increasing 6.7% annually from 1984 to 2004. The prevention of strokes is more important than their treatment. Tai Chi Quan is a slow and graceful Chinese exercise that includes a form of mindful meditation known for its health benefits. Many studies have shown that Tai Chi Quan not only improves gait, balance cap...

  5. Dicty_cDB: CHI718 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI718 (Link to dictyBase) - G20569 DDB0188420 Contig-U11787-1 CHI718P (Lin ... 4 (Q9QZ71) RecName: Full=Xenotropic and polytropic retrovirus ... rece... 82 2e-14 (Q9R031) RecName: Full=Xenotropic ... and polytropic retrovirus ... rece... 82 2e-14 AF131096_1( AF131096 |pid:none) M ...

  6. CHI '13 Extended Abstracts on Human Factors in Computing Systems

    DEFF Research Database (Denmark)

    The CHI Papers and Notes program is continuing to grow along with many of our sister conferences. We are pleased that CHI is still the leading venue for research in human-computer interaction. CHI 2013 continued the use of subcommittees to manage the review process. Authors selected the subcommit......The CHI Papers and Notes program is continuing to grow along with many of our sister conferences. We are pleased that CHI is still the leading venue for research in human-computer interaction. CHI 2013 continued the use of subcommittees to manage the review process. Authors selected the...... tremendous amount of work from all areas of the human-computer interaction community. As co-chairs of the process, we are amazed at the ability of the community to organize itself to accomplish this task. We would like to thank the 2680 individual reviewers for their careful consideration of these papers. We...... that you enjoy these papers and notes, which represent the best research in human-computer interaction....

  7. Effects of the hanging wall and footwall on peak acceleration during the Jiji (Chi-Chi), Taiwan Province, earthquake

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    The M=7.6 Jiji (Chi-Chi) earthquake, Taiwan Province, on September 21, 1999 (local time) is a thrust fault style earthquake. The empirical attenuation relations of the horizontal and vertical peak ground accelerations (PGA) for the Jiji (Chi-Chi) earthquake are developed by regression method. By examining the residuals from the Jiji (Chi-Chi) earthquake-specific peak acceleration attenuation relations, it is found that there are systematic differences between PGA on the hanging-wall and footwall. The recorded peak accelerations are higher on the hanging-wall and lower on the footwall. The clear asymmetry of PGA distribution to the surface rupture trace can also be seen from the PGA contour map. These evidences indicate that the PGA attenuates faster on the hanging-wall than on the footwall. In the study of near-source strong motion, seismic hazard assessment, scenario earthquake and seis-mic disaster prediction, the style-of-faulting must be considered in order that the attenuation model can reflect the characteristic of ground motion in various seismic environmental regions.

  8. Physiological responses to Tai Chi in stable patients with COPD.

    Science.gov (United States)

    Qiu, Zhi-Hui; Guo, Hong-Xi; Lu, Gan; Zhang, Ning; He, Bai-Ting; Zhou, Lian; Luo, Y M; Polkey, M I

    2016-01-15

    We compared the physiological work, judged by oxygen uptake, esophageal pressure swing and diaphragm electromyography, elicited by Tai Chi compared with that elicited by constant rate treadmill walking at 60% of maximal load in eleven patients with COPD (Mean FEV1 61% predicted, FEV1/FVC 47%). Dynamic hyperinflation was assessed by inspiratory capacity and twitch quadriceps tension (TwQ) elicited by supramaximal magnetic stimulation of the femoral nerve was also measured before and after both exercises. The EMGdi and esophageal pressure at the end of exercise were similar for both treadmill exercise and Tai Chi (0.109±0.047 mV vs 0.118±0.061 mV for EMGdi and 22.3±7.1 cmH2O vs 21.9±8.1 cmH2O for esophageal pressure). Moreover the mean values of oxygen uptake during Tai Chi and treadmill exercise did not differ significantly: 11.3 ml/kg/min (51.1% of maximal oxygen uptake derived from incremental exercise) and 13.4 ml/kg/min (52.5%) respectively, p>0.05. Respiratory rate during Tai Chi was significantly lower than that during treadmill exercise. Both Tai Chi and treadmill exercise elicited a fall in IC at end exercise, indicating dynamic hyperinflation, but this was statistically significant only after treadmill exercise. TwQ decreased significantly after Tai Chi but not after treadmill. We conclude that Tai Chi constitutes a physiologically similar stimulus to treadmill exercise and may therefore be an acceptable modality for pulmonary rehabilitation which may be culturally more acceptable in some parts of the world. PMID:26549554

  9. Health Risk Assessment of Mobility-Related Air Pollution in Ha Noi, Vietnam

    OpenAIRE

    Vu Van Hieu; Le Xuan Quynh; Pham Ngoc Ho; Luc Hens

    2013-01-01

    Hanoi is the capital city of Vietnam and the second largest city of the country, just behind Ho Chi Minh City. During the last two decades, Hanoi developed fast and expanded steadily. Since the city acquired large parts of the surrounding provinces in 2008, Hanoi tripled its size and doubled its population. The new development aims to spread the concentrated population and economic activities to alleviate the stress caused by pollution and the decreasing quality of life of the residents....

  10. A CHI wiggler ubitron amplifier experiment: Wiggler characterization

    Energy Technology Data Exchange (ETDEWEB)

    Taccetti, J.M.; Jackson, R.H.; Freund, H.P. [Naval Research Lab., Washington, DC (United States)] [and others

    1995-12-31

    A 35 GHz CHI (Coaxial Hybrid Iron) wiggler ubitron amplifier experiment is under construction at the Naval Research Laboratory. The CHI wiggler configuration has the potential of generating high wiggler magnetic fields at short periods with excellent beam focusing and transport properties. This makes it a desirable configuration for the generation of high power coherent radiation in relatively compact systems. The CHI wiggler consists of alternating rings of magnetic and non-magnetic materials concentric with a central rod of similar alternating design but shifted along the axis by half a period. Once inserted in a solenoidal magnetic field, the CHI structure deforms the axial field to create a radial field oscillating with the same periodicity as the rings. An annular electron beam is propagated through the coaxial gap where the oscillating radial field imparts an azimuthal wiggle motion. The principal goals of the experiment are to investigate the performance tradeoffs involved in the CHI configuration for high frequency amplifiers operating at low voltages with small wiggler periods. The nominal design parameters are a center frequency of 35 GHz, wiggler period of 0.75 cm, and beam voltage of approximately 150 kV. Calculations have shown an intrinsic (untapered) efficiency of {approximately} 7% when operating at 6.3 kG axial field (wiggler field, B{sub w}{approximately}1270 G). The calculated gain was 36 dB, saturating at a distance of 46 cm. These parameters yield an instantaneous amplifier bandwidth of {approximately} 25%. There appears to be room for further improvement in efficiency, a matter which will be scrutinized more closely in the final design. A prototype CHI wiggler is presently being fabricated for use in conjunction with an existing 30 kG superconducting solenoid. The performance properties of the prototype will be characterized and compared with linear and non-linear calculations.

  11. Observation of B0 -> chi_c0 K*0 and Evidence of B+ -> chi_c0 K*+

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, : B.

    2008-08-13

    The authors present the observation of the decay B{sup 0} {yields} {chi}{sub c0}K*{sup 0} as well as evidence of B{sup +} {yields} {chi}{sub c0}K*{sup +}, with an 8.9 and a 3.6 standard deviation significance, respectively, using a data sample of 454 million {Upsilon}(4S) {yields} B{bar B} decays collected with the BABAR detector at the PEP-II B meson factory located at the Standard Linear Accelerator Center (SLAC). The measured branching fractions are: {Beta}(B{sup 0} {yields} {chi}{sub c0}K*{sup 0}) = (1.7 {+-} 0.3 {+-} 0.2) x 10{sup -4} and {Beta}(B{sup +} {yields} {chi}{sub c0}K*{sup +}) = (1.4 {+-} 0.5 {+-} 0.2) x 10{sup -4}, where the first quoted errors are statistical and the second are systematic. They obtain a branching fraction upper limit of {Beta}(B{sup +} {yields} {chi}{sub c0}K*{sup +}) < 2.1 x 10{sup -4} at the 90% confidence level.

  12. Chi-squared goodness of fit tests with applications

    CERN Document Server

    Balakrishnan, N; Nikulin, MS

    2013-01-01

    Chi-Squared Goodness of Fit Tests with Applications provides a thorough and complete context for the theoretical basis and implementation of Pearson's monumental contribution and its wide applicability for chi-squared goodness of fit tests. The book is ideal for researchers and scientists conducting statistical analysis in processing of experimental data as well as to students and practitioners with a good mathematical background who use statistical methods. The historical context, especially Chapter 7, provides great insight into importance of this subject with an authoritative author team

  13. Dicty_cDB: CHI642 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI642 (Link to dictyBase) - - - Contig-U14351-1 CHI642E (Link to Original ... 37 (Q4G069) RecName: Full=Regulator of microtubule dynamics ... protein... 154 3e-36 AF151848_1( AF151848 |pid:non ... 36 (Q96DB5) RecName: Full=Regulator of microtubule dynamics ... protein... 153 5e-36 (Q5R8E4) RecName: Full=Regula ...

  14. The Shape of the Noncentral Chi-square Density

    CERN Document Server

    Yu, Yaming

    2011-01-01

    A noncentral chi-square density is log-concave if the degree of freedom is nu>=2. We complement this known result by showing that, for each 00 such that the chi-square with nu degrees of freedom and noncentrality parameter lambda has a decreasing density if lambda <= lambda_nu, and is bi-modal otherwise. The critical lambda_nu is characterized by an equation involving a ratio of modified Bessel functions. When an interior mode exists we derive precise bounds on its location.

  15. Chi-squared and Associations in Tabular Audiology Data

    OpenAIRE

    Muhammad N. Anwar; Michael P. Oakes; Ken McGarry

    2010-01-01

    In this paper, we have used the chi-squared test and Yule’s Q measure to discover associations in tables of patient audiology data. These records are examples of heterogeneous medical records, since they contain audiograms, textual notes and typical relational fields. In our first experiment we used the chi-squared measure to discover associations between the different fields of audiology data such as patient gender and patient age with diagnosis. Then, in our second experiment we used Yule’s...

  16. Dicty_cDB: CHI478 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI478 (Link to dictyBase) - G01678 DDB0185605 Contig-U11784-1 CHI478P (Lin ... lis melanin b... 82 4e-14 ( P07524 ) RecName: Full=Tyrosinase ; EC=1.14.18.1; AltNam... 81 9e-14 AP009493_2447( A ... us subsp. gri... 80 2e-13 ( P06845 ) RecName: Full=Tyrosinase ; EC=1.14.18.1; AltNam... 79 4e-13 A24089( A24089 ) ...

  17. A Study on Corporate Governance of Vietnamese Firms

    OpenAIRE

    Phung, Dinh Trong; Toma, Masayoshi

    2016-01-01

    Based on the result of actual survey concerning corporate governance of Japanese companies conducted by study group at Wako University, a short survey was conducted at four companies in Ho Chi Minh City, Vietnam. Through this survey, this paper introduces briefly about corporate governance of Vietnamese companies and notes some differences of corporate governance between Japanese companies and Vietnamese companies.

  18. Factors Affecting English Language Teaching and Learning in Higher Education

    Science.gov (United States)

    Nguyen, Hong Thi; Warren, Wendy; Fehring, Heather

    2014-01-01

    This paper reports part of a study that aims to explore factors affecting the efficacy of non-major English teaching and learning in Vietnamese higher education through an investigation of classroom practices. Eight non-participant class observations were conducted at HUTECH University, Ho Chi Minh City, Vietnam. The study's findings show that…

  19. Neighbors in Trade

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    China’s Guangxi Zhuang Autonomous Region has achieved rapid growth in its trade with the neighboring Viet Nam Lai Kim is chairman of Binh Tan Consumer Goods Manufacturing Ltd. in Viet Nam’s Ho Chi Minh City. Producing rubber slippers, as well as

  20. Solar radiation in atmospheric condition and possibility of nanotechnology to improve the efficiency of solar cells on the base of hydrogenated silicon

    Czech Academy of Sciences Publication Activity Database

    Stuchlík, Jiří; Pham, M.T.; Pham, K.T.; Müller, Martin; Purkrt, Adam; Remeš, Zdeněk; Stuchlíková, The-Ha

    Ho Chi Minh City: Viet Nam National University, 2015, s. 270-274. [International Workshop on Nanotechnology and Application /5./ (IWNA 2015). Vung Tau (VN), 11.11.2015-14.11.2015] R&D Projects: GA MŠk LH12236 Institutional support: RVO:68378271 Keywords : solar radiation * hydrogenated silicon * embedded nanoparticles Subject RIV: BM - Solid Matter Physics ; Magnetism

  1. Stock Market Efficiency in Thin Trading Markets: The Case of the Vietnamese Stock Market

    NARCIS (Netherlands)

    Dong Loc, T.; Lanjouw, G.; Lensink, B.W.

    2010-01-01

    This article reviews developments in the Stock Trading Centre (STC) in Ho Chi Minh City, Vietnam, the main stock market in the country, since its start in 2000. It presents information about developments in the number of stocks traded, trading activity and stock-price developments. This article focu

  2. Stock-market efficiency in thin-trading markets : the case of the Vietnamese stock market

    NARCIS (Netherlands)

    Truong Dong Loc, [No Value; Lanjouw, Ger; Lensink, Robert

    2010-01-01

    This article reviews developments in the Stock Trading Centre (STC) in Ho Chi Minh City, Vietnam, the main stock market in the country, since its start in 2000. It presents information about developments in the number of stocks traded, trading activity and stock-price developments. This article focu

  3. Firm-Specific Marketing Capital and Job Satisfaction of Marketers: Evidence from Vietnam

    Science.gov (United States)

    Nguyen, Tho D.; Nguyen, Trang T. M.

    2011-01-01

    Purpose: Based on the resource-based view of the firm, this study aims to examine antecedents and outcomes of firm-specific marketing capital pool invested by marketers in a transition market, Vietnam. Design/methodology/approach: A sample of 528 marketers in Ho Chi Minh City was surveyed to test the theoretical model. Structural equation…

  4. EFL Teaching and Learning at a Vietnamese University: What Do Teachers Say?

    Science.gov (United States)

    Nguyen, Hong Thi; Fehring, Heather; Warren, Wendy

    2015-01-01

    This paper reports part of a study that documents the factors affecting the efficacy of teaching and learning English as a Foreign Language (EFL) in Vietnamese higher education from the teachers' perspectives. Individual face-to-face semi-structured interviews were conducted with twelve EFL teachers at Ho Chi Minh City University of Technology…

  5. Measurement of hadronic production of the chi /sub 1//sup ++/(3507) and the chi /sub 2//sup ++/(3553) through their radiative decay to J/ psi

    CERN Document Server

    Lemoigne, Y; Barate, R; Bareyre, P; Bonamy, P; Borgeaud, P; Brabson, B B; Crittenden, R R; David, M; Duane, A; Gentit, F X; Heinz, R M; King, G J; Krider, J; Laurens, G; Marshall, T; McEwen, J G; Namjoshi, R; Nandi, B C; Pietrzyk, B; Villet, G; Websdale, D M; Wiejak, J; Zaninotti, S

    1982-01-01

    The chi /sub 1//sup ++/(3507) and the chi /sub 2//sup ++/(3553) states have been observed in the Goliath spectrometer at the CERN SPS in 185 GeV/c\\pi^{-}-Be collisions. Their radiative decays contribute 27.7% (for the chi /sub 1//sup ++/) and 12.8% (for the chi /sub 2//sup ++/) to J/ psi production. At this energy, their cross sections are 65+or-19 nb and 96+or-29 nb, respectively.

  6. Anomalous effect in Schumann resonance phenomena observed in Japan, possibly associated with the Chi-chi earthquake in Taiwan

    Directory of Open Access Journals (Sweden)

    M. Hayakawa

    2005-06-01

    Full Text Available The Schumann resonance phenomenon has been monitored at Nakatsugawa (near Nagoya in Japan since the beginning of 1999, and due to the occurance of a severe earthquake (so-called Chi-chi earthquake on 21 September 1999 in Taiwan we have examined our Schumann resonance data at Nakatsugawa during the entire year of 1999. We have found a very anomalous effect in the Schumann resonance, possibly associated with two large land earthquakes (one is the Chi-chi earthquake and another one on 2 November 1999 (Chia-yi earthquake with a magnitude again greater than 6.0. Conspicuous effects are observed for the larger Chi-chi earthquake, so that we summarize the characteristics for this event. The anomaly is characterized mainly by the unusual increase in amplitude of the fourth Schumann resonance mode and a significant frequency shift of its peak frequency (~1.0Hz from the conventional value on the By magnetic field component which is sensitive to the waves propagating in the NS meridian plane. Anomalous Schumann resonance signals appeared from about one week to a few days before the main shock. Secondly, the goniometric estimation of the arrival angle of the anomalous signal is found to coincide with the Taiwan azimuth (the unresolved dual direction indicates toward South America. Also, the pulsed signals, such as the Q-bursts, were simultaneously observed with the "carrier" frequency around the peak frequency of the fourth Schumann resonance mode. The anomaly for the second event for the Chia-yi earthquake on 2 November had much in common. But, most likely due to a small magnitude, the anomaly appears one day before and lasts until one day after the main shock, with the enhancement at the fourth Schumann resonance mode being smaller in amplitude than the case of the Chi-chi earthquake. Yet, the other characteristics, including the goniometric direction finding result, frequency shift, etc., are nearly the same. Although the emphasis of

  7. Modulational instability in the nonlocal chi(2)-model

    DEFF Research Database (Denmark)

    Wyller, John Andreas; Krolikowski, Wieslaw; Bang, Ole;

    2007-01-01

    are recovered as the asymptotic limit of one of the branches of the plane waves (i.e. the adiabatic branch or the acoustic branch) of the full chi((2))-model by means of a singular perturbational approach. It is also proven that the stability results for the adiabatic branch continuously approach...

  8. Escape angles in bulk chi((2)) soliton interactions

    DEFF Research Database (Denmark)

    Johansen, Steffen Kjær; Bang, Ole; Sørensen, Mads Peter

    2002-01-01

    We develop a theory for nonplanar interaction between two identical type I spatial solitons propagating at opposite, but arbitrary transverse angles in quadratic nonlinear (or so-called chi((2))) bulk, media. We predict quantitatively the outwards escape angle, below which the solitons turn aroun...

  9. Dicty_cDB: CHI113 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI113 (Link to dictyBase) - - - Contig-U14338-1 - (Link to Original site) ... 37591_59( DQ437591 |pid:none) Variola virus strain Sumatra ... 1970... 33 3.0 AL844504_205( AL844504 |pid:none) P ...

  10. Dicty_cDB: CHI816 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI816 (Link to dictyBase) - G20190 DDB0202068 Contig-U14357-1 - (Link to O ... BD080275 |BD080275.1 Transgenic plant with altered morphology ... and endo-1,4-beta-glucanase gene, promoter and pro ...

  11. Bisimulation Lattice of Asymmetric Chi Calculus with Mismatch

    Institute of Scientific and Technical Information of China (English)

    Dong Xiaoju(董笑菊); Zhong Farong; Fu Yuxi

    2003-01-01

    This paper carries out a systematic investigation into the bisimulation lattice of asymmetric chi calculus with a mismatch combinator. It is shown that all the sixty three L-bisimilarities collapse to twelve distinct relations and they form a bisimulation lattice with respect to set inclusion. The top of the lattice coincides with the barbed bisimilarity.

  12. Dicty_cDB: CHI610 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI610 (Link to dictyBase) - - - Contig-U14350-1 - (Link to Original site) ... CFFFFFWI*kk--- Translated Amino Acid sequence (All Frames ) Frame A: nsnthlthysqkkk**ink**in*ink*nfihi*lnfls* ...

  13. Measurement of $\\chi_{c1}$ and $\\chi_{c2}$ production with $\\sqrt{s}=7$ TeV $pp$ collisions at ATLAS

    CERN Document Server

    Aad, Georges; Abbott, Brad; Abdallah, Jalal; Abdel Khalek, Samah; Abdinov, Ovsat; Aben, Rosemarie; Abi, Babak; Abolins, Maris; AbouZeid, Ossama; Abramowicz, Halina; Abreu, Henso; Abulaiti, Yiming; Acharya, Bobby Samir; Adamczyk, Leszek; Adams, David; Addy, Tetteh; Adelman, Jahred; Adomeit, Stefanie; Adye, Tim; Aefsky, Scott; Agatonovic-Jovin, Tatjana; Aguilar-Saavedra, Juan Antonio; Agustoni, Marco; Ahlen, Steven; Ahmad, Ashfaq; Ahmadov, Faig; Aielli, Giulio; Åkesson, Torsten Paul Ake; Akimoto, Ginga; Akimov, Andrei; Alam, Muhammad Aftab; Albert, Justin; Albrand, Solveig; Alconada Verzini, Maria Josefina; Aleksa, Martin; Aleksandrov, Igor; Alessandria, Franco; Alexa, Calin; Alexander, Gideon; Alexandre, Gauthier; Alexopoulos, Theodoros; Alhroob, Muhammad; Aliev, Malik; Alimonti, Gianluca; Alio, Lion; Alison, John; Allbrooke, Benedict; Allison, Lee John; Allport, Phillip; Allwood-Spiers, Sarah; Almond, John; Aloisio, Alberto; Alon, Raz; Alonso, Alejandro; Alonso, Francisco; Altheimer, Andrew David; Alvarez Gonzalez, Barbara; Alviggi, Mariagrazia; Amako, Katsuya; Amaral Coutinho, Yara; Amelung, Christoph; Ammosov, Vladimir; Amor Dos Santos, Susana Patricia; Amorim, Antonio; Amoroso, Simone; Amram, Nir; Amundsen, Glenn; Anastopoulos, Christos; Ancu, Lucian Stefan; Andari, Nansi; Andeen, Timothy; Anders, Christoph Falk; Anders, Gabriel; Anderson, Kelby; Andreazza, Attilio; Andrei, George Victor; Anduaga, Xabier; Angelidakis, Stylianos; Anger, Philipp; Angerami, Aaron; Anghinolfi, Francis; Anisenkov, Alexey; Anjos, Nuno; Annovi, Alberto; Antonaki, Ariadni; Antonelli, Mario; Antonov, Alexey; Antos, Jaroslav; Anulli, Fabio; Aoki, Masato; Aperio Bella, Ludovica; Apolle, Rudi; Arabidze, Giorgi; Aracena, Ignacio; Arai, Yasuo; Arce, Ayana; Arfaoui, Samir; Arguin, Jean-Francois; Argyropoulos, Spyridon; Arik, Engin; Arik, Metin; Armbruster, Aaron James; Arnaez, Olivier; Arnal, Vanessa; Arslan, Ozan; Artamonov, Andrei; Artoni, Giacomo; Asai, Shoji; Asbah, Nedaa; Ask, Stefan; Åsman, Barbro; Asquith, Lily; Assamagan, Ketevi; Astalos, Robert; Astbury, Alan; Atkinson, Markus; Atlay, Naim Bora; Auerbach, Benjamin; Auge, Etienne; Augsten, Kamil; Aurousseau, Mathieu; Avolio, Giuseppe; Azuelos, Georges; Azuma, Yuya; Baak, Max; Bacci, Cesare; Bach, Andre; Bachacou, Henri; Bachas, Konstantinos; Backes, Moritz; Backhaus, Malte; Backus Mayes, John; Badescu, Elisabeta; Bagiacchi, Paolo; Bagnaia, Paolo; Bai, Yu; Bailey, David; Bain, Travis; Baines, John; Baker, Oliver Keith; Baker, Sarah; Balek, Petr; Balli, Fabrice; Banas, Elzbieta; Banerjee, Swagato; Banfi, Danilo; Bangert, Andrea Michelle; Bansal, Vikas; Bansil, Hardeep Singh; Barak, Liron; Baranov, Sergei; Barber, Tom; Barberio, Elisabetta Luigia; Barberis, Dario; Barbero, Marlon; Barillari, Teresa; Barisonzi, Marcello; Barklow, Timothy; Barlow, Nick; Barnett, Bruce; Barnett, Michael; Baroncelli, Antonio; Barone, Gaetano; Barr, Alan; Barreiro, Fernando; Barreiro Guimarães da Costa, João; Bartoldus, Rainer; Barton, Adam Edward; Bartos, Pavol; Bartsch, Valeria; Bassalat, Ahmed; Basye, Austin; Bates, Richard; Batkova, Lucia; Batley, Richard; Battistin, Michele; Bauer, Florian; Bawa, Harinder Singh; Beau, Tristan; Beauchemin, Pierre-Hugues; Beccherle, Roberto; Bechtle, Philip; Beck, Hans Peter; Becker, Anne Kathrin; Becker, Sebastian; Beckingham, Matthew; Beddall, Andrew; Beddall, Ayda; Bedikian, Sourpouhi; Bednyakov, Vadim; Bee, Christopher; Beemster, Lars; Beermann, Thomas; Begel, Michael; Behr, Katharina; Belanger-Champagne, Camille; Bell, Paul; Bell, William; Bella, Gideon; Bellagamba, Lorenzo; Bellerive, Alain; Bellomo, Massimiliano; Belloni, Alberto; Beloborodova, Olga; Belotskiy, Konstantin; Beltramello, Olga; Benary, Odette; Benchekroun, Driss; Bendtz, Katarina; Benekos, Nektarios; Benhammou, Yan; Benhar Noccioli, Eleonora; Benitez Garcia, Jorge-Armando; Benjamin, Douglas; Bensinger, James; Benslama, Kamal; Bentvelsen, Stan; Berge, David; Bergeaas Kuutmann, Elin; Berger, Nicolas; Berghaus, Frank; Berglund, Elina; Beringer, Jürg; Bernard, Clare; Bernat, Pauline; Bernhard, Ralf; Bernius, Catrin; Bernlochner, Florian Urs; Berry, Tracey; Berta, Peter; Bertella, Claudia; Bertolucci, Federico; Besana, Maria Ilaria; Besjes, Geert-Jan; Bessidskaia, Olga; Besson, Nathalie; Bethke, Siegfried; Bhimji, Wahid; Bianchi, Riccardo-Maria; Bianchini, Louis; Bianco, Michele; Biebel, Otmar; Bieniek, Stephen Paul; Bierwagen, Katharina; Biesiada, Jed; Biglietti, Michela; Bilbao De Mendizabal, Javier; Bilokon, Halina; Bindi, Marcello; Binet, Sebastien; Bingul, Ahmet; Bini, Cesare; Bittner, Bernhard

    2014-01-01

    The prompt and non-prompt production cross-sections for the $\\chi_{c1}$ and $\\chi_{c2}$ charmonium states are measured in $pp$ collisions at $\\sqrt{s}=7$ TeV with the ATLAS detector at the LHC using 4.5 fb-1 of integrated luminosity. The $\\chi_{c}$ states are reconstructed through the radiative decay $\\chi_{c}\\rightarrow J/\\psi\\,\\gamma$ (with $J/\\psi\\rightarrow\\mu^{+}\\mu^{-}$) where photons are reconstructed from $\\gamma\\rightarrow e^{+}e^{-}$ conversions. The production rate of the $\\chi_{c2}$ state relative to the $\\chi_{c1}$ state is measured for prompt and non-prompt $\\chi_{c}$ as a function of $J/\\psi$ transverse momentum. The prompt $\\chi_{c}$ cross-sections are combined with existing measurements of prompt $J/\\psi$ production to derive the fraction of prompt $J/\\psi$ produced in feed-down from $\\chi_{c}$ decays. The fractions of $\\chi_{c1}$ and $\\chi_{c2}$ produced in $b$-hadron decays are also measured. In addition to measurements of inclusive $\\chi_{c}$ production, the branching fraction ${\\cal B}(B^...

  14. Education Cities

    Science.gov (United States)

    Shaked, Haim

    2014-01-01

    In recent years, several cities in Israel have labeled themselves "Education Cities," concentrating on education as their central theme. Employing qualitative techniques, this article aims to describe, define, and conceptualize this phenomenon as it is being realized in three such cities. Findings show that Education Cities differ from…

  15. Image city

    DEFF Research Database (Denmark)

    2003-01-01

    Image city exhibition explores a condition of mediation, through a focus on image and sound narratives with a point of departure on a number of Asian cities.......Image city exhibition explores a condition of mediation, through a focus on image and sound narratives with a point of departure on a number of Asian cities....

  16. Measurement of the $\\chi_b(3P)$ mass and of the relative rate of $\\chi_{b1}(1P)$ and $\\chi_{b2}(1P)$ production

    CERN Document Server

    Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Bjørnstad, Pål Marius; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brambach, Tobias; van den Brand, Johannes; Bressieux, Joël; Brett, David; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Brown, Henry; Bursche, Albert; Busetto, Giovanni; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Ciba, Krzystof; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cojocariu, Lucian; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Counts, Ian; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pascal; David, Pieter; Davis, Adam; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Di Canto, Angelo; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dreimanis, Karlis; Dujany, Giulio; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gavrilov, Gennadii; Geraci, Angelo; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Gianì, Sebastiana; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, Vladimir; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hunt, Philip; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jaton, Pierre; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kelsey, Matthew; Kenyon, Ian; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kozlinskiy, Alexandr; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leo, Sabato; Leroy, Olivier; Lesiak, Tadeusz; Lespinasse, Mickael; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Lohn, Stefan; Longstaff, Iain; Lopes, Jose; Lopez-March, Neus; Lowdon, Peter; Lu, Haiting; Lucchesi, Donatella; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martens, Aurelien; Martín Sánchez, Alexandra; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Moggi, Niccolò; Molina Rodriguez, Josue; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Katharina; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Oggero, Serena; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Orlandea, Marius; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Perrin-Terrin, Mathieu; Pescatore, Luca; Pesen, Erhan; Petridis, Konstantin; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Poluektov, Anton; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Roa Romero, Diego; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruiz, Hugo; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Sparkes, Ailsa; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Subbiah, Vijay Kartik; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Whitehead, Mark; Wicht, Jean; Wiedner, Dirk; Wilkinson, Guy; Williams, Matthew; Williams, Mike; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wu, Suzhi; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zvyagin, Alexander

    2014-01-01

    The production of $\\chi_b$ mesons in proton-proton collisions is studied using a data sample collected by the LHCb detector, at centre-of-mass energies of $\\sqrt{s}=7$ and $8$ TeV and corresponding to an integrated luminosity of 3.0 fb$^{-1}$. The $\\chi_b$ mesons are identified through their decays to $\\Upsilon(1S)\\gamma$ and $\\Upsilon(2S)\\gamma$ using photons that converted to $e^+e^-$ pairs in the detector. The $\\chi_b(3P)$ meson mass, and the relative prompt production rate of $\\chi_{b1}(1P)$ and $\\chi_{b2}(1P)$ mesons as a function of the $\\Upsilon(1S)$ transverse momentum in the $\\chi_b$ rapidity range 2.0< $y$<4.5, are measured. Assuming a mass splitting between the $\\chi_{b1}(3P)$ and the $\\chi_{b2}(3P)$ states of 10.5 MeV/$c^2$, the mass of the $\\chi_{b1}(3P)$ meson is \\begin{equation*} m(\\chi_{b1}(3P))= 10515.7^{+2.2}_{-3.9}(stat) ^{+1.5}_{-2.1}(syst) MeV/c^2. \\end{equation*}

  17. Escape angles in bulk chi((2)) soliton interactions

    OpenAIRE

    Johansen, Steffen Kjær; Bang, Ole; Sørensen, Mads Peter

    2002-01-01

    We develop a theory for nonplanar interaction between two identical type I spatial solitons propagating at opposite, but arbitrary transverse angles in quadratic nonlinear (or so-called chi((2))) bulk, media. We predict quantitatively the outwards escape angle, below which the solitons turn around and collide, and above which they continue to move-away from each other. For in-plane interaction, the theory allows prediction of the Outcome of a collision through the inwards escape angle, i.e., ...

  18. Feynman Rules of Higher-order Poles in CHY Construction

    CERN Document Server

    Huang, Rijun; Luo, Ming-xing; Zhu, Chuan-Jie

    2016-01-01

    In this paper, we generalize the integration rules for scattering equations to situations where higher-order poles are present. We describe the strategy to deduce the Feynman rules of higher-order poles from known analytic results of simple CHY-integrands, and propose the Feynman rules for single double pole and triple pole as well as duplex-double pole and triplex-double pole structures. We demonstrate the validation and strength of these rules by ample non-trivial examples.

  19. An Advanced Dictionary? Similarities and Differences between Duramazwi ReChiShona and Duramazwi Guru ReChiShona *

    Directory of Open Access Journals (Sweden)

    Emmanuel Chabata

    2011-10-01

    Full Text Available

    Abstract: In this article a comparative analysis of Duramazwi ReChiShona (DRC and Duramazwi Guru ReChiShona (DGC is made. Both DRC and DGC are monolingual Shona dictionaries compiled by a team of researchers under the African Languages Lexical (ALLEX Project, now the African Languages Research Institute (ALRI. During the compilation process, DRC was known as the General Shona Dictionary and DGC as the Advanced Shona Dictionary. A simple analysis of these titles shows that the dictionaries are similar in some ways and also different in others. The writer tries to show the ways in which DGC is regarded as a more advanced dictionary when compared to DRC. Although the argument of the article is mainly built on those differences which make DGC the more advanced, attention is also paid to the similarities between the dictionaries.

    Keywords: ALLEX PROJECT, ALRI, DURAMAZWI RECHISHONA, DURAMAZWI GURU RECHISHONA, DICTIONARY, SHONA, HEADWORD, SENSE, MONOLINGUAL DICTIONARY, CORPUS, IDIOM, PROVERB, PITHY SAYING

    Opsomming: 'n Gevorderde woordeboek? Ooreenkomste en verskille tussen Duramazwi ReChiShona en Duramazwi Guru ReChiShona. In hierdie artikel word 'n vergelykende ontleding van Duramazwi ReChiShona (DRC en Duramazwi Guru ReChiShona (DGC gemaak. Sowel die DRC en DGC is eentalige Sjonawoordeboeke, saamgestel deur ?n span navorsers by die African Languages Lexical (ALLEX Project, tans die African Languages Research Institute (ALRI. Gedurende die samestellingsproses was DRC bekend as die Algemene Sjonawoordeboek en DGC as die Gevorderde Sjonawoordeboek. 'n Eenvoudige ontleding van hierdie titels toon dat die woordeboeke op sommige maniere eenders en op ander ook verskillend is. Die skrywer probeer die maniere aantoon waarop DGC beskou word as 'n meer gevorderde woordeboek wanneer dit met DRC vergelyk word. Alhoewel die argument van die artikel hoofsaaklik gebou is op daardie verskille wat DGC die gevorderdste maak, word ook aandag gegee aan

  20. Tai Chi Chuan and Qigong in scientific research: present and future. [Tai Chi Chuan y Qigong en el ámbito científico: presente y futuro].

    Directory of Open Access Journals (Sweden)

    Pedro Jesús Jiménez-Martín

    2014-04-01

    Full Text Available Introduction Asian natural health practices are increasingly present in the physical and sporting habits of the Western population. In particular, the Tai Chi Chuan (TCC and Qigong (QG have become an everyday activity that can be performed both in parks and sports facilities in Western cities. The impact of these activities on a global level is very difficult to measure, however, given the lack of statistics on the number of practitioners, associations and existing schools. The degree of acceptance that these disciplines have achieved can be measured by the number of informative publications about them. According to the study by Perez and Gutierrez (2008, 215 (62.3 % of the 345 papers published between 1960 and 2006 on Chinese martial arts were on QG, and 115 (33.3 % papers were on TCC, implying that both practices represented 95.6 percent of these publications. More importantly, during the 1990-1999 and 2000-2006 time periods, TCC came to occupy the top of monographs published, ahead of the rest of all forms of Chinese, Japanese and Korean martial arts; during the last time period, QG represented the third most published. According to the authors, the rise of this activity can be attributed to motivation changes for sports. Health, personal development, education, and socialization, as opposed to competition, have become increasingly important goals, which both TCC and QG fit perfectly.

  1. Amplitude analyses of the decays chi_c1 -> eta pi+ pi- and chi_c1 -> eta' pi+ pi-

    CERN Document Server

    Adams, G S; Ecklund, K M; Insler, J; Muramatsu, H; Park, C S; Pearson, L J; Thorndike, E H; Ricciardi, S; Thomas, C; Artuso, M; Blusk, S; Mountain, R; Skwarnicki, T; Stone, S; Zhang, L M; Bonvicini, G; Cinabro, D; Lincoln, A; Smith, M J; Zhou, P; Zhu, J; Naik, P; Rademacker, J; Asner, D M; Edwards, K W; Randrianarivony, K; Tatishvili, G; Briere, R A; Vogel, H; Onyisi, P U E; Rosner, J L; Alexander, J P; Cassel, D G; Das, S; Ehrlich, R; Gibbons, L; Gray, S W; Hartill, D L; Heltsley, B K; Kreinick, D L; Kuznetsov, V E; Patterson, J R; Peterson, D; Riley, D; Ryd, A; Sadoff, A J; Shi, X; Sun, W M; Yelton, J; Rubin, P; Lowrey, N; Mehrabyan, S; Selen, M; Wiss, J; Libby, J; Kornicer, M; Mitchell, R E; Shepherd, M R; Szczepaniak, A; Besson, D; Pedlar, T K; Cronin-Hennessy, D; Hietala, J; Dobbs, S; Metreveli, Z; Seth, K K; Tomaradze, A; Xiao, T; Martin, L; Powell, A; Wilkinson, G; Ge, J Y; Miller, D H; Shipsey, I P J; Xin, B

    2011-01-01

    Using a data sample of 2.59 x 10^7 psi(2S) decays obtained with the CLEO-c detector, we perform amplitude analyses of the complementary decay chains chi_c1 -> eta pi+ pi- and chi_c1 -> eta' pi+ pi-. We find evidence for a P-wave eta' pi scattering amplitude, which, if interpreted as a resonance, would have exotic J^PC = 1^-+ and parameters consistent with the pi_1(1600) state reported in other production mechanisms. We also make the first observation of the decay a_0(980) -> eta' pi and measure the ratio of branching fractions B(a_0(980) -> eta' pi)/B(a_0(980) -> eta pi) = 0.064 +- 0.014 +- 0.014. The pi pi spectrum produced with a recoiling eta is compared to that with eta' recoil.

  2. Beer City

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    Shandong Province’s Qingdao is becoming China’s great beer city sicenically located on a peninsula over-looking the Pacific Ocean, Qingdao, |or Tsingtao, is a coastal city soaked in two kinds of foam. One floats in

  3. Ideal Cities

    OpenAIRE

    Meitner, Erika

    2012-01-01

    Erika Meitner discusses her new book: Ideal Cities. This collection of autobiographical narrative and lyric poems explores the relationship between body and place—specifically the pleasures and dangers of women’s corporeal experiences. Ideal Cities is guided by an epigraph from Song of Songs, and the metaphorical idea of bodies as cities, and cities as bodies. How do women’s bodies become sites of inscription via sex, childbirth, and other highly physical acts? These poems also investigate ur...

  4. Sin City?

    OpenAIRE

    Gautier, Pieter A; Svarer, Michael; Teulings, Coen N.

    2007-01-01

    Is moving to the countryside a credible commitment device for couples? Weinvestigate whether lowering the arrival rate of potential alternative partners bymoving to a less populated area lowers the dissolution risk for a sample of Danishcouples. We find that of the couples who married in the city, the ones who stay inthe city have significant higher divorce rates. Similarly, for the couples who marriedoutside the city, the ones who move to the city are more likely to divorce. Thiscorrelation ...

  5. Measurement of the Branching Fraction for B+- --> chi_c0 K+-

    CERN Document Server

    Aubert, B; Boutigny, D; Gaillard, J M; Hicheur, A; Karyotakis, Yu; Lees, J P; Robbe, P; Tisserand, V; Zghiche, A; Palano, A; Pompili, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Borgland, A W; Breon, A B; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Day, C T; Gill, M S; Gritsan, A V; Groysman, Y; Jacobsen, R G; Kadel, R W; Kadyk, J; Kerth, L T; Kolomensky, Yu G; Kral, J F; Kukartsev, G; Le Clerc, C; Levi, M E; Lynch, G; Mir, L M; Oddone, P J; Orimoto, T J; Pripstein, M; Roe, N A; Romosan, A; Ronan, Michael T; Shelkov, V G; Telnov, A V; Wenzel, W A; Ford, K; Harrison, T J; Hawkes, C M; Knowles, D J; Morgan, S E; Penny, R C; Watson, A T; Watson, N K; Goetzen, K; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Peters, K; Schmücker, H; Steinke, M; Barlow, N R; Boyd, J T; Chevalier, N; Cottingham, W N; Kelly, M P; Latham, T E; MacKay, C; Wilson, F F; Abe, K; Çuhadar-Dönszelmann, T; Hearty, C; Mattison, T S; McKenna, J A; Thiessen, D; Kyberd, P; McKemey, A K; Blinov, V E; Bukin, A D; Golubev, V B; Ivanchenko, V N; Kravchenko, E A; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Yushkov, A N; Best, D; Bruinsma, M; Chao, M; Kirkby, D; Lankford, A J; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Buchanan, C; Hartfiel, B L; Shen, B C; Del Re, D; Hadavand, H K; Hill, E J; MacFarlane, D B; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Dahmes, B; Kuznetsova, N; Levy, S L; Long, O; Lu, A; Mazur, M A; Richman, J D; Verkerke, W; Beck, T W; Beringer, J; Eisner, A M; Heusch, C A; Lockman, W S; Schalk, T; Schmitz, R E; Schumm, B A; Seiden, A; Turri, M; Walkowiak, W; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dubois-Felsmann, G P; Dvoretskii, A; Hitlin, D G; Narsky, I; Porter, F C; Ryd, A; Samuel, A; Yang, S; Jayatilleke, S M; Mancinelli, G; Meadows, B T; Sokoloff, M D; Abe, T; Blanc, F; Bloom, P; Chen, S; Clark, P J; Ford, W T; Nauenberg, U; Olivas, A; Rankin, P; Roy, J; Smith, J G; Van Hoek, W C; Zhang, L; Harton, J L; Hu, T; Soffer, A; Toki, W H; Wilson, R J; Zhang, J; Altenburg, D; Brandt, T; Brose, J; Colberg, T; Dickopp, M; Dubitzky, R S; Hauke, A; Lacker, H M; Maly, E; Müller-Pfefferkorn, R; Nogowski, R; Otto, S; Schubert, J; Schubert, Klaus R; Schwierz, R; Spaan, B; Wilden, L; Bernard, D; Bonneaud, G R; Brochard, F; Cohen-Tanugi, J; Grenier, P; Thiebaux, C; Vasileiadis, G; Verderi, M; Khan, A; Lavin, D; Muheim, F; Playfer, S; Swain, J E; Andreotti, M; Azzolini, V; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Piemontese, L; Sarti, A; Treadwell, E; Anulli, F; Baldini-Ferroli, R; Biasini, M; Calcaterra, A; De Sangro, R; Falciai, D; Finocchiaro, G; Patteri, P; Peruzzi, I M; Piccolo, M; Pioppi, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Crosetti, G; Lo Vetere, M; Macri, M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Bailey, S; Morii, M; Won, E; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Eschrich, I; Gaillard, J R; Morton, G W; Nash, J A; Sanders, P; Taylor, G P; Grenier, G J; Lee, S J; Mallik, U; Cochran, J; Crawley, H B; Lamsa, J; Meyer, W T; Prell, S; Rosenberg, E I; Yi, J; Davier, M; Grosdidier, G; Höcker, A; Laplace, S; Le Diberder, F R; Lepeltier, V; Lutz, A M; Petersen, T C; Plaszczynski, S; Schune, M H; Tantot, L; Wormser, G; Brigljevic, V; Cheng, C H; Lange, D J; Wright, D M; Bevan, A J; Coleman, J P; Fry, J R; Gabathuler, Erwin; Gamet, R; Kay, M; Parry, R J; Payne, D J; Sloane, R J; Touramanis, C; Back, J J; Harrison, P F; Shorthouse, H W; Strother, P; Vidal, P B; Brown, C L; Cowan, G; Flack, R L; Flächer, H U; George, S; Green, M G; Kurup, A; Marker, C E; McMahon, T R; Ricciardi, S; Salvatore, F; Vaitsas, G; Winter, M A; Brown, D; Davis, C L; Allison, J; Barlow, R J; Forti, A C; Hart, P A; Hodgkinson, M C; Jackson, F; Lafferty, G D; Lyon, A J; Weatherall, J H; Williams, J C; Farbin, A; Jawahery, A; Kovalskyi, D; Lae, C K; Lillard, V; Roberts, D A; Blaylock, G; Dallapiccola, C; Flood, K T; Hertzbach, S S; Kofler, R; Koptchev, V B; Moore, T B; Saremi, S; Stängle, H; Willocq, S; Cowan, R; Sciolla, G; Taylor, F; Yamamoto, R K; Mangeol, D J J; Patel, P M; Lazzaro, A; Palombo, F; Bauer, J M; Cremaldi, L M; Eschenburg, V; Godang, R; Kroeger, R; Reidy, J; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Cote-Ahern, D; Hast, C; Taras, P; Nicholson, H; Cartaro, C; Cavallo, N; De Nardo, Gallieno; Fabozzi, F; Gatto, C; Lista, L; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M A; Raven, G; LoSecco, J M; Gabriel, T A; Brau, B; Gan, K K; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Pulliam, T; Wong, Q K; Brau, J E; Frey, R; Potter, C T; Sinev, N B; Strom, D; Torrence, E; Colecchia, F; Dorigo, A; Galeazzi, F; Margoni, M; Morandin, M; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Tiozzo, G; Voci, C; Benayoun, M; Briand, H; Chauveau, J; David, P; La Vaissière, C de; Del Buono, L; Hamon, O; John, M J J; Leruste, P; Ocariz, J; Pivk, M; Roos, L; Stark, J; T'Jampens, S; Therin, G; Manfredi, P F; Re, V; Behera, P K; Gladney, L; Guo, Q H; Panetta, J; Angelini, C; Batignani, G; Bettarini, S; Bondioli, M; Bucci, F; Calderini, G; Carpinelli, M; Del Gamba, V; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Martínez-Vidal, F; Morganti, M; Neri, N; Paoloni, E; Rama, M; Rizzo, G; Sandrelli, F; Walsh, J; Haire, M; Judd, D; Paick, K; Wagoner, D E; Danielson, N; Elmer, P; Lü, C; Miftakov, V; Olsen, J; Smith, A J S; Tanaka, H A; Varnes, E W; Bellini, F; Cavoto, G; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Mazzoni, M A; Morganti, S; Pierini, M; Piredda, G; Safai-Tehrani, F; Voena, C; Christ, S; Wagner, G; Waldi, R; Adye, T; De Groot, N; Franek, B J; Geddes, N I; Gopal, G P; Olaiya, E O; Xella, S M; Aleksan, Roy; Emery, S; Gaidot, A; Ganzhur, S F; Giraud, P F; Hamel de Monchenault, G; Kozanecki, Witold; Langer, M; Legendre, M; London, G W; Mayer, B; Schott, G; Vasseur, G; Yéche, C; Zito, M; Purohit, M V; Weidemann, A W; Yumiceva, F X; Aston, D; Bartoldus, R; Berger, N; Boyarski, A M; Buchmüller, O L; Convery, M R; Coupal, D P; Dong, D; Dorfan, J; Dujmic, D; Dunwoodie, W M; Field, R C; Glanzman, T; Gowdy, S J; Graugès-Pous, E; Hadig, T; Halyo, V; Hrynóva, T; Innes, W R; Jessop, C P; Kelsey, M H; Kim, P; Kocian, M L; Langenegger, U; Leith, D W G S; Luitz, S; Lüth, V; Lynch, H L; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Petrak, S; Ratcliff, B N; Robertson, S H; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Simi, G; Snyder, A; Soha, A; Stelzer, J; Su, D; Sullivan, M K; Vavra, J; Wagner, S R; Weaver, M; Weinstein, A J R; Wisniewski, W J; Wright, D H; Young, C C; Burchat, Patricia R; Edwards, A J; Meyer, T I; Petersen, B A; Roat, C; Ahmed, S; Alam, M S; Ernst, J A; Saleem, M; Wappler, F R; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Kim, H; Ritchie, J L; Schwitters, R F; Izen, J M; Kitayama, I; Lou, X C; Ye, S; Bianchi, F; Bóna, M; Gallo, F; Gamba, D; Borean, C; Bosisio, L; Della Ricca, G; Dittongo, S; Grancagnolo, S; Lanceri, L; Poropat, P; Vitale, L; Vuagnin, G; Panvini, R S; Banerjee, Sw; Brown, C M; Fortin, D; Jackson, P D; Kowalewski, R V; Roney, J M; Band, H R; Dasu, S; Datta, M; Eichenbaum, A M; Johnson, J R; Kutter, P E; Li, H; Liu, R; Di Lodovico, F; Mihályi, A; Mohapatra, A K; Pan, Y; Prepost, R; Sekula, S J; Von Wimmersperg-Töller, J H; Wu, J; Wu, S L; Yu, Z; Neal, H

    2004-01-01

    We present a measurement of the branching fraction of the decay B+- --> chi_c0 K+- from a sample of 89 million BB pairs collected by the BaBar detector at the PEP-II asymmetric-energy B Factory at SLAC. The chi_c0 meson is reconstructed through its two-body decays to pi+ pi- and K+ K-. We measure BR(B+- --> chi_c0 K+-)* BR(chi_c0 --> pi+ pi-) = (1.32^{+0.28}_{-0.27}(stat) +- 0.09(syst))*10^-6 and BR(B+- --> chi_c0 K+-) * BR(chi_c0 --> K+ K-) = (1.49^{+0.36}_{-0.34}(stat) +- 0.11(syst))* 10^-6. Using the known values for the chi_c0 decays branching fractions, we combine these results to obtain BR(B+- --> chi_c0 K+-) = (2.7+-0.7)* 10^-4.

  6. The best approximation of $P-$ metric space of $\\chi^{2}-$ defined by Musielak

    Directory of Open Access Journals (Sweden)

    NAGARAJAN SUBRAMANIAN

    2014-06-01

    Full Text Available In this paper, we introduce the idea of constructing sequence space $\\chi^{2}$ of best approximation in $p-$ metric defined by Musielak and also construct some general topological properties of approximation of $\\chi^{2}$

  7. Effect of tai chi exercise on proprioception of ankle and knee joints in old people

    OpenAIRE

    Xu, D.; Hong, Y; Li, J.; Chan, K.

    2004-01-01

    Objectives: To assess if tai chi, a traditional Chinese form of exercise, could improve proprioception in old people and if the effects of tai chi on proprioception are more evident than other exercise forms in the elderly.

  8. Search for Factorization-Suppressed $B \\to{ chi_c} K^(*)$ Decays

    CERN Document Server

    Aubert, B; Boutigny, D; Couderc, F; Karyotakis, Yu; Lees, J P; Poireau, V; Tisserand, V; Zghiche, A; Graugès-Pous, E; Palano, A; Pompili, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Borgland, A W; Breon, A B; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Day, C T; Gill, M S; Gritsan, A V; Groysman, Y; Jacobsen, R G; Kadel, R W; Kadyk, J; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lynch, G; Mir, L M; Oddone, P J; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, Michael T; Wenzel, W A; Barrett, M; Ford, K E; Harrison, T J; Hart, A J; Hawkes, C M; Morgan, S E; Watson, A T; Fritsch, M; Goetzen, K; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Schröder, T; Steinke, M; Boyd, J T; Chevalier, N; Cottingham, W N; Kelly, M P; Latham, T E; Wilson, F F; Çuhadar-Dönszelmann, T; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Thiessen, D; Khan, A; Kyberd, P; Teodorescu, L; Blinov, A E; Blinov, V E; Druzhinin, V P; Golubev, V B; Ivanchenko, V N; Kravchenko, E A; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Yushkov, A N; Best, D; Bruinsma, M; Chao, M; Eschrich, I; Kirkby, D; Lankford, A J; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Buchanan, C; Hartfiel, B L; Weinstein, A J R; Foulkes, S D; Gary, J W; Long, O; Shen, B C; Wang, K; Del Re, D; Hadavand, H K; Hill, E J; MacFarlane, D B; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Lu, A; Mazur, M A; Richman, J D; Verkerke, W; Beck, T W; Eisner, A M; Heusch, C A; Kroseberg, J; Lockman, W S; Nesom, G; Schalk, T; Schumm, B A; Seiden, A; Spradlin, P; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dubois-Felsmann, G P; Dvoretskii, A; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Ryd, A; Samuel, A; Yang, S; Jayatilleke, S M; Mancinelli, G; Meadows, B T; Sokoloff, M D; Blanc, F; Bloom, P; Chen, S; Ford, W T; Nauenberg, U; Olivas, A; Rankin, P; Ruddick, W O; Smith, J G; Ulmer, K A; Zhang, J; Zhang, L; Chen, A; Eckhart, E A; Harton, J L; Soffer, A; Toki, W H; Wilson, R J; Zeng, Q; Spaan, B; Altenburg, D; Brandt, T; Brose, J; Dickopp, M; Feltresi, E; Hauke, A; Lacker, H M; Nogowski, R; Otto, S; Petzold, A; Schubert, J; Schubert, Klaus R; Schwierz, R; Sundermann, J E; Bernard, D; Bonneaud, G R; Grenier, P; Schrenk, S; Thiebaux, C; Vasileiadis, G; Verderi, M; Bard, D J; Clark, P J; Muheim, F; Playfer, S; Xie, Y; Andreotti, M; Azzolini, V; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Piemontese, L; Sarti, A; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Patteri, P; Peruzzi, I M; Piccolo, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Crosetti, G; Lo Vetere, M; Macri, M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Bailey, S; Brandenburg, G; Chaisanguanthum, K S; Morii, M; Won, E; Dubitzky, R S; Langenegger, U; Marks, J; Uwer, U; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Gaillard, J R; Morton, G W; Nash, J A; Nikolich, M B; Taylor, G P; Charles, M J; Grenier, G J; Mallik, U; Cochran, J; Crawley, H B; Lamsa, J; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Yi, J; Arnaud, N; Davier, M; Giroux, X; Grosdidier, G; Höcker, A; Le Diberder, F R; Lepeltier, V; Lutz, A M; Petersen, T C; Plaszczynski, S; Schune, M H; Wormser, G; Cheng, C H; Lange, D J; Simani, M C; Wright, D M; Bevan, A J; Chavez, C A; Coleman, J P; Forster, I J; Fry, J R; Gabathuler, Erwin; Gamet, R; Hutchcroft, D E; Parry, R J; Payne, D J; Touramanis, C; Cormack, C M; Di Lodovico, F; Brown, C L; Cowan, G; Flack, R L; Flächer, H U; Green, M G; Jackson, P S; McMahon, T R; Ricciardi, S; Salvatore, F; Winter, M A; Brown, D; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Hodgkinson, M C; Lafferty, G D; Williams, J C; Chen, C; Farbin, A; Hulsbergen, W D; Jawahery, A; Kovalskyi, D; Lae, C K; Lillard, V; Roberts, D A; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Kofler, R; Koptchev, V B; Moore, T B; Saremi, S; Stängle, H; Willocq, S; Cowan, R; Koeneke, K; Sciolla, G; Sekula, S J; Taylor, F; Yamamoto, R K; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L M; Eschenburg, V; Godang, R; Kroeger, R; Reidy, J; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Taras, P; Nicholson, H; Cavallo, N; Fabozzi, F; Gatto, C; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M; Bulten, H; Raven, G; Snoek, H L; Wilden, L; Jessop, C P; LoSecco, J M; Allmendinger, T; Benelli, G; Gan, K K; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Pulliam, T; Rahimi, A M; Ter-Antonian, R; Wong, Q K; Brau, J E; Frey, R; Igonkina, O; Lu, M; Potter, C T; Sinev, N B; Strom, D; Torrence, E; Colecchia, F; Dorigo, A; Galeazzi, F; Margoni, M; Morandin, M; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Benayoun, M; Briand, H; Chauveau, J; David, P; La Vaissière, C de; Del Buono, L; Hamon, O; John, M J J; Leruste, P; Malcles, J; Ocariz, J; Roos, L; Therin, G; Behera, P K; Gladney, L; Guo, Q H; Panetta, J; Biasini, M; Covarelli, R; Pioppi, M; Angelini, C; Batignani, G; Bettarini, S; Bondioli, M; Bucci, F; Calderini, G; Carpinelli, M; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Morganti, M; Neri, N; Paoloni, E; Rama, M; Rizzo, G; Simi, G; Walsh, J; Haire, M; Judd, D; Paick, K; Wagoner, D E; Danielson, N; Elmer, P; Lau, Y P; Lü, C; Miftakov, V; Olsen, J; Smith, A J S; Telnov, A V; Bellini, F; Cavoto, G; D'Orazio, A; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Li Gioi, L; Mazzoni, M A; Morganti, S; Pierini, M; Piredda, G; Polci, F; Safai-Tehrani, F; Voena, C; Christ, S; Schröder, H; Wagner, G; Waldi, R; Adye, T; De Groot, N; Franek, B J; Gopal, G P; Olaiya, E O; Aleksan, Roy; Emery, S; Gaidot, A; Ganzhur, S F; Giraud, P F; Hamel de Monchenault, G; Kozanecki, Witold; Legendre, M; London, G W; Mayer, B; Schott, G; Vasseur, G; Yéche, C; Zito, M; Purohit, M V; Weidemann, A W; Wilson, J R; Yumiceva, F X; Abe, T; Allen, M; Aston, D; Bartoldus, R; Berger, N; Boyarski, A M; Buchmüller, O L; Claus, R; Convery, M R; Cristinziani, M; De Nardo, Gallieno; Dingfelder, J C; Dong, D; Dorfan, J; Dujmic, D; Dunwoodie, W M; Fan, S; Field, R C; Glanzman, T; Gowdy, S J; Hadig, T; Halyo, V; Hast, C; Hrynóva, T; Innes, W R; Kelsey, M H; Kim, P; Kocian, M L; Leith, D W G S; Libby, J; Luitz, S; Lüth, V; Lynch, H L; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Soha, A; Stelzer, J; Strube, J; Su, D; Sullivan, M K; Thompson, J; Vavra, J; Wagner, S R; Weaver, M; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Young, C C; Burchat, Patricia R; Edwards, A J; Majewski, S A; Petersen, B A; Roat, C; Ahmed, M; Ahmed, S; Alam, M S; Ernst, J A; Saeed, M A; Saleem, M; Wappler, F R; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Kim, H; Ritchie, J L; Satpathy, A; Schwitters, R F; Izen, J M; Kitayama, I; Lou, X C; Ye, S; Bianchi, F; Bóna, M; Gallo, F; Gamba, D; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Dittongo, S; Grancagnolo, S; Lanceri, L; Poropat, P; Vitale, L; Vuagnin, G; Martínez-Vidal, F; Panvini, R S; Banerjee, S; Bhuyan, B; Brown, C M; Fortin, D; Jackson, P D; Kowalewski, R V; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Mohanty, G B; Band, H R; Chen, X; Cheng, B; Dasu, S; Datta, M; Eichenbaum, A M; Flood, K T; Graham, M; Hollar, J J; Johnson, J R; Kutter, P E; Li, H; Liu, R; Mihályi, A; Pan, Y; Prepost, R; Tan, P; Von Wimmersperg-Töller, J H; Wu, J; Wu, S L; Yu, Z; Greene, M G; Neal, H

    2005-01-01

    We search for the factorization-suppressed decays B -> chi_c0 K(*) and B -> chi_c2 K(*), with chi_c0 and chi_c2 decaying into J/psi gamma using a sample of 124 10^6 BBbar events collected with the BABAR detector at the PEP-II storage ring of the Stanford Linear Accelerator Center.

  9. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... Tai Chi and Qi Gong for Health and Well-Being Share: taichi_nccamIMG_2962.jpg © Mariann Seriff ... Tai Chi and Qi Gong for Health and Well-Being Video › Tai Chi and Qi Gong for ...

  10. City PLANTastic

    DEFF Research Database (Denmark)

    , any attempt to create a green city is motivated by certain ecological, political and esthetical perspectives. Therefore the role of plants in tomorrows cities is everything but straightforward. Rather, a broad range of possibilities unfolds. City PLANTastic is the title of the 8th World in Denmark...... urbanism, who reflect upon the multiple roles of plants in the future city through their most recent projects. The theme for the 2012 World in Denmark conference is City PLANTastic, which will also be explored by researchers through their works....

  11. Dicty_cDB: CHI614 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 850F7 (Roswell Park Cancer Institute Human BAC Library) complete sequence. 38 0.53 5 CR382125 |CR382125.1 Kluyveromyces lact...AAACCTTATTATCCA ATATTTTATTATCAGGTTTTAGG Length of 3' end seq. 743 Connected seq. ID CHI614P Connected seq. >...IILVXIINXVYNXFSGHS SEHTKNXLKXASKTSKKX--- ---DNHTFLRENRDPVKKMKHLPQGIL*sksirerffigfgtwhwwcts...ENRDPVKKMKHLPQGIL*sksirerffigfgtwhwwctsfsqss*ti*lc isitllvatyss*yv*tlvlcrn*sfmrtqisiikhwsrsksystmskrw*nya*ysts...d in the head. 40 2.1 2 CR238085 |CR238085.1 Forward strand read from insert in 5'HPRT insertion

  12. Dicty_cDB: CHI740 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI740 (Link to dictyBase) - - - Contig-U16419-1 - (Link to Original site) ... krftxchenctx** Frame B: ---xkttslvfkmxtks*m*i**prssmlc kgsp**mfikmshmamnvklitmvknvxsd pidhhhqkfvh*dahqnmnv ... slrcptwp*m*s*sqw*rmlxqi p*ttttrslfikmptkt*m*i**sw*kmlc kdsl**sl*frlw*rf*m*n*t*wfkmlc p frkttpttt*km**empxrp ... *m*s*stwkrmlrccp*txtkmlfkmstkt*m*sqpxw*r mlc *sspr*mfiemstrp*m*s*stwkrmxrccp*tttemlikmstkt*m*nqs ... lw*rml c *k*k*lfnl*rpktvkekvyxvp*klyxlik Homology vs CSM-cD ...

  13. Two-Photon Widths of the chi_cJ States of Charmonium

    CERN Document Server

    Ecklund, K M; Savinov, V; López, A; Méndez, H; Ramírez, J; Ge, J Y; Miller, D H; Shipsey, I P J; Xin, B; Adams, G S; Anderson, M; Cummings, J P; Danko, I; Hu, D; Moziak, B; Napolitano, J; He, Q; Insler, J; Muramatsu, H; Park, C S; Thorndike, E H; Yang, F; Artuso, M; Blusk, S; Khalil, S; Li, J; Mountain, R; Nisar, S; Randrianarivony, K; Sultana, N; Skwarnicki, T; Stone, S; Wang, J C; Zhang, L M; Bonvicini, G; Cinabro, D; Dubrovin, M; Lincoln, A; Naik, P; Rademacker, J; Asner, D M; Edwards, K W; Reed, J; Briere, R A; Ferguson, T; Tatishvili, G; Vogel, H; Watkins, M E; Rosner, J L; Alexander, J P; Cassel, D G; Duboscq, J E; Ehrlich, R; Fields, L; Galik, R S; Gibbons, L; Gray, R; Gray, S W; Hartill, D L; Hertz, D; Hunt, J M; Kandaswamy, J; Kreinick, D L; Kuznetsov, V E; Ledoux, J; Mahlke-Krüger, H; Mohapatra, D; Onyisi, P U E; Patterson, J R; Peterson, D; Riley, D; Ryd, A; Sadoff, A J; Shi, X; Stroiney, S; Sun, W M; Wilksen, T; Athar, S B; Patel, R; Yelton, J; Rubin, P; Eisenstein, B I; Karliner, I; Mehrabyan, S; Lowrey, N; Selen, M; White, E J; Wiss, J; Mitchell, R E; Shepherd, M R; Besson, D; Pedlar, T K; Cronin-Hennessy, D; Gao, K Y; Hietala, J; Kubota, Y; Klein, T; Lang, B W; Poling, R; Scott, A W; Zweber, P; Dobbs, S; Metreveli, Z; Seth, K K; Tomaradze, A G; Libby, J; Powell, A; Wilkinson, G

    2008-01-01

    Using a data sample of 24.5 million psi(2S) the reactions psi(2S)->gamma chi_cJ, chi_cJ->gamma gamma have been studied for the first time to determine the two-photon widths of the chi_cJ states of charmonium in their decay into two photons. The measured quantities are B(psi(2S)->gamma chi_c0)xB(chi_c0->gamma gamma)=(2.22+-0.32+-0.10)x10^-5, and B(psi(2S)->gamma chi_c2)xB(chi_c2->gamma gamma)=(2.70+-0.28+-0.15)x10^-5. Using values for B(psi(2S)->gamma chi_c0,c2) and \\Gamma(chi_c0,c2) from the literature the two-photon widths are derived to be \\Gamma_{gamma gamma}(chi_c0)=(2.53+-0.37+-0.26) keV, \\Gamma_{gamma gamma}(chi_c2)=(0.60+-0.06+-0.06) keV, and R=\\Gamma_{gamma gamma}(chi_c2)/\\Gamma_{gamma gamma}(chi_c0)= 0.237+-0.043+-0.034. The importance of the measurement of R is emphasized. For the forbidden transition, chi_c1->gamma gamma, an upper limit of \\Gamma_{gamma gamma}(chi_c1)<0.03 keV is established.

  14. Two-photon widths of the $\\chi_{c0, 2}$ states and helicity analysis for $\\chi_{c2}\\ar\\gamma\\gamma$}

    CERN Document Server

    Ablikim, M; Ambrose, D J; An, F F; An, Q; An, Z H; Bai, J Z; Ferroli, R B; Ban, Y; Becker, J; Berger, N; Bertani, M B; Bian, J M; Boger, E; Bondarenko, O; Boyko, I; Briere, R A; Bytev, V; Cai, X; Calcaterra, A C; Cao, G F; Chang, J F; Chelkov, G; Chen, G; Chen, H S; Chen, J C; Chen, M L; Chen, S J; Chen, Y; Chen, Y B; Cheng, H P; Chu, Y P; Cronin-Hennessy, D; Dai, H L; Dai, J P; Dedovich, D; Deng, Z Y; Denig, A; Denysenko, I; Destefanis, M; Ding, W M; Ding, Y; Dong, L Y; Dong, M Y; Du, S X; Fang, J; Fang, S S; Fava, L; Feldbauer, F; Feng, C Q; Fu, C D; Fu, J L; Gao, Y; Geng, C; Goetzen, K; Gong, W X; Gradl, W; Greco, M; Gu, M H; Gu, Y T; Guan, Y H; Guo, A Q; Guo, L B; Guo, Y P; Han, Y L; Hao, X Q; Harris, F A; He, K L; He, M; He, Z Y; Held, T; Heng, Y K; Hou, Z L; Hu, H M; Hu, J F; Hu, T; Huang, B; Huang, G M; Huang, J S; Huang, X T; Huang, Y P; Hussain, T; Ji, C S; Ji, Q; Ji, X B; Ji, X L; Jia, L K; Jiang, L L; Jiang, X S; Jiao, J B; Jiao, Z; Jin, D P; Jin, S; Jing, F F; Kalantar-Nayestanaki, N; Kavatsyuk, M; Kuehn, W; Lai, W; Lange, J S; Leung, J K C; Li, C H; Li, Cheng; Li, Cui; Li, D M; Li, F; Li, G; Li, H B; Li, J C; Li, K; Li, Lei; Li, N B; Li, Q J; Li, S L; Li, W D; Li, W G; Li, X L; Li, X N; Li, X Q; Li, X R; Li, Z B; Liang, H; Liang, Y F; Liang, Y T; Liao, G R; Liao, X T; Liu, B J; Liu, B J; Liu, C L; Liu, C X; Liu, C Y; Liu, F H; Liu, Fang; Liu, Feng; Liu, H; Liu, H B; Liu, H H; Liu, H M; Liu, H W; Liu, J P; Liu, Kun; Liu, Kai; Liu, K Y; Liu, P L; Liu, S B; Liu, X; Liu, X H; Liu, Y B; Liu, Y; Liu, Z A; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H; Lu, G R; Lu, H J; Lu, J G; Lu, Q W; Lu, X R; Lu, Y P; Luo, C L; Luo, M X; Luo, T; Luo, X L; Lv, M; Ma, C L; Ma, F C; Ma, H L; Ma, Q M; Ma, S; Ma, T; Ma, X Y; Ma, Y; Maas, F E; Maggiora, M; Malik, Q A; Mao, H; Mao, Y J; Mao, Z P; Messchendorp, J G; Min, J; Min, T J; Mitchell, R E; Mo, X H; Morales, C Morales; Motzko, C; Muchnoi, N Yu; Nefedov, Y; Nicholson, C; Nikolaev, I B; Ning, Z; Olsen, S L; Ouyang, Q; Pacetti, S P; Park, J W; Pelizaeus, M; Peters, K; Ping, J L; Ping, R G; Poling, R; Prencipe, E; Pun, C S J; Qi, M; Qian, S; Qiao, C F; Qin, X S; Qin, Y; Qin, Z H; Qiu, J F; Rashid, K H; Rong, G; Ruan, X D; Sarantsev, A; Schulze, J; Shao, M; Shen, C P; Shen, X Y; Sheng, H Y; Shepherd, M R; Song, X Y; Spataro, S; Spruck, B; Sun, D H; Sun, G X; Sun, J F; Sun, S S; Sun, X D; Sun, Y J; Sun, Y Z; Sun, Z J; Sun, Z T; Tang, C J; Tang, X; Thorndike, E H; Tian, H L; Toth, D; Ulrich, M U; Varner, G S; Wang, B; Wang, B Q; Wang, K; Wang, L L; Wang, L S; Wang, M; Wang, P; Wang, P L; Wang, Q; Wang, Q J; Wang, S G; Wang, X F; Wang, X L; Wang, Y D; Wang, Y F; Wang, Y Q; Wang, Z; Wang, Z G; Wang, Z Y; Wei, D H; Weidenkaff, P; Wen, Q G; Wen, S P; Werner, M W; Wiedner, U; Wu, L H; Wu, N; Wu, S X; Wu, W; Wu, Z; Xia, L G; Xiao, Z J; Xie, Y G; Xiu, Q L; Xu, G F; Xu, G M; Xu, H; Xu, Q J; Xu, X P; Xu, Y; Xu, Z R; Xue, F; Xue, Z; Yan, L; Yan, W B; Yan, Y H; Yang, H X; Yang, T; Yang, Y; Yang, Y X; Ye, H; Ye, M; Ye, M H; Yu, B X; Yu, C X; Yu, J S; Yu, S P; Yuan, C Z; Yuan, W L; Yuan, Y; Zafar, A A; Zallo, A Z; Zeng, Y; Zhang, B X; Zhang, B Y; Zhang, C C; Zhang, D H; Zhang, H H; Zhang, H Y; Zhang, J; Zhang, J G; Zhang, J Q; Zhang, J W; Zhang, J Y; Zhang, J Z; Zhang, L; Zhang, S H; Zhang, T R; Zhang, X J; Zhang, X Y; Zhang, Y; Zhang, Y H; Zhang, Y S; Zhang, Z P; Zhang, Z Y; Zhao, G; Zhao, H S; Zhao, J W; Zhao, K X; Zhao, Lei; Zhao, Ling; Zhao, M G; Zhao, Q; Zhao, S J; Zhao, T C; Zhao, X H; Zhao, Y B; Zhao, Z G; Zhemchugov, A; Zheng, B; Zheng, J P; Zheng, Y H; Zheng, Z P; Zhong, B; Zhong, J; Zhou, L; Zhou, X K; Zhou, X R; Zhu, C; Zhu, K; Zhu, K J; Zhu, S H; Zhu, X L; Zhu, X W; Zhu, Y M; Zhu, Y S; Zhu, Z A; Zhuang, J; Zou, B S; Zou, J H; Zuo, J X

    2012-01-01

    Based on a data sample of 106 M $\\psi^{\\prime}$ events collected with the BESIII detector, the decays $\\psi^{\\prime}\\ar\\gamma\\chi_{c0, 2}$,$\\chi_{c0, 2}\\ar\\gamma\\gamma$ are studied to determine the two-photon widths of the $\\chi_{c0, 2}$ states. The two-photon decay branching fractions are determined to be ${\\cal B}(\\chi_{c0}\\ar\\gamma\\gamma) = (2.24\\pm 0.19\\pm 0.12\\pm 0.08)\\times 10^{-4}$ and ${\\cal B}(\\chi_{c2}\\ar\\gamma\\gamma) = (3.21\\pm 0.18\\pm 0.17\\pm 0.13)\\times 10^{-4}$. From these, the two-photon widths are determined to be $\\Gamma_{\\gamma \\gamma}(\\chi_{c0}) = (2.33\\pm0.20\\pm0.13\\pm0.17)$ keV, $\\Gamma_{\\gamma \\gamma}(\\chi_{c2}) = (0.63\\pm0.04\\pm0.04\\pm0.04)$ keV, and $\\cal R$ $=\\Gamma_{\\gamma \\gamma}(\\chi_{c2})/\\Gamma_{\\gamma \\gamma}(\\chi_{c0})=0.271\\pm 0.029\\pm 0.013\\pm 0.027$, where the uncertainties are statistical, systematic, and those from the PDG ${\\cal B}(\\psi^{\\prime}\\ar\\gamma\\chi_{c0,2})$ and $\\Gamma(\\chi_{c0,2})$ errors, respectively. The ratio of the two-photon widths for helicity $\\lambda=0...

  15. Chi-Chi (Taiwan) earthquake of September 21, 1999. Findings for the nuclear installations in Switzerland: short report

    International Nuclear Information System (INIS)

    The Swiss Federal Nuclear Safety Inspectorate (HSK) has a great interest to be rapidly informed and documented on relevant consequences of major earthquakes in industrialized countries in the world, in particular with respect to nuclear installations. The main goal is to recognize within a short time after such events, if measures should be taken at the Swiss nuclear installations. Therefore, Basler and Hofmann have prepared a report on the Chi-Chi (1999) earthquake for HSK within a few weeks after the event. The information was obtained primarily from the Internet and by directly contacting local authorities and other selected organisations in Taiwan. This short report is a summary representation of the HSK report of November 23, 1999. No updated or additional information on the earthquake is included herein. The summary concentrates on the findings for the Swiss nuclear installations. Compared with Taiwan, Switzerland is situated in a seismically much less active region. However, similarities exist with respect to the focal mechanism (thrust), the compressional stress regime and the low focal depth. Thus, the pattern of the iso-seismal lines and the maximum acceleration values would be similar in Switzerland in the case of an equally strong event. Such a strong event has been considered as unrealistic to occur in Switzerland so far. In the PSA studies for the Swiss nuclear power plants, a maximum magnitude up to 7.5 was considered, but only with a low weight. Under the assumption of a magnitude 7.6 event in the seismically most active region in Switzerland (Valais), the SSE accelerations at the closest site (Muehleberg NPP) could probably be exceeded. Most effects at components observed during the Chi-Chi earthquake (at non-nuclear sites) are already known to HSK and they have been considered systematically at the Swiss NPPs. A rather sensitive point is the possible loss of power from emergency diesel generators, as observed at non-nuclear sites in Taiwan. The

  16. Exclusive Baryon-Antibaryon Decays of the chi_cJ Mesons

    CERN Document Server

    Naik, P; Asner, D M; Edwards, K W; Reed, J; Briere, R A; Ferguson, T; Tatishvili, G; Vogel, H; Watkins, M E; Rosner, J L; Alexander, J P; Cassel, D G; Duboscq, J E; Ehrlich, R; Fields, L; Gibbons, L; Gray, R; Gray, S W; Hartill, D L; Heltsley, B K; Hertz, D; Hunt, J M; Kandaswamy, J; Kreinick, D L; Kuznetsov, V E; Ledoux, J; Mahlke-Krüger, H; Mohapatra, D; Onyisi, P U E; Patterson, J R; Peterson, D; Riley, D; Ryd, A; Sadoff, A J; Shi, X; Stroiney, S; Sun, W M; Wilksen, T; Athar, S B; Patel, R; Yelton, J; Rubin, P; Eisenstein, B I; Karliner, I; Mehrabyan, S; Lowrey, N; Selen, M; White, E J; Wiss, J; Mitchell, R E; Shepherd, M R; Besson, D; Pedlar, T K; Cronin-Hennessy, D; Gao, K Y; Hietala, J; Kubota, Y; Klein, T; Lang, B W; Poling, R; Scott, A W; Zweber, P; Dobbs, S; Metreveli, Z; Seth, K K; Tomaradze, A G; Libby, J; Powell, A; Wilkinson, G; Ecklund, K M; Love, W; Savinov, V; Méndez, H; Ge, J Y; Miller, D H; Shipsey, I P J; Xin, B; Adams, G S; Anderson, M; Cummings, J P; Danko, I; Hu, D; Moziak, B; Napolitano, J; He, Q; Insler, J; Muramatsu, H; Park, C S; Thorndike, E H; Yang, F; Artuso, M; Blusk, S; Khalil, S; Li, J; Mountain, R; Nisar, S; Randrianarivony, K; Sultana, N; Skwarnicki, T; Stone, S; Wang, J C; Zhang, L M; Bonvicini, G; Cinabro, D; Dubrovin, M; Lincoln, A

    2008-01-01

    Using a sample of 2.59 \\times 10^7 psi(2S) decays collected by the CLEO--c detector, we present results of a study of chi_{cJ} (J=0,1,2) decays into baryon-antibaryon final states. We present the world's most precise measurements of the chi_cJ -> p-pbar and chi_cJ -> Lambda-Lambdabar branching fractions, and the first measurements of chi_c0 decays to other hyperons. These results illuminate the decay mechanism of the chi_c states.

  17. Tai Chi as a form of exercise training in people with chronic obstructive pulmonary disease.

    Science.gov (United States)

    Leung, Regina W M; McKeough, Zoe J; Alison, Jennifer A

    2013-12-01

    Tai Chi is an ancient Chinese martial art which incorporates elements of strengthening, balance, postural alignment and concentration. The benefits of Tai Chi in the healthy population have been widely examined. In comparison, only three studies have evaluated the effects of Tai Chi in people with chronic obstructive pulmonary disease (COPD). Existing evidence suggests that the exercise intensity of Tai Chi reaches a moderate level in people with COPD. Furthermore, a short-term program of Tai Chi improves exercise capacity, health-related quality of life, balance and quadriceps strength in people with mild to moderate COPD. More studies are warranted to examine the effects of different styles of Tai Chi and the long-term benefits of Tai Chi as an exercise regimen for people with COPD. PMID:24224506

  18. mRNA Expression of EgCHI1, EgCHI2, and EgCHI3 in Oil Palm Leaves (Elaeis guineesis Jacq. after Treatment with Ganoderma boninense Pat. and Trichoderma harzianum Rifai

    Directory of Open Access Journals (Sweden)

    Laila Naher

    2012-01-01

    Full Text Available Background. Basal stem rot (BSR disease caused by the fungus Ganoderma boninense is the most serious disease affecting the oil palm; this is because the disease escapes the early disease detection. The biocontrol agent Trichoderma harzianum can protect the disease only at the early stage of the disease. In the present study, the expression levels of three oil palm (Elaeis guineensis Jacq. chitinases encoding EgCHI1, EgCHI2, and EgCHI3 at 2, 5, and 8 weeks inoculation were measured in oil palm leaves from plants treated with G. boninense or T. harzianum alone or both. Methods. The five-month-old oil palm seedlings were treated with Gano-wood blocks inoculum and trichomulch. Expression of EgCHI1, EgCHI2, and EgCHI3 in treated leaves tissue was determined by real-time PCR. Results. Oil palm chitinases were not strongly expressed in oil palm leaves of plants treated with G. boninense alone compared to other treatments. Throughout the 8-week experiment, expression of EgCHI1 increased more than 3-fold in leaves of plants treated with T. harzianum and G. boninense when compared to those of control and other treated plants. Conclusion. The data illustrated that chitinase cDNA expression varied depending on tissue and the type of treatment.

  19. INSTANT CITY

    DEFF Research Database (Denmark)

    Marling, Gitte; Kiib, Hans

    2013-01-01

    This article analyses Roskilde Festival as an Instant City. For more than 40 years, Roskilde Festival has had many thousands participants for a weeklong festival on music, performances and cultural experiences in a layout designed as an urban environment. During the last ten years, in- creasing...... emphasis has been laid on creating a vivid, and engaging social environment in order to create a lab for social, and architectural experi- ments. These goals challenge the city planning as well as the urban sce- nography. The article addresses the research questions: What kind of city life and social...... of an experimental and social en- gaged city environment? The analysis shows that the specific city life at the instant city, Roskilde Festival, can be characterized by being ‘open minded’, ‘playful’ and ‘inclusive’, but also by ‘a culture of laughter’ that penetrates the aesthetics and the urban...

  20. 青海民和县胡李家遗址的发掘%Excavation at the Hulijia Site in Minhe county,Qinghai

    Institute of Scientific and Technical Information of China (English)

    中国社会科学院考古研究所甘青工作队; 青海省文物考古研究所

    2001-01-01

    The Hulijia site is a subject of archaeological researches on ancient sites within the Guanting Basin, Minhe, and was excavated in 1999 in an area of 500 sq m. It lies on the third terrace in a basin of the Yellow River valley, and contains principally remains of the Miaodigou period. There are ash-pits, fire-places, house-foundations, pottery-making kilns and tombs. Among the abundant objects unearthed are red-painted stone tools, perforated pottery vessels, and the remains of animal heads buried during foundation laying ceremonies. The implements of production are rather coarse and consist mainly of chipped stone tools. The stone and bone ornaments are made fine, such as a precious stone adorment and bi discs. The other noteworthy finds include a terra-cotta human figure, carbonized millet and domestic horses's teeth. The pottery vessels show typical features of Miaodigou period forms and painted decorations. The site represents the earliest Neolithic culture known so far in Qinghai province. Its excavation is of great importance to studying the then culture in this region.

  1. Estimation of Potentials of Mean Force from Nonequilibrium Pulling Simulations Using Both Minh-Adib Estimator and Weighted Histogram Analysis Method.

    Science.gov (United States)

    Ngo, Van A; Kim, Ilsoo; Allen, Toby W; Noskov, Sergei Y

    2016-03-01

    Nonequilibrium pulling simulations have been a useful approach for investigating a variety of physical and biological problems. The major target in the simulations is to reconstruct reliable potentials of mean force (PMFs) or unperturbed free-energy profiles for quantitatively addressing both equilibrium mechanistic properties and contributions from nonequilibrium processes. While several current nonequilibrium methods were shown to be accurate in computing free-energy profiles in systems with relatively simple dynamics, they have proved to be unsuitable in more complicated systems. To extend the applicability of nonequilibrium sampling, we demonstrate a novel method that combines Minh-Adib's bidirectional estimator with nonlinear WHAM equations to reconstruct and assess PMFs from relatively fast pulling trajectories. We test the method in a one-dimensional model system and in a system of an antibiotic gramicidin-A (gA) channel, which is considered a significant challenge for nonequilibrium sampling. We identify key parameters for efficiently performing pulling simulations to improve and ensure the convergence and accuracy of estimated PMFs. We show that a few pulling trajectories of a relatively fast pulling speed v = 10 Å/ns can return a fair estimate of the PMF of a single potassium ion in gA. PMID:26799775

  2. Excavation on the Lajia Site in Minhe County, Qinghai, in 2000%青海民和县喇家遗址2000年发掘简报

    Institute of Scientific and Technical Information of China (English)

    中国社会科学院考古研究所甘青工作队; 青海省文物考古研究所

    2002-01-01

    The Lajia site in the Guanting Basin in Minhe,Qinghai,belongs mainly to the Qijia culture and occupies an area of 200,000sq m as is known from survey,Excavation in 2000 revealed on house-foundations human remains as vestiges of a disater,The present paper accounts the archaeo-logical discoveries on House-foundations F3 and F4 and discusses the date,building form and funciton of these houses and the cause of the disaster,On F3,two human skeletons were found to be the remains of a mother kneeling on the floor and leaning against the eastern wall with a baby in her arms;and 36 pottery vessels,stone tools and bone objects were discovered in the house,On F4 ,14 human skeletons were found to be in six groups .one of whic also consists of a mother and her baby at the eastern wall.The rest are five skeletons in the northwestern corner and fiver in the southwestern,mostly children,a youth's remains near the fireplace at the center,and a juvenile's skeleton to the northeast of the fireplace,24 pottery,stone and jade articles were yielded from this house,All the findings must have been vestiges of a disaster judging from the various positions of the dead especially the extraordinary postures of some skeletons.In addition.Remains of floods on the Yellow River were discovered on the Lajia site.

  3. Long-period ground motion characteristic of the 1999 Jiji (Chi-Chi), Taiwan, mainshock and aftershocks

    Institute of Scientific and Technical Information of China (English)

    LI Chun-feng; ZHANG Yang; ZHAO Jin-bao; TANG Hui

    2006-01-01

    This paper investigates long-period ground motion characteristic of the 1999 Jiji (Chi-Chi), Taiwan, mainshock and aftershocks on the basis of lots of high quality digital strong motion records. The study attaches the importance to the variation of strength of the long-period ground motion with the magnitude, distance, and site condition. In the meantime, the near-fault long-period ground motion characteristic is analyzed. The result shows that the shape of the long-period response spectrum is mainly controlled by site condition and magnitude (the spectrum of class D+E is wider than that of class B+C, and the spectrum of larger magnitude is wider than that of smaller magnitude), and the effect of fault distance on the shape is not evident. And near-fault long-period ground motion characteristic depends on fault activity apparently, that is to say, the long-term ground motion in the hanger is stronger than that in the footwall, and the long-term ground motion in the north is stronger than that in the south.

  4. Limerick City

    OpenAIRE

    2011-01-01

    Postcard. Colour photograph of River Shannon with Limerick City in background. Number 2/LK-018. Printed on reverse "Limerick city, where the Shannon river meets the sea is one of the most progressive of Irish cities, where the past and present mingle pleasantly. That part of the city called Newtown Pery was designed and planned in 1767, and is the Limerick of wide streets crossing at right angles, and the pleasantly tree-sprinkled People's Park. The tall column in the park commemorates Thomas...

  5. mRNA Expression of EgCHI1, EgCHI2, and EgCHI3 in Oil Palm Leaves (Elaeis guineesis Jacq.) after Treatment with Ganoderma boninense Pat. and Trichoderma harzianum Rifai

    OpenAIRE

    Laila Naher; Soon Guan Tan; Chai Ling Ho; Umi Kalsom Yusuf; Siti Hazar Ahmad; Faridah Abdullah

    2012-01-01

    Background. Basal stem rot (BSR) disease caused by the fungus Ganoderma boninense is the most serious disease affecting the oil palm; this is because the disease escapes the early disease detection. The biocontrol agent Trichoderma harzianum can protect the disease only at the early stage of the disease. In the present study, the expression levels of three oil palm (Elaeis guineensis Jacq.) chitinases encoding EgCHI1, EgCHI2, and EgCHI3 at 2, 5, and 8 weeks inoculation were measured in oil pa...

  6. High-level expression and characterization of two chitinases, ChiCH and ChiCW, of Bacillus cereus 28-9 in Escherichia coli

    International Nuclear Information System (INIS)

    Many chitinase genes have been cloned and sequenced from prokaryotes and eukaryotes but overexpression of chitinases in Escherichia coli cells was less reported. ChiCH and ChiCW of Bacillus cereus 28-9 belong to two distinct groups based on their amino acid sequences of catalytic domains, and in addition, domain structures of two enzymes are different. In this study, we established an ideal method for high-level expression of chitinases in E. coli as glutathione-S-transferase fusion proteins using pGEX-6P-1 vector. Both ChiCH and ChiCW were successfully highly expressed in E. coli cells as soluble GST-chitinase fusion proteins, and recombinant native ChiCH and ChiCW could be purified after cleavage with PreScission protease to remove GST tag. Purified chitinases were used for biochemical characterization of kinetics, hydrolysis products, and binding activities. The results indicate that ChiCW is an endo-chitinase and effectively hydrolyzes chitin and chito-multimers to chito-oligomers and the end product chitobiose, and ChiCH is an exo-chitinase and degrades chito-oligomers to produce chitobiose. Furthermore, due to higher affinity of ChiCW toward colloidal chitin than Avicel, C-terminal domain of ChiCW should be classified as a chitin-binding domain not a cellulose-binding domain although that was revealed as a cellulose-binding domain by conserved domain analysis. Therefore, the method of high-level expression of chitinases is helpful to studies and applications of chitinases

  7. Vung Tau - Co Gong dam, Vietnam

    OpenAIRE

    Dekens, B.; Meerdink, L.; G.J. Meijer; Sirks, E.; Vliet, R. van

    2011-01-01

    The area around Ho Chi Minh City (HCMC) faces flooding and salt intrusion problems. Flooding problems are caused by intensive rainfall in the city, high river discharges and high tides on sea. Dr. Hoc, the vice-minister of MARD (Vietnamese Ministry of Agriculture and Rural Development) proposed to construct a hydraulic structure downstream of HCMC. This will solve both the flooding and siltation problem. A possibility is to construct a dam between Vung Tau and Go Cong. This solution has been ...

  8. BUSINESS PLAN FOR BOKE INSECT RESTAURANT

    OpenAIRE

    Nguyen, Duc Van

    2015-01-01

    The economy in Vietnam has been growing quite considerably since the past two decades. Different business fields have been developed very widely and strongly such as culinary industry particularly in Ho Chi Minh City, the largest city in Vietnam. Many restaurants with various styles and cuisines are being established and invested due to the increase of customers’ demand. However, there are some areas in this business field which have not been exploited recently, for example insect food, so bu...

  9. Similarities and differences in values between Vietnamese parents and adolescents

    OpenAIRE

    Truong Thi Khanh Ha; Nguyen Van Luot; Joanna Różycka-Tran

    2015-01-01

    Background The purpose of this study was to analyse similarities and differences in the motivational value system of Vietnamese parents and adolescents, in the context of Schwartz’s value theory. Also, the transmission of values between two generations was studied. Participants and procedure The study was performed in three different cities of Vietnam – Hanoi, Hue and Ho Chi Minh City – on adolescents, their fathers and mothers (N = 2226). The hierarchy of values was measured w...

  10. Strong, Safe, and Resilient : A Strategic Policy Guide for Disaster Risk Management in East Asia and the Pacific

    OpenAIRE

    Jha, Abhas K.; Stanton-Geddes, Zuzana

    2013-01-01

    Experiencing both recurrent small-scale events as well as devastating large-scale catastrophes, no other region in the world is affected by disasters as is East Asia and the Pacific. In the last decade, Ho Chi Minh City, Jakarta, Manila, and many other cities have been repeatedly hit by floods. In the last five years, Asia has experienced a large share of wide-scale natural catastrophes, i...

  11. Utilizing a Sampling Center as a Marketing Research optimization model For Vietnamese manufacturers

    OpenAIRE

    Nguyen Thi, Kim

    2013-01-01

    This Bachelor's thesis presents ideas and researches that suggest manufacturers considering and increasing the usability of their new products through a more innovative interaction with consumers. The study concentrates on business and consumers in two major cities in Vietnam: Hanoi and Ho Chi Minh city. According to the facts of this specific market, finding a way to optimize marketing research is possibly an underrated potential. Therefore, the model namely 'Product Sampling Center' is intr...

  12. The CHY representation of tree-level primitive QCD amplitudes

    CERN Document Server

    de la Cruz, Leonardo; Weinzierl, Stefan

    2015-01-01

    In this paper we construct a CHY representation for all tree-level primitive QCD amplitudes. The quarks may be massless or massive. We define a generalised cyclic factor $\\hat{C}(w,z)$ and a generalised permutation invariant function $\\hat{E}(z,p,\\varepsilon)$. The amplitude is then given as a contour integral encircling the solutions of the scattering equations with the product $\\hat{C} \\hat{E}$ as integrand. Equivalently, it is given as a sum over the inequivalent solutions of the scattering equations, where the summand consists of a Jacobian times the product $\\hat{C} \\hat{E}$. This representation separates information: The generalised cyclic factor does not depend on the helicities of the external particles, the generalised permutation invariant function does not depend on the ordering of the external particles.

  13. The CHY representation of tree-level primitive QCD amplitudes

    Science.gov (United States)

    de la Cruz, Leonardo; Kniss, Alexander; Weinzierl, Stefan

    2015-11-01

    In this paper we construct a CHY representation for all tree-level primitive QCD amplitudes. The quarks may be massless or massive. We define a generalised cyclic factor Ĉ( w, z) and a generalised permutation invariant function Ê( z, p, ɛ). The amplitude is then given as a contour integral encircling the solutions of the scattering equations with the product ĈÊ as integrand. Equivalently, it is given as a sum over the inequivalent solutions of the scattering equations, where the summand consists of a Jacobian times the product Ĉ Ê. This representation separates information: The generalised cyclic factor does not depend on the helicities of the external particles, the generalised permutation invariant function does not depend on the ordering of the external particles.

  14. Landslide susceptibility mapping using decision-tree based CHi-squared automatic interaction detection (CHAID) and Logistic regression (LR) integration

    International Nuclear Information System (INIS)

    This article uses methodology based on chi-squared automatic interaction detection (CHAID), as a multivariate method that has an automatic classification capacity to analyse large numbers of landslide conditioning factors. This new algorithm was developed to overcome the subjectivity of the manual categorization of scale data of landslide conditioning factors, and to predict rainfall-induced susceptibility map in Kuala Lumpur city and surrounding areas using geographic information system (GIS). The main objective of this article is to use CHi-squared automatic interaction detection (CHAID) method to perform the best classification fit for each conditioning factor, then, combining it with logistic regression (LR). LR model was used to find the corresponding coefficients of best fitting function that assess the optimal terminal nodes. A cluster pattern of landslide locations was extracted in previous study using nearest neighbor index (NNI), which were then used to identify the clustered landslide locations range. Clustered locations were used as model training data with 14 landslide conditioning factors such as; topographic derived parameters, lithology, NDVI, land use and land cover maps. Pearson chi-squared value was used to find the best classification fit between the dependent variable and conditioning factors. Finally the relationship between conditioning factors were assessed and the landslide susceptibility map (LSM) was produced. An area under the curve (AUC) was used to test the model reliability and prediction capability with the training and validation landslide locations respectively. This study proved the efficiency and reliability of decision tree (DT) model in landslide susceptibility mapping. Also it provided a valuable scientific basis for spatial decision making in planning and urban management studies

  15. Two-dimensional Co-Seismic Surface Displacements Field of the Chi-Chi Earthquake Inferred from SAR Image Matching

    Directory of Open Access Journals (Sweden)

    Jian-Jun Zhu

    2008-10-01

    Full Text Available The Mw=7.6 Chi-Chi earthquake in Taiwan occurred in 1999 over the Chelungpu fault and caused a great surface rupture and severe damage. Differential Synthetic Aperture Radar Interferometry (DInSAR has been applied previously to study the co-seismic ground displacements. There have however been significant limitations in the studies. First, only one-dimensional displacements along the Line-of-Sight (LOS direction have been measured. The large horizontal displacements along the Chelungpu fault are largely missing from the measurements as the fault is nearly perpendicular to the LOS direction. Second, due to severe signal decorrelation on the hangling wall of the fault, the displacements in that area are un-measurable by differential InSAR method. We estimate the co-seismic displacements in both the azimuth and range directions with the method of SAR amplitude image matching. GPS observations at the 10 GPS stations are used to correct for the orbital ramp in the amplitude matching and to create the two-dimensional (2D co-seismic surface displacements field using the descending ERS-2 SAR image pair. The results show that the co-seismic displacements range from about -2.0 m to 0.7 m in the azimuth direction (with the positive direction pointing to the flight direction, with the footwall side of the fault moving mainly southwards and the hanging wall side northwards. The displacements in the LOS direction range from about -0.5 m to 1.0 m, with the largest displacement occuring in the northeastern part of the hanging wall (the positive direction points to the satellite from ground. Comparing the results from amplitude matching with those from DInSAR, we can see that while only a very small fraction of the LOS displacement has been recovered by the DInSAR mehtod, the azimuth displacements cannot be well detected with the DInSAR measurements as they are almost perpendicular to the LOS. Therefore, the amplitude matching method is obviously more

  16. Observation of direct ion heating in double-pulsing CHI in helicity injected spherical torus plasmas

    International Nuclear Information System (INIS)

    Anomalous ion heating has been observed for the first time during flux/current amplification by double-pulsing coaxial helicity injection (CHI) in the helicity injected spherical torus (HIST) device. Doppler ion temperature increases significantly near the separatrix on the inboard side during the second CHI pulse, whereas electron temperature remains constant. The experimental results indicate that selective ion heating may be associated with viscous damping of poloidal flows driven by the CHI pulse. (author)

  17. Training in ChiRunning to reduce blood pressure: a randomized controlled pilot study

    OpenAIRE

    McDermott, Kelly; Kumar, Deepak; Goldman, Veronica; Feng, Haojun; Mehling, Wolf; Moskowitz, Judith T.; Souza, Richard B.; Frederick M Hecht

    2015-01-01

    Background People with prehypertension (120–130/80–90 mmHg) are at increased risk of progressing to hypertension. Recommendations for prehypertension include engaging in regular physical activity. We aimed to assess feasibility and acceptability and collect preliminary outcome data on ChiRunning for people with elevated blood pressure. ChiRunning is a commercially available running program based on the mindful movements of Tai Chi, which is aimed at decreasing injury by both increasing body a...

  18. Flying Cities

    DEFF Research Database (Denmark)

    Herbelin, Bruno; Lasserre, Sebastien; Ciger, Jan

    2008-01-01

    Flying Cities is an artistic installation which generates imaginary cities from the speech of its visitors. Thanks to an original interactive process analyzing people's vocal input to create 3D graphics, a tangible correspondence between speech and visuals opens new possibilities of interaction....... This cross-modal interaction not only supports our artistic messages, but also aims at providing anyone with a pleasant and stimulating feedback from her/his speech activity. As the feedback we have received when presenting Flying Cities was very positive, our objective is now to cross the bridge...

  19. Drone City

    DEFF Research Database (Denmark)

    Jensen, Ole B.

    2016-01-01

    design” will be used as a background perspective to reflect upon the future of drones in cities. The other perspective used to frame the phenomenon is the emerging discourse of the “smart city”. A city of proliferating digital information and data communication may be termed a smart city as shorthand...... on the block” that will potentially be a game-changer for urban governance, economics and everyday life. Here we are thinking of the unmanned aerial vehicle or drone as the popular term has it. Therefore, the paper asks how life in “drone city” may play out. Drones may alter the notion of surveillance by means...

  20. An Efficacious Sage of Traditional Medicine in Modern Times——interview with Dr.Chi Wai Wong

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    @@ Dr.Chi Wai Wong is a licensed Traditional Chinese Medicine (TCM) practitioner in New York who focuses on the healing modalities of acupuncture,herbology,Qi Gong and medical massage (Tui Na).He is a native from Shen Zhen of Guang Dong province in China.He received his Medical Degree in China and became a surgeon where he learned acupuncture anesthesia.When he immigrated to United States,he established his family-run herbal dispensary called Zhong Guo Yao Chai Inc.Since the development of his practices in New York City and Long Island,he has specialized in the research and advancement of utilizing Chinese medicinal modalities for modern clinical application.

  1. First Observation of Exclusive chi_cJ Decays to Two Charged and Two Neutral Hadrons

    OpenAIRE

    Q. He

    2008-01-01

    We study exclusive chi_c0, chi_c1 and chi_c2 decays to four-hadron final states involving two charged and two neutral mesons: pi^+pi^-pi^0pi^0, K^+K^-pi^0pi^0, pppi^0pi^0, K^+K^-etapi^0, and K^+-pi^-+K^0pi^0o. The chi_c states are produced in radiative decays of 3.08 million psi-prime resonance decays and observed in the CLEO detector. We also measure the largest substructure contributions to the modes pi^+pi^-pi^0pi^0 and K^+-pi^-+K^0pi^0.

  2. Study of {chi}{sub c} production using HERA-B data

    Energy Technology Data Exchange (ETDEWEB)

    Aleksandrov, Aleksandar

    2010-07-15

    In this thesis the production of the charmonium states {chi}{sub c1} and {chi}{sub c2} in protonnucleus collisions at a proton-nucleon center-of-mass energy {radical}(s)=41.6 GeV was studied. The data used for the analysis have been taken by the fixed-target experiment HERA-B that uses the HERA proton beam to scatter protons off the nuclei of different wire targets. About 122.10{sup 3} recorded muonic J/{psi} decays, J/{psi}{yields}{mu}{sup +}{mu}{sup -}, resulted in almost 10000 reconstructed {chi}{sub c}{yields}J/{psi}{gamma}. The ratio R{sub {chi}{sub c}}= sum {sub i=1,2}{sigma}({chi}{sub ci})Br({chi}{sub ci}{yields}J/{psi}{gamma})/{sigma}(J/{psi}), which is the ratio of J/{psi} from {chi}{sub c} decays to all produced J/{psi}, was measured in the kinematical range -0.35chi}{sub c}}=0.190{sub -0.029}{sup +0.030}. Despite the small separation of the masses of the two {chi}{sub c} states, comparable to the detector resolution, the ratio R{sub 12}=R{sub {chi}{sub c}{sub 1}}/R{sub {chi}{sub c}{sub 2}} was measured yielding R{sub 12}=1.30{sub -0.37}{sup +0.59} which corresponds to a production cross section ratio ({sigma}({chi}{sub c1}))/({sigma}({chi}{sub c2}))=0.74{sub -0.22}{sup +0.34}. By using the known J/{psi} production cross section, the {chi}{sub c1} and {chi}{sub c2} production cross sections are calculated to be {sigma}({chi}{sub c1})=(153{+-}27) nb/nucleon and {sigma}({chi}{sub c2})=(207{+-}39) nb/nucleon, respectively. All results were obtained under the assumption that both the J/{psi} and {chi}{sub c} states are produced without polarization. In addition a study of possible deviations of R{sub {chi}{sub c}} and R{sub 12} due to the polarization of J/{psi} and {chi}{sub c} was performed. By varying the polarization parameter, {lambda}{sub obs}, of all produced J/{psi} by 2{sigma} around the value measured by HERA-B, and assuming fully

  3. City Streets

    Data.gov (United States)

    Minnesota Department of Natural Resources — This data set contains roadway centerlines for city streets found on the USGS 1:24,000 mapping series. In some areas, these roadways are current through the 2000...

  4. Potential Cities_

    OpenAIRE

    Budzynski, Scott

    2015-01-01

    Buildings and urban construction are understood in this paper as representations of the city. Their meanings, however, are often invisible, positing unrealized urban visions, which are both imbedded in and which call up chains of associations expressing desires and fears. Narratives of what the city should be often contain the rejection of the existing urban situation. Understanding architectural objects as potential underscores their imaginary nature. Freud, for example, uses the Roman ruins...

  5. Beautiful city

    OpenAIRE

    Gerald A. Carlino

    2009-01-01

    Proponents of the City Beautiful movement advocated for sizable public investments in monumental spaces, street beautification, and classical architecture. Today, economists and policymakers see the provision of consumer leisure amenities as a way to attract people and jobs to cities. But past studies have provided only indirect evidence of the importance of leisure amenities for urban growth and development. In this article, Jerry Carlino uses a new data set on the number of leisure tourist ...

  6. City Beautiful

    OpenAIRE

    Gerald A. Carlino; Saiz, Albert

    2008-01-01

    The City Beautiful movement, which in the early 20th century advocated city beautification as a way to improve the living conditions and civic virtues of the urban dweller, had languished by the Great Depression. Today, new urban economic theorists and policymakers are coming to see the provision of consumer leisure amenities as a way to attract population, especially the highly skilled and their employers. However, past studies have provided only indirect evidence of the importance of leisur...

  7. Model cities

    OpenAIRE

    M Batty

    2007-01-01

    The term ?model? is now central to our thinking about how weunderstand and design cities. We suggest a variety of ways inwhich we use ?models?, linking these ideas to Abercrombie?sexposition of Town and Country Planning which represented thestate of the art fifty years ago. Here we focus on using models asphysical representations of the city, tracing the development ofsymbolic models where the focus is on simulating how functiongenerates form, to iconic models where the focus is on representi...

  8. Learn with SAT to Minimize Büchi Automata

    Directory of Open Access Journals (Sweden)

    Stephan Barth

    2012-10-01

    Full Text Available We describe a minimization procedure for nondeterministic Büchi automata (NBA. For an automaton A another automaton A_min with the minimal number of states is learned with the help of a SAT-solver. This is done by successively computing automata A' that approximate A in the sense that they accept a given finite set of positive examples and reject a given finite set of negative examples. In the course of the procedure these example sets are successively increased. Thus, our method can be seen as an instance of a generic learning algorithm based on a "minimally adequate teacher'' in the sense of Angluin. We use a SAT solver to find an NBA for given sets of positive and negative examples. We use complementation via construction of deterministic parity automata to check candidates computed in this manner for equivalence with A. Failure of equivalence yields new positive or negative examples. Our method proved successful on complete samplings of small automata and of quite some examples of bigger automata. We successfully ran the minimization on over ten thousand automata with mostly up to ten states, including the complements of all possible automata with two states and alphabet size three and discuss results and runtimes; single examples had over 100 states.

  9. Electromagnetic Currents and Magnetic Moments in $\\chi$EFT

    Energy Technology Data Exchange (ETDEWEB)

    Saori Pastore, Luca Girlanda, Rocco Schiavilla, Michele Viviani, Robert Wiringa

    2009-09-01

    A two-nucleon potential and consistent electromagnetic currents are derived in chiral effective field theory ($\\chi$EFT) at, respectively, $Q^{\\, 2}$ (or N$^2$LO) and $e\\, Q$ (or N$^3$LO), where $Q$ generically denotes the low-momentum scale and $e$ is the electric charge. Dimensional regularization is used to renormalize the pion-loop corrections. A simple expression is derived for the magnetic dipole ($M1$) operator associated with pion loops, consisting of two terms, one of which is determined, uniquely, by the isospin-dependent part of the two-pion-exchange potential. This decomposition is also carried out for the $M1$ operator arising from contact currents, in which the unique term is determined by the contact potential. Finally, the low-energy constants (LEC's) entering the N$^2$LO potential are fixed by fits to the $np$ S- and P-wave phase shifts up to 100 MeV lab energies. Three additional LEC's are needed to completely specify the $M1$ operator at N$^3$L

  10. High chi polymer development for DSA applications using RAFT technology

    Science.gov (United States)

    Sheehan, Michael T.; Farnham, William B.; Tran, Hoang V.; Londono, J. David; Brun, Yefim

    2013-03-01

    Directed self-assembly (DSA) of block copolymers is proving to be an interesting and innovative method to make three-dimensional periodic, uniform patterns useful in a variety of microelectronics applications. Attributes critical to acceptable DSA performance of block copolymers include molecular weight uniformity, final purity, and reproducibility in all the steps involved in producing the polymers. Reversible Addition Fragmentation Chain Transfer (RAFT) polymerization technology enables the production of such materials provided that careful process monitoring and compositional homogeneity measurement systems are employed. It is uniquely suited to construction of multiblocks with components of widely divergent surface energies and functionality. We describe a high chi diblock system comprising partially fluorinated methacrylates and substituted styrenics. While special new polymer separation strategies involving controlled polymer particle assembly in liquid media are required for some monomer systems and molecular weight regimes, we have been able to demonstrate high yield and compositionally homogeneous diblocks of lamellar and cylindrical morphology with polydispersities < 1.1. During purification processes, these diblock materials undergo assembly processes in liquid media, and with appropriate controls, this allows for removal of soluble homopolymer contaminants. SAXS analyses of solid polymer samples provide estimates of lamellar d-spacing, and a good correlation with molecular weight is shown. This system will be described.

  11. Acute Cardiovascular Response to Sign Chi Do Exercise

    Directory of Open Access Journals (Sweden)

    Carol E. Rogers

    2015-08-01

    Full Text Available Safe and gentle exercise may be important for older adults overcoming a sedentary lifestyle. Sign Chi Do (SCD, a novel form of low impact exercise, has shown improved balance and endurance in healthy older adults, and there have been no SCD-related injuries reported. Sedentary older adults are known to have a greater cardiovascular (CV response to physical activity than those who regularly exercise. However their CV response to SCD is unknown. This study explored the acute CV response of older adults to SCD. Cross-sectional study of 34 sedentary and moderately active adults over age 55 with no previous experience practicing SCD. Participants completed a 10 min session of SCD. CV outcomes of heart rate, blood pressure, rate pressure product were recorded at 0, 5, 10 min of SCD performance, and after 10 min of rest. HR was recorded every minute. There was no difference in CV scores of sedentary and moderately active older adults after a session of SCD-related activity. All CV scores increased at 5 min, were maintained at 10 min, and returned to baseline within 10 min post SCD (p < 0.05. SCD may be a safe way to increase participation in regular exercise by sedentary older adults.

  12. Central Exclusive Production of $\\chi$ Mesons at LHCb

    CERN Document Server

    Bjornstad, Pal Marius

    The LHCb experiment is a forward spectrometer at the Large Hadron Collider, covering a range of pseudorapidity $1.9<\\eta<4.9$. It has a very precise vertex detector called the VELO, near the interaction point. The monitoring software for the VELO is discussed in this thesis. In proton-proton interactions, Central Exclusive Production (CEP) is a process where the protons remain intact after the interaction, and an additional simple central system is produced. CEP processes are selected experimentally by requiring that there is no activity in the detector apart from the central system. The installation of additional detectors to increase the sensitivity at small angles from the beam axis is discussed. A geometrical description of the region of the LHC up to $100$~m on each side of the LHCb interaction point is developed. Simulated forward shower counters are added to the model, and the efficiencies of the detectors are measured. The main part of this thesis describes an analysis of CEP of $\\chi_c$ mes...

  13. Sustainable cities

    International Nuclear Information System (INIS)

    The Sustainable City Project, a collaboration among the cities of Portland, Oregon, and San Francisco and San Jose, California, aims at developing and implementing sustainable energy planning methods and programs for cites. For a period of two years (1989-90), the three project cities worked in parallel, yet pursued independent courses to develop appropriate sustainable urban energy practices to meet local needs and aspirations. Central to the Sustainable City Project was finding ways to manage today's urban energy needs without jeopardizing the needs of future generations. Sustainability implies that nothing should go to waste, but rather should contribute to the proper balance between the natural environment and the built environment Sustainable urban energy systems encompass more than energy efficiency and energy conservation measures: they must be diverse, flexible, self-reliant, renewable, and integrated. Since local governments make decisions affecting land use, building codes, transportation systems, waste disposal, and power plants--all of which impact energy resource use--local jurisdictions can do much to ensure their own sustainable future. This paper will present an accounting of the specific steps that each city took to determine and begin implementation of their respective approaches to sustainable energy planning, with a specific focus on the City of San Jose activities. Useful tools for facilitating community process, program planning and implementation, and quantitative analysis will also be discussed

  14. Statistical analysis of earthquakes after the 1999 MW 7.7 Chi-Chi, Taiwan, earthquake based on a modified Reasenberg-Jones model

    Science.gov (United States)

    Chen, Yuh-Ing; Huang, Chi-Shen; Liu, Jann-Yenq

    2015-12-01

    We investigated the temporal-spatial hazard of the earthquakes after the 1999 September 21 MW = 7.7 Chi-Chi shock in a continental region of Taiwan. The Reasenberg-Jones (RJ) model (Reasenberg and Jones, 1989, 1994) that combines the frequency-magnitude distribution (Gutenberg and Richter, 1944) and time-decaying occurrence rate (Utsu et al., 1995) is conventionally employed for assessing the earthquake hazard after a large shock. However, it is found that the b values in the frequency-magnitude distribution of the earthquakes in the study region dramatically decreased from background values after the Chi-Chi shock, and then gradually increased up. The observation of a time-dependent frequency-magnitude distribution motivated us to propose a modified RJ model (MRJ) to assess the earthquake hazard. To see how the models perform on assessing short-term earthquake hazard, the RJ and MRJ models were separately used to sequentially forecast earthquakes in the study region. To depict the potential rupture area for future earthquakes, we further constructed relative hazard (RH) maps based on the two models. The Receiver Operating Characteristics (ROC) curves (Swets, 1988) finally demonstrated that the RH map based on the MRJ model was, in general, superior to the one based on the original RJ model for exploring the spatial hazard of earthquakes in a short time after the Chi-Chi shock.

  15. Observation of chi(cJ) decays to Lambda(Lambda)over-bar pi(+)pi(-)

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Ambrose, D. J.; An, F. F.; An, Q.; An, Z. H.; Bai, J. Z.; Ban, Y.; Becker, J.; Bennett, J. V.; Bertani, M.; Bian, J. M.; Boger, E.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Bytev, V.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, Y. B.; Cheng, H. P.; Chu, Y. P.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; Ding, W. M.; Ding, Y.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Fang, J.; Fang, S. S.; Fava, L.; Feldbauer, F.; Feng, C. Q.; Ferroli, R. B.; Fu, C. D.; Fu, J. L.; Gao, Y.; Geng, C.; Goetzen, K.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y. P.; Han, Y. L.; Harris, F. A.; He, K. L.; He, M.; He, Z. Y.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, H. M.; Hu, J. F.; Hu, T.; Huang, G. M.; Huang, J. S.; Huang, X. T.; Huang, Y. P.; Hussain, T.; Ji, C. S.; Ji, Q.; Ji, X. B.; Ji, X. L.; Jiang, L. L.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jing, F. F.; Kalantar-Nayestanaki, N.; Kavatsyuk, M.; Kuehn, W.; Lai, W.; Lange, J. S.; Li, C. H.; Li, Cheng; Li, Cui; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, K.; Li, Lei; Li, Q. J.; Li, S. L.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, X. R.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Liao, X. T.; Liu, B. J.; Liu, C. L.; Liu, C. X.; Liu, C. Y.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H.; Liu, H. B.; Liu, H. H.; Liu, H. M.; Liu, H. W.; Liu, J. P.; Liu, K. Y.; Liu, Kai; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. H.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H.; Lu, G. R.; Lu, H. J.; Lu, J. G.; Lu, Q. W.; Lu, X. R.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lv, M.; Ma, C. L.; Ma, F. C.; Ma, H. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X. Y.; Ma, Y.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Morales, C. Morales; Motzko, C.; Muchnoi, N. Yu.; Muramatsu, H.; Nefedov, Y.; Nicholson, C.; Nikolaev, I. B.; Ning, Z.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Park, J. W.; Pelizaeus, M.; Peng, H. P.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Prencipe, E.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, X. S.; Qin, Y.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Rong, G.; Ruan, X. D.; Sarantsev, A.; Schaefer, B. D.; Schulze, J.; Shao, M.; Shen, C. P.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, X. Y.; Spataro, S.; Spruck, B.; Sun, D. H.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tapan, I.; Thorndike, E. H.; Toth, D.; Ullrich, M.; Varner, G. S.; Wang, B.; Wang, B. Q.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q.; Wang, Q. J.; Wang, S. G.; Wang, X. L.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. Y.; Wei, D. H.; Weidenkaff, P.; Wen, Q. G.; Wen, S. P.; Wiedner, U.; Wu, L. H.; Wu, N.; Wu, S. X.; Wu, W.; Wu, Z.; Xia, L. G.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, G. M.; Xu, H.; Xu, Q. J.; Xu, X. P.; Xu, Z. R.; Xue, F.; Xue, Z.; Yan, L.; Yan, W. B.; Yan, Y. H.; Yang, H. X.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yu, B. X.; Yu, C. X.; Yu, J. S.; Yu, S. P.; Yuan, C. Z.; Yuan, Y.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, S. H.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. S.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, H. S.; Zhao, J. W.; Zhao, K. X.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, X. H.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, Y. H.; Zhong, B.; Zhong, J.; Zhou, L.; Zhou, X. K.; Zhou, X. R.; Zhu, C.; Zhu, K.; Zhu, K. J.; Zhu, S. H.; Zhu, X. L.; Zhu, X. W.; Zhu, Y. C.; Zhu, Y. M.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Werner, M.J.; Zheng, J.P.

    2012-01-01

    Decays of the chi(cJ) states (J = 0, 1, 2) to Lambda(Lambda) over bar pi(+)pi(-), including processes with intermediate Sigma(1385), are studied through the E1 transition psi(1) -> gamma chi(cJ) using 106 x 10(6) psi(1) events collected with the BESIII detector at BEPCII. This is the first observati

  16. Higher-order multipole amplitude measurement in psi ' -> gamma chi(c2)

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Alberto, D.; An, F. F.; An, Q.; An, Z. H.; Bai, J. Z.; Baldini, R.; Ban, Y.; Becker, J.; Berger, N.; Bertani, M.; Bian, J. M.; Boger, E.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Bytev, V.; Cai, X.; Calcaterra, A. C.; Cao, G. F.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, Y.; Chen, Y. B.; Cheng, H. P.; Chu, Y. P.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dedovich, D.; Deng, Z. Y.; Denysenko, I.; Destefanis, M.; Ding, Y.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Fang, J.; Fang, S. S.; Feng, C. Q.; Fu, C. D.; Fu, J. L.; Gao, Y.; Geng, C.; Goetzen, K.; Gong, W. X.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y. P.; Han, Y. L.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, M.; He, Z. Y.; Heng, Y. K.; Hou, Z. L.; Hu, H. M.; Hu, J. F.; Hu, T.; Huang, B.; Huang, G. M.; Huang, J. S.; Huang, X. T.; Huang, Y. P.; Hussain, T.; Ji, C. S.; Ji, Q.; Ji, X. B.; Ji, X. L.; Jia, L. K.; Jiang, L. L.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jing, F. F.; Kalantar-Nayestanaki, N.; Kavatsyuk, M.; Kuehn, W.; Lai, W.; Lange, J. S.; Leung, J. K. C.; Li, C. H.; Li, Cheng; Li, Cui; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, K.; Li, Lei; Li, N. B.; Li, Q. J.; Li, S. L.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, X. R.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, X. T.; Liu, B. J.; Liu, C. L.; Liu, C. X.; Liu, C. Y.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H.; Liu, H. B.; Liu, H. H.; Liu, H. M.; Liu, H. W.; Liu, J. P.; Liu, K.; Liu, K.; Liu, K. Y.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. H.; Liu, Y. B.; Liu, Y. W.; Liu, Yong; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H.; Lu, G. R.; Lu, H. J.; Lu, J. G.; Lu, Q. W.; Lu, X. R.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lv, M.; Ma, C. L.; Ma, F. C.; Ma, H. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X.; Ma, X. Y.; Maggiora, M.; Malik, Q. A.; Mao, H.; Mao, Y. J.; Mao, Z. P.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Muchnoi, N. Yu; Nefedov, Y.; Nikolaev, I. B.; Ning, Z.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Park, J. W.; Pelizaeus, M.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Pun, C. S. J.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, X. S.; Qiu, J. F.; Rashid, K. H.; Rong, G.; Ruan, X. D.; Sarantsev, A.; Schulze, J.; Shao, M.; Shen, C. P.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, X. Y.; Spataro, S.; Spruck, B.; Sun, D. H.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, X. D.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tian, H. L.; Toth, D.; Varner, G. S.; Wang, B.; Wang, B. Q.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q.; Wang, Q. J.; Wang, S. G.; Wang, X. L.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. Y.; Wei, D. H.; Wen, Q. G.; Wen, S. P.; Wiedner, U.; Wu, L. H.; Wu, N.; Wu, W.; Wu, Z.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, G. M.; Xu, H.; Xu, Q. J.; Xu, X. P.; Xu, Y.; Xu, Z. R.; Xu, Z. Z.; Xue, Z.; Yan, L.; Yan, W. B.; Yan, Y. H.; Yang, H. X.; Yang, T.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yu, B. X.; Yu, C. X.; Yu, S. P.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, L.; Zhang, S. H.; Zhang, T. R.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. S.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, H. S.; Zhao, Jiawei; Zhao, Jingwei; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, X. H.; Zhao, Y. B.; Zhao, Z. G.; Zhao, Z. L.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, Y. H.; Zheng, Z. P.; Zhong, B.; Zhong, J.; Zhong, L.; Zhou, L.; Zhou, X. K.; Zhou, X. R.; Zhu, C.; Zhu, K.; Zhu, K. J.; Zhu, S. H.; Zhu, X. L.; Zhu, X. W.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Zuo, J. X.

    2011-01-01

    Using 106 x 10(6) psi' events collected with the BESIII detector at the BEPCII storage ring, the higher-order multipole amplitudes in the radiative transition psi' -> gamma chi(c2) -> gamma pi(+)pi(-)/gamma K+K- are measured. A fit to the chi(c2) production and decay angular distributions yields M2

  17. Quantum key distribution by swapping the entanglement of {chi}-type state

    Energy Technology Data Exchange (ETDEWEB)

    Gao Gan, E-mail: gaogan0556@163.co [Department of Electrical Engineering, Tongling University, Tongling 244000 (China)

    2010-06-01

    We propose a quantum key distribution protocol using entanglement swapping of {chi}-type state; in this protocol, Alice and Bob transmit a particle sequence to each other and perform {chi}-type state measurements. Alice's and Bob's roles are completely symmetric.

  18. Implementing e-Health through CHI: A Very Canadian Solution to a Very Canadian Problem

    Directory of Open Access Journals (Sweden)

    Tom Daniels

    2014-05-01

    Full Text Available Canada Health Infoway (CHI was established as an arms-length body by the federal government in 2001 to provide funding to provinces for the development of interoperable e-health systems. CHI was established in response to a number of reports calling on the government to act to make use of technological advances to improve health care quality and provide more rigorous data. In addition to these explicit goals, through establishing CHI the federal government also sought to avoid potential criticism if the implementation of e-health failed, increase its own popularity ahead of the 2000 election and subtly redistribute wealth between the provinces. The paper suggests that the major influence behind the policy to establish CHI came from Canadian institutions and the fact that the federal government was hamstrung by the Canadian Constitution and Canada Health Act. Evaluation of the reform shows that progress has been made by CHI in implementing e-health solutions, but that Canada still lags behind other comparable health systems in the use of technologies. SWOT analysis of the CHI implementation highlights the criticism that CHI could stifle provincial innovation but recognizes that it also offers the opportunity for best practice dissemination across Canada and ensures that ring-fenced funding is available for e-health implementation across the provinces. In conclusion, the paper suggests that, because of constitutional constraints, the federal government was limited in options to implement e-health and that CHI represents a fair compromise.

  19. $\\chi_{c2}$ formation in two-photon collisions at LEP

    CERN Document Server

    Acciarri, M; Adriani, O; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Balandras, A; Ball, R C; Banerjee, S; Banerjee, Sw; Banicz, K; Barczyk, A; Barillère, R; Barone, L; Bartalini, P; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brigljevic, V; Brochu, F; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Button, A M; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chéreau, X J; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Coignet, G; Colijn, A P; Colino, N; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; van Dalen, J A; D'Alessandro, R; De Asmundis, R; Déglon, P L; Degré, A; Deiters, K; Della Volpe, D; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Dufournaud, D; Duinker, P; Durán, I; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Extermann, Pierre; Fabre, M; Faccini, R; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Goldfarb, S; Gong, Z F; Grünewald, M W; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hartmann, B; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hidas, P; Hirschfelder, J; Hofer, H; Holzner, G; Hoorani, H; Hou, S R; Iashvili, I; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Khan, R A; Kamrad, D; Kapustinsky, J S; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, D H; Kim, J K; Kim, S C; Kinnison, W W; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopp, A; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Lacentre, P E; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lavorato, A; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee, H J; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Marchesini, P A; Marian, G; Martin, J P; Marzano, F; Massaro, G G G; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Migani, D; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moulik, T; Muanza, G S; Muheim, F; Muijs, A J M; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nippe, A; Nisati, A; Nowak, H; Oh, Yu D; Organtini, G; Ostonen, R; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Park, I H; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pedace, M; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Piccolo, D; Pieri, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Pothier, J; Produit, N; Prokofev, D; Prokofiev, D O; Quartieri, J; Rahal-Callot, G; Raja, N; Rancoita, P G; Raven, G; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Robohm, A; Rodin, J; Roe, B P; Romero, L; Rosier-Lees, S; Roth, S; Rubio, Juan Antonio; Ruschmeier, D; Rykaczewski, H; Sakar, S; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stone, H; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Suter, H; Swain, J D; Szillási, Z; Tang, X W; Tauscher, Ludwig; Taylor, L; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Uchida, Y; Ulbricht, J; Valente, E; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Z M; Weber, A; Wilkens, H; Wu, S X; Wynhoff, S; Xia, L; Xu, Z Z; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zeng, Y; Zhang, Z P; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F; Zilizi, G

    1999-01-01

    Two-photon formation of the charmonium resonance $\\chi_{{\\rm c}2}$ has been studied with the L3 detector at LEP. The $\\chi_{{\\rm c}2}$ is identified through its decay $\\chi_{{\\rm c}2} \\rightarrow \\gamma {\\rm J}$, with a subsequent decay ${\\rm J} \\rightarrow {\\mathrm{e^+ e^-}}$ or ${\\rm J} \\rightarrow {\\mathrm{\\mu^+ \\mu^-}}$. With an integrated luminosity of 140 pb$^{-1}$ at $\\sqrt{s} \\simeq$ 91~\\textrm{Ge\\kern -0.1em V} and 52 pb$^{-1}$ at $\\sqrt{s} \\simeq$ {Ge\\kern -0.1em V}, we measure the two-photon width of the $\\chi_{{\\rm c}2}$ to be \\begin{center} $\\Gamma_{\\gamma\\gamma}(\\chi_{{\\rm c}2})=1.02 \\pm 0.40 \\mbox{$\\;$(stat.)} \\pm 0.15 \\mbox{$\\;$(sys.)} \\pm 0.09(\\rm{BR.}) {\\mathrm{\\ ke\\kern -0.1em V}}$.

  20. City Branding

    DEFF Research Database (Denmark)

    Trads, Søren Frimann; Stigel, Jørgen

    2006-01-01

    Succesful corporate branding requires that questions related to communication, publicity, and organizational structures are adressed. An uncritical adoption of approaches known from tradition product branding will inevitable give problems as the properties of tangible commodities and services with...... potential visitors, problems seem to multiply in what has becom known as city branding. This analysis of the communicational aspects of two Danish provincial towns´ branding efforts examines both their internally and externally directed communication. It demonstrates that an insufficient understanding of...... - or willingness to face - these differences will inevitably hamper such branding efforts because of the consequential inconsistencies. Finally, paths to more effective city branding are indicated...

  1. Soft Cities

    DEFF Research Database (Denmark)

    Brix, Anders; Yoneda, Akira; Nakamura, Kiyoshi

    2015-01-01

    This paper presents a project exploring sustainable ways of urban living. The project renders a scenario comprised of an array of simple conversions of existing urban spaces and buildings, in the attempt to tie strategies ranging from urban planning to interior design into a coherent vision of a...... sustainable future. The project is the result of a joint research study between Denmark and Japan. Taking as its example the city of Kyoto, the project investigates some possible strategies on how cities more generally may be transformed into liveable, healthy and ecologically sensible environments....

  2. City 2020+

    Science.gov (United States)

    Schneider, C.; Buttstädt, M.; Merbitz, H.; Sachsen, T.; Ketzler, G.; Michael, S.; Klemme, M.; Dott, W.; Selle, K.; Hofmeister, H.

    2010-09-01

    This research initiative CITY 2020+ assesses the risks and opportunities for residents in urban built environments under projected demographic and climate change for the year 2020 and beyond, using the City of Aachen as a case study. CITY 2020+ develops scenarios, options and tools for planning and developing sustainable future city structures. We investigate how urban environment, political structure and residential behavior can best be adapted, with attention to the interactions among structural, political, and sociological configurations and with their consequences on human health. Demographers project that in the EU-25-States by 2050, approximately 30% of the population will be over age 65. Also by 2050, average tem¬peratures are projected to rise by 1 to 2 K. Combined, Europe can expect enhanced thermal stress and higher levels of particulate matter. CITY 2020+ amongst other sub-projects includes research project dealing with (1) a micro-scale assessment of blockages to low-level cold-air drainage flow into the city centre by vegetation and building structures, (2) a detailed analysis of the change of probability density functions related to the occurrence of heat waves during summer and the spatial and temporal structure of the urban heat island (UHI) (3) a meso-scale analysis of particulate matter (PM) concentrations depending on topography, local meteorological conditions and synoptic-scale weather patterns. First results will be presented specifically from sub-projects related to vegetation barriers within cold air drainage, the assessment of the UHI and the temporal and spatial pattern of PM loadings in the city centre. The analysis of the cold air drainage flow is investigated in two consecutive years with a clearing of vegetation stands in the beginning of the second year early in 2010. The spatial pattern of the UHI and its possible enhancement by climate change is addressed employing a unique setup using GPS devices and temperature probes fixed to

  3. Fun City

    DEFF Research Database (Denmark)

    Once the blues guitarist B.B. King sang that when he "didn't wanna live no more", he would go shopping instead. Now, however, shopping has become a lifestyle... The city of today has become "Disneyfied" and "Tivolized". It has become a scene for events. The aim of the book is to encircle and pin ...

  4. City Geology.

    Science.gov (United States)

    Markle, Sandra

    1989-01-01

    This article provides information on the evolution of the building material, concrete, and suggests hands-on activities that allow students to experience concrete's qualities, test the heat absorbency of various ground surface materials, discover how an area's geology changes, and search for city fossils. A reproducible activity sheet is included.…

  5. Tai chi training reduces self-report of inattention in healthy young adults.

    Science.gov (United States)

    Converse, Alexander K; Ahlers, Elizabeth O; Travers, Brittany G; Davidson, Richard J

    2014-01-01

    It is important to identify effective non-pharmacological alternatives to stimulant medications that reduce symptoms of attention deficit hyperactivity disorder (ADHD). In this study of healthy young adults, we measured the effects of training in tai chi, which involves mindful attention to the body during movement. Using a non-randomized, controlled, parallel design, students in a 15-week introductory tai chi course (n = 28) and control participants (n = 44) were tested for ADHD indicators and cognitive function at three points over the course of the 15-weeks. The tai chi students' self-report of attention, but not hyperactivity-impulsivity, improved compared to controls. At baseline, inattention correlated positively with reaction time variability in an affective go/no-go task across all participants, and improvements in attention correlated with reductions in reaction time variability across the tai chi students. Affective bias changed in the tai chi students, as reaction times to positive- and negative-valenced words equalized over time. These results converge to suggest that tai chi training may help improve attention in healthy young adults. Further studies are needed to confirm these results and to evaluate tai chi as therapy for individuals with ADHD. PMID:24478679

  6. Tai chi training reduces self-report of inattention in healthy young adults

    Directory of Open Access Journals (Sweden)

    Alexander K. Converse

    2014-01-01

    Full Text Available It is important to identify effective non-pharmacological alternatives to stimulant medications that reduce symptoms of attention deficit hyperactivity disorder (ADHD. In this study of healthy young adults, we measured the effects of training in tai chi, which involves mindful attention to the body during movement. Using a non-randomized, controlled, parallel design, students in a 15-week introductory tai chi course (n=28 and control participants (n=44 were tested for ADHD indicators and cognitive function at three points over the course of the 15 weeks. The tai chi students' self-report of attention, but not hyperactivity-impulsivity, improved compared to controls. At baseline, inattention correlated positively with reaction time variability in an affective go/no-go task across all participants, and improvements in attention correlated with reductions in reaction time variability across the tai chi students. Affective bias changed in the tai chi students, as reaction times to positive- and negative-valenced words equalized over time. These results converge to suggest that tai chi training may help improve attention in healthy young adults. Further studies are needed to confirm these results and to evaluate tai chi as therapy for individuals with ADHD.

  7. Measurement of the relative prompt production rate of $\\chi_{c2}$ and $\\chi_{c1}$ in pp collisions at $\\sqrt{s}$ = 7 TeV

    CERN Document Server

    Chatrchyan, Serguei; Sirunyan, Albert M; Tumasyan, Armen; Adam, Wolfgang; Aguilo, Ernest; Bergauer, Thomas; Dragicevic, Marko; Erö, Janos; Fabjan, Christian; Friedl, Markus; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Hammer, Josef; Hörmann, Natascha; Hrubec, Josef; Jeitler, Manfred; Kiesenhofer, Wolfgang; Knünz, Valentin; Krammer, Manfred; Krätschmer, Ilse; Liko, Dietrich; Mikulec, Ivan; Pernicka, Manfred; Rahbaran, Babak; Rohringer, Christine; Rohringer, Herbert; Schöfbeck, Robert; Strauss, Josef; Taurok, Anton; Waltenberger, Wolfgang; Walzel, Gerhard; Widl, Edmund; Wulz, Claudia-Elisabeth; Mossolov, Vladimir; Shumeiko, Nikolai; Suarez Gonzalez, Juan; Bansal, Monika; Bansal, Sunil; Cornelis, Tom; De Wolf, Eddi A; Janssen, Xavier; Luyckx, Sten; Mucibello, Luca; Ochesanu, Silvia; Roland, Benoit; Rougny, Romain; Selvaggi, Michele; Staykova, Zlatka; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Van Spilbeeck, Alex; Blekman, Freya; Blyweert, Stijn; D'Hondt, Jorgen; Gonzalez Suarez, Rebeca; Kalogeropoulos, Alexis; Maes, Michael; Olbrechts, Annik; Van Doninck, Walter; Van Mulders, Petra; Van Onsem, Gerrit Patrick; Villella, Ilaria; Clerbaux, Barbara; De Lentdecker, Gilles; Dero, Vincent; Gay, Arnaud; Hreus, Tomas; Léonard, Alexandre; Marage, Pierre Edouard; Mohammadi, Abdollah; Reis, Thomas; Thomas, Laurent; Vander Marcken, Gil; Vander Velde, Catherine; Vanlaer, Pascal; Wang, Jian; Adler, Volker; Beernaert, Kelly; Cimmino, Anna; Costantini, Silvia; Garcia, Guillaume; Grunewald, Martin; Klein, Benjamin; Lellouch, Jérémie; Marinov, Andrey; Mccartin, Joseph; Ocampo Rios, Alberto Andres; Ryckbosch, Dirk; Strobbe, Nadja; Thyssen, Filip; Tytgat, Michael; Verwilligen, Piet; Walsh, Sinead; Yazgan, Efe; Zaganidis, Nicolas; Basegmez, Suzan; Bruno, Giacomo; Castello, Roberto; Ceard, Ludivine; Delaere, Christophe; Du Pree, Tristan; Favart, Denis; Forthomme, Laurent; Giammanco, Andrea; Hollar, Jonathan; Lemaitre, Vincent; Liao, Junhui; Militaru, Otilia; Nuttens, Claude; Pagano, Davide; Pin, Arnaud; Piotrzkowski, Krzysztof; Schul, Nicolas; Vizan Garcia, Jesus Manuel; Beliy, Nikita; Caebergs, Thierry; Daubie, Evelyne; Hammad, Gregory Habib; Alves, Gilvan; Correa Martins Junior, Marcos; De Jesus Damiao, Dilson; Martins, Thiago; Pol, Maria Elena; Henrique Gomes E Souza, Moacyr; Aldá Júnior, Walter Luiz; Carvalho, Wagner; Custódio, Analu; Da Costa, Eliza Melo; De Oliveira Martins, Carley; Fonseca De Souza, Sandro; Matos Figueiredo, Diego; Mundim, Luiz; Nogima, Helio; Oguri, Vitor; Prado Da Silva, Wanda Lucia; Santoro, Alberto; Soares Jorge, Luana; Sznajder, Andre; Souza Dos Anjos, Tiago; Bernardes, Cesar Augusto; De Almeida Dias, Flavia; Tomei, Thiago; De Moraes Gregores, Eduardo; Lagana, Caio; Da Cunha Marinho, Franciole; Mercadante, Pedro G; Novaes, Sergio F; Padula, Sandra; Genchev, Vladimir; Iaydjiev, Plamen; Piperov, Stefan; Rodozov, Mircho; Stoykova, Stefka; Sultanov, Georgi; Tcholakov, Vanio; Trayanov, Rumen; Vutova, Mariana; Dimitrov, Anton; Hadjiiska, Roumyana; Kozhuharov, Venelin; Litov, Leander; Pavlov, Borislav; Petkov, Peicho; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Jiang, Chun-Hua; Liang, Dong; Liang, Song; Meng, Xiangwei; Tao, Junquan; Wang, Jian; Wang, Xianyou; Wang, Zheng; Xiao, Hong; Xu, Ming; Zang, Jingjing; Zhang, Zhen; Asawatangtrakuldee, Chayanit; Ban, Yong; Guo, Yifei; Li, Wenbo; Liu, Shuai; Mao, Yajun; Qian, Si-Jin; Teng, Haiyun; Wang, Dayong; Zhang, Linlin; Zou, Wei; Avila, Carlos; Gomez, Juan Pablo; Gomez Moreno, Bernardo; Osorio Oliveros, Andres Felipe; Sanabria, Juan Carlos; Godinovic, Nikola; Lelas, Damir; Plestina, Roko; Polic, Dunja; Puljak, Ivica; Antunovic, Zeljko; Kovac, Marko; Brigljevic, Vuko; Duric, Senka; Kadija, Kreso; Luetic, Jelena; Morovic, Srecko; Attikis, Alexandros; Galanti, Mario; Mavromanolakis, Georgios; Mousa, Jehad; Nicolaou, Charalambos; Ptochos, Fotios; Razis, Panos A; Finger, Miroslav; Finger Jr, Michael; Assran, Yasser; Elgammal, Sherif; Ellithi Kamel, Ali; Khalil, Shaaban; Mahmoud, Mohammed; Radi, Amr; Kadastik, Mario; Müntel, Mait; Raidal, Martti; Rebane, Liis; Tiko, Andres; Eerola, Paula; Fedi, Giacomo; Voutilainen, Mikko; Härkönen, Jaakko; Heikkinen, Mika Aatos; Karimäki, Veikko; Kinnunen, Ritva; Kortelainen, Matti J; Lampén, Tapio; Lassila-Perini, Kati; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Mäenpää, Teppo; Peltola, Timo; Tuominen, Eija; Tuominiemi, Jorma; Tuovinen, Esa; Ungaro, Donatella; Wendland, Lauri; Banzuzi, Kukka; Karjalainen, Ahti; Korpela, Arja; Tuuva, Tuure; Besancon, Marc; Choudhury, Somnath; Dejardin, Marc; Denegri, Daniel; Fabbro, Bernard; Faure, Jean-Louis; Ferri, Federico; Ganjour, Serguei; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Locci, Elizabeth; Malcles, Julie; Millischer, Laurent; Nayak, Aruna; Rander, John; Rosowsky, André; Shreyber, Irina; Titov, Maksym; Baffioni, Stephanie; Beaudette, Florian; Benhabib, Lamia; Bianchini, Lorenzo; Bluj, Michal; Broutin, Clementine; Busson, Philippe; Charlot, Claude; Daci, Nadir; Dahms, Torsten; Dobrzynski, Ludwik; Granier de Cassagnac, Raphael; Haguenauer, Maurice; Miné, Philippe; Mironov, Camelia; Naranjo, Ivo Nicolas; Nguyen, Matthew; Ochando, Christophe; Paganini, Pascal; Sabes, David; Salerno, Roberto; Sirois, Yves; Veelken, Christian; Zabi, Alexandre; Agram, Jean-Laurent; Andrea, Jeremy; Bloch, Daniel; Bodin, David; Brom, Jean-Marie; Cardaci, Marco; Chabert, Eric Christian; Collard, Caroline; Conte, Eric; Drouhin, Frédéric; Ferro, Cristina; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Juillot, Pierre; Le Bihan, Anne-Catherine; Van Hove, Pierre; Fassi, Farida; Mercier, Damien; Beauceron, Stephanie; Beaupere, Nicolas; Bondu, Olivier; Boudoul, Gaelle; Chasserat, Julien; Chierici, Roberto; Contardo, Didier; Depasse, Pierre; El Mamouni, Houmani; Fay, Jean; Gascon, Susan; Gouzevitch, Maxime; Ille, Bernard; Kurca, Tibor; Lethuillier, Morgan; Mirabito, Laurent; Perries, Stephane; Sordini, Viola; Tschudi, Yohann; Verdier, Patrice; Viret, Sébastien; Tsamalaidze, Zviad; Anagnostou, Georgios; Autermann, Christian; Beranek, Sarah; Edelhoff, Matthias; Feld, Lutz; Heracleous, Natalie; Hindrichs, Otto; Jussen, Ruediger; Klein, Katja; Merz, Jennifer; Ostapchuk, Andrey; Perieanu, Adrian; Raupach, Frank; Sammet, Jan; Schael, Stefan; Sprenger, Daniel; Weber, Hendrik; Wittmer, Bruno; Zhukov, Valery; Ata, Metin; Caudron, Julien; Dietz-Laursonn, Erik; Duchardt, Deborah; Erdmann, Martin; Fischer, Robert; Güth, Andreas; Hebbeker, Thomas; Heidemann, Carsten; Hoepfner, Kerstin; Klingebiel, Dennis; Kreuzer, Peter; Magass, Carsten; Merschmeyer, Markus; Meyer, Arnd; Olschewski, Mark; Papacz, Paul; Pieta, Holger; Reithler, Hans; Schmitz, Stefan Antonius; Sonnenschein, Lars; Steggemann, Jan; Teyssier, Daniel; Weber, Martin; Bontenackels, Michael; Cherepanov, Vladimir; Erdogan, Yusuf; Flügge, Günter; Geenen, Heiko; Geisler, Matthias; Haj Ahmad, Wael; Hoehle, Felix; Kargoll, Bastian; Kress, Thomas; Kuessel, Yvonne; Nowack, Andreas; Perchalla, Lars; Pooth, Oliver; Sauerland, Philip; Stahl, Achim; Aldaya Martin, Maria; Behr, Joerg; Behrenhoff, Wolf; Behrens, Ulf; Bergholz, Matthias; Bethani, Agni; Borras, Kerstin; Burgmeier, Armin; Cakir, Altan; Calligaris, Luigi; Campbell, Alan; Castro, Elena; Costanza, Francesco; Dammann, Dirk; Diez Pardos, Carmen; Eckerlin, Guenter; Eckstein, Doris; Flucke, Gero; Geiser, Achim; Glushkov, Ivan; Gunnellini, Paolo; Habib, Shiraz; Hauk, Johannes; Hellwig, Gregor; Jung, Hannes; Kasemann, Matthias; Katsas, Panagiotis; Kleinwort, Claus; Kluge, Hannelies; Knutsson, Albert; Krämer, Mira; Krücker, Dirk; Kuznetsova, Ekaterina; Lange, Wolfgang; Lohmann, Wolfgang; Lutz, Benjamin; Mankel, Rainer; Marfin, Ihar; Marienfeld, Markus; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Mnich, Joachim; Mussgiller, Andreas; Naumann-Emme, Sebastian; Olzem, Jan; Perrey, Hanno; Petrukhin, Alexey; Pitzl, Daniel; Raspereza, Alexei; Ribeiro Cipriano, Pedro M; Riedl, Caroline; Ron, Elias; Rosin, Michele; Salfeld-Nebgen, Jakob; Schmidt, Ringo; Schoerner-Sadenius, Thomas; Sen, Niladri; Spiridonov, Alexander; Stein, Matthias; Walsh, Roberval; Wissing, Christoph; Blobel, Volker; Draeger, Jula; Enderle, Holger; Erfle, Joachim; Gebbert, Ulla; Görner, Martin; Hermanns, Thomas; Höing, Rebekka Sophie; Kaschube, Kolja; Kaussen, Gordon; Kirschenmann, Henning; Klanner, Robert; Lange, Jörn; Mura, Benedikt; Nowak, Friederike; Peiffer, Thomas; Pietsch, Niklas; Rathjens, Denis; Sander, Christian; Schettler, Hannes; Schleper, Peter; Schlieckau, Eike; Schmidt, Alexander; Schröder, Matthias; Schum, Torben; Seidel, Markus; Sola, Valentina; Stadie, Hartmut; Steinbrück, Georg; Thomsen, Jan; Vanelderen, Lukas; Barth, Christian; Berger, Joram; Böser, Christian; Chwalek, Thorsten; De Boer, Wim; Descroix, Alexis; Dierlamm, Alexander; Feindt, Michael; Guthoff, Moritz; Hackstein, Christoph; Hartmann, Frank; Hauth, Thomas; Heinrich, Michael; Held, Hauke; Hoffmann, Karl-Heinz; Honc, Simon; Katkov, Igor; Komaragiri, Jyothsna Rani; Lobelle Pardo, Patricia; Martschei, Daniel; Mueller, Steffen; Müller, Thomas; Niegel, Martin; Nürnberg, Andreas; Oberst, Oliver; Oehler, Andreas; Ott, Jochen; Quast, Gunter; Rabbertz, Klaus; Ratnikov, Fedor; Ratnikova, Natalia; Röcker, Steffen; Scheurer, Armin; Schilling, Frank-Peter; Schott, Gregory; Simonis, Hans-Jürgen; Stober, Fred-Markus Helmut; Troendle, Daniel; Ulrich, Ralf; Wagner-Kuhr, Jeannine; Wayand, Stefan; Weiler, Thomas; Zeise, Manuel; Daskalakis, Georgios; Geralis, Theodoros; Kesisoglou, Stilianos; Kyriakis, Aristotelis; Loukas, Demetrios; Manolakos, Ioannis; Markou, Athanasios; Markou, Christos; Mavrommatis, Charalampos; Ntomari, Eleni; Gouskos, Loukas; Mertzimekis, Theodoros; Panagiotou, Apostolos; Saoulidou, Niki; Evangelou, Ioannis; Foudas, Costas; Kokkas, Panagiotis; Manthos, Nikolaos; Papadopoulos, Ioannis; Patras, Vaios; Bencze, Gyorgy; Hajdu, Csaba; Hidas, Pàl; Horvath, Dezso; Sikler, Ferenc; Veszpremi, Viktor; Vesztergombi, Gyorgy; Beni, Noemi; Czellar, Sandor; Molnar, Jozsef; Palinkas, Jozsef; Szillasi, Zoltan; Karancsi, János; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Beri, Suman Bala; Bhatnagar, Vipin; Dhingra, Nitish; Gupta, Ruchi; Kaur, Manjit; Mehta, Manuk Zubin; Nishu, Nishu; Saini, Lovedeep Kaur; Sharma, Archana; Singh, Jasbir; Kumar, Ashok; Kumar, Arun; Ahuja, Sudha; Bhardwaj, Ashutosh; Choudhary, Brajesh C; Malhotra, Shivali; Naimuddin, Md; Ranjan, Kirti; Sharma, Varun; Shivpuri, Ram Krishen; Banerjee, Sunanda; Bhattacharya, Satyaki; Dutta, Suchandra; Gomber, Bhawna; Jain, Sandhya; Jain, Shilpi; Khurana, Raman; Sarkar, Subir; Sharan, Manoj; Abdulsalam, Abdulla; Choudhury, Rajani Kant; Dutta, Dipanwita; Kailas, Swaminathan; Kumar, Vineet; Mehta, Pourus; Mohanty, Ajit Kumar; Pant, Lalit Mohan; Shukla, Prashant; Aziz, Tariq; Ganguly, Sanmay; Guchait, Monoranjan; Maity, Manas; Majumder, Gobinda; Mazumdar, Kajari; Mohanty, Gagan Bihari; Parida, Bibhuti; Sudhakar, Katta; Wickramage, Nadeesha; Banerjee, Sudeshna; Dugad, Shashikant; Arfaei, Hessamaddin; Bakhshiansohi, Hamed; Etesami, Seyed Mohsen; Fahim, Ali; Hashemi, Majid; Hesari, Hoda; Jafari, Abideh; Khakzad, Mohsen; Mohammadi Najafabadi, Mojtaba; Paktinat Mehdiabadi, Saeid; Safarzadeh, Batool; Zeinali, Maryam; Abbrescia, Marcello; Barbone, Lucia; Calabria, Cesare; Chhibra, Simranjit Singh; Colaleo, Anna; Creanza, Donato; De Filippis, Nicola; De Palma, Mauro; Fiore, Luigi; Iaselli, Giuseppe; Lusito, Letizia; Maggi, Giorgio; Maggi, Marcello; Marangelli, Bartolomeo; My, Salvatore; Nuzzo, Salvatore; Pacifico, Nicola; Pompili, Alexis; Pugliese, Gabriella; Selvaggi, Giovanna; Silvestris, Lucia; Singh, Gurpreet; Venditti, Rosamaria; Zito, Giuseppe; Abbiendi, Giovanni; Benvenuti, Alberto; Bonacorsi, Daniele; Braibant-Giacomelli, Sylvie; Brigliadori, Luca; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Fasanella, Daniele; Giacomelli, Paolo; Grandi, Claudio; Guiducci, Luigi; Marcellini, Stefano; Masetti, Gianni; Meneghelli, Marco; Montanari, Alessandro; Navarria, Francesco; Odorici, Fabrizio; Perrotta, Andrea; Primavera, Federica; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gian Piero; Travaglini, Riccardo; Albergo, Sebastiano; Cappello, Gigi; Chiorboli, Massimiliano; Costa, Salvatore; Potenza, Renato; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Frosali, Simone; Gallo, Elisabetta; Gonzi, Sandro; Meschini, Marco; Paoletti, Simone; Sguazzoni, Giacomo; Tropiano, Antonio; Benussi, Luigi; Bianco, Stefano; Colafranceschi, Stefano; Fabbri, Franco; Piccolo, Davide; Fabbricatore, Pasquale; Musenich, Riccardo; Tosi, Silvano; Benaglia, Andrea; De Guio, Federico; Di Matteo, Leonardo; Fiorendi, Sara; Gennai, Simone; Ghezzi, Alessio; Malvezzi, Sandra; Manzoni, Riccardo Andrea; Martelli, Arabella; Massironi, Andrea; Menasce, Dario; Moroni, Luigi; Paganoni, Marco; Pedrini, Daniele; Ragazzi, Stefano; Redaelli, Nicola; Sala, Silvano; Tabarelli de Fatis, Tommaso; Buontempo, Salvatore; Carrillo Montoya, Camilo Andres; Cavallo, Nicola; De Cosa, Annapaola; Dogangun, Oktay; Fabozzi, Francesco; Iorio, Alberto Orso Maria; Lista, Luca; Meola, Sabino; Merola, Mario; Paolucci, Pierluigi; Azzi, Patrizia; Bacchetta, Nicola; Bisello, Dario; Branca, Antonio; Carlin, Roberto; Checchia, Paolo; Dorigo, Tommaso; Gasparini, Fabrizio; Gasparini, Ugo; Gozzelino, Andrea; Kanishchev, Konstantin; Lacaprara, Stefano; Lazzizzera, Ignazio; Margoni, Martino; Meneguzzo, Anna Teresa; Pazzini, Jacopo; Pozzobon, Nicola; Ronchese, Paolo; Simonetto, Franco; Torassa, Ezio; Tosi, Mia; Vanini, Sara; Zotto, Pierluigi; Zucchetta, Alberto; Zumerle, Gianni; Gabusi, Michele; Ratti, Sergio P; Riccardi, Cristina; Torre, Paola; Vitulo, Paolo; Biasini, Maurizio; Bilei, Gian Mario; Fanò, Livio; Lariccia, Paolo; Lucaroni, Andrea; Mantovani, Giancarlo; Menichelli, Mauro; Nappi, Aniello; Romeo, Francesco; Saha, Anirban; Santocchia, Attilio; Spiezia, Aniello; Taroni, Silvia; Azzurri, Paolo; Bagliesi, Giuseppe; Boccali, Tommaso; Broccolo, Giuseppe; Castaldi, Rino; D'Agnolo, Raffaele Tito; Dell'Orso, Roberto; Fiori, Francesco; Foà, Lorenzo; Giassi, Alessandro; Kraan, Aafke; Ligabue, Franco; Lomtadze, Teimuraz; Martini, Luca; Messineo, Alberto; Palla, Fabrizio; Rizzi, Andrea; Serban, Alin Titus; Spagnolo, Paolo; Squillacioti, Paola; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; Del Re, Daniele; Diemoz, Marcella; Fanelli, Cristiano; Grassi, Marco; Longo, Egidio; Meridiani, Paolo; Micheli, Francesco; Nourbakhsh, Shervin; Organtini, Giovanni; Paramatti, Riccardo; Rahatlou, Shahram; Sigamani, Michael; Soffi, Livia; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Biino, Cristina; Cartiglia, Nicolo; Costa, Marco; Demaria, Natale; Mariotti, Chiara; Maselli, Silvia; Migliore, Ernesto; Monaco, Vincenzo; Musich, Marco; Obertino, Maria Margherita; Pastrone, Nadia; Pelliccioni, Mario; Potenza, Alberto; Romero, Alessandra; Sacchi, Roberto; Solano, Ada; Staiano, Amedeo; Usai, Emanuele; Vilela Pereira, Antonio; Belforte, Stefano; Candelise, Vieri; Cossutti, Fabio; Della Ricca, Giuseppe; Gobbo, Benigno; Marone, Matteo; Montanino, Damiana; Penzo, Aldo; Schizzi, Andrea; Heo, Seong Gu; Kim, Tae Yeon; Nam, Soon-Kwon; Chang, Sunghyun; Kim, Dong Hee; Kim, Gui Nyun; Kong, Dae Jung; Park, Hyangkyu; Ro, Sang-Ryul; Son, Dong-Chul; Son, Taejin; Kim, Jae Yool; Kim, Zero Jaeho; Song, Sanghyeon; Choi, Suyong; Gyun, Dooyeon; Hong, Byung-Sik; Jo, Mihee; Kim, Hyunchul; Kim, Tae Jeong; Lee, Kyong Sei; Moon, Dong Ho; Park, Sung Keun; Choi, Minkyoo; Kim, Ji Hyun; Park, Chawon; Park, Inkyu; Park, Sangnam; Ryu, Geonmo; Cho, Yongjin; Choi, Young-Il; Choi, Young Kyu; Goh, Junghwan; Kim, Min Suk; Kwon, Eunhyang; Lee, Byounghoon; Lee, Jongseok; Lee, Sungeun; Seo, Hyunkwan; Yu, Intae; Bilinskas, Mykolas Jurgis; Grigelionis, Ignas; Janulis, Mindaugas; Juodagalvis, Andrius; Castilla-Valdez, Heriberto; De La Cruz-Burelo, Eduard; Heredia-de La Cruz, Ivan; Lopez-Fernandez, Ricardo; Magaña Villalba, Ricardo; Martínez-Ortega, Jorge; Sánchez-Hernández, Alberto; Villasenor-Cendejas, Luis Manuel; Carrillo Moreno, Salvador; Vazquez Valencia, Fabiola; Salazar Ibarguen, Humberto Antonio; Casimiro Linares, Edgar; Morelos Pineda, Antonio; Reyes-Santos, Marco A; Krofcheck, David; Bell, Alan James; Butler, Philip H; Doesburg, Robert; Reucroft, Steve; Silverwood, Hamish; Ahmad, Muhammad; Ansari, Muhammad Hamid; Asghar, Muhammad Irfan; Hoorani, Hafeez R; Khalid, Shoaib; Khan, Wajid Ali; Khurshid, Taimoor; Qazi, Shamona; Shah, Mehar Ali; Shoaib, Muhammad; Bialkowska, Helena; Boimska, Bozena; Frueboes, Tomasz; Gokieli, Ryszard; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Romanowska-Rybinska, Katarzyna; Szleper, Michal; Wrochna, Grzegorz; Zalewski, Piotr; Brona, Grzegorz; Bunkowski, Karol; Cwiok, Mikolaj; Dominik, Wojciech; Doroba, Krzysztof; Kalinowski, Artur; Konecki, Marcin; Krolikowski, Jan; Almeida, Nuno; Bargassa, Pedrame; David Tinoco Mendes, Andre; Faccioli, Pietro; Ferreira Parracho, Pedro Guilherme; Gallinaro, Michele; Seixas, Joao; Varela, Joao; Vischia, Pietro; Belotelov, Ivan; Bunin, Pavel; Gavrilenko, Mikhail; Golutvin, Igor; Gorbunov, Ilya; Kamenev, Alexey; Karjavin, Vladimir; Kozlov, Guennady; Lanev, Alexander; Malakhov, Alexander; Moisenz, Petr; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Smirnov, Vitaly; Volodko, Anton; Zarubin, Anatoli; Evstyukhin, Sergey; Golovtsov, Victor; Ivanov, Yury; Kim, Victor; Levchenko, Petr; Murzin, Victor; Oreshkin, Vadim; Smirnov, Igor; Sulimov, Valentin; Uvarov, Lev; Vavilov, Sergey; Vorobyev, Alexey; Vorobyev, Andrey; Andreev, Yuri; Dermenev, Alexander; Gninenko, Sergei; Golubev, Nikolai; Kirsanov, Mikhail; Krasnikov, Nikolai; Matveev, Viktor; Pashenkov, Anatoli; Tlisov, Danila; Toropin, Alexander; Epshteyn, Vladimir; Erofeeva, Maria; Gavrilov, Vladimir; Kossov, Mikhail; Lychkovskaya, Natalia; Popov, Vladimir; Safronov, Grigory; Semenov, Sergey; Stolin, Viatcheslav; Vlasov, Evgueni; Zhokin, Alexander; Belyaev, Andrey; Boos, Edouard; Dubinin, Mikhail; Dudko, Lev; Ershov, Alexander; Gribushin, Andrey; Klyukhin, Vyacheslav; Kodolova, Olga; Lokhtin, Igor; Markina, Anastasia; Obraztsov, Stepan; Perfilov, Maxim; Petrushanko, Sergey; Popov, Andrey; Sarycheva, Ludmila; Savrin, Viktor; Snigirev, Alexander; Andreev, Vladimir; Azarkin, Maksim; Dremin, Igor; Kirakosyan, Martin; Leonidov, Andrey; Mesyats, Gennady; Rusakov, Sergey V; Vinogradov, Alexey; Azhgirey, Igor; Bayshev, Igor; Bitioukov, Sergei; Grishin, Viatcheslav; Kachanov, Vassili; Konstantinov, Dmitri; Krychkine, Victor; Petrov, Vladimir; Ryutin, Roman; Sobol, Andrei; Tourtchanovitch, Leonid; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Adzic, Petar; Djordjevic, Milos; Ekmedzic, Marko; Krpic, Dragomir; Milosevic, Jovan; Aguilar-Benitez, Manuel; Alcaraz Maestre, Juan; Arce, Pedro; Battilana, Carlo; Calvo, Enrique; Cerrada, Marcos; Chamizo Llatas, Maria; Colino, Nicanor; De La Cruz, Begona; Delgado Peris, Antonio; Domínguez Vázquez, Daniel; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Ferrando, Antonio; Flix, Jose; Fouz, Maria Cruz; Garcia-Abia, Pablo; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M; Josa, Maria Isabel; Merino, Gonzalo; Puerta Pelayo, Jesus; Quintario Olmeda, Adrián; Redondo, Ignacio; Romero, Luciano; Santaolalla, Javier; Soares, Mara Senghi; Willmott, Carlos; Albajar, Carmen; Codispoti, Giuseppe; de Trocóniz, Jorge F; Brun, Hugues; Cuevas, Javier; Fernandez Menendez, Javier; Folgueras, Santiago; Gonzalez Caballero, Isidro; Lloret Iglesias, Lara; Piedra Gomez, Jonatan; Brochero Cifuentes, Javier Andres; Cabrillo, Iban Jose; Calderon, Alicia; Chuang, Shan-Huei; Duarte Campderros, Jordi; Felcini, Marta; Fernandez, Marcos; Gomez, Gervasio; Gonzalez Sanchez, Javier; Graziano, Alberto; Jorda, Clara; Lopez Virto, Amparo; Marco, Jesus; Marco, Rafael; Martinez Rivero, Celso; Matorras, Francisco; Munoz Sanchez, Francisca Javiela; Rodrigo, Teresa; Rodríguez-Marrero, Ana Yaiza; Ruiz-Jimeno, Alberto; Scodellaro, Luca; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Auffray, Etiennette; Auzinger, Georg; Bachtis, Michail; Baillon, Paul; Ball, Austin; Barney, David; Benitez, Jose F; Bernet, Colin; Bianchi, Giovanni; Bloch, Philippe; Bocci, Andrea; Bonato, Alessio; Botta, Cristina; Breuker, Horst; Camporesi, Tiziano; Cerminara, Gianluca; Christiansen, Tim; Coarasa Perez, Jose Antonio; D'Enterria, David; Dabrowski, Anne; De Roeck, Albert; Di Guida, Salvatore; Dobson, Marc; Dupont-Sagorin, Niels; Elliott-Peisert, Anna; Frisch, Benjamin; Funk, Wolfgang; Georgiou, Georgios; Giffels, Manuel; Gigi, Dominique; Gill, Karl; Giordano, Domenico; Giunta, Marina; Glege, Frank; Gomez-Reino Garrido, Robert; Govoni, Pietro; Gowdy, Stephen; Guida, Roberto; Hansen, Magnus; Harris, Philip; Hartl, Christian; Harvey, John; Hegner, Benedikt; Hinzmann, Andreas; Innocente, Vincenzo; Janot, Patrick; Kaadze, Ketino; Karavakis, Edward; Kousouris, Konstantinos; Lecoq, Paul; Lee, Yen-Jie; Lenzi, Piergiulio; Lourenco, Carlos; Magini, Nicolo; Maki, Tuula; Malberti, Martina; Malgeri, Luca; Mannelli, Marcello; Masetti, Lorenzo; Meijers, Frans; Mersi, Stefano; Meschi, Emilio; Moser, Roland; Mozer, Matthias Ulrich; Mulders, Martijn; Musella, Pasquale; Nesvold, Erik; Orimoto, Toyoko; Orsini, Luciano; Palencia Cortezon, Enrique; Perez, Emmanuelle; Perrozzi, Luca; Petrilli, Achille; Pfeiffer, Andreas; Pierini, Maurizio; Pimiä, Martti; Piparo, Danilo; Polese, Giovanni; Quertenmont, Loic; Racz, Attila; Reece, William; Rodrigues Antunes, Joao; Rolandi, Gigi; Rovelli, Chiara; Rovere, Marco; Sakulin, Hannes; Santanastasio, Francesco; Schäfer, Christoph; Schwick, Christoph; Segoni, Ilaria; Sekmen, Sezen; Sharma, Archana; Siegrist, Patrice; Silva, Pedro; Simon, Michal; Sphicas, Paraskevas; Spiga, Daniele; Tsirou, Andromachi; Veres, Gabor Istvan; Vlimant, Jean-Roch; Wöhri, Hermine Katharina; Worm, Steven; Zeuner, Wolfram Dietrich; Bertl, Willi; Deiters, Konrad; Erdmann, Wolfram; Gabathuler, Kurt; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; König, Stefan; Kotlinski, Danek; Langenegger, Urs; Meier, Frank; Renker, Dieter; Rohe, Tilman; Sibille, Jennifer; Bäni, Lukas; Bortignon, Pierluigi; Buchmann, Marco-Andrea; Casal, Bruno; Chanon, Nicolas; Deisher, Amanda; Dissertori, Günther; Dittmar, Michael; Donegà, Mauro; Dünser, Marc; Eugster, Jürg; Freudenreich, Klaus; Grab, Christoph; Hits, Dmitry; Lecomte, Pierre; Lustermann, Werner; Marini, Andrea Carlo; Martinez Ruiz del Arbol, Pablo; Mohr, Niklas; Moortgat, Filip; Nägeli, Christoph; Nef, Pascal; Nessi-Tedaldi, Francesca; Pandolfi, Francesco; Pape, Luc; Pauss, Felicitas; Peruzzi, Marco; Ronga, Frederic Jean; Rossini, Marco; Sala, Leonardo; Sanchez, Ann - Karin; Starodumov, Andrei; Stieger, Benjamin; Takahashi, Maiko; Tauscher, Ludwig; Thea, Alessandro; Theofilatos, Konstantinos; Treille, Daniel; Urscheler, Christina; Wallny, Rainer; Weber, Hannsjoerg Artur; Wehrli, Lukas; Amsler, Claude; Chiochia, Vincenzo; De Visscher, Simon; Favaro, Carlotta; Ivova Rikova, Mirena; Millan Mejias, Barbara; Otiougova, Polina; Robmann, Peter; Snoek, Hella; Tupputi, Salvatore; Verzetti, Mauro; Chang, Yuan-Hann; Chen, Kuan-Hsin; Kuo, Chia-Ming; Li, Syue-Wei; Lin, Willis; Liu, Zong-Kai; Lu, Yun-Ju; Mekterovic, Darko; Singh, Anil; Volpe, Roberta; Yu, Shin-Shan; Bartalini, Paolo; Chang, Paoti; Chang, You-Hao; Chang, Yu-Wei; Chao, Yuan; Chen, Kai-Feng; Dietz, Charles; Grundler, Ulysses; Hou, George Wei-Shu; Hsiung, Yee; Kao, Kai-Yi; Lei, Yeong-Jyi; Lu, Rong-Shyang; Majumder, Devdatta; Petrakou, Eleni; Shi, Xin; Shiu, Jing-Ge; Tzeng, Yeng-Ming; Wan, Xia; Wang, Minzu; Adiguzel, Aytul; Bakirci, Mustafa Numan; Cerci, Salim; Dozen, Candan; Dumanoglu, Isa; Eskut, Eda; Girgis, Semiray; Gokbulut, Gul; Gurpinar, Emine; Hos, Ilknur; Kangal, Evrim Ersin; Karaman, Turker; Karapinar, Guler; Kayis Topaksu, Aysel; Onengut, Gulsen; Ozdemir, Kadri; Ozturk, Sertac; Polatoz, Ayse; Sogut, Kenan; Sunar Cerci, Deniz; Tali, Bayram; Topakli, Huseyin; Vergili, Latife Nukhet; Vergili, Mehmet; Akin, Ilina Vasileva; Aliev, Takhmasib; Bilin, Bugra; Bilmis, Selcuk; Deniz, Muhammed; Gamsizkan, Halil; Guler, Ali Murat; Ocalan, Kadir; Ozpineci, Altug; Serin, Meltem; Sever, Ramazan; Surat, Ugur Emrah; Yalvac, Metin; Yildirim, Eda; Zeyrek, Mehmet; Gülmez, Erhan; Isildak, Bora; Kaya, Mithat; Kaya, Ozlem; Ozkorucuklu, Suat; Sonmez, Nasuf; Cankocak, Kerem; Levchuk, Leonid; Bostock, Francis; Brooke, James John; Clement, Emyr; Cussans, David; Flacher, Henning; Frazier, Robert; Goldstein, Joel; Grimes, Mark; Heath, Greg P; Heath, Helen F; Kreczko, Lukasz; Metson, Simon; Newbold, Dave M; Nirunpong, Kachanon; Poll, Anthony; Senkin, Sergey; Smith, Vincent J; Williams, Thomas; Basso, Lorenzo; Bell, Ken W; Belyaev, Alexander; Brew, Christopher; Brown, Robert M; Cockerill, David JA; Coughlan, John A; Harder, Kristian; Harper, Sam; Jackson, James; Kennedy, Bruce W; Olaiya, Emmanuel; Petyt, David; Radburn-Smith, Benjamin Charles; Shepherd-Themistocleous, Claire; Tomalin, Ian R; Womersley, William John; Bainbridge, Robert; Ball, Gordon; Beuselinck, Raymond; Buchmuller, Oliver; Colling, David; Cripps, Nicholas; Cutajar, Michael; Dauncey, Paul; Davies, Gavin; Della Negra, Michel; Ferguson, William; Fulcher, Jonathan; Futyan, David; Gilbert, Andrew; Guneratne Bryer, Arlo; Hall, Geoffrey; Hatherell, Zoe; Hays, Jonathan; Iles, Gregory; Jarvis, Martyn; Karapostoli, Georgia; Lyons, Louis; Magnan, Anne-Marie; Marrouche, Jad; Mathias, Bryn; Nandi, Robin; Nash, Jordan; Nikitenko, Alexander; Papageorgiou, Anastasios; Pela, Joao; Pesaresi, Mark; Petridis, Konstantinos; Pioppi, Michele; Raymond, David Mark; Rogerson, Samuel; Rose, Andrew; Ryan, Matthew John; Seez, Christopher; Sharp, Peter; Sparrow, Alex; Stoye, Markus; Tapper, Alexander; Vazquez Acosta, Monica; Virdee, Tejinder; Wakefield, Stuart; Wardle, Nicholas; Whyntie, Tom; Chadwick, Matthew; Cole, Joanne; Hobson, Peter R; Khan, Akram; Kyberd, Paul; Leggat, Duncan; Leslie, Dawn; Martin, William; Reid, Ivan; Symonds, Philip; Teodorescu, Liliana; Turner, Mark; Hatakeyama, Kenichi; Liu, Hongxuan; Scarborough, Tara; Charaf, Otman; Henderson, Conor; Rumerio, Paolo; Avetisyan, Aram; Bose, Tulika; Fantasia, Cory; Heister, Arno; St John, Jason; Lawson, Philip; Lazic, Dragoslav; Rohlf, James; Sperka, David; Sulak, Lawrence; Alimena, Juliette; Bhattacharya, Saptaparna; Cutts, David; Ferapontov, Alexey; Heintz, Ulrich; Jabeen, Shabnam; Kukartsev, Gennadiy; Laird, Edward; Landsberg, Greg; Luk, Michael; Narain, Meenakshi; Nguyen, Duong; Segala, Michael; Sinthuprasith, Tutanon; Speer, Thomas; Tsang, Ka Vang; Breedon, Richard; Breto, Guillermo; Calderon De La Barca Sanchez, Manuel; Chauhan, Sushil; Chertok, Maxwell; Conway, John; Conway, Rylan; Cox, Peter Timothy; Dolen, James; Erbacher, Robin; Gardner, Michael; Houtz, Rachel; Ko, Winston; Kopecky, Alexandra; Lander, Richard; Miceli, Tia; Pellett, Dave; Ricci-Tam, Francesca; Rutherford, Britney; Searle, Matthew; Smith, John; Squires, Michael; Tripathi, Mani; Vasquez Sierra, Ricardo; Andreev, Valeri; Cline, David; Cousins, Robert; Duris, Joseph; Erhan, Samim; Everaerts, Pieter; Farrell, Chris; Hauser, Jay; Ignatenko, Mikhail; Jarvis, Chad; Plager, Charles; Rakness, Gregory; Schlein, Peter; Traczyk, Piotr; Valuev, Vyacheslav; Weber, Matthias; Babb, John; Clare, Robert; Dinardo, Mauro Emanuele; Ellison, John Anthony; Gary, J William; Giordano, Ferdinando; Hanson, Gail; Jeng, Geng-Yuan; Liu, Hongliang; Long, Owen Rosser; Luthra, Arun; Nguyen, Harold; Paramesvaran, Sudarshan; Sturdy, Jared; Sumowidagdo, Suharyo; Wilken, Rachel; Wimpenny, Stephen; Andrews, Warren; Branson, James G; Cerati, Giuseppe Benedetto; Cittolin, Sergio; Evans, David; Golf, Frank; Holzner, André; Kelley, Ryan; Lebourgeois, Matthew; Letts, James; Macneill, Ian; Mangano, Boris; Padhi, Sanjay; Palmer, Christopher; Petrucciani, Giovanni; Pieri, Marco; Sani, Matteo; Sharma, Vivek; Simon, Sean; Sudano, Elizabeth; Tadel, Matevz; Tu, Yanjun; Vartak, Adish; Wasserbaech, Steven; Würthwein, Frank; Yagil, Avraham; Yoo, Jaehyeok; Barge, Derek; Bellan, Riccardo; Campagnari, Claudio; D'Alfonso, Mariarosaria; Danielson, Thomas; Flowers, Kristen; Geffert, Paul; Incandela, Joe; Justus, Christopher; Kalavase, Puneeth; Koay, Sue Ann; Kovalskyi, Dmytro; Krutelyov, Vyacheslav; Lowette, Steven; Mccoll, Nickolas; Pavlunin, Viktor; Rebassoo, Finn; Ribnik, Jacob; Richman, Jeffrey; Rossin, Roberto; Stuart, David; To, Wing; West, Christopher; Apresyan, Artur; Bornheim, Adolf; Chen, Yi; Di Marco, Emanuele; Duarte, Javier; Gataullin, Marat; Ma, Yousi; Mott, Alexander; Newman, Harvey B; Rogan, Christopher; Spiropulu, Maria; Timciuc, Vladlen; Veverka, Jan; Wilkinson, Richard; Xie, Si; Yang, Yong; Zhu, Ren-Yuan; Akgun, Bora; Azzolini, Virginia; Calamba, Aristotle; Carroll, Ryan; Ferguson, Thomas; Iiyama, Yutaro; Jang, Dong Wook; Liu, Yueh-Feng; Paulini, Manfred; Vogel, Helmut; Vorobiev, Igor; Cumalat, John Perry; Drell, Brian Robert; Edelmaier, Christopher; Ford, William T; Gaz, Alessandro; Heyburn, Bernadette; Luiggi Lopez, Eduardo; Smith, James; Stenson, Kevin; Ulmer, Keith; Wagner, Stephen Robert; Alexander, James; Chatterjee, Avishek; Eggert, Nicholas; Gibbons, Lawrence Kent; Heltsley, Brian; Khukhunaishvili, Aleko; Kreis, Benjamin; Mirman, Nathan; Nicolas Kaufman, Gala; Patterson, Juliet Ritchie; Ryd, Anders; Salvati, Emmanuele; Sun, Werner; Teo, Wee Don; Thom, Julia; Thompson, Joshua; Tucker, Jordan; Vaughan, Jennifer; Weng, Yao; Winstrom, Lucas; Wittich, Peter; Winn, Dave; Abdullin, Salavat; Albrow, Michael; Anderson, Jacob; Bauerdick, Lothar AT; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C; Bloch, Ingo; Burkett, Kevin; Butler, Joel Nathan; Chetluru, Vasundhara; Cheung, Harry; Chlebana, Frank; Elvira, Victor Daniel; Fisk, Ian; Freeman, Jim; Gao, Yanyan; Green, Dan; Gutsche, Oliver; Hanlon, Jim; Harris, Robert M; Hirschauer, James; Hooberman, Benjamin; Jindariani, Sergo; Johnson, Marvin; Joshi, Umesh; Kilminster, Benjamin; Klima, Boaz; Kunori, Shuichi; Kwan, Simon; Leonidopoulos, Christos; Linacre, Jacob; Lincoln, Don; Lipton, Ron; Lykken, Joseph; Maeshima, Kaori; Marraffino, John Michael; Maruyama, Sho; Mason, David; McBride, Patricia; Mishra, Kalanand; Mrenna, Stephen; Musienko, Yuri; Newman-Holmes, Catherine; O'Dell, Vivian; Prokofyev, Oleg; Sexton-Kennedy, Elizabeth; Sharma, Seema; Spalding, William J; Spiegel, Leonard; Tan, Ping; Taylor, Lucas; Tkaczyk, Slawek; Tran, Nhan Viet; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vidal, Richard; Whitmore, Juliana; Wu, Weimin; Yang, Fan; Yumiceva, Francisco; Yun, Jae Chul; Acosta, Darin; Avery, Paul; Bourilkov, Dimitri; Chen, Mingshui; Cheng, Tongguang; Das, Souvik; De Gruttola, Michele; Di Giovanni, Gian Piero; Dobur, Didar; Drozdetskiy, Alexey; Field, Richard D; Fisher, Matthew; Fu, Yu; Furic, Ivan-Kresimir; Gartner, Joseph; Hugon, Justin; Kim, Bockjoo; Konigsberg, Jacobo; Korytov, Andrey; Kropivnitskaya, Anna; Kypreos, Theodore; Low, Jia Fu; Matchev, Konstantin; Milenovic, Predrag; Mitselmakher, Guenakh; Muniz, Lana; Remington, Ronald; Rinkevicius, Aurelijus; Sellers, Paul; Skhirtladze, Nikoloz; Snowball, Matthew; Yelton, John; Zakaria, Mohammed; Gaultney, Vanessa; Hewamanage, Samantha; Lebolo, Luis Miguel; Linn, Stephan; Markowitz, Pete; Martinez, German; Rodriguez, Jorge Luis; Adams, Todd; Askew, Andrew; Bochenek, Joseph; Chen, Jie; Diamond, Brendan; Gleyzer, Sergei V; Haas, Jeff; Hagopian, Sharon; Hagopian, Vasken; Jenkins, Merrill; Johnson, Kurtis F; Prosper, Harrison; Veeraraghavan, Venkatesh; Weinberg, Marc; Baarmand, Marc M; Dorney, Brian; Hohlmann, Marcus; Kalakhety, Himali; Vodopiyanov, Igor; Adams, Mark Raymond; Anghel, Ioana Maria; Apanasevich, Leonard; Bai, Yuting; Bazterra, Victor Eduardo; Betts, Russell Richard; Bucinskaite, Inga; Callner, Jeremy; Cavanaugh, Richard; Evdokimov, Olga; Gauthier, Lucie; Gerber, Cecilia Elena; Hofman, David Jonathan; Khalatyan, Samvel; Lacroix, Florent; Malek, Magdalena; O'Brien, Christine; Silkworth, Christopher; Strom, Derek; Turner, Paul; Varelas, Nikos; Akgun, Ugur; Albayrak, Elif Asli; Bilki, Burak; Clarida, Warren; Duru, Firdevs; Griffiths, Scott; Merlo, Jean-Pierre; Mermerkaya, Hamit; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Newsom, Charles Ray; Norbeck, Edwin; Onel, Yasar; Ozok, Ferhat; Sen, Sercan; Tiras, Emrah; Wetzel, James; Yetkin, Taylan; Yi, Kai; Barnett, Bruce Arnold; Blumenfeld, Barry; Bolognesi, Sara; Fehling, David; Giurgiu, Gavril; Gritsan, Andrei; Guo, Zijin; Hu, Guofan; Maksimovic, Petar; Rappoccio, Salvatore; Swartz, Morris; Whitbeck, Andrew; Baringer, Philip; Bean, Alice; Benelli, Gabriele; Grachov, Oleg; Kenny Iii, Raymond Patrick; Murray, Michael; Noonan, Daniel; Sanders, Stephen; Stringer, Robert; Tinti, Gemma; Wood, Jeffrey Scott; Zhukova, Victoria; Barfuss, Anne-Fleur; Bolton, Tim; Chakaberia, Irakli; Ivanov, Andrew; Khalil, Sadia; Makouski, Mikhail; Maravin, Yurii; Shrestha, Shruti; Svintradze, Irakli; Gronberg, Jeffrey; Lange, David; Wright, Douglas; Baden, Drew; Boutemeur, Madjid; Calvert, Brian; Eno, Sarah Catherine; Gomez, Jaime; Hadley, Nicholas John; Kellogg, Richard G; Kirn, Malina; Kolberg, Ted; Lu, Ying; Marionneau, Matthieu; Mignerey, Alice; Pedro, Kevin; Peterman, Alison; Skuja, Andris; Temple, Jeffrey; Tonjes, Marguerite; Tonwar, Suresh C; Twedt, Elizabeth; Apyan, Aram; Bauer, Gerry; Bendavid, Joshua; Busza, Wit; Butz, Erik; Cali, Ivan Amos; Chan, Matthew; Dutta, Valentina; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Hahn, Kristan Allan; Kim, Yongsun; Klute, Markus; Krajczar, Krisztian; Li, Wei; Luckey, Paul David; Ma, Teng; Nahn, Steve; Paus, Christoph; Ralph, Duncan; Roland, Christof; Roland, Gunther; Rudolph, Matthew; Stephans, George; Stöckli, Fabian; Sumorok, Konstanty; Sung, Kevin; Velicanu, Dragos; Wenger, Edward Allen; Wolf, Roger; Wyslouch, Bolek; Yang, Mingming; Yilmaz, Yetkin; Yoon, Sungho; Zanetti, Marco; Cooper, Seth; Dahmes, Bryan; De Benedetti, Abraham; Franzoni, Giovanni; Gude, Alexander; Kao, Shih-Chuan; Klapoetke, Kevin; Kubota, Yuichi; Mans, Jeremy; Pastika, Nathaniel; Rusack, Roger; Sasseville, Michael; Singovsky, Alexander; Tambe, Norbert; Turkewitz, Jared; Cremaldi, Lucien Marcus; Kroeger, Rob; Perera, Lalith; Rahmat, Rahmat; Sanders, David A; Avdeeva, Ekaterina; Bloom, Kenneth; Bose, Suvadeep; Butt, Jamila; Claes, Daniel R; Dominguez, Aaron; Eads, Michael; Keller, Jason; Kravchenko, Ilya; Lazo-Flores, Jose; Malbouisson, Helena; Malik, Sudhir; Snow, Gregory R; Baur, Ulrich; Godshalk, Andrew; Iashvili, Ia; Jain, Supriya; Kharchilava, Avto; Kumar, Ashish; Shipkowski, Simon Peter; Smith, Kenneth; Alverson, George; Barberis, Emanuela; Baumgartel, Darin; Chasco, Matthew; Haley, Joseph; Nash, David; Trocino, Daniele; Wood, Darien; Zhang, Jinzhong; Anastassov, Anton; Kubik, Andrew; Mucia, Nicholas; Odell, Nathaniel; Ofierzynski, Radoslaw Adrian; Pollack, Brian; Pozdnyakov, Andrey; Schmitt, Michael; Stoynev, Stoyan; Velasco, Mayda; Won, Steven; Antonelli, Louis; Berry, Douglas; Brinkerhoff, Andrew; Hildreth, Michael; Jessop, Colin; Karmgard, Daniel John; Kolb, Jeff; Lannon, Kevin; Luo, Wuming; Lynch, Sean; Marinelli, Nancy; Morse, David Michael; Pearson, Tessa; Planer, Michael; Ruchti, Randy; Slaunwhite, Jason; Valls, Nil; Wayne, Mitchell; Wolf, Matthias; Bylsma, Ben; Durkin, Lloyd Stanley; Hill, Christopher; Hughes, Richard; Kotov, Khristian; Ling, Ta-Yung; Puigh, Darren; Rodenburg, Marissa; Vuosalo, Carl; Williams, Grayson; Winer, Brian L; Adam, Nadia; Berry, Edmund; Elmer, Peter; Gerbaudo, Davide; Halyo, Valerie; Hebda, Philip; Hegeman, Jeroen; Hunt, Adam; Jindal, Pratima; Lopes Pegna, David; Lujan, Paul; Marlow, Daniel; Medvedeva, Tatiana; Mooney, Michael; Olsen, James; Piroué, Pierre; Quan, Xiaohang; Raval, Amita; Safdi, Ben; Saka, Halil; Stickland, David; Tully, Christopher; Werner, Jeremy Scott; Zuranski, Andrzej; Acosta, Jhon Gabriel; Brownson, Eric; Huang, Xing Tao; Lopez, Angel; Mendez, Hector; Oliveros, Sandra; Ramirez Vargas, Juan Eduardo; Zatserklyaniy, Andriy; Alagoz, Enver; Barnes, Virgil E; Benedetti, Daniele; Bolla, Gino; Bortoletto, Daniela; De Mattia, Marco; Everett, Adam; Hu, Zhen; Jones, Matthew; Koybasi, Ozhan; Kress, Matthew; Laasanen, Alvin T; Leonardo, Nuno; Maroussov, Vassili; Merkel, Petra; Miller, David Harry; Neumeister, Norbert; Shipsey, Ian; Silvers, David; Svyatkovskiy, Alexey; Vidal Marono, Miguel; Yoo, Hwi Dong; Zablocki, Jakub; Zheng, Yu; Guragain, Samir; Parashar, Neeti; Adair, Antony; Boulahouache, Chaouki; Ecklund, Karl Matthew; Geurts, Frank JM; Padley, Brian Paul; Redjimi, Radia; Roberts, Jay; Zabel, James; Betchart, Burton; Bodek, Arie; Chung, Yeon Sei; Covarelli, Roberto; de Barbaro, Pawel; Demina, Regina; Eshaq, Yossof; Ferbel, Thomas; Garcia-Bellido, Aran; Goldenzweig, Pablo; Han, Jiyeon; Harel, Amnon; Miner, Daniel Carl; Vishnevskiy, Dmitry; Zielinski, Marek; Bhatti, Anwar; Ciesielski, Robert; Demortier, Luc; Goulianos, Konstantin; Lungu, Gheorghe; Malik, Sarah; Mesropian, Christina; Arora, Sanjay; Barker, Anthony; Chou, John Paul; Contreras-Campana, Christian; Contreras-Campana, Emmanuel; Duggan, Daniel; Ferencek, Dinko; Gershtein, Yuri; Gray, Richard; Halkiadakis, Eva; Hidas, Dean; Lath, Amitabh; Panwalkar, Shruti; Park, Michael; Patel, Rishi; Rekovic, Vladimir; Robles, Jorge; Rose, Keith; Salur, Sevil; Schnetzer, Steve; Seitz, Claudia; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Cerizza, Giordano; Hollingsworth, Matthew; Spanier, Stefan; Yang, Zong-Chang; York, Andrew; Eusebi, Ricardo; Flanagan, Will; Gilmore, Jason; Kamon, Teruki; Khotilovich, Vadim; Montalvo, Roy; Osipenkov, Ilya; Pakhotin, Yuriy; Perloff, Alexx; Roe, Jeffrey; Safonov, Alexei; Sakuma, Tai; Sengupta, Sinjini; Suarez, Indara; Tatarinov, Aysen; Toback, David; Akchurin, Nural; Damgov, Jordan; Dragoiu, Cosmin; Dudero, Phillip Russell; Jeong, Chiyoung; Kovitanggoon, Kittikul; Lee, Sung Won; Libeiro, Terence; Roh, Youn; Volobouev, Igor; Appelt, Eric; Delannoy, Andrés G; Florez, Carlos; Greene, Senta; Gurrola, Alfredo; Johns, Willard; Johnston, Cody; Kurt, Pelin; Maguire, Charles; Melo, Andrew; Sharma, Monika; Sheldon, Paul; Snook, Benjamin; Tuo, Shengquan; Velkovska, Julia; Arenton, Michael Wayne; Balazs, Michael; Boutle, Sarah; Cox, Bradley; Francis, Brian; Goodell, Joseph; Hirosky, Robert; Ledovskoy, Alexander; Lin, Chuanzhe; Neu, Christopher; Wood, John; Yohay, Rachel; Gollapinni, Sowjanya; Harr, Robert; Karchin, Paul Edmund; Kottachchi Kankanamge Don, Chamath; Lamichhane, Pramod; Sakharov, Alexandre; Anderson, Michael; Belknap, Donald; Borrello, Laura; Carlsmith, Duncan; Cepeda, Maria; Dasu, Sridhara; Friis, Evan; Gray, Lindsey; Grogg, Kira Suzanne; Grothe, Monika; Hall-Wilton, Richard; Herndon, Matthew; Hervé, Alain; Klabbers, Pamela; Klukas, Jeffrey; Lanaro, Armando; Lazaridis, Christos; Leonard, Jessica; Loveless, Richard; Mohapatra, Ajit; Ojalvo, Isabel; Palmonari, Francesco; Pierro, Giuseppe Antonio; Ross, Ian; Savin, Alexander; Smith, Wesley H; Swanson, Joshua

    2012-01-01

    A measurement is presented of the relative prompt production rate of $\\chi_{c2}$ and $\\chi_{c1}$ with 4.6 inverse femtobarns of data collected by the CMS experiment at the LHC in pp collisions at $\\sqrt{s}$ = 7 TeV. The two states are measured via their radiative decays $\\chi_{c} \\to J/\\psi + \\gamma$, with the photon converting into a dielectron pair for J/$\\psi$ rapidity abs(y(J/$\\psi$)) 0.5 GeV. The measurement is given for six intervals of pt(J/$\\psi$) between 7 and 25 GeV. The results are compared to theoretical predictions.

  8. Characterization of new cell line stably expressing CHI3L1 oncogene

    Directory of Open Access Journals (Sweden)

    Chekhonin V. P.

    2011-06-01

    Full Text Available Aim. To characterize the immortalized 293 cell line after stable transfection with human oncogene (CHI3L1. Methods. 293 cells, stably transfected with pcDNA3.1_CHI3L1, and 293 cells, stably transfected with pcDNA3.1 as a negative control, were used throughout all experiments. The clones of CHI3L1-expressing 293 cells and 293 cells, transfected with pcDNA3.1, were analyzed by immunofluorescence and confocal microscopy. Cell proliferation was measured using MTT assay; analyses of ERK1/2 and AKT activation and their cellular localization were performed with anti-phospho-ERK and anti-phospho-AKT antibodies. Specific activation of MAP and PI3 kinases was measured by densitometric analysis of Western-blot signals. Results. The obtained results show quite modest ability of CHI3L1 to stimulate cell growth and reflect rather an improved cellular plating efficiency of the 293 cells stably transfected with pcDNA3.1_CHI3L1 as compared to the 293 cells transfected with an «empty» vector. ERK1/2 and AKT are activated in the 293_CHI3L1 cells. In these cells phosphorylated ERK1/2 were localized in both cell cytoplasm and nuclei while AKT only in cytoplasm. The 293_CHI3L1 cells differed from the 293 cells, transfected with an «empty» vector, in their size and ability to adhere to the culture plates. Conclusions. The overexpression of CHI3L1 is likely to have an important role in tumorigenesis via a mechanism which involves activation of PI3K and ERK1/2 pathways. The tumors which can be induced by orthotopic implantation of the transformed human cells with overexpressed human oncogene CHI3L1 into the rat brain can be used as a target for anticancer drug development.

  9. A {chi}{sup 2} veto for continuous gravitational wave searches

    Energy Technology Data Exchange (ETDEWEB)

    Sancho de la Jordana, Llucia; Sintes, Alicia M [Departament de Fisica, Universitat de les Illes Balears, Cra. Valldemossa Km. 7.5, E-07122 Palma de Mallorca (Spain)], E-mail: llucia.sancho@uib.es, E-mail: sintes@aei.mpg.de

    2008-09-21

    {chi}{sup 2} vetoes are commonly used in searching for gravitational waves, in particular for broadband signals, but they can also be applied to narrowband continuous wave signals, such as those expected from rapidly rotating neutron stars. In this paper, we present a {chi}{sup 2} veto adapted to the Hough transform searches for continuous gravitational wave signals; we characterize the {chi}{sup 2} significance plane for different frequency bands and discuss the expected performance of this veto in LIGO analysis.

  10. A proposal for a different chi-square function for Poisson distributions

    OpenAIRE

    Almeida Jr., F. M. L.; Barbi, M; Vale, M. A. B. do

    1999-01-01

    We obtain an approximate Gaussian distribution from a Poisson distribution after doing a change of variable. A new chi-square function is obtained which can be used for parameter estimations and goodness-of-fit testing when adjusting curves to histograms. Since the new distribution is approximately Gaussian we can use it even when the bin contents are small. The corresponding chi-square function can be used for curve fitting. This chi-square function is simple to implement and presents a fast...

  11. A randomized controlled trial of tai chi for long-term low back pain (TAI CHI: Study rationale, design, and methods

    Directory of Open Access Journals (Sweden)

    Hall Amanda M

    2009-05-01

    Full Text Available Abstract Background Low back pain persisting for longer than 3 months is a common and costly condition for which many current treatments have low-moderate success rates at best. Exercise is among the more successful treatments for this condition, however, the type and dosage of exercise that elicits the best results is not clearly defined. Tai chi is a gentle form of low intensity exercise that uses controlled movements in combination with relaxation techniques and is currently used as a safe form of exercise for people suffering from other chronic pain conditions such as arthritis. To date, there has been no scientific evaluation of tai chi as an intervention for people with back pain. Thus the aim of this study will be to examine the effects of a tai chi exercise program on pain and disability in people with long-term low back pain. Methods and design The study will recruit 160 healthy individuals from the community setting to be randomised to either a tai chi intervention group or a wait-list control group. Individuals in the tai chi group will attend 2 tai chi sessions (40 minutes/week for 8 weeks followed by 1 tai chi session/week for 2 weeks. The wait-list control will continue their usual health care practices and have the opportunity to participate in the tai chi program once they have completed the follow-up assessments. The primary outcome will be bothersomeness of back symptoms measured with a 0–10 numerical rating scale. Secondary outcomes include, self-reports of pain-related disability, health-related quality of life and global perceived effect of treatment. Statistical analysis of primary and secondary outcomes will be based on the intention to treat principle. Linear mixed models will be used to test for the effect of treatment on outcome at 10 weeks follow up. This trial has received ethics approval from The University of Sydney Human Research Ethics Committee. HREC Approval No.10452 Discussion This study will be the first

  12. A Emprical Investigation on Service Failure and Recovery at Retailing Bank in Vietnam

    OpenAIRE

    Tu Van Binh; Nguyen Tran Phuong Vi

    2013-01-01

    To identify factors affecting satisfaction with service recovery of banking sector and overall satisfaction, together with the effect of customersatisfaction on repurchase intent and word-of-mouth intent in the banking in Vietnam, a survey is conducted on 215 customers.Those respondents, who are buying services from the bank, namely Vietnamese Local Bank (VLB), have experienced in service failure and service recovery in their transaction with VLB, and lived in Ho Chi Minh City. Structural equ...

  13. Growth of silicon nanowires on ZnO thin film stimulated by VLS and PECVD processes for photovoltaic applications

    Czech Academy of Sciences Publication Activity Database

    Pham, T.T.; Le, V.T.H.; Cu, T.S.; Stuchlíková, The-Ha; Hruška, Karel; Ledinský, Martin; Stuchlík, Jiří

    Ho Chi Minh City: Laboratory for Nanotechnology, VNU, 2013, s. 411-414. [IWNA 2013 - 4th International Workshop on Nanotechnology and Application. Vung Tau (VN), 14.11.2013-16.11.2013] R&D Projects: GA MŠk LH12236 Institutional support: RVO:68378271 Keywords : silicon nanowires (Si-NWs) * PECVD * ZnO * VLS process * Sn Subject RIV: BM - Solid Matter Physics ; Magnetism

  14. Explanatory factors behind formalizing non-farm household businesses in Vietnam

    OpenAIRE

    Jean-Pierre Cling; Mireille Razafindrakoto; François Roubaud

    2012-01-01

    (english) This article sets out to investigate the reasons why some household businesses decide to register and become formal (while others do not) in order to shed light on the origins of informality. We use qualitative as well as quantitative data on household businesses (HB) derived from first-hand representative surveys implemented in Hanoi and Ho Chi Minh city. The study reveals that although most of the informal businesses operate ‘illegally’, this is more due to unclear registration le...

  15. Tensile Stress Analyses of the Hip Joint Endoprosthesis Ceramic Head with Real Shape Deviations

    Czech Academy of Sciences Publication Activity Database

    Fuis, Vladimír; Toi, V. V. (ed.); Phuong, T.H.L. (ed.)

    NEW YORK : Springer Verlag, 2015. ISBN 978-3-319-11775-1. ISSN 1680-0737. - (IFMBE Proceedings. 46). [International Conference on the Development of Biomedical Engineering /5./. Ho Chi Minh City (VN), 16.06.2014-18.06.2014] R&D Projects: GA ČR GA13-34632S Institutional support: RVO:61388998 Keywords : total hip joint endoprosthesis * ceramics head * micro and macro shape deviations Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass

  16. Assessing sexual risk behavior among men who have sex with men in Vietnam : development and use of a new Internet-based sampling method

    OpenAIRE

    Bengtsson, Linus

    2012-01-01

    Background: Men who have sex with men (MSM) are at high risk of HIV infection in all regions globally. Surveys among MSM in Hanoi and Ho Chi Minh City in Vietnam have shown prevalence rates of 15% and 17% respectively. Representative data about MSM and other hidden populations are extremely difficult to collect, due to stigma. Much available data may thus not be representative of the MSM population as a whole, preventing an evidence-based response to the HIV epidemic. Respon...

  17. Viet Nam National Atomic Energy Commission

    International Nuclear Information System (INIS)

    Vietnam National Atomic Energy Commission (VINATOM) is a governmental body in charge of organizing and coordinating activities related to use of nuclear energy for peaceful purpose. VINATOM in structure consists of the Nuclear Research Institute (Dalat), the Institute of Nuclear Science and Technology (Hanoi), the Institute for Technology of Radioactive and Rare Elements (Hanoi), and the Centre for Nuclear Technique Application (Ho Chi Minh City). This catalogue introduces profiles of nuclear R and D activities under management by VINATOM. (N.H.A)

  18. 5th International Conference on Biomedical Engineering in Vietnam

    CERN Document Server

    Phuong, Tran

    2015-01-01

    This volume presents the proceedings of the Fifth International Conference on the Development of Biomedical Engineering in Vietnam which was held from June 16-18, 2014 in Ho Chi Minh City. The volume reflects the progress of Biomedical Engineering and discusses problems and solutions. I aims identifying new challenges, and shaping future directions for research in biomedical engineering fields including medical instrumentation, bioinformatics, biomechanics, medical imaging, drug delivery therapy, regenerative medicine and entrepreneurship in medical devices.

  19. Progress in the development of infra red led diode based on amorphous hydrogenated silicon with embedded Pbs nanoparticles

    Czech Academy of Sciences Publication Activity Database

    Stuchlík, Jiří; Fajgar, Radek; Koštejn, Martin; Remeš, Zdeněk; Purkrt, Adam; Pham, M.T.; Stuchlíková, The-Ha

    Ho Chi Minh City: Viet Nam National University, 2015, s. 208-210. [International Workshop on Nanotechnology and Application /5./ (IWNA 2015). Vung Tau (VN), 11.11.2015-14.11.2015] R&D Projects: GA MŠk LH12236 Institutional support: RVO:68378271 ; RVO:67985858 Keywords : a-Si:H * photoluminescence * electroluminescence * PbS NPs * IR LED Subject RIV: BM - Solid Matter Physics ; Magnetism

  20. Quality of life among people living with hypertension in a rural Vietnam community

    OpenAIRE

    Ha, Ninh Thi; Duy, Hoa Thi; Le, Ninh Hoang; Khanal, Vishnu; Moorin, Rachael

    2014-01-01

    Background To respond to growing prevalence of hypertension in Vietnam, it is critical to have an in-depth understanding about quality of life (QOL) among people living with hypertension and related factors. This study aimed to measure QOL among hypertensive people in a rural community in Vietnam, and its association with socio-demographic characteristics and factors related to treatment. Methods This study was conducted in a rural community located 60 km from Ho Chi Minh City. Face-to-face i...

  1. Further Glimpse at Intonation Teaching

    OpenAIRE

    Luu Trong Tuan

    2011-01-01

    This paper sought to find out why intonation has been neglected in the process of teaching pronunciation to EFL learners at Ho Chi Minh City University for Natural Resources and Environment (HCMUNRE) and corroborate that teaching intonation in Yes/No questions and Wh-questions to learners has positive influence on their English speaking skill. The research also suggested some useful in-class activities to teach intonation in Yes/No questions and Wh-questions to EFL learners.

  2. 3rd International Symposium on Innovative Management, Information and Production

    CERN Document Server

    Xu, Bing; Wu, Berlin

    2014-01-01

    Innovative Management in Information and Production is based on the proceedings of the Third International Symposium on Innovative Managemet, Information and Production. This symposium is held by International Society of Management Engineers. The symposium took place on October 8-10, in Ho Chi Minh City, Vietnam. This book examines recent innovative management of information and productions such as digital collection management and operations planning, scheduling and control.

  3. Environmental Information Portals for Local Stakeholders: Lessons Learned from Different Projects in Asia

    OpenAIRE

    Ahrens, Malte; Jaspersen, Verena; Eisfelder, Christina; Huth, Juliane; Künzer, Claudia

    2014-01-01

    In the “Water-related Information System for the sustainable Development of the Mekong Delta in Vietnam“ project, an internet-based information system was built to support integrated water, land and coastal resource management. The system was deployed on servers in Ho Chi Minh City and was officially handed over to Vietnamese institutions in early 2013 at the Mekong Environmental Symposium. Based on the experiences gained during 6 years of work in Vietnam, the River Delta Information Syste...

  4. Advantages and Disadvantages in setting up and managing a Captive Center in Vietnam

    OpenAIRE

    Nguyen, An; Nguyen, Thanh

    2015-01-01

    This work concerns factors that Captive Centers would face when they operate in Vietnam. In other words, it purposes to perceive in detail what Vietnam offers to Captive Centers by identifying the advantages and disadvantages in establishing and managing Captive Centers in Vietnam from the perspective of foreign companies. Under the qualitative research method, the authors have done three interviews with the managers of two Captive Centers operating in Ho Chi Minh City, Vietnam, by sending th...

  5. Employee's Motivation : How to improve employees’ motivation in order to increase work performance.

    OpenAIRE

    Ho, Oanh

    2016-01-01

    This thesis examines the state of employee’s job satisfaction and motivation at language school KTDC Group that is located in Ho Chi Minh City, Vietnam. The study deals with the major factors that influence teachers’ motivation at the target school. Employee motivation is extremely crucial for the company as it has a great impact on employee’s job performance and responsibility. Especially for companies that are operating in services and education industry, motivated employees are vital. Ther...

  6. Sustainable Cities

    DEFF Research Database (Denmark)

    Georg, Susse; Garza de Linde, Gabriela Lucía

    Judging from the number of communities and cities striving or claiming to be sustainable and how often eco-development is invoked as the means for urban regeneration, it appears that sustainable and eco-development have become “the leading paradigm within urban development” (Whitehead 2003). But......), urban design competitions are understudied mechanisms for bringing about field level changes. Drawing on actor network theory, this paper examines how urban design competitions may bring about changes within the professional field through the use of intermediaries such as a sustainable planning....../assessment tool. The context for our study is urban regeneration in one Danish city, which had been suffering from industrial decline and which is currently investing in establishing a “sustainable city”. Based on this case study we explore how the insights and inspiration evoked in working with the tool...

  7. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... that features tai chi A practice in traditional Chinese medicine that uses a series of slow, gentle ... stress. and qi gong A component of traditional Chinese medicine that combines movement, meditation, and controlled breathing. ...

  8. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... Online Continuing Education Series Distinguished Lecture Series Integrated Medicine Research Lecture Series All Training Information News & Events ... features tai chi A practice in traditional Chinese medicine that uses a series of slow, gentle movements ...

  9. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... Legislation Advisory Council Job Opportunities All About NCCIH Health Topics A-Z # A B C D E ... Y Z Tai Chi and Qi Gong for Health and Well-Being Share: © Mariann Seriff The following ...

  10. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... NCCIH Clinical Digest A monthly newsletter with evidence-based information on complementary and integrative practices and a health condition All News & Events About NCCIH NCCIH At a Glance Mission and Vision Organizational ... Tai Chi and Qi ...

  11. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... Advisory Council Job Opportunities All About NCCIH Health Topics A-Z # A B C D E F ... up Qi Gong Tai Chi Cool Down This page last modified February 12, 2015 Follow NCCIH: Read ...

  12. Tai Chi and Qi Gong for Health and Well-Being

    Science.gov (United States)

    ... Vision Organizational Structure Director's Message Strategic Plans & Reports Budget & Legislation Advisory Council Job Opportunities All About NCCIH ... tool that features tai chi A practice in traditional Chinese medicine that uses a series of slow, ...

  13. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... Vision Organizational Structure Director's Message Strategic Plans & Reports Budget & Legislation Advisory Council Job Opportunities All About NCCIH ... tool that features tai chi A practice in traditional Chinese medicine that uses a series of slow, ...

  14. chi_cJ Decays to h^+h^-h^0

    CERN Document Server

    Athar, S; Potlia, V; Yelton, J; Rubin, P; Cawlfield, C; Eisenstein, B I; Karliner, I; Kim, D; Lowrey, N; Naik, P; Sedlack, C; Selen, M; White, E J; Wiss, J; Shepherd, M R; Besson, D; Pedlar, T K; Cronin-Hennessy, D; Gao, K Y; Gong, D T; Hietala, J; Kubota, Y; Klein, T; Lang, B W; Poling, R; Scott, A W; Smith, A; Zweber, P; Dobbs, S; Metreveli, Z V; Seth, K K; Tomaradze, A G; Ernst, J; Severini, H; Dytman, S A; Love, W; Savinov, V; Aquines, O; Li, Z; López, A; Mehrabyan, S S; Méndez, H; Ramírez, J; Huang, G S; Miller, D H; Pavlunin, V; Sanghi, B; Shipsey, I P J; Xin, B; Adams, G S; Anderson, M; Cummings, J P; Danko, I; Napolitano, J; He, Q; Insler, J; Muramatsu, H; Park, C S; Thorndike, E H; Yang, F; Coan, T E; Gao, Y S; Liu, F; Artuso, M; Blusk, S; Butt, J; Li, J; Menaa, N; Mountain, R; Nisar, S; Randrianarivony, K; Redjimi, R; Sia, R; Skwarnicki, T; Stone, S; Wang, J C; Zhang, K; Csorna, S E; Bonvicini, G; Cinabro, D; Dubrovin, M; Lincoln, A; Asner, D M; Edwards, K W; Briere, R A; Brock, I; Chen, J; Ferguson, T; Tatishvili, G T; Vogel, H; Watkins, M E; Rosner, J L; Adam, N E; Alexander, J P; Berkelman, K; Cassel, D G; Duboscq, J E; Ecklund, K M; Ehrlich, R; Fields, L; Galik, R S; Gibbons, L; Gray, R; Gray, S W; Hartill, D L; Heltsley, B K; Hertz, D; Jones, C D; Kandaswamy, J; Kreinick, D L; Kuznetsov, V E; Mahlke-Krüger, H; Onyisi, P U E; Patterson, J R; Peterson, D; Pivarski, J; Riley, D; Ryd, A; Sadoff, A J; Schwarthoff, H; Shi, X; Stroiney, S; Sun, W M; Wilksen, T; Weinberger, M

    2006-01-01

    Using a sample of 3x10^6 psi(2S) decays recorded by the CLEO detector, we study three body decays of the chi_{c0}, chi_{c1}, and chi_{c2} produced in radiative decays of the psi(2S). We consider the decay modes pi+ pi- eta, K+ K- eta, p pbar eta, pi+ pi- etaprime, K+ K- pi0, p pbar pi0, pi+ K- K0S, and K+ pbar Lambda measuring branching fractions or placing upper limits. For chi_{c1} to pi+ pi- eta, K+ K- pi0, and pi+ K- K0S our observed samples are large enough to study the substructure in a Dalitz plot analysis. The results presented in this document are preliminary.

  15. chi_{cJ} Decays to h^+h^-h^0

    CERN Document Server

    Athar, S; Potlia, V; Yelton, J; Rubin, P; Cawlfield, C; Eisenstein, B I; Karliner, I; Kim, D; Lowrey, N; Naik, P; Selen, M; White, E J; Wiss, J; Mitchell, R E; Shepherd, M R; Besson, D; Pedlar, T K; Cronin-Hennessy, D; Gao, K Y; Hietala, J; Kubota, Y; Klein, T; Lang, B W; Poling, R; Scott, A W; Smith, A; Zweber, P; Dobbs, S; Metreveli, Z V; Seth, K K; Tomaradze, A G; Ernst, J; Severini, H; Love, W; Savinov, V; Aquines, O; Li, Z; López, A; Mehrabyan, S S; Méndez, H; Ramírez, J; Huang, G S; Miller, D H; Pavlunin, V; Sanghi, B; Shipsey, I P J; Xin, B; Adams, G S; Anderson, M; Cummings, J P; Danko, I; Hu, D; Moziak, B; Napolitano, J; He, Q; Insler, J; Muramatsu, H; Park, C S; Thorndike, E H; Yang, F; Coan, T E; Gao, Y S; Artuso, M; Blusk, S; Butt, J; Li, J; Menaa, N; Mountain, R; Nisar, S; Randrianarivony, K; Sia, R; Skwarnicki, T; Stone, S; Wang, J C; Zhang, K; Bonvicini, G; Cinabro, D; Dubrovin, M; Lincoln, A; Asner, D M; Edwards, K W; Briere, R A; Ferguson, T; Tatishvili, G T; Vogel, H; Watkins, M E; Rosner, J L; Adam, N E; Alexander, J P; Cassel, D G; Duboscq, J E; Ecklund, K M; Ehrlich, R; Fields, L; Gibbons, L; Gray, R; Gray, S W; Hartill, D L; Heltsley, B K; Hertz, D; Jones, C D; Kandaswamy, J; Kreinick, D L; Kuznetsov, V E; Mahlke-Krüger, H; Onyisi, P U E; Patterson, J R; Peterson, D; Pivarski, J; Riley, D; Ryd, A; Sadoff, A J; Schwarthoff, H; Shi, X; Stroiney, S; Sun, W M; Wilksen, T; Weinberger, M; al, et

    2007-01-01

    Using a sample of 3 million psi(2S) decays recorded by the CLEO detector, we study three-body decays of the chi_c0, chi_c1, and chi_c2 produced in radiative decays of the psi(2S). We consider the final states pi+ pi- eta, K+ K- eta, p p-bar eta, pi+ pi- eta-prime, K+ K- pi0, p p-bar pi0, pi+ K- K0S, and K+ p-bar Lambda, measuring branching fractions or placing upper limits. For chi_c1 decays to pi+ pi- eta, K+ K- pi0, and pi+ K- K0S our observed samples are large enough to study the substructure in a Dalitz plot analysis.

  16. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... tool that features tai chi A practice in traditional Chinese medicine that uses a series of slow, gentle movements coordinated with breathing and meditation. The goal is to enhance physical functioning, improve balance and ...

  17. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... Council Job Opportunities All About NCCIH Health Topics A-Z # A B C D E F G H I ... be an educational tool that features tai chi A practice in traditional Chinese medicine that uses a ...

  18. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... tool that features tai chi A practice in traditional Chinese medicine that uses a series of slow, ... reduce stress. and qi gong A component of traditional Chinese medicine that combines movement, meditation, and controlled ...

  19. Chi 2 tests: how useful are they in the analysis of medical research data?

    Science.gov (United States)

    Osborn, J F

    1989-01-01

    This paper has outlined analyses of data for which the chi 2 test is commonly applied and has shown that on its own, a chi 2 test provides very little information about the interpretation of the data. In goodness to fit tests, at best, the chi 2 test is a mere first step in the interpretation of the data and much more information can be gleaned from the deviations between the observed and theoretical distributions, and graphical methods are more sensitive for assessing Normality. Similarly, the chi 2 test as the analysis of a 2 x 2 contingency table misses the most important features of the data. A chi 2 value and associated p value should not be presented without an estimation of the effect and its confidence interval. The use of NS, (not significant), after a chi 2 value (or any other test statistic) is particularly meaningless as it does not even specify a level of significance. The analysis of 2 x 2 contingency tables should specify a measure of the effect such as the difference between two proportions, their ratio or the odds ratio. Confidence intervals should be calculated and least importantly, statistical significance assessed by the Standard Normal Deviate. Chi 2 has no useful role to play in the analysis of 2 x 2 contingency tables. In fact, even with larger two dimensional tables, although chi 2 can be used to test the significance of associations between the rows and columns, such results are seldom of much interest as they give no indication of where in the table associations may exist. They are insensitive particularly if the categories of the row or column variables are quantitative since chi 2 takes no account of the ordering of the rows and columns. Although simple analyses of such tables are inefficient the advent of desk-top computers means that more sophisticated techniques such as logistic regression for proportions and Poisson regression for larger or multidimensional contingency tables can be applied. Although these methods may involve chi 2

  20. Deciding the weak definability of Büchi definable tree languages

    OpenAIRE

    Colcombet, Thomas; Kuperberg, Denis; Löding, Christof; Vanden Boom, Michael

    2013-01-01

    Weakly definable languages of infinite trees are an expressive subclass of regular tree languages definable in terms of weak monadic second-order logic, or equivalently weak alternating automata. Our main result is that given a Büchi automaton, it is decidable whether the language is weakly definable. We also show that given a parity automaton, it is decidable whether the language is recognizable by a nondeterministic co-Büchi automaton. The decidability proofs build on recent results abou...

  1. A Randomized Controlled Trial of Patient-Reported Outcomes With Tai Chi Exercise in Parkinson's Disease

    OpenAIRE

    Li, Fuzhong; Harmer, Peter; Liu, Yu; Eckstrom, Elizabeth; Fitzgerald, Kathleen; Stock, Ronald; Chou, Li-Shan

    2013-01-01

    A previous randomized, controlled trial of tai chi showed improvements in objectively measured balance and other motor-related outcomes in patients with Parkinson's disease. This study evaluated whether patient-reported outcomes could be improved through exercise interventions and whether improvements were associated with clinical outcomes and exercise adherence. In a secondary analysis of the tai chi trial, patient-reported and clinical outcomes and exercise adherence measures were compared ...

  2. Quality of Reporting of Randomized Clinical Trials in Tai Chi Interventions—A Systematic Review

    Directory of Open Access Journals (Sweden)

    Jing-Yi Li

    2011-01-01

    Full Text Available Objectives. To evaluate the reporting quality of published randomized clinical trials (RCTs in the Tai Chi literature following the publication of the CONSORT guidelines in 2001. Data Sources. The OVID MEDLINE and PUBMED databases. Review Methods. To survey the general characteristics of Tai Chi RCTs in the literature, we included any report if (i it was an original report of the trial; (ii its design was RCT; (iii one of the treatments being tested was Tai Chi; and (iv it was in English. In addition, we assessed the reporting quality of RCTs that were published between 2002 and 2007, using a modified CONSORT checklist of 40 items. The adequate description of Tai Chi interventions in these trials was examined against a 10-item checklist adapted from previous reviews. Results. The search yielded 31 Tai Chi RCTs published from 2002 to 2007 and only 11 for 1992–2001. Among trials published during 2002–2007, the most adequately reported criteria were related to background, participant eligibility and interpretation of the study results. Nonetheless, the most poorly reported items were associated with randomization allocation concealment, implementation of randomization and the definitions of period of recruitment and follow-up. In addition, only 23% of RCTs provided adequate details of Tai Chi intervention used in the trials. Conclusion. The findings in this review indicated that the reporting quality of Tai Chi intervention trials is sub-optimal. Substantial improvement is required to meet the CONSORT guidelines and allow assessment of the quality of evidence. We believe that not only investigators, but also journal editors, reviewers and funding agencies need to follow the CONSORT guidelines to improve the standards of research and strengthen the evidence base for Tai Chi and for complementary and alternative medicine.

  3. Ground Reaction Forces and Plantar Pressure Distribution Generated by Two Tai Chi Movements

    OpenAIRE

    Wong, Shiu Hong Trevor

    2013-01-01

    Tai Chi Chuan, Tai Chi (TC) in short, is a popular form of Chinese martial arts which have been practised by millions of people and provides various health benefits, such as improving balance control, strengthening leg muscles, reducing fear of falling, enhancing flexibility and many more. The American Geriatrics Society and the British Geriatrics Society have recommended TC as a suitable exercise for preventing falls of older people. However, it is not clear which TC components are the most ...

  4. Asymptotic Chi-Square Tests for a Large Class of Factor Analysis Models

    OpenAIRE

    Amemiya, Yasuo; Anderson, T W

    1990-01-01

    Three types of asymptotic $\\chi^2$ goodness-of-fit tests derived under the normal assumption have been used widely in factor analysis. Asymptotic behavior of the test statistics is investigated here for the factor analysis model with linearly or nonlinearly restricted factor loadings under weak assumptions on the factor vector and the error vector. In particular the limiting $\\chi^2$ result for the three tests is shown to hold for the factor vector, either fixed or random with any distributio...

  5. Water-based Tai Chi: theoretical benefits in musculoskeletal diseases. Current evidence

    OpenAIRE

    Macías-Hernández, Salvador Israel; Vázquez-Torres, Lucio; Morones-Alba, Juan Daniel; Coronado-Zarco, Roberto; de los Angeles Soria-Bastida, María; Cruz-Medina, Eva; Nava-Bringas, Tania Inés

    2015-01-01

    Tai Chi is a low-impact and moderate intensity exercise that has shown positive effects in patients with musculoskeletal disorders. Recently have been developed clinical studies on the benefits of Tai Chi techniques combined with hydrotherapy. Both types of treatment include physical training of balance, mobility, strength, coordination and sensory input that could complement each other. This report aims to present the current evidence about the benefits of the combination of water based Tai ...

  6. A systematic review of the health benefits of Tai Chi for students in higher education

    OpenAIRE

    Webster, Craig S.; Luo, Anna Y.; Krägeloh, Chris; Moir, Fiona; Henning, Marcus

    2015-01-01

    Background The poor health consequences of stress are well recognized, and students in higher education may be at particular risk. Tai Chi integrates physical exercise with mindfulness techniques and seems well suited to relieve stress and related conditions. Methods We conducted a systematic review of the health benefits of Tai Chi for students in higher education reported in the English and Chinese literature, using an evidence hierarchy approach, allowing the inclusion of studies additiona...

  7. CHI3L1 nuclear localization in monocyte derived dendritic cells.

    Science.gov (United States)

    Di Rosa, Michelino; Tibullo, Daniele; Saccone, Salvatore; Distefano, Gisella; Basile, Maria Sofia; Di Raimondo, Francesco; Malaguarnera, Lucia

    2016-02-01

    Chitinase-3-like-1 protein (CHI3L1) is a glycosyl hydrolase (GH) highly expressed in a variety of inflammatory diseases at infectious and non-infectious etiology. CHI3L1 is produced by a wide variety of cells including monocyte-derived macrophages cell lines such as polarized M1 and M2 type macrophages, osteoclasts and Kupffer cells. In this study we have examined the expression of CHI3L1 during the differentiation and maturation of dendritic cells. Magnetically-isolated peripheral blood monocytes were differentiated toward immature DCs (iDC) and mature DCs (mDCs) through a combination of factors and cytokines. Our result showed, for the first time, that CHI3L1 is expressed during the process of differentiation and maturation of dendritic cells in time dependent manner. Furthermore, the CHI3L1 is evenly distributed in cytoplasm and in the nucleus of both the iDCs and mDCs. These results suggest that CHI3L1 may play crucial role in the DCs immunoresponse. PMID:26466985

  8. Cross-ratio Identities and Higher-order Poles of CHY-integrand

    CERN Document Server

    Cardona, Carlos; Gomez, Humberto; Huang, Rijun

    2016-01-01

    The evaluation of generic Cachazo-He-Yuan(CHY)-integrands is a big challenge and efficient computational methods are in demand for practical evaluation. In this paper, we propose a systematic decomposition algorithm by using cross-ratio identities, which provides an analytic and easy to implement method for the evaluation of any CHY-integrand. This algorithm aims to decompose a given CHY-integrand containing higher-order poles as a linear combination of CHY-integrands with only simple poles in a finite number of steps, which ultimately can be trivially evaluated by integration rules of simple poles. To make the method even more efficient for CHY-integrands with large number of particles and complicated higher-order pole structures, we combine the $\\Lambda$-algorithm and the cross-ratio identities, and as a by-product it provides us a way to deal with CHY-integrands where the $\\Lambda$-algorithm was not applicable in its original formulation.

  9. Nonperturbative and spin effects in the central exclusive production of tensor \\chi_c(2^+) meson

    CERN Document Server

    Pasechnik, R S; Teryaev, O V

    2009-01-01

    We discuss central exclusive production (CEP) of the tensor $\\chi_c(2^{+})$ meson in proton-(anti)proton collisions at Tevatron, RHIC and LHC energies. The amplitude for the process is derived within the $k_t$-factorisation approach. Differential and total cross sections are calculated for several unintegrated gluon distributions (UGDFs). We compare exclusive production of all charmonium states $\\chi_c(0^+), \\chi_c(1^+)$ and $\\chi_c(2^+)$. Good description of the recent Tevatron data is achieved both with Martin-Ryskin phenomenological UGDF and UGDF based on unified BFKL-DGLAP approach. Unlike for Higgs production, the main contribution to the diffractive amplitude of heavy quarkonia comes from nonperturbative region of gluon transverse momenta $Q_{\\perp}<1 \\GeV$. At $y \\approx$ 0, we predict the contribution of $\\chi_c(1^+,2^+)$ to the $J/\\Psi + \\gamma$ channel to be larger than that of the $\\chi_c(0^+)$ one. This is partially due to a significant contribution from lower polarization states $\\lambda=0$ fo...

  10. Flying Cities

    DEFF Research Database (Denmark)

    Ciger, Jan

    2006-01-01

    of providing a tangible correspondence between the two spaces. This interaction mean has proved to suit the artistic expression well but it also aims at providing anyone with a pleasant and stimulating feedback from speech activity, a new medium for creativity and a way to visually perceive a vocal...... performance. As the feedback we have received when presenting Flying Cities was very positive, our objective now is to cross the bridge between art and the potential applications to the rehabilitation of people with reduced mobility or for the treatment of language impairments....

  11. The Value Loss of Chinese Key Cities due to Traffic Noise

    OpenAIRE

    Yang Ruiliang; He Zhifan; Zhu Caixia; Xu Zilong

    2013-01-01

    A method for analyzing value loss of Chinese key cities due to traffic noise is proposed based on the rate of pollution loss. Correlative parameter of this method is confirmed according to the national standard of environmental noise. Then the rate of pollution loss for different sound level is computed. Considering the characteristic of traffic noise of China cities, the general computational method for value loss due to traffic noise is proposed in this study. Finally, the value loss of Chi...

  12. Branding Cities, Changing Societies

    DEFF Research Database (Denmark)

    Ooi, Can-Seng

    Societal changes are seldom discussed in the literature on city branding. The time element is important because it highlights the fluctuating reality of society. The city brand message freezes the place but in fact, the city branding exercise is a continuous process. Society emerges too. City...... brands are supposed to accentuate the uniqueness of the city, be built from the bottom-up and reflect the city's identity. This paper highlights three paradoxes, pointing out that city branding processes can also make cities more alike, bring about societal changes and forge new city identities. A city...... branding campaign does not just present the city, it may change the city. The relationships between the branding exercise and the city are intertwined in the evolution of the place....

  13. Learning Cities as Healthy Green Cities: Building Sustainable Opportunity Cities

    Science.gov (United States)

    Kearns, Peter

    2012-01-01

    This paper discusses a new generation of learning cities we have called EcCoWell cities (Economy, Community, Well-being). The paper was prepared for the PASCAL International Exchanges (PIE) and is based on international experiences with PIE and developments in some cities. The paper argues for more holistic and integrated development so that…

  14. The autonomic and rate pressure product responses of Tai Chi practitioners

    Directory of Open Access Journals (Sweden)

    Michael A Figueroa

    2012-01-01

    Full Text Available Background: Spectral analysis of autonomic nervous system activity can provide insight into cardiovascular function. Rate pressure product is the parameter often targeted pharmacologically to decrease the incidence of myocardial events. Aim: The purpose of this study was to investigate whether or not Tai Chi Chuan practitioners would demonstrate autonomic responses that would be more cardioprotective when compared to non-trained controls. Materials and Methods: This was a cross-sectional study that measured the autonomic responses and rate pressure product of 2 groups of subjects; a Tai Chi Chuan trained (n = 13 and non-trained sedentary controls (n = 13 at rest and during 2 stressor phases that simulated functional activities of daily living. Results: The Tai Chi group maintained a greater parasympathetic outflow at rest and during the isometric grip stressor phase (P<0.05. Sympathetic outflow, systolic blood pressure and rate pressure product were significantly lower in the Tai Chi group at rest, during the isometric grip and standing stressor phases (P<0.05. Conclusion: Although a cause-and-effect relationship cannot be concluded in this study, the Tai Chi group was able to demonstrate efficiency of the myocardium with suppressed rate pressure product values and autonomic responses that favored parasympathetic outflow. This type of training may complement non-pharmacological anti-hypertensive therapy.

  15. Polarized $\\chi_{c2}$-charmonium production in antiproton-nucleus interactions

    CERN Document Server

    Larionov, A B; Bleicher, M

    2014-01-01

    Starting from the Feynman diagram representation of multiple scattering we consider the polarized $\\chi_c$(1P)-charmonia production in antiproton-nucleus reactions close to the threshold ($p_{\\rm lab}=5-7$ GeV/c). The rescattering and absorption of the incoming antiproton and outgoing charmonium on nucleons are taken into account, including the possibility of the elastic and nondiagonal (flavor-conserving) scattering $\\chi_{cJ} N \\to \\chi_{cJ^\\prime} N$, $J,J^\\prime=0,1,2$. The elementary amplitudes of the latter processes are evaluated by expanding the physical $\\chi_c$-states in the Clebsch-Gordan series of the $c \\bar c$ states with fixed values of internal orbital angular momentum ($L_z$) and spin projections on the $\\chi_c$ momentum axis. The total interaction cross sections of these $c \\bar c$ states with nucleons have been calculated in previous works using the QCD factorization theorem and the nonrelativistic quarkonium model and turned out to be strongly $L_z$-dependent due to the transverse size dif...

  16. Dynamic mechanisms of the post-seismic deformation following large events:Case study of the 1999 Chi-Chi earthquake in Taiwan of China

    Institute of Scientific and Technical Information of China (English)

    ZHU ShouBiao; CAI YongEn

    2009-01-01

    The mechanism of postseismic deformation related to strong earthquakes is important in geodynamics,and presumably afterslip or viscoelastic relaxation is responsible for the postsesimic deformation.The 1999 Chi-Chi,Taiwan of China,earthquake occurred in the region where GPS observation station is most densely deployed in the world.The unprecedented GPS data provides a unique opportunity to study the physical processes of postseismic deformation.Here we assume that the interactions of viscoelastic relaxation,afterslip,fault zone collapse,poroelastic rebound,flow of underground fluids,and all these combined contribute to the surface displacements following the main shock.In order to know the essence of the postseismic deformation after the strong event,fault zone collapse,poroelastic rebound,flow of underground fluids,and so on,are represented equivalently by the variations of the focal medium properties.Therefore,the viscoelastic relaxation,afterslip,and the variations of the equivalent focal medium properties are inverted by applying the GPS temporal series measurement data with viscoelastic finite element method.Both the afterslip rate distribution along the fault and the afterslip evolution with time are obtained by means of inversion.Also,the preliminary result suggests that viscosities of the lower crust and the upper mantle in Taiwan region is 2.7×10~(18) and 4.2×10~(20) Pa.s,respectively.Moreover,the inversion results indicate that the afterslip contributing to postseismic deformation of 44.6% in 450 days after the Chi-Chi earthquake,with 34.7% caused by the viscous relaxation and 20.7% by other factors such as fault zone collapse,poroelastic rebound,and the flow of liquids.

  17. Dynamic mechanisms of the post-seismic deformation following large events:Case study of the 1999 Chi-Chi earthquake in Taiwan of China

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    The mechanism of postseismic deformation related to strong earthquakes is important in geodynamics, and presumably afterslip or viscoelastic relaxation is responsible for the postsesimic deformation. The 1999 Chi-Chi, Taiwan of China, earthquake occurred in the region where GPS observation station is most densely deployed in the world. The unprecedented GPS data provides a unique opportunity to study the physical processes of postseismic deformation. Here we assume that the interactions of viscoelastic relaxation, afterslip, fault zone collapse, poroelastic rebound, flow of underground fluids, and all these combined contribute to the surface displacements following the main shock. In order to know the essence of the postseismic deformation after the strong event, fault zone collapse, poroelastic rebound, flow of underground fluids, and so on, are represented equivalently by the variations of the focal medium properties. Therefore, the viscoelastic relaxation, afterslip, and the variations of the equivalent focal medium properties are inverted by applying the GPS temporal series measurement data with viscoelastic finite element method. Both the afterslip rate distribution along the fault and the afterslip evolution with time are obtained by means of inversion. Also, the preliminary result suggests that viscosities of the lower crust and the upper mantle in Taiwan region is 2.7×1018 and 4.2×1020 Pa·s, respectively. Moreover, the inversion results indicate that the afterslip contributing to postseismic deformation of 44.6% in 450 days after the Chi-Chi earthquake, with 34.7% caused by the viscous relaxation and 20.7% by other factors such as fault zone collapse, poroelastic rebound, and the flow of liquids.

  18. A randomized controlled trial of tai chi for long-term low back pain (TAI CHI): Study rationale, design, and methods

    OpenAIRE

    Hall Amanda M; Maher Chris G; Latimer Jane; Ferreira Manuela L; Lam Paul

    2009-01-01

    Abstract Background Low back pain persisting for longer than 3 months is a common and costly condition for which many current treatments have low-moderate success rates at best. Exercise is among the more successful treatments for this condition, however, the type and dosage of exercise that elicits the best results is not clearly defined. Tai chi is a gentle form of low intensity exercise that uses controlled movements in combination with relaxation techniques and is currently used as a safe...

  19. Pittsburgh City Facilities

    Data.gov (United States)

    Allegheny County / City of Pittsburgh / Western PA Regional Data Center — Pittsburgh City FacilitiesIncludes: City Administrative Buildings, Police Stations, Fire Stations, EMS Stations, DPW Sites, Senior Centers, Recreation Centers,...

  20. Towards ensemble asteroseismology of the young open clusters Chi Persei and NGC 6910

    CERN Document Server

    Saesen, S; Carrier, F; Michalska, G; Aerts, C; De Ridder, J; Briquet, M; Handler, G; Kolaczkowski, Z; Acke, B; Bauwens, E; Beck, P G; Blom, Y; Blommaert, J; Broeders, E; Cherix, M; Davignon, G; Debosscher, J; Degroote, P; Decin, L; Dehaes, S; De Meester, W; Deroo, P; Desmet, M; Drummond, R; Eggen, J R; Fu, J; Gazeas, K; Gelven, G A; Gielen, C; Huygen, R; Jiang, X; Kalomeni, B; Kim, S -L; Kim, D H; Kopacki, G; Kwon, J -H; Ladjal, D; Lee, C -U; Lee, Y -J; Lefever, K; Leitner, A; Lenz, P; Liakos, A; Lorenz, D; Narwid, A; Niarchos, P; Oestensen, R; Poretti, E; Prins, S; Provencal, J; Antolin, E Puga; Puschnig, J; Raskin, G; Reed, M D; Reyniers, M; Schmidt, E; Schmitzberger, L; Spano, M; Steininger, B; Steslicki, M; Uytterhoeven, K; Vanautgaerden, J; Vandenbussche, B; Van Helshoecht, V; Vanhollebeke, E; Van Winckel, H; Verhoelst, T; Vuckovic, M; Waelkens, C; Wolf, G W; Yakut, K; Zhang, C; Zima, W

    2010-01-01

    As a result of the variability survey in Chi Persei and NGC6910, the number of Beta Cep stars that are members of these two open clusters is increased to twenty stars, nine in NGC6910 and eleven in Chi Persei. We compare pulsational properties, in particular the frequency spectra, of Beta Cep stars in both clusters and explain the differences in terms of the global parameters of the clusters. We also indicate that the more complicated pattern of the variability among B type stars in Chi Persei is very likely caused by higher rotational velocities of stars in this cluster. We conclude that the sample of pulsating stars in the two open clusters constitutes a very good starting point for the ensemble asteroseismology of Beta Cep-type stars and maybe also for other B-type pulsators.

  1. Cities, Towns and Villages - City Limit (polygon)

    Data.gov (United States)

    NSGIC GIS Inventory (aka Ramona) — Data available online through GeoStor at http://www.geostor.arkansas.gov. Arkansas Cities: This data set contains all of the city limit boundaries within the state...

  2. Tai Chi for treating knee osteoarthritis: Designing a long-term follow up randomized controlled trial

    Directory of Open Access Journals (Sweden)

    Rones Ramel

    2008-07-01

    Full Text Available Abstract Background Knee Osteoarthritis (KOA is a major cause of pain and functional impairment among elders. Currently, there are neither feasible preventive intervention strategies nor effective medical remedies for the management of KOA. Tai Chi, an ancient Chinese mind-body exercise that is reported to enhance muscle function, balance and flexibility, and to reduce pain, depression and anxiety, may safely and effectively be used to treat KOA. However, current evidence is inconclusive. Our study examines the effects of a 12-week Tai Chi program compared with an attention control (wellness education and stretching on pain, functional capacity, psychosocial variables, joint proprioception and health status in elderly people with KOA. The study will be completed by July 2009. Methods/Design Forty eligible patients, age > 55 yr, BMI ≤ 40 kg/m2 with tibiofemoral osteoarthritis (American College of Rheumatology criteria are identified and randomly allocated to either Tai Chi (10 modified forms from classical Yang style Tai Chi or attention control (wellness education and stretching. The 60-minute intervention sessions take place twice weekly for 12 weeks. The study is conducted at an urban tertiary medical center in Boston, Massachusetts. The primary outcome measure is the Western Ontario and McMaster Universities (WOMAC pain subscale at 12 weeks. Secondary outcomes include weekly WOMAC pain, function and stiffness scores, patient and physician global assessments, lower-extremity function, knee proprioception, depression, self-efficacy, social support, health-related quality of life, adherence and occurrence of adverse events after 12, 24 and 48 weeks. Discussion In this article, we present the challenges of designing a randomized controlled trial with long-term follow up. The challenges encountered in this design are: strategies for recruitment, avoidance of selection bias, the actual practice of Tai Chi, and the maximization of adherence

  3. TAI CHI CHUAN: STATE OF THE ART IN INTERNATIONAL RESEARCH: VOL 52 (MEDICINE & SPORT SCIENCE

    Directory of Open Access Journals (Sweden)

    Youlian Hong

    2008-09-01

    Full Text Available DESCRIPTION This collection on the latest and practical research data about the characteristics and beneficial effects of Tai Chi Chuan on various physiological and pathological matters is published as the 52nd volume of Medicine and Sport Science Journal. PURPOSE To address the effects of Tai Chi Chuan in the fields of biomechanics and physiology, sensory motor control and fall prevention, psychology and social aspects, as well as various clinical applications. FEATURES The book is organised into four sections, each containing four to seven chapters: the first section focuses on biomechanical and physiological aspects of Tai Chi in seven chapters, the second section addresses the benefits of the sport in terms of sensory motor control and fall prevention in five chapters, the third section highlights the psychological and social aspects in four chapters, and in the last section the application of Tai Chi in clinical intervention such as in Parkinson's disease, Alzheimer's diseases, coronary heart disease, chronic heart failure, breast cancer, rheumatoid arthritis and diabetes is demonstrated in six chapters. AUDIENCE This is a thorough reference book for students, researchers, teachers and healthcare professionals in exercise science and medicine. In fact, anyone already practicing Tai Chi Chuan or considering it up would benefit from this book. ASSESSMENT This 52nd volume of Medicine and Sport Science Journal on Tai Chi Chuan is a valuable and essential source of information brought together by recognized researchers around the Globe. The book is for everybody who is interested in understanding the effects and application of this fascinating form of exercise which has been developed as a form of martial arts and used for health exercise for centuries in China.

  4. Electrical properties of resistive switches based on Ba{sub 1-{chi}S}r{sub {chi}T}iO{sub 3} thin films prepared by RF co-sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Marquez H, A.; Hernandez R, E.; Zapata T, M. [IPN, Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada, Calzada Legaria No. 694, Col. Irrigacion, 11500 Mexico D. F. (Mexico); Guillen R, J. [Instituto Tecnologico y de Estudios Superiores de Monterrey, Campus Tampico, Puerto Industrial, Altamira 89600, Tamaulipas (Mexico); Cruz, M. P. [UNAM, Centro de Nanociencias y Nanotecnologia, Km. 107 Carretera Tijuana-Ensenada, 22860 Ensenada, Baja California (Mexico); Calzadilla A, O. [Universidad de la Habana, Facultad de Fisica-IMRE, San Lazaro y L. Municipio Plaza de la Revolucion, La Habana, Cuba (Cuba); Melendez L, M., E-mail: amarquez@ipn.m [IPN, Centro de Investigacion y de Estudios Avanzados, Departamento de Fisica, A. P. 14-740, 07000 Mexico D. F. (Mexico)

    2010-07-01

    In this work, was proposed the use of Ba{sub 1-{chi}S}r{sub {chi}T}iO{sub 3}(0{<=}x{<=}1) thin films for the construction of metal-insulator-metal heterostructures; and their great potential for the development of non-volatile resistance memories (ReRAM) is shown. The deposition of Ba{sub 1-{chi}S}r{sub {chi}T}iO{sub 3} thin films was done by the RF co-sputtering technique using two magnetron sputtering cathodes with BaTiO{sub 3} and SrTiO{sub 3} targets. The chemical composition (x parameter) in the deposited Ba{sub 1-{chi}S}r{sub {chi}T}iO{sub 3} thin films was varied through the RF powder applied to the targets. The constructed metal-insulator-metal heterostructures were Al/Ba{sub 1-{chi}S}r{sub {chi}T}iO{sub 3}/nichrome. The I-V measurements of the heterostructures showed that their hysteretic characteristics change depending on the Ba/Sr ratio of the Ba{sub 1-{chi}S}r{sub {chi}T}iO{sub 3} thin films; the Ba/Sr ratio was determined by employing the energy dispersive spectroscopy; Sem micrographs showed that Ba{sub 1-{chi}S}r{sub {chi}T}iO{sub 3} thin films were uniform without cracks or pinholes. Additionally, the analysis of the X-ray diffraction results indicated the substitutional incorporation of Sr into the BaTiO{sub 3} lattice and the obtainment of crystalline films for the entire range of the x values. (Author)

  5. Sister Cities Flourish

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    @@ Building sister city relation,also known as friendsh ip city,is a common channel for cities in different countries to keep a closer tie and communication.According to the statistics from China International Friendship Cities Association,up to the end of 2007,1087 provinces and states and 314 cities from 120 countries in the world have found their sister cities in China.Among them,Japan has the largest amount of Chinese sister cities,that is 200 provinces and 33 cities,and takes up almost 17 percent of the total number.

  6. Tai Chi for osteopenic women: design and rationale of a pragmatic randomized controlled trial

    Directory of Open Access Journals (Sweden)

    Fischer Mary

    2010-03-01

    Full Text Available Abstract Background Post-menopausal osteopenic women are at increased risk for skeletal fractures. Current osteopenia treatment guidelines include exercise, however, optimal exercise regimens for attenuating bone mineral density (BMD loss, or for addressing other fracture-related risk factors (e.g. poor balance, decreased muscle strength are not well-defined. Tai Chi is an increasingly popular weight bearing mind-body exercise that has been reported to positively impact BMD dynamics and improve postural control, however, current evidence is inconclusive. This study will determine the effectiveness of Tai Chi in reducing rates of bone turnover in post-menopausal osteopenic women, compared with standard care, and will preliminarily explore biomechanical processes that might inform how Tai Chi impacts BMD and associated fracture risks. Methods/Design A total of 86 post-menopausal women, aged 45-70y, T-score of the hip and/or spine -1.0 and -2.5, have been recruited from primary care clinics of a large healthcare system based in Boston. They have been randomized to a group-based 9-month Tai Chi program plus standard care or to standard care only. A unique aspect of this trial is its pragmatic design, which allows participants randomized to Tai Chi to choose from a pre-screened list of community-based Tai Chi programs. Interviewers masked to participants' treatment group assess outcomes at baseline and 3 and 9 months after randomization. Primary outcomes are serum markers of bone resorption (C-terminal cross linking telopeptide of type I collagen, bone formation (osteocalcin, and BMD of the lumbar spine and proximal femur (dual-energy X-ray absorptiometry. Secondary outcomes include health-related quality-of-life, exercise behavior, and psychological well-being. In addition, kinetic and kinematic characterization of gait, standing, and rising from a chair are assessed in subset of participants (n = 16 to explore the feasibility of modeling skeletal

  7. Connor H. G. Patros: Psi Chi/APA Edwin B. Newman Graduate Research Award.

    Science.gov (United States)

    2015-11-01

    The Edwin B. Newman Graduate Research Award is given jointly by Psi Chi and APA. The award was established to recognize young researchers at the beginning of their professional lives and to commemorate both the 50th anniversary of Psi Chi and the 100th anniversary of psychology as a science (dating from the founding of Wundt's laboratory). The 2015 recipient is Connor H. G Patros. Patros was chosen for "an excellent research paper that examines the complex relationship between working memory, choice-impulsivity, and the attention-deficit/hyperactivity disorder (ADHD) phenotype." Patros's award citation, biography, and a selected bibliography are presented here. PMID:26618965

  8. Novel probe of new light Higgs bosons from bottomonium chi_{b0} decay

    CERN Document Server

    Godfrey, Stephen

    2015-01-01

    We calculate the branching ratios of chi_{b0} --> tau+ tau- via an s-channel Higgs boson and estimate the sensitivity to this process from Upsilon --> gamma chi_{b0} --> gamma tau+ tau-. We show that future running at the Upsilon(3S) at a very high luminosity super B factory can put significant constraints on the Type-II two Higgs doublet model when the discovered 125 GeV Higgs boson is the heavier of the two CP-even scalars.

  9. Variation in CHI3LI in relation to type 2 diabetes and related quantitative traits.

    Directory of Open Access Journals (Sweden)

    Camilla Noelle Rathcke

    Full Text Available BACKGROUND: CHI3LI encoding the inflammatory glycoprotein YKL-40 is located on chromosome 1q32.1. YKL-40 is involved in inflammatory processes and patients with Type 2 Diabetes (T2D have elevated circulating YKL-40 levels which correlate with their level of insulin resistance. Interestingly, it has been reported that rs10399931 (-329 G/A of CHI3LI contributes to the inter-individual plasma YKL-40 levels in patients with sarcoidosis, and that rs4950928 (-131 C/G is a susceptibility polymorphism for asthma and a decline in lung function. We hypothesized that single nucleotide polymorphisms (SNPs or haplotypes thereof the CHI3LI locus might influence risk of T2D. The aim of the present study was to investigate the putative association between SNPs and haplotype blocks of CHI3LI and T2D and T2D related quantitative traits. METHODS/PRINCIPAL FINDINGS: Eleven SNPs of CHI3LI were genotyped in 6514 individuals from the Inter99 cohort and 2924 individuals from the outpatient clinic at Steno Diabetes Center. In cas-control studies a total of 2345 T2D patients and 5302 individuals with a normal glucose tolerance test were examined. We found no association between rs10399931 (OR, 0.98 (CI, 0.88-1.10, p = 0.76, rs4950928 (0.98 (0.87-1.10, p = 0.68 or any of the other SNPs with T2D. Similarly, we found no significant association between any of the 11 tgSNPs and T2D related quantitative traits, all p>0.14. None of the identified haplotype blocks of CHI3LI showed any association with T2D, all p>0.16. CONCLUSIONS/SIGNIFICANCE: None of the examined SNPs or haplotype blocks of CHI3LI showed any association with T2D or T2D related quantitative traits. Estimates of insulin resistance and dysregulated glucose homeostasis in T2D do not seem to be accounted for by the examined variations of CHI3LI.

  10. NLO corrections to $\\chi_{bJ}$ two-body exclusive decay processes

    CERN Document Server

    Chen, Long-Bin

    2014-01-01

    The next-to-leading order QCD corrections for $\\chi_{bJ}$, the p-wave bottomonium, to $J/\\psi$ pair decay processes were evaluated utilizing NRQCD factorization formalism. It was determined that the scale dependence was depressed with NLO corrections, and hence the uncertainties in the leading order results were greatly reduced. The total branch ratios were found to be the order of $10^{-5}$ for all three $\\chi_{bJ}\\rightarrow J/\\psi J/\\psi$ processes,indicating that they were observable in the LHC and super-B experiments.

  11. City positioning theories and city core competencies

    Institute of Scientific and Technical Information of China (English)

    Xinquan; Zhu

    2007-01-01

    Gity positioning The Chinese city in a decision develops the topic of the destiny. Since the 90's of 20 centuries, the economic integral and globalization developed rapidly. The development make national boundary become not so important, the function of the city is increasingly outstanding. In other words, national competition ability is morally now on the city competition ability. At the same time, this development result that the industry is divided internationally and is divided in cities. Therefore, under the condition of globalization, if the city wants the superior development, it must take advantages and avoid shortage, to position the city accurately, establish the competition and development the strategy. The city positioning is clearly defined the city competition ability, more important it indicated the direction of the city development. Trough the analysis of the resource and environment of the city, decide an accurate position of the best function of the city, well configure the inner and outside resource, catch the opportunities,face the challenges, maximized the market share in order to maximized the wealth and city competition ability.

  12. Helicobacter pylori infection and gastroduodenal diseases in Vietnam: a cross-sectional, hospital-based study

    Directory of Open Access Journals (Sweden)

    Okimoto Tadayoshi

    2010-09-01

    Full Text Available Abstract Background The rate of H. pylori infection in Vietnam is reportedly high, but the spectrum of H. pylori-associated gastroduodenal diseases has not been systematically investigated. Moreover, despite the similarities of ethnicity and diet, the age-standardized incidence rate of gastric cancer in the northern city of Hanoi is higher than that in the southern city of Ho Chi Minh, but the reason for this phenomenon is unknown. The virulence of Vietnamese H. pylori has also not been investigated in detail. Methods Individuals undergoing esophagogastroduodenoscopy were randomly recruited. H. pylori infection status was determined based on the combined results of culture, histology, immunohistochemistry, rapid urine test and serum ELISA. Peptic ulcer (PU and gastroesophageal reflux disease was diagnosed by endoscopy, and chronic gastritis was determined histologically. H. pylori virulence factors were investigated by PCR and sequencing. Results Among the examined patients, 65.6% were infected with H. pylori. The prevalence of infection was significantly higher in those over 40 years of age than in those aged ≤40. Chronic gastritis was present in all H. pylori-infected individuals, 83.1% of whom had active gastritis, and 85.3% and 14.7% had atrophy and intestinal metaplasia, respectively. PU was present in 21% of infected patients, whereas its incidence was very low in non-infected individuals. The prevalence of PU was significantly higher in Hanoi than in Ho Chi Minh. The prevalence of vacA m1, which has been identified as an independent risk factor for PU in Vietnam, was significantly higher among H. pylori isolates from Hanoi than among those from Ho Chi Minh. Conclusions H. pylori infection is common in Vietnam and is strongly associated with PU, active gastritis, atrophy and intestinal metaplasia. vacA m1 is associated with an increased risk for PU and might contribute to the difference in the prevalence of PU and gastric cancer between

  13. Introduction of a tryptophan side chain into subsite +1 enhances transglycosylation activity of a GH-18 chitinase from Arabidopsis thaliana, AtChiC

    DEFF Research Database (Denmark)

    Umemoto, Naoyuki; Ohnuma, Takayuki; Mizuhara, Mamiko; Sato, Hirokazu; Skriver, Karen; Fukamizo, Tamo

    2013-01-01

    A tryptophan side chain was introduced into subsite +1 of family GH-18 (class V) chitinases from Nicotiana tabacum and Arabidopsis thaliana (NtChiV and AtChiC, respectively) by the mutation of a glycine residue to tryptophan (G74W-NtChiV and G75W-AtChiC). The specific activity toward glycol chitin...

  14. Draped heterogeneity, forced uniformity: when agro-environmental policies drive family development: The U Minh Thượng forest reserve, (Mekong delta, Vietnam) Hétérogénéité cachée, uniformité forcée : quand les politiques agro-environnementales guident le développement familial – Cas de la réserve forestière de U Minh Thượng (delta du Mékong, Vietnam) Heterogeneidad oculta, uniformidad forzada: cuando las políticas agro-ambientales impulsan el desarrollo familiar. La reserva del bosque de U Minh Thượng (delta del Mekong, Vietnam)

    OpenAIRE

    Mehdi Saqalli; Mireille Dosso

    2011-01-01

    The U Minh Thượng natural reserve was created during the 1990s with a surrounding buffer zone where 3,500 households have been settled between 1992 and 1995, each household on a lot of 4 hectares. From a social point of view, the settlers were selected as 'poor people' or war veterans. A social discrimination was slowly built in favour of the latter. Despite an apparent homogeneity, the environment shows slight variations which has huge effects on the potential of the lots. From 1992 to 1998,...

  15. Robust Satellite Techniques (RST) for monitoring earthquake prone areas by satellite TIR observations: The case of 1999 Chi-Chi earthquake (Taiwan)

    Science.gov (United States)

    Genzano, N.; Filizzola, C.; Paciello, R.; Pergola, N.; Tramutoli, V.

    2015-12-01

    different years (from 1995 to 2002). In this dataset the Chi-Chi earthquake (MW = 7.6) which occurred on September 20, 1999 represents the major, but not unique, event. The analysis shows that all identified SSTAs occur in the pre-fixed space-time window around (in terms of time and location) earthquakes with M > 4. The false positive rate remains zero even if only earthquakes with M > 4.5 are considered. In the case of the Chi-Chi earthquake, 3 SSTAs were identified (all within the established space-time correlation window), one of them appearing about 2 weeks before and very close to the epicentre of the earthquake just along the associated tectonic lineaments. The wide considered space-time window, together with the high seismicity of the considered area, surely positively conditioned the achieved results, so that further analyses should be carried out by using longer datasets and different geographic areas. However, also considering the coincidence with other (possible) precursor phenomena, independently reported (particularly within the iSTEP project) at the time of the Chi Chi earthquake, achieved results seem already sufficient (at least) to qualify TIR anomalies (identified by RST) among the parameters to be considered in the framework of a multi-parametric approach to a time-Dependent Assessment of Seismic Hazard (t-DASH).

  16. Resilience of aging populations after devastating earthquake event and its determinants - A case study of the Chi-Chi earthquake in Taiwan

    Science.gov (United States)

    Hung, Chih-Hsuan; Hung, Hung-Chih

    2016-04-01

    1.Background Major portions of urban areas in Asia are highly exposed and vulnerable to devastating earthquakes. Many studies identify ways to reduce earthquake risk by concentrating more on building resilience for the particularly vulnerable populations. By 2020, as the United Nations' warning, many Asian countries would become 'super-aged societies', such as Taiwan. However, local authorities rarely use resilience approach to frame earthquake disaster risk management and land use strategies. The empirically-based research about the resilience of aging populations has also received relatively little attention. Thus, a challenge arisen for decision-makers is how to enhance resilience of aging populations within the context of risk reduction. This study aims to improve the understanding of the resilience of aging populations and its changes over time in the aftermath of a destructive earthquake at the local level. A novel methodology is proposed to assess the resilience of aging populations and to characterize their changes of spatial distribution patterns, as well as to examine their determinants. 2.Methods and data An indicator-based assessment framework is constructed with the goal of identifying composite indicators (including before, during and after a disaster) that could serve as proxies for attributes of the resilience of aging populations. Using the recovery process of the Chi-Chi earthquake struck central Taiwan in 1999 as a case study, we applied a method combined a geographical information system (GIS)-based spatial statistics technique and cluster analysis to test the extent of which the resilience of aging populations is spatially autocorrelated throughout the central Taiwan, and to explain why clustering of resilient areas occurs in specific locations. Furthermore, to scrutinize the affecting factors of resilience, we develop an aging population resilience model (APRM) based on existing resilience theory. Using the APRM, we applied a multivariate

  17. Cynthia J. Najdowski: Psi Chi/APA Edwin B. Newman Graduate Research Award

    Science.gov (United States)

    American Psychologist, 2012

    2012-01-01

    Presents a short biography of the winner of the American Psychological Association's Psi Chi/APA Edwin B. Newman Graduate Research Award. The 2012 winner is Cynthia J. Najdowski for an outstanding research paper that examines how jurors' judgments are influenced by a juvenile defendant's confession and status as intellectually disabled. Through…

  18. Gregory Daniel Webster: Psi Chi/APA Edwin B. Newman Graduate Research Award.

    Science.gov (United States)

    2006-11-01

    Presents a citation for Gregory Daniel Webster, who received the Psi Chi/APA Edwin B. Newman Graduate Research Award "for an outstanding research paper whose findings report that APA journal articles became shorter in length after the year 2000." A brief profile and a selected bibliography accompany the citation. ((c) 2006 APA, all rights reserved). PMID:17115835

  19. Hannah Höchi ja feministide peavoolu poliitikat häiriv eraelu / Rebeka Põldsam

    Index Scriptorium Estoniae

    Põldsam, Rebeka

    2010-01-01

    Saksa kunstniku Hannah Höchi näitus "Personal is Political. Hannah Höch ja tema kunsti tõlgendus" Tallinna Kunstihoones 17. oktoobrini 2010, kuraator Reet Varblane. Eksponeeritakse ka Guerrilla Girlsi (USA), Martha Rosleri (USA), Shadi Ghadiriani (Iraan), Anna-Stina Treumundi (Eesti) jt. töid

  20. A Chi-Square Program for a Microcomputer Using a Tape Unit.

    Science.gov (United States)

    Dreger, Ralph Mason

    1979-01-01

    A program is described utilizing a microcomputer and tape drive with any contingency or chi-square table from 2x2 to 8x8. It requires only the entering of the number of rows and number of columns, plus one-time entry of cell frequencies. (Author/JKS)

  1. Chi Sigma Iota Chapter Leadership and Professional Identity Development in Early Career Counselors

    Science.gov (United States)

    Luke, Melissa; Goodrich, Kristopher M.

    2010-01-01

    As the academic and professional honor society of counseling, Chi Sigma Iota (CSI) has been recognized in developing advocacy, leadership, and professional identity in student and professional members. A qualitative, grounded theory study was conducted to investigate experiences of 15 early career counselors who were CSI chapter leaders as…

  2. Observation of Persistent Edge Current Driven by Coaxial Helicity Injection (CHI)

    International Nuclear Information System (INIS)

    Coaxial Helicity Injection, CHI, has been used on the National Spherical Torus Experiment (NSTX) [M. Ono et al., Nucl. Fusion 40 (2000) 557], the Helicity Injected Torus (HIT) [B.A. Nelson et al., Phys. Rev. Lett. 72 (1994) 3666] and HIT-II [T.R. Jarboe et al., Phys. Plasmas 5 (1998) 1807] to initiate plasma and to drive up to 400 kA of toroidal current. On HIT-II, CHI initiated discharges have been successfully coupled to ohmic sustainment [R. Raman et al., Phys. Plasmas 11 (2004) 2565]. This paper presents the first results on the use of CHI to demonstrate the persistence of edge current drive in a preestablished single-null diverted inductive discharge. Edge current drive has the potential to improve plasma stability limits [J.E. Menard et al., Nucl. Fusion 37 (1997) 595]. While most current drive methods drive current in the interior of the plasma, CHI is well suited for driving current in the edge plasma

  3. R by C Chi-Square Analysis with Small Expected Cell Frequencies.

    Science.gov (United States)

    Berry, Kenneth J.; Mielke, Paul W., Jr.

    1986-01-01

    A nonasymptotic Chi-Square analysis algorithm is presented to investigate r by c contingency tables where small expected cell frequencies render the usual asymptotic analysis inappropriate. A FORTRAN subroutine is provided for analyzing the tables having highly disproportionate or small marginal totals. (Author/GDC)

  4. $\\chi$EFT studies of few-nucleon systems: a status report

    CERN Document Server

    Schiavilla, R

    2015-01-01

    A status report on $\\chi$EFT studies of few-nucleon electroweak structure and dynamics is provided, including electromagnetic form factors of few-nucleon systems, the $pp$ weak fusion and muon weak captures on deuteron and $^3$He, and a number of parity-violating processes induced by hadronic weak interactions.

  5. Light stop decays into $W b \\tilde{\\chi}_1^0$ near the kinematic threshold

    CERN Document Server

    Grober, Ramona; Popenda, Eva; Wlotzka, Alexander

    2015-01-01

    We investigate the decays of the light stop in scenarios with the lightest neutralino $\\tilde{\\chi}_1^0$ being the lightest supersymmetric particle, including flavour-violating (FV) effects. We analyse the region where the three-body decay $\\tilde{t}_1\\to W b \\tilde{\\chi}_1^0$ is kinematically allowed and provide a proper description of the transition region between the three-body decay and the four-body decay $\\tilde{t}_1 \\to\\tilde{\\chi}_1^0 b f \\bar{f}'$. The improved treatment has been implemented in the Fortran package {\\tt SUSY-HIT} and is used for the analysis of this region. A scan over the parameter range including all relevant experimental constraints reveals that the FV two-body decay into charm and $\\tilde{\\chi}_1^0$ can be as important as the three-, respectively, four-body decays if not dominant and therefore should be taken into account in order to complete the experimental searches for the light stop.

  6. Effects of Tai Chi exercise on physical and psychological health of older people.

    Science.gov (United States)

    Blake, Holly; Hawley, Helen

    2012-02-01

    Tai Chi is a traditional Chinese form of conditioning exercise derived from martial arts and rooted in eastern philosophy and Chinese Medicine. Based on the inter-relatedness of mind, body and spirit this form of exercise focuses on producing an inner calmness which is thought to have both physical and psychological therapeutic value. This article provides a brief overview of selected current evidence examining the relationship between Tai Chi and physical, neurocognitive and psychosocial outcomes in older people. This is an emerging and growing area of research and improvements have often been reported in health functioning, physical and emotional health, reducing falls, fear of falling and risk of falls, and possibly enhancing cardiovascular functioning in older adults although the effects on bone density, cognitive and immunological functioning are less clear. Results overall are inconsistent and health improvements have not been evident in all studies. Tai Chi is becoming increasingly popular in practice, and more recent evidence is emerging which is based on experimental and longitudinal designs, although many of the proposed benefits of Tai Chi are yet to be validated in large, randomised controlled trials. PMID:21762093

  7. The efficacy of Tai Chi Chuan in older adults: a systematic review

    NARCIS (Netherlands)

    A.P. Verhagen (Arianne); M. Immink; A. van der Meulen; S.M. Bierma-Zeinstra (Sita)

    2004-01-01

    textabstractOBJECTIVES: The purpose of this study was to assess the effect of Tai Chi Chuan (TCC) on fall prevention, balance and cardiorespiratory functions in the elderly. METHODS: A systematic review was carried out according to the Cochrane standards. A computerized literature

  8. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... Legislation Advisory Council Job Opportunities All About NCCIH Health Topics A-Z # A B C D E ... Y Z Tai Chi and Qi Gong for Health and Well-Being Share: taichi_nccamIMG_2962.jpg © ...

  9. Effects of Aging and Tai Chi on a Finger-Pointing Task with a Choice Paradigm

    Directory of Open Access Journals (Sweden)

    William W. N. Tsang

    2013-01-01

    Full Text Available Background. This cross-sectional study examined the effect of aging on performing finger-pointing tasks involving choices and whether experienced older Tai Chi practitioners perform better than healthy older controls in such tasks. Methods. Thirty students and 30 healthy older controls were compared with 31 Tai Chi practitioners. All the subjects performed a rapid index finger-pointing task. The visual signal appeared randomly under 3 conditions: (1 to touch a black ball as quickly and as accurately as possible, (2 not to touch a white ball, (3 to touch only the white ball when a black and a white ball appeared simultaneously. Reaction time (RT of anterior deltoid electromyogram, movement time (MT from electromyogram onset to touching of the target, end-point accuracy from the center of the target, and the number of wrong movements were recorded. Results. Young students displayed significantly faster RT and MT, achieving significantly greater end-point accuracy and fewer wrong movements than older controls. Older Tai Chi practitioners had significantly faster MT than older controls. Conclusion. Finger-pointing tasks with a choice paradigm became slower and less accurate with age. Positive findings suggest that Tai Chi may slow down the aging effect on eye-hand coordination tasks involving choices that require more cognitive progressing.

  10. $\\chi$EFT studies of few-nucleon systems: a status report

    Energy Technology Data Exchange (ETDEWEB)

    Schiavilla, Rocco [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Old Dominion Univ., Norfolk, VA (United States)

    2016-06-01

    A status report on $\\chi$EFT studies of few-nucleon electroweak structure and dynamics is provided, including electromagnetic elastic form factors of few-nucleon systems, the $pp$ weak fusion and muon weak captures on deuteron and $^3$He, and a number of parity-violating processes induced by hadronic weak interactions.

  11. A Regular City

    OpenAIRE

    Arina Sharavina

    2015-01-01

    The article describes the first plans of Chita, which served as the basis for the city development. It presents contribution to the city history made by the Decembrist Dmiry Zavalishin’s, who was the first author of the city development plan. Peculiarities of the quarter development of the realized city plan are also presented.

  12. Water changed the cities

    DEFF Research Database (Denmark)

    Elle, Morten; Jensen, Marina Bergen

    An improvement in water infrastructure and cleaning up the waters changed many harbour cities in Denmark at the beginning of the 90s. The harbour cities changed from drity, run-down industrial harbours to clean and attractive harbour dwelling creating new city centres and vital city areas...

  13. Immunosuppressive CD11b+Ly6Chi monocytes in pristane-induced lupus mouse model.

    Science.gov (United States)

    Ma, Huijuan; Wan, Suigui; Xia, Chang-Qing

    2016-06-01

    Myeloid-derived suppressor cells with immunosuppressive functions have been described to be associated with one of the mechanisms by which malignant tumors escape immune surveillance. However, little is known about the role of myeloid-derived suppressor cells in autoimmunity. In the current study, when we attempted to characterize the peritoneal cells in pristane-induced lupus model, as reported previously, we observed that there were markedly increased CD11b(+)Ly6C(hi) monocytes. Surprisingly, this type of monocytes was almost phenotypically identical to the reported monocytic myeloid-derived suppressor cells. Further analysis on how these CD11b(+)Ly6C(hi) cells affected T cell response showed that they strongly suppressed T cell proliferation in vitro in a manner dependent on cell-cell contact, NO, and PGE2. In addition, we found that CD11b(+)Ly6C(hi) monocytes inhibited Th1 differentiation but enhanced development of forkhead box p3(+)CD4(+) regulatory T cells. Consistent with the in vitro experimental results, the in vivo adoptive cell transfer study showed that infusion of pristane-treated syngeneic CD11b(+)Ly6C(hi) monocytes significantly suppressed the production of anti-keyhole limpet hemocyanin antibodies induced by keyhole limpet hemocyanin immunization. In addition, we found that CD11b(+)Ly6C(hi) monocytes were also increased significantly in spleen and peripheral blood and showed immunosuppressive characteristics similar to their peritoneal counterparts. Our findings indicate that CD11b(+)Ly6C(hi) monocytes in a pristane-induced lupus mouse model are monocytic myeloid-derived suppressor cells instead of inflammatory monocytes, as demonstrated previously. To our knowledge, this is the first to describe myeloid-derived suppressor cells in a pristane-induced lupus mouse model, which may lead to a better understanding of the role of CD11b(+)Ly6C(hi) monocytes in this specific pristane-induced lupus model. PMID:26657791

  14. Tai Chi on psychological well-being: systematic review and meta-analysis

    Directory of Open Access Journals (Sweden)

    Scott Tammy

    2010-05-01

    Full Text Available Abstract Background Physical activity and exercise appear to improve psychological health. However, the quantitative effects of Tai Chi on psychological well-being have rarely been examined. We systematically reviewed the effects of Tai Chi on stress, anxiety, depression and mood disturbance in eastern and western populations. Methods Eight English and 3 Chinese databases were searched through March 2009. Randomized controlled trials, non-randomized controlled studies and observational studies reporting at least 1 psychological health outcome were examined. Data were extracted and verified by 2 reviewers. The randomized trials in each subcategory of health outcomes were meta-analyzed using a random-effects model. The quality of each study was assessed. Results Forty studies totaling 3817 subjects were identified. Approximately 29 psychological measurements were assessed. Twenty-one of 33 randomized and nonrandomized trials reported that 1 hour to 1 year of regular Tai Chi significantly increased psychological well-being including reduction of stress (effect size [ES], 0.66; 95% confidence interval [CI], 0.23 to 1.09, anxiety (ES, 0.66; 95% CI, 0.29 to 1.03, and depression (ES, 0.56; 95% CI, 0.31 to 0.80, and enhanced mood (ES, 0.45; 95% CI, 0.20 to 0.69 in community-dwelling healthy participants and in patients with chronic conditions. Seven observational studies with relatively large sample sizes reinforced the beneficial association between Tai Chi practice and psychological health. Conclusions Tai Chi appears to be associated with improvements in psychological well-being including reduced stress, anxiety, depression and mood disturbance, and increased self-esteem. Definitive conclusions were limited due to variation in designs, comparisons, heterogeneous outcomes and inadequate controls. High-quality, well-controlled, longer randomized trials are needed to better inform clinical decisions.

  15. A INSERÇÃO DA GINÁSTICA ORIENTAL LIEN CH`I NA EDUCAÇÃO FÍSICA ESCOLAR

    Directory of Open Access Journals (Sweden)

    Leandro Alves da Cunha

    2012-12-01

    Full Text Available The present study evaluated the technique of insertion eastern Lien Ch`i gymnastic as programmatic content from Physical Education discipline in schools of basic education, through the discipline teachers’ view. The schools and the teachers belong to the public teaching service of São Paulo state, in the cities of Presidente Prudente-SP and Araçatuba-SP. The Education Department of São Paulo (SEE / SP carried out such an intervention enabling its faculty in 2003 and 2004, effecting the practice of Lien Ch`i during the years 2005, 2006 and 2007. The current National Curricular Parameters (PCN's suggest splitting the content of physical education in three blocks, a sports, games, wrestling and gymnastics, b Rhythmic and expressive Activities, c knowledge about the body. Due to its rich job options, the Lien Ch`i may be inserted into any of the three blocks mentioned above. Added to these aspects, our interest was keen to investigate the characteristics of this modality and its effectiveness, motivation and acceptance of the people involved in the process. This research is predominantly qualitative, which most significant features are descriptive and interpretive content. Data were collected through an interview transcribed later and documents consultation. The studied teachers (n = 21 have demonstrated knowledge about the received training (Lien Ch `i towards to origin and history, constitution, composition and goals of the exercises, as well as its help to maximize schoolchildren learning. The teachers were direct agents in the implementation and development of the proposal which took place in state schools of São Paulo. It was observed greater reciprocity, acceptance and participation for Lien Ch`i, as well as better use of lessons in the first cycle of primary education (1st to 4th grades. It was detected a strong dissatisfaction over the proposed curriculum content inserted in the discipline of Physical Education (69.3% and an even

  16. Stress among Doctors Doing Residency: A Cross-Sectional Study at a Tertiary Care Hospital in the City of Mumbai

    OpenAIRE

    Aarti G Sahasrabuddhe, S R Suryawanshi, Suman Rai Bhandari

    2015-01-01

    "Background: The workload of a tertiary care teaching hospital in a metropolitan city is tremendous. Resident doctors in these health care facilities bear the over whelming burden. This study was carried out to assess the stress among resident doctors and the factors associated with it. Methods: This was a cross sectional study carried out on resident doctors in a tertiary care hospital in the city of Mumbai. Statistical analysis was done using proportions and chi squre. Results:...

  17. Transport simulations of ohmic TFTR experiments with profile-consistent microinstability-based models for chi/sub e/ and chi/sub i/

    International Nuclear Information System (INIS)

    Transport simulations of ohmically heated TFTR experiments with recently developed profile-consistent microinstability models for the anomalous thermal diffusivities, chi/sub e/ and chi/sub i/, give good agreement with experimental data. The steady-state temperature profiles and the total energy confinement times, tau/sub e/, were found to agree for each of the ohmic TFTR experiments simulated, including three high radiation cases and two plasmas fueled by pellet injection. Both collisional and collisionless models are tested. The trapped-electron drift wave microinstability model results are consistent with the thermal confinement of large plasma ohmic experiments on TFTR. We also find that transport due to the toroidal ion temperature gradient (eta/sub i/) modes can cause saturation in tau/sub E/ at the highest densities comparable to that observed on TFTR and equivalent to a neoclassical anomaly factor of 3. Predictions based on stabilized eta/sub i/-mode-driven ion transport are found to be in agreement with the enhanced global energy confinement times for pellet-fueled plasmas. 33 refs., 26 figs., 4 tabs

  18. Observation of chi(cJ) decaying into the p(p)over-barK(+)K(-) final state

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Alberto, D.; An, L.; An, Q.; An, Z. H.; Bai, J. Z.; Baldini, R.; Ban, Y.; Becker, J.; Berger, N.; Bertani, M.; Bian, J. M.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Bytev, V.; Cai, X.; Cao, G. F.; Cao, X. X.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, Y.; Chen, Y. B.; Cheng, H. P.; Chu, Y. P.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dedovich, D.; Deng, Z. Y.; Denysenko, I.; Destefanis, M.; Ding, Y.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Fan, R. R.; Fang, J.; Fang, S. S.; Feng, C. Q.; Fu, C. D.; Fu, J. L.; Gao, Y.; Geng, C.; Goetzen, K.; Gong, W. X.; Greco, M.; Grishin, S.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y. P.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, M.; He, Z. Y.; Heng, Y. K.; Hou, Z. L.; Hu, H. M.; Hu, J. F.; Hu, T.; Huang, B.; Huang, G. M.; Huang, J. S.; Huang, X. T.; Huang, Y. P.; Hussain, T.; Ji, C. S.; Ji, Q.; Ji, X. B.; Ji, X. L.; Jia, L. K.; Jiang, L. L.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jing, F. F.; Kalantar-Nayestanaki, N.; Kavatsyuk, M.; Komamiya, S.; Kuehn, W.; Lange, J. S.; Leung, J. K. C.; Li, Cheng; Li, Cui; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, Lei; Li, N. B.; Li, Q. J.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, X. R.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Liao, X. T.; Liu, B. J.; Liu, B. J.; Liu, C. L.; Liu, C. X.; Liu, C. Y.; Liu, F. H.; Liu, Fang; Liu, G. C.; Liu, H.; Liu, H. B.; Liu, H. M.; Liu, H. W.; Liu, J. P.; Liu, K.; Liu, K. Y.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. H.; Liu, Y. B.; Liu, Y. W.; Liu, Yong; Liu, Z. A.; Liu, Z. Q.; Loehner, H.; Lu, G. R.; Lu, H. J.; Lu, J. G.; Lu, Q. W.; Lu, X. R.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Ma, C. L.; Ma, F. C.; Ma, H. L.; Ma, Q. M.; Ma, T.; Ma, X.; Ma, X. Y.; Maggiora, M.; Malik, Q. A.; Mao, H.; Mao, Y. J.; Mao, Z. P.; Messchendorp, J. G.; Min, J.; Mitchell, R. E.; Mo, X. H.; Muchnoi, N. Yu.; Nefedov, Y.; Ning, Z.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Pelizaeus, M.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Pun, C. S. J.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, X. S.; Qiu, J. F.; Rashid, K. H.; Rong, G.; Ruan, X. D.; Sarantsev, A.; Schulze, J.; Shao, M.; Shen, C. P.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, X. Y.; Sonoda, S.; Spataro, S.; Spruck, B.; Sun, D. H.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, X. D.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tang, X. F.; Tian, H. L.; Toth, D.; Varner, G. S.; Wan, X.; Wang, B. Q.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q.; Wang, S. G.; Wang, X. L.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. Y.; Wei, D. H.; Wen, Q. G.; Wen, S. P.; Wiedner, U.; Wu, L. H.; Wu, N.; Wu, W.; Wu, Z.; Xiao, Z. J.; Xie, Y. G.; Xu, G. F.; Xu, G. M.; Xu, H.; Xu, Y.; Xu, Z. R.; Xu, Z. Z.; Xue, Z.; Yan, L.; Yan, W. B.; Yan, Y. H.; Yang, H. X.; Yang, M.; Yang, T.; Yang, Y.; Yang, Y. X.; Ye, M.; Ye, M. H.; Yu, B. X.; Yu, C. X.; Yu, L.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, L.; Zhang, S. H.; Zhang, T. R.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, H. S.; Zhao, Jiawei; Zhao, Jingwei; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, X. H.; Zhao, Y. B.; Zhao, Z. G.; Zhao, Z. L.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, Y. H.; Zheng, Z. P.; Zhong, B.; Zhong, J.; Zhong, L.; Zhou, L.; Zhou, X. K.; Zhou, X. R.; Zhu, C.; Zhu, K.; Zhu, K. J.; Zhu, S. H.; Zhu, X. L.; Zhu, X. W.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Zuo, J. X.; Zweber, P.

    2011-01-01

    First measurements of the decays of the three chi(cJ) states to p (p) over barK(+)K(-) final states are presented. Intermediate phi -> K+K- and Lambda(1520) -> pK(-) resonance states are observed, and branching fractions for chi(cJ) -> (p) over barK(+) Lambda(1520), Lambda(1520)(Lambda) over bar (15

  19. Enhancing the Psychological Well-Being of Elderly Individuals through Tai Chi Exercise: A Latent Growth Curve Analysis.

    Science.gov (United States)

    Li, Fuzhong; Duncan, Terry E.; Duncan, Susan C.; McAuley, Edward; Chaumeton, Nigel R.; Harmer, Peter

    2001-01-01

    Examined whether a Tai Chi exercise program enhanced the psychological well-being of 98 elderly individuals. Analyzed repeated measures data about participants using latent growth curve analysis. Results indicate the beneficial effects of participation in the Tai Chi program. Discusses implications related to the exercise-psychological health…

  20. 改进卡方检验%A Modified Chi-Squared Goodness-of-Fit Test

    Institute of Scientific and Technical Information of China (English)

    戴家佳; 杨爱军

    2009-01-01

    In goodness-of-fit tests,Pearson's chi-squared test is one of most widely used tools of formal statistical analysis.However,Pearson's chi-squared test depends on the partition of the sample space.Different constructions of the partition of the sample space may lead to different conclusions.Based on an equiprobable partition of sample space,a modified chi-squared test is proposed.A method for constructing the modified chi-squared test is proposed.As an application,the proposed test is used to test whether vectorial data come from an uniformity distribution defined on the hypersphere.Some simulation studies show that the modified chi-squared test against different alternative is robust.

  1. Cities and Countries

    OpenAIRE

    Andrew K. Rose

    2005-01-01

    If one ranks cities by population, the rank of a city is inversely related to its size, a well-documented phenomenon known as Zipf's Law. Further, the growth rate of a city's population is uncorrelated with its size, another well-known characteristic known as Gibrat's Law. In this paper, I show that both characteristics are true of countries as well as cities; the size distributions of cities and countries are similar. But theories that explain the size-distribution of cities do not obviously...

  2. Variation in CHI3LI in relation to type 2 diabetes and related quantitative traits

    DEFF Research Database (Denmark)

    Rathcke, Camilla Noelle; Holmkvist, Johan; Jørgensen, Torben; Borch-Johnsen, Knut; Hansen, Torben; Pedersen, Oluf; Vestergaard, Henrik

    2009-01-01

    BACKGROUND: CHI3LI encoding the inflammatory glycoprotein YKL-40 is located on chromosome 1q32.1. YKL-40 is involved in inflammatory processes and patients with Type 2 Diabetes (T2D) have elevated circulating YKL-40 levels which correlate with their level of insulin resistance. Interestingly, it...... has been reported that rs10399931 (-329 G/A) of CHI3LI contributes to the inter-individual plasma YKL-40 levels in patients with sarcoidosis, and that rs4950928 (-131 C/G) is a susceptibility polymorphism for asthma and a decline in lung function. We hypothesized that single nucleotide polymorphisms...... 6514 individuals from the Inter99 cohort and 2924 individuals from the outpatient clinic at Steno Diabetes Center. In cas-control studies a total of 2345 T2D patients and 5302 individuals with a normal glucose tolerance test were examined. We found no association between rs10399931 (OR, 0.98 (CI, 0...

  3. Conjectures and experiments concerning the moments of $L(1/2,\\chi_d)$

    CERN Document Server

    Alderson, Matthew W

    2011-01-01

    We report on some extensive computations and experiments concerning the moments of quadratic Dirichlet $L$-functions at the critical point. We computed the values of $L(1/2,\\chi_d)$ for $- 5\\times 10^{10} < d < 1.3 \\times 10^{10}$ in order to numerically test conjectures concerning the moments $\\sum_{|d|chi_d)^k$. Specifically, we tested the full asymptotics for the moments conjectured by Conrey, Farmer, Keating, Rubinstein, and Snaith, as well as the conjectures of Diaconu, Goldfeld, Hoffstein, and Zhang concerning additional lower terms in the moments. We also describe the algorithms used for this large scale computation.

  4. Study of \\chi_{bJ}(1P) Properties in the Radiative \\Upsilon(2S) Decays

    CERN Document Server

    Abdesselam, A; Adamczyk, K; Aihara, H; Said, S Al; Arinstein, K; Arita, Y; Asner, D M; Aso, T; Atmacan, H; Aulchenko, V; Aushev, T; Ayad, R; Aziz, T; Babu, V; Badhrees, I; Bahinipati, S; Bakich, A M; Bala, A; Ban, Y; Bansal, V; Barberio, E; Barrett, M; Bartel, W; Bay, A; Bedny, I; Behera, P; Belhorn, M; Belous, K; Berger, M; Besson, D; Bhardwaj, V; Bhuyan, B; Biswal, J; Bloomfield, T; Blyth, S; Bobrov, A; Bondar, A; Bonvicini, G; Bookwalter, C; Boulahouache, C; Bozek, A; Bračko, M; Breibeck, F; Brodzicka, J; Browder, T E; Waheed, E; Červenkov, D; Chang, M -C; Chang, P; Chao, Y; Chekelian, V; Chen, A; Chen, K -F; Chen, P; Cheon, B G; Chilikin, K; Chistov, R; Cho, K; Chobanova, V; Choi, S -K; Choi, Y; Cinabro, D; Crnkovic, J; Dalseno, J; Danilov, M; Dash, N; Di Carlo, S; Dingfelder, J; Doležal, Z; Dossett, D; Drásal, Z; Drutskoy, A; Dubey, S; Dutta, D; Dutta, K; Eidelman, S; Epifanov, D; Esen, S; Farhat, H; Fast, J E; Feindt, M; Ferber, T; Frey, A; Frost, O; Fulsom, B G; Gaur, V; Gabyshev, N; Ganguly, S; Garmash, A; Getzkow, D; Gillard, R; Giordano, F; Glattauer, R; Goh, Y M; Goldenzweig, P; Golob, B; Greenwald, D; Perdekamp, M Grosse; Grygier, J; Grzymkowska, O; Guo, H; Haba, J; Hamer, P; Han, Y L; Hara, K; Hara, T; Hasegawa, Y; Hasenbusch, J; Hayasaka, K; Hayashii, H; He, X H; Heck, M; Hedges, M T; Heffernan, D; Heider, M; Heller, A; Higuchi, T; Himori, S; Hirose, S; Horiguchi, T; Hoshi, Y; Hoshina, K; Hou, W -S; Hsiung, Y B; Hsu, C -L; Huschle, M; Hyun, H J; Igarashi, Y; Iijima, T; Imamura, M; Inami, K; Inguglia, G; Ishikawa, A; Itagaki, K; Itoh, R; Iwabuchi, M; Iwasaki, M; Iwasaki, Y; Iwata, S; Jacobs, W W; Jaegle, I; Jeon, H B; Joffe, D; Jones, M; Joo, K K; Julius, T; Kakuno, H; Kang, J H; Kang, K H; Kapusta, P; Kataoka, S U; Kato, E; Kato, Y; Katrenko, P; Kawai, H; Kawasaki, T; Keck, T; Kichimi, H; Kiesling, C; Kim, B H; Kim, D Y; Kim, H J; Kim, H -J; Kim, J B; Kim, J H; Kim, K T; Kim, M J; Kim, S H; Kim, S K; Kim, Y J; Kinoshita, K; Kleinwort, C; Klucar, J; Ko, B R; Kobayashi, N; Koblitz, S; Kodyš, P; Koga, Y; Korpar, S; Kotchetkov, D; Kouzes, R T; Križan, P; Krokovny, P; Kronenbitter, B; Kuhr, T; Kulasiri, L; Kumar, R; Kumita, T; Kurihara, E; Kuroki, Y; Kuzmin, A; Kvasnička, P; Kwon, Y -J; Lai, Y -T; Lange, J S; Lee, D H; Lee, I S; Lee, S -H; Leitgab, M; Leitner, R; Levit, D; Lewis, P; Li, C H; Li, H; Li, J; Li, L; Li, X; Li, Y; Gioi, L Li; Libby, J; Limosani, A; Liu, C; Liu, Y; Liu, Z Q; Liventsev, D; Loos, A; Louvot, R; Lubej, M; Lukin, P; Luo, T; MacNaughton, J; Masuda, M; Matsuda, T; Matvienko, D; Matyja, A; McOnie, S; Mikami, Y; Miyabayashi, K; Miyachi, Y; Miyake, H; Miyata, H; Miyazaki, Y; Mizuk, R; Mohanty, G B; Mohanty, S; Mohapatra, D; Moll, A; Moon, H K; Mori, T; Morii, T; Moser, H -G; Müller, T; Muramatsu, N; Mussa, R; Nagamine, T; Nagasaka, Y; Nakahama, Y; Nakamura, I; Nakamura, K R; Nakano, E; Nakano, H; Nakano, T; Nakao, M; Nakayama, H; Nakazawa, H; Nanut, T; Nath, K J; Natkaniec, Z; Nayak, M; Nedelkovska, E; Negishi, K; Neichi, K; Ng, C; Niebuhr, C; Niiyama, M; Nisar, N K; Nishida, S; Nishimura, K; Nitoh, O; Nozaki, T; Ogawa, A; Ogawa, S; Ohshima, T; Okuno, S; Olsen, S L; Ono, Y; Onuki, Y; Ostrowicz, W; Oswald, C; Ozaki, H; Pakhlov, P; Pakhlova, G; Pal, B; Palka, H; Panzenböck, E; Park, C -S; Park, C W; Park, H; Park, K S; Paul, S; Peak, L S; Pedlar, T K; Peng, T; Pesántez, L; Pestotnik, R; Peters, M; Petrič, M; Piilonen, L E; Poluektov, A; Prasanth, K; Prim, M; Prothmann, K; Pulvermacher, C; Purohit, M V; Rauch, J; Reisert, B; Ribežl, E; Ritter, M; Röhrken, M; Rorie, J; Rostomyan, A; Rozanska, M; Rummel, S; Ryu, S; Sahoo, H; Saito, T; Sakai, K; Sakai, Y; Sandilya, S; Santel, D; Santelj, L; Sanuki, T; Sasao, N; Sato, Y; Savinov, V; Schlüter, T; Schneider, O; Schnell, G; Schönmeier, P; Schram, M; Schwanda, C; Schwartz, A J; Schwenker, B; Seidl, R; Seino, Y; Semmler, D; Senyo, K; Seon, O; Seong, I S; Sevior, M E; Shang, L; Shapkin, M; Shebalin, V; Shen, C P; Shibata, T -A; Shibuya, H; Shinomiya, S; Shiu, J -G; Shwartz, B; Sibidanov, A; Simon, F; Singh, J B; Sinha, R; Smerkol, P; Sohn, Y -S; Sokolov, A; Soloviev, Y; Solovieva, E; Stanič, S; Starič, M; Steder, M; Strube, J F; Stypula, J; Sugihara, S; Sugiyama, A; Sumihama, M; Sumisawa, K; Sumiyoshi, T; Suzuki, K; Suzuki, K; Suzuki, S; Suzuki, S Y; Suzuki, Z; Takeichi, H; Takizawa, M; Tamponi, U; Tanaka, M; Tanaka, S; Tanida, K; Taniguchi, N; Taylor, G N; Tenchini, F; Teramoto, Y; Tikhomirov, I; Trabelsi, K; Trusov, V; Tse, Y F; Tsuboyama, T; Uchida, M; Uchida, T; Uehara, S; Ueno, K; Uglov, T; Unno, Y; Uno, S; Uozumi, S; Urquijo, P; Ushiroda, Y; Usov, Y; Vahsen, S E; Van Hulse, C; Vanhoefer, P; Varner, G; Varvell, K E; Vervink, K; Vinokurova, A; Vorobyev, V; Vossen, A; Wagner, M N; Waheed, E; Wang, C H; Wang, J; Wang, M -Z; Wang, P; Wang, X L; Watanabe, M; Watanabe, Y; Wedd, R; Wehle, S; White, E; Widmann, E; Wiechczynski, J; Williams, K M; Won, E; Yabsley, B D; Yamada, S; Yamamoto, H; Yamaoka, J; Yamashita, Y; Yamauchi, M; Yashchenko, S; Ye, H; Yelton, J; Yook, Y; Yuan, C Z; Yusa, Y; Zhang, C C; Zhang, L M; Zhang, Z P; Zhao, L; Zhilich, V; Zhukova, V; Zhulanov, V; Ziegler, M; Zivko, T; Zupanc, A; Zwahlen, N; Zyukova, O

    2016-01-01

    We report a study of radiative decays of \\chi_{bJ}(1P)(J=0,1,2) mesons into 74 hadronic final states comprising charged and neutral pions, kaons, protons; out of these, 41 modes are observed with at least 5 standard deviation significance. Our measurements not only improve the previous measurements by the CLEO Collaboration but also lead to first observations in many new modes. The large sample allows us to probe the total decay width of the \\chi_{b0}(1P). In the absence of a statistically significant result, a 90% confidence-level upper limit is set on the width at \\Gamma_{total}< 2.4 MeV. Our results are based on 24.7 fb^{-1} of e+e- collision data recorded by the Belle detector at the \\Upsilon(2S) resonance, corresponding to (157.8\\pm3.6)\\times10^6 \\Upsilon(2S) decays.

  5. Multi-Core Emptiness Checking of Timed Büchi Automata using Inclusion Abstraction

    DEFF Research Database (Denmark)

    Laarman, Alfons; Olesen, Mads Chr.; Dalsgaard, Andreas;

    2013-01-01

    the first parallel LTL model checking algorithm for timed automata. The algorithms are implemented in LTSmin, and experimental evaluations show the effectiveness and scalability of both contributions: subsumption halves the number of states in the real-world FDDI case study, and the multi......This paper contributes to the multi-core model checking of timed automata (TA) with respect to liveness properties, by investigating checking of TA Büchi emptiness under the very coarse inclusion abstraction or zone subsumption, an open problem in this field. We show that in general Büchi emptiness...... is not preserved under this abstraction, but some other structural properties are preserved. Based on those, we propose a variation of the classical nested depth-first search (NDFS) algorithm that exploits subsumption. In addition, we extend the multi-core cndfs algorithm with subsumption, providing...

  6. Evidence for $B^0 \\to \\chi_{c1} \\pi ^0$ at Belle

    CERN Document Server

    Kumar, R; Adachi, I; Aihara, H; Arinstein, K; Aushev, T; Aziz, T; Bakich, A M; Balagura, V; Bay, A; Bhardwaj, V; Bitenc, U; Bozek, A; Bracko, M; Browder, T E; Chen, A; Cheon, B G; Chistov, R; Cho, I S; Choi, Y; Dalseno, J; Dash, M; Drutskoy, A; Dungel, W; Eidelman, S; Gabyshev, N; Goldenzweig, P; Golob, B; Ha, H; Haba, J; Hayasaka, K; Hayashii, H; Hazumi, M; Horii, Y; Hoshi, Y; Hou, W S; Hsiung, Y B; Hyun, H J; Iijima, T; Inami, K; Ishikawa, A; Ishino, H; Itoh, R; Iwasaki, M; Kah, D H; Kang, J H; Katayama, N; Kawai, H; Kawasaki, T; Kichimi, H; Kim, S K; Kim, Y I; Kim, Y J; Kinoshita, K; Korpar, S; Krizan, P; Krokovny, P; Kuzmin, A; Kwon, Y J; Kyeong, S H; Lange, J S; Lee, J S; Lee, M J; Limosani, A; Lin, S W; Liventsev, D; Louvot, R; Mandl, F; Matyja, A; McOnie, S; Medvedeva, T; Miyabayashi, K; Miyake, H; Miyata, H; Miyazaki, Y; Mizuk, R; Mori, T; Nakamura, I; Nakano, E; Nakazawa, H; Nishida, S; Nitoh, O; Ogawa, S; Ohshima, T; Okuno, S; Ozaki, H; Pakhlov, P; Pakhlova, G; Park, C W; Park, H; Park, H K; Pestotnik, R; Piilonen, L E; Sahoo, H; Sakai, Y; Schneider, O; Sekiya, A; Senyo, K; Shapkin, M; Shiu, J G; Shwartz, B; Somov, A; Stanic, S; Staric, M; Sumiyoshi, T; Suzuki, S; Tanaka, M; Taylor, G N; Teramoto, Y; Trabelsi, K; Uehara, S; Unno, Y; Uno, S; Usov, Yu; Varner, G; Vervink, K; Wang, C C; Wang, C H; Wang, M Z; Wang, P; Watanabe, Y; Wedd, R; Won, E; Yamashita, Y; Zhang, C C; Zhang, Z P; Zhulanov, V; Zivko, T; Zupanc, A; Zyukova, O

    2008-01-01

    We present a measurement of the branching fraction for the Cabibbo- and color-suppressed $B^0 \\to \\chi_{c1}\\pi^0$ decay based on a data sample of $657\\times 10^6$ $B\\bar B$ events collected at the $\\Upsilon(4S)$ resonance with the Belle detector at the KEKB asymmetric-energy $e^+e^-$ collider. We observe a signal of $40\\pm9$ events with a significance of $4.7\\sigma$ including systematic uncertainties. The measured branching fraction is $\\mathcal {B}(B^0 \\to \\chi_{c1} \\pi^0) = (1.12\\pm 0.25(\\rm {stat.})\\pm 0.12({\\rm syst.}))\\times 10^{-5}$.

  7. Polynomial reduction and evaluation of tree- and loop-level CHY amplitudes

    CERN Document Server

    Zlotnikov, Michael

    2016-01-01

    We develop a polynomial reduction procedure that transforms any gauge fixed CHY amplitude integrand for $n$ scattering particles into a $\\sigma$-moduli multivariate polynomial of what we call the $\\textit{standard form}$. We show that a standard form polynomial must have a specific $\\textit{ladder type}$ monomial structure, which has finite size at any $n$, with highest multivariate degree given by $\\frac{(n-3)(n-4)}{2}$. This set of monomials spans a complete basis for polynomials with rational coefficients in kinematic data on the support of scattering equations. Subsequently, at tree and one-loop level, we employ the global residue theorem to derive a prescription that evaluates any CHY amplitude by means of collecting simple residues at infinity only. The prescription is then applied explicitly to some tree and one-loop amplitude examples.

  8. Design, Installation and Performance of the New insulator for NSTX CHI Experiments

    Energy Technology Data Exchange (ETDEWEB)

    Mueller, D; Chrzanowski, J; Gates, D; Menard, J; Raman, R; Jarboe, T R; Nelson, B A; Maqueda, R J; Schaffer, M J

    2008-03-05

    Coaxial Helicity Injection (CHI), a non-inductive method to initiate plasma and generate toroidal plasma current, is being investigated in the National Spherical Torus Experiment (NSTX). The center stack and outer vacuum vessel are separated by insulating gaps at the top and bottom of the slim central column so that a high voltage (up to 2 kV) can be applied between them from a pulsed power supply or a capacitor bank to initiate an arc discharge. In the presence of a suitable poloidal magnetic field, the discharge is initiated at the lower gap (the injector gap) and because of the strong toroidal field develops a helical structure resulting in substantial toroidal plasma current being driven. In NSTX, up to 390 kA of toroidal current has been generated for an injected current of 25 kA. The early investigations of CHI however frequently developed arcs across the insulator at the top of the machine (the absorber gap), which terminated the desired discharge. This arcing greatly restricted the operational space available for CHI studies. During 2002, the absorber region was modified to suppress these arcs. The new design includes a new ceramic insulator on the high field side of the absorber region with a much longer tracking distance between conducting elements at the different potentials. Furthermore, two new coils were installed near the absorber to provide the ability to minimize the poloidal field connecting the center stack and outer vacuum vessel. During the subsequent experimental campaign, CHI operation was less prone to arcing in the absorber and those arcs that did occur did not terminate the main discharge.)

  9. Knowledge Organization of Integrated Water Resources Management: A Case of Chi River Basin, Thailand

    OpenAIRE

    Nattapong Kaewboonma; Kulthida Tuamsuk; Wanida Kanarkard

    2013-01-01

    This study is a part of the research project on the Development of an Ontology-Based Semantic Search for Integrated Water Resources Management of the Chi River Basin (CRB), Thailand. The study aimed at developing the knowledge domain of water resources management for CRB. The research methods included document analysis and qualitative research by adopting Liou (1990)’s knowledge acquisition approach. Fifteen experts including ten experts in the areas of environmental engineerin...

  10. Tai Chi Chuan Optimizes the Functional Organization of the Intrinsic Human Brain Architecture in Older Adults

    OpenAIRE

    Jing Luo; Xi-Nian Zuo

    2014-01-01

    Whether Tai Chi Chuan (TCC) can influence the intrinsic functional architecture of the human brain remains unclear. To examine TCC-associated changes in functional connectomes, resting-state functional magnetic resonance images were acquired from 40 older individuals including 22 experienced TCC practitioners (experts) and 18 demographically matched TCC-naïve healthy controls, and their local functional homogeneities across the cortical mantle were compared. Compared to the controls, the TCC ...

  11. Tai Chi Chuan optimizes the functional organization of the intrinsic human brain architecture in older adults

    OpenAIRE

    Wei, Gao-Xia; Dong, Hao-Ming; Yang, Zhi; Luo, Jing; Zuo, Xi-Nian

    2014-01-01

    Whether Tai Chi Chuan (TCC) can influence the intrinsic functional architecture of the human brain remains unclear. To examine TCC-associated changes in functional connectomes, resting-state functional magnetic resonance images were acquired from 40 older individuals including 22 experienced TCC practitioners (experts) and 18 demographically matched TCC-naïve healthy controls, and their local functional homogeneities across the cortical mantle were compared. Compared to the controls, the TCC ...

  12. Formation of macrocyclic lactones in the Paternò–Büchi dimerization reaction

    OpenAIRE

    Manabu Abe; Yoshikazu Hiraga; Junya Arimura; Tsutomu Mizuta

    2011-01-01

    Furan-2-ylmethyl 2-oxoacetates 1a,b, in which the furan ring and the carbonyl moiety were embedded intramolecularly, were synthesized from commercially available furan-2-ylmethanol and their photochemical reaction (hν > 290 nm) was investigated. Twelve-membered macrocyclic lactones 2a,b with Ci symmetry including two oxetane-rings, which are the Paternò–Büchi dimerization products, were isolated in ca. 20% yield. The intramolecular cyclization products, such as 3-alkox...

  13. Implications of a $\\chi(3.86)$ State for Theoretical Models

    CERN Document Server

    Tuan, S F

    2000-01-01

    Recent preliminary evidence for a $D \\bar{D}$ state $\\chi(3.86)$ raises extremely interesting implications for theoretical models, particularly those currently in vogue, e.g. the flux tube model and a molecular charmonium picture. We examine the experimental consequences as well as the possible unveiling of a strata of C-exotic states in heavy quarkonia systems by future facilities like BES Upgrade/Tau-Charm Factory and CLEO III/B-Factories.

  14. The pragmatic import of pronominal usage in chiShona discourse

    OpenAIRE

    Pedzisai Mashiri; Sinfree Makoni

    2011-01-01

    This article discusses the pragmatic significance of chiShona pronouns by examining the use of different pronouns: personal, enumerative, and demonstrative, and by demonstrating their address and referential value and social meanings. Two important issues are addressed.  First, we demonstrate that a purely grammatical analysis of pronouns, which emphasise the internal analysis and the anaphoric function of pronouns, fails to capture the complexity of pronominal usage in ordinary conversations...

  15. Chi Square Feature Extraction Based Svms Arabic Language Text Categorization System

    OpenAIRE

    Abdelwadood M.A. MESLEH

    2007-01-01

    This paper aims to implement a Support Vector Machines (SVMs) based text classification system for Arabic language articles. This classifier uses CHI square method as a feature selection method in the pre-processing step of the Text Classification system design procedure. Comparing to other classification methods, our system shows a high classification effectiveness for Arabic data set in term of F-measure (F=88.11).

  16. The efficacy of Tai Chi Chuan in older adults: a systematic review

    OpenAIRE

    Verhagen, Arianne; Immink, M.; van der Meulen, A; Bierma-zeinstra, Sita

    2004-01-01

    textabstractOBJECTIVES: The purpose of this study was to assess the effect of Tai Chi Chuan (TCC) on fall prevention, balance and cardiorespiratory functions in the elderly. METHODS: A systematic review was carried out according to the Cochrane standards. A computerized literature search was carried out. Studies were selected when they had an experimental design; the age of the study population was >50; one of the interventions was a form of TCC; and when falls, balance or cardiorespiratory f...

  17. Increased first and second pulse harmonics in Tai Chi Chuan practitioners

    OpenAIRE

    Lu, Wan-An; Chen, Yung-Sheng; Kuo, Cheng-Deng

    2016-01-01

    Background Tai Chi Chuan (TCC) is known to be a good calisthenics for people. This study examined the relationship between pulse harmonics and autonomic nervous modulation in TCC practitioners. Methods Power spectral measures of right pulse wave and heart rate variability (HRV) measures were compared between TCC practitioners and control subjects. Correlation analyses between pulse harmonics and HRV measures were performed using linear regression analysis. Results At baseline, the total power...

  18. The rate of convergence of some asymptotically chi-square distributed statistics by Stein's method

    OpenAIRE

    Gaunt, Robert E.; Reinert, Gesine

    2016-01-01

    We build on recent works on Stein's method for functions of multivariate normal random variables to derive bounds for the rate of convergence of some asymptotically chi-square distributed statistics. We obtain some general bounds and establish some simple sufficient conditions for convergence rates of order $n^{-1}$ for smooth test functions. These general bounds are applied to Friedman's statistic for comparing $r$ treatments across $n$ trials and the family of power divergence statistics fo...

  19. Chi-Square Goodness-if-Fit Tests for Randomly Censored Data

    OpenAIRE

    Habib, M. G.; Thomas, D R

    1986-01-01

    Two Pearson-type goodness-of-fit test statistics for parametric families are considered for randomly right-censored data. Asymptotic distribution theory for the test statistics is based on the result that the product-limit process with MLE for nuisance parameters converges weakly to a Gaussian process. The Chernoff-Lehmann (1954) result extends to a generalized Pearson statistic. A modified Pearson statistic is shown to have a limiting chi-square null distribution.

  20. Evaluating the effects of Tai Chi on physical fitness and mental health of the elderly

    OpenAIRE

    Nguyen, Manh Hung

    2013-01-01

    The aims of this study are to examine the effects of 24-form Tai Chi exercise in six months on physical fitness, blood pressure and perceived health as well as sleep quality, visual attention, and balance ability of older people living in dwelling community. This study is also aimed to compare differences in physical fitness and subjectively rated health between German and Vietnamese older adults in terms cross-cultural study between Vietnamese and German samples. The subjects were divided...

  1. Changes in heart-rate variability of survivors of nasopharyngeal cancer during Tai Chi Qigong practice

    OpenAIRE

    Fong, Shirley S.M.; Wong, Janet Y. H.; Chung, Louisa M. Y.; Yam, Timothy T.T.; Chung, Joanne W. Y.; Lee, Y.M.; Chow, Lina P. Y.; Luk, W. S.; Ng, Shamay S.M.

    2015-01-01

    [Purpose] To explore the changes in heart-rate variability (HRV) of survivors of nasopharyngeal cancer (NPC) before, during, and after a Tai Chi (TC) Qigong exercise. [Subjects and Methods] Eleven survivors of NPC participated voluntarily in the study. The heart rate of each participant was measured continuously for 1 minute before the TC Qigong intervention, during the 5-minute TC Qigong intervention, and for 1 minute after the intervention, using a Polar heart-rate monitor. Spectral HRV was...

  2. Chi-square goodness of fit tests for weighted histograms. Review and improvements

    International Nuclear Information System (INIS)

    Weighted histograms are used for the estimation of probability density functions. Computer simulation is the main domain of application of this type of histogram. A review of chi-square goodness of fit tests for weighted histograms is presented in this paper. Improvements are proposed to these tests that have size more close to its nominal value. Numerical examples are presented in this paper for evaluation of tests and to demonstrate various applications of tests

  3. City Car = The City Car / Andres Sevtshuk

    Index Scriptorium Estoniae

    Sevtshuk, Andres, 1981-

    2008-01-01

    Massachusettsi Tehnoloogiainstituudi (MIT) meedialaboratooriumi juures tegutseva Targa Linna Grupi (Smart City Group) ja General Motorsi koostööna sündinud kaheistmelisest linnasõbralikust elektriautost City Car. Nimetatud töögrupi liikmed (juht William J. Mitchell, töögruppi kuulus A. Sevtshuk Eestist)

  4. Tai Chi Chuan for Cardiac Rehabilitation in Patients with Coronary Arterial Disease

    Directory of Open Access Journals (Sweden)

    Rosane Maria Nery

    2014-07-01

    Full Text Available Background: Several studies have shown that Tai Chi Chuan can improve cardiac function in patients with heart disease. Objective: To conduct a systematic review of the literature to assess the effects of Tai Chi Chuan on cardiac rehabilitation for patients with coronary artery disease. Methods: We performed a search for studies published in English, Portuguese and Spanish in the following databases: MEDLINE, EMBASE, LILACS and Cochrane Register of Controlled Trials. Data were extracted in a standardized manner by three independent investigators, who were responsible for assessing the methodological quality of the manuscripts. Results: The initial search found 201 studies that, after review of titles and abstracts, resulted in a selection of 12 manuscripts. They were fully analyzed and of these, nine were excluded. As a final result, three randomized controlled trials remained. The studies analyzed in this systematic review included patients with a confirmed diagnosis of coronary artery disease, all were clinically stable and able to exercise. The three experiments had a control group that practiced structured exercise training or received counseling for exercise. Follow-up ranged from 2 to 12 months. Conclusion: Preliminary evidence suggests that Tai Chi Chuan can be an unconventional form of cardiac rehabilitation, being an adjunctive therapy in the treatment of patients with stable coronary artery disease. However, the methodological quality of the included articles and the small sample sizes clearly indicate that new randomized controlled trials are needed in this regard.

  5. A proposal for a different chi-square function for Poisson distributions

    International Nuclear Information System (INIS)

    We obtain an approximate Gaussian distribution from a Poisson distribution after doing a change of variable. A new chi-square function is obtained which can be used for parameter estimations and goodness-of-fit testing when adjusting curves to histograms. Since, the new distribution is approximately Gaussian we can use it even when the bin contents are small. The corresponding chi-square function can be used for curve fitting. This chi-square function is simple to implement and presents a fast convergence of the parameters to the correct value, especially for the parameters associated with the width of the fitted curve. We present a Monte Carlo comparative study of the fitting method introduced here and two other methods for three types of curves: Gaussian, Breit-Wigner and Moyal, when each bin content obeys a Poisson distribution. It is also shown that the new method and the other two converge to the same result when the number of events increases

  6. Chi-square Fitting When Overall Normalization is a Fit Parameter

    CERN Document Server

    Roe, Byron

    2015-01-01

    The problem of fitting an event distribution when the total expected number of events is not fixed, keeps appearing in experimental studies. In a chi-square fit, if overall normalization is one of the parameters parameters to be fit, the fitted curve may be seriously low with respect to the data points, sometimes below all of them. This problem and the solution for it are well known within the statistics community, but, apparently, not well known among some of the physics community. The purpose of this note is didactic, to explain the cause of the problem and the easy and elegant solution. The solution is to use maximum likelihood instead of chi-square. The essential difference between the two approaches is that maximum likelihood uses the normalization of each term in the chi-square assuming it is a normal distribution, 1/sqrt(2 pi sigma-square). In addition, the normalization is applied to the theoretical expectation not to the data. In the present note we illustrate what goes wrong and how maximum likeliho...

  7. Bright Lights, Big Cities

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    Overabundant lighting has become another pollution source in the Chinese cities The glow of electric lights illuminating the nights of ever-brighter cities has been regarded as one of the signs of prosperity and modern civilization.

  8. A Crowded City

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    Over 4 million vehicles on road challenge Beijing’s city management Beijing, the city once known as the kingdom of bicycles, has become clogged with automobiles, the Beijing Municipal Government Publicity Office said on December 18.

  9. Globalization and cities

    OpenAIRE

    Petrović Mina

    2004-01-01

    This paper deals with the basic concepts on cities within contemporary globalisation. First, it briefly reviews the city perspective within the world system theory (concepts of over-urbanisation, under-urbanisation, and dependent urbanisation), new international division of labour, theory of the second circuit of capital and informational society. The second part of the paper is dedicated to the concepts of global and world cities and their implications for the cities in developed and develop...

  10. Cities as Spatial Clusters

    OpenAIRE

    Ferdinand Rauch

    2013-01-01

    This paper shows that Zipf's Law for cities can emerge as a property of a clustering process. If initially uniformly distributed people chose their location based on a specific gravity equation as found in trade studies, they will form cities that follow Zipf's Law in expected value. This view of cities as spatial agglomerations is supported empirically by the observation that larger cities are surrounded by larger hinterland areas and larger countryside populations.

  11. Non-inductive plasma start-up on NSTX and projections to NSTX-U using transient CHI

    International Nuclear Information System (INIS)

    Transient coaxial helicity injection (CHI) in the National Spherical Torus Experiment (NSTX) has generated toroidal current on closed-flux surfaces without the use of the central solenoid. When induction from the central solenoid was added, CHI initiated discharges in NSTX achieved 1 MA of plasma current using 65% of the solenoid flux of standard induction-only discharges. In addition, the CHI-initiated discharges have lower density and a low normalized internal plasma inductance of 0.35, as desired for achieving advanced scenarios. Transient CHI will be used for non-inductive plasma start-up on the upgrade to NSTX (NSTX-U) that is now under construction. It will have numerous improvements that significantly enhance CHI start-up capability. The TSC code is now starting to be used for full discharge simulation, which includes solenoid-less start-up with CHI and subsequent non-inductive current ramp-up using neutral beams. These results suggest that the increased injector flux capability of NSTX-U should allow CHI start-up at more than the 400 kA level and that the new tangential neutral beam system on NSTX-U should be able to ramp the current to the 1 MA levels. (paper)

  12. A small RNA controls expression of the chitinase ChiA in Listeria monocytogenes.

    Directory of Open Access Journals (Sweden)

    Jesper S Nielsen

    Full Text Available In recent years, more than 60 small RNAs (sRNAs have been identified in the gram-positive human pathogen Listeria monocytogenes, but their putative roles and mechanisms of action remain largely unknown. The sRNA LhrA was recently shown to be a post-transcriptional regulator of a single gene, lmo0850, which encodes a small protein of unknown function. LhrA controls the translation and degradation of the lmo0850 mRNA by an antisense mechanism, and it depends on the RNA chaperone Hfq for efficient binding to its target. In the present study, we sought to gain more insight into the functional role of LhrA in L. monocytogenes. To this end, we determined the effects of LhrA on global-wide gene expression. We observed that nearly 300 genes in L. monocytogenes are either positively or negatively affected by LhrA. Among these genes, we identified lmo0302 and chiA as direct targets of LhrA, thus establishing LhrA as a multiple target regulator. Lmo0302 encodes a hypothetical protein with no known function, whereas chiA encodes one of two chitinases present in L. monocytogenes. We show here that LhrA acts as a post-transcriptional regulator of lmo0302 and chiA by interfering with ribosome recruitment, and we provide evidence that both LhrA and Hfq act to down-regulate the expression of lmo0302 and chiA. Furthermore, in vitro binding experiments show that Hfq stimulates the base pairing of LhrA to chiA mRNA. Finally, we demonstrate that LhrA has a negative effect on the chitinolytic activity of L. monocytogenes. In marked contrast to this, we found that Hfq has a stimulating effect on the chitinolytic activity, suggesting that Hfq plays multiple roles in the complex regulatory pathways controlling the chitinases of L. monocytogenes.

  13. The Creative Cities Network

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    The Creative Cities Network, started by UNESCO in 2004, is one of the world’s highest-level non-governmental organizations in creative industry. The network focuses on the excellence of its member cities as its main product, and finds ways to maintain relevance in city life, local economy

  14. Imagineering the city

    NARCIS (Netherlands)

    M. van den Berg

    2015-01-01

    Cities today are products. The urban experience is commodified into marketable items by urban entrepreneurs. Urban administrations, city marketers, politicians, local businesses and other actors all over the world are developing entrepreneurial strategies to sell their city. From "‘I ♥ New York"’ to

  15. Validation of Chinese Version of Polycystic Ovary Syndrome Health-Related Quality of Life Questionnaire (Chi-PCOSQ.

    Directory of Open Access Journals (Sweden)

    Chung-Ying Lin

    Full Text Available To evaluate the responsiveness, longitudinal validity, and measurement invariance of the Chinese version of the Polycystic Ovary Syndrome Health-related Quality of Life Questionnaire (Chi-PCOSQ.This prospective study was conducted in a medical center in southern Taiwan. 102 women aged 18-45 years and diagnosed with PCOS were enrolled. Objective indicators for clinical changes of PCOS included assessing the 2-hour glucose and insulin levels before and after treatment. The responsiveness of Chi-PCOSQ and WHOQOL-BREF was analyzed using paired t-tests and the standard response mean. Confirmatory factor analysis was performed to assess the measurement invariance of Chi-PCOSQ.With improved 2-hour glucose and insulin levels, we also found significantly increased Chi-PCOSQ total and individual domain scores (total score: t (49 = 5.20; p < 0.001, domain scores: t (49 = 2.72 to 3.87; p < 0.01, except for hair growth. Half of the domains scores (3 of 6 and the total score of Chi-PCOSQ had a medium responsiveness, but WHOQOL-BREF was not sufficiently responsive to clinical changes of PCOS. Improved PCOS-specific health-related quality of life (HRQoL, as indicated by Chi-PCOSQ scores, was significantly associated with improved 2-hour glucose and insulin levels. All indices of the data-model fit of the Chi-PCOSQ structure were satisfactory, except for the slightly high standardized root mean square residual values (0.087 to 0.088. The measurement invariance of Chi-PCOSQ was supported across time.Chi-PCOSQ is sufficiently sensitive in detecting clinical changes and its measurement structure is suitable for Chinese women with PCOS. It is thus a promising tool for assessing the HRQoL of ethnic Chinese women with PCOS.

  16. $J-\\psi$ Production via $\\chi_c$ Decays in 920 GeV pA Interactions

    CERN Document Server

    Abt, I; Adams, M; Albrecht, H; Amaral, V S; Amorim, A; Aplin, S J; Arefev, A; Arino, I; Atiya, M; Aushev, V M; Bagaturia, Yu S; Baghshetsyan, R; Balagura, V; Bargiotti, M; Barsuk, S; Barsukova, O; Bassetti, V; Bastos, J; Bauer, C; Bauer, T S; Beck, M; Belkov, A A; Belotelov, I; Belyaev, I; Berkhan, K; Bertin, A; Bobchenko, B M; Böcker, M; Bogatyrev, A; Böhm, G; Borgmeier, C; Brauer, M; Broemmelsiek, D R; Bruinsma, M; Bruschi, M; Buchholz, P; Büchler, M C; Buran, T; Capéans-Garrido, M; Capponi, M; Carvalho, J; Chamanina, J; Chen, B X; Chistov, R; Chmeissani, M; Christensen, A; Conde, P; Cruse, C; Dam, M; Danielsen, K M; Danilov, M; De Castro, S; Deckers, H; Dehmelt, K; Deppe, H; Dolgoshein, B A; Dong, X; Dreis, H B; Dressel, M; Dujmic, D; Eckmann, R; Egorytchev, V; Ehret, K; Eiges, V; Eisele, Franz; Emeliyanov, D; Erhan, S; Essenov, S; Fabbri, Franco Luigi; Faccioli, P; Fallot-Burghardt, W; Feuerstack-Raible, M; Flammer, J; Fleckenstein, H; Fominykh, B A; Fourletov, S; Fuljahn, T; Funcke, M; Galli, D; García, A; Garrido, L; Gascón, D; Gellrich, A; Gerndt, K E K; Giacobbe, B; Glass, J; Glebe, T; Goloubkov, D; Golutvin, A; Golutvin, I A; Gorbunov, I V; Gorisek, A; Gouchtchine, O; Goulart, D C; Gradl, S; Gradl, W; Guilitsky, Yu; Hamacher, T; Hansen, J D; Harr, R; Hast, C; Hausmann, S A; Hernández, J M; Hildebrandt, M; Hölscher, A; Höpfner, K; Hofmann, W; Hohlmann, M; Hott, T; Hulsbergen, W D; Husemann, U; Igonkina, O; Ispirian, M K; Issever, I; Itterbeck, H; Ivarsson, J; Jagla, T; Jia, Y; Jiang, C; Kaoukher, A; Kapitza, H; Karabekyan, S; Karchin, P; Karpenko, N; Ke, Z; Keller, S; Khasanov, F M; Kim, H; Kiryushin, Yu T; Kisel, I V; Klefenz, F; Knöpfle, K T; Kochetkov, V; Kolanoski, H; Korpar, S; Krauss, C; Kreuzer, P K; Krizan, P; Krücker, D; Kvaratskheliia, T; Lange, A; Lanyov, A V; Lau, K; Leffers, G; Legrand, I; Lewendel, B; Liu Ya Qian; Lohse, T; Loke, R; Lomonosov, B N; Lüdemann, J; Männer, R; Mankel, R; Marconi, U; Masciocchi, S; Massa, I; Matchikhilian, I; Medin, G; Medinnis, M; Mevius, M; Michetti, A; Mikhailov, Yu; Miquel, R; Mizuk, R; Mohapatra, A; Moshkin, A; Moshous, B; Muresan, R; Nam, S; Negodaev, M A; Negri, I; Nörenberg, M; Nowak, S; Núñez-Pardo de Vera, M T; Oest, T; Oliveira, A; Ouchrif, M; Ould-Saada, F; Padilla, C; Pakhlov, P; Pavlenko, Yu N; Peralta, D; Pernack, R; Perschke, T; Pestotnik, R; Petersen, B AA; Piccinini, M; Pleier, M A; Poli, M; Popov, V; Pose, A V; Pose, D; Pugatch, V; Pylypchenko, Y; Pyrlik, J; Ramachandran, S; Ratnikov, F; Reeves, K; Ressing, D; Riechmann, K; Rieling, J; Rietz, M; Riu, I; Robmann, P; Rosen, J; Rothe, C; Rückstuhl, W; Rusinov, V Yu; Rybnikov, V; Ryzhikov, D; Saadi-Ludemann, F; Samtleben, D; Sánchez, F; Sang, M; Saveliev, V; Sbrizzi, A; Schaller, S C; Schlein, Peter E; Schmelling, M; Schmidt, B; Schmidt, S; Schmidt-Parzefall, W; Schreiner, A T; Schröder, H; Schultz, H D; Schwanke, U; Schwartz, A J; Schwarz, A S; Schwenninger, B; Schwingenheuer, B; Schwitters, Roy F; Sciacca, F; Semenov, S; Semprini-Cesari, N; Sexauer, E; Seybold, L; Shiu, J; Shuvalov, S M; Siccama, I; Skrk, D; Sozuer, L; Soldatov, A; Solunin, S A; Somov, A; Somov, S V; Souvorov, V; Spahn, M; Spengler, J; Spighi, R; Spiridonov, A A; Spratte, S; Stanovnik, A; Staric, M; Saint-Denis, R; Stegmann, C; Steinbeck, S; Steinkamp, O; Stieler, D; Straumann, U; Sun, F; Sun, H; Symalla, M; Takach, S F; Tesch, N; Thurn, H; Tikhomirov, I; Titov, M L; Trunk, U; Truöl, P; Tsakov, I; Uwer, U; Vagnoni, V M; Van Eldik, C; Van Staa, R; Vasilev, Yu; Villa, M; Vitale, A; Vukotic, I; Wagner, G; Wagner, W; Wahlberg, H; Walenta, Albert H; Walter, M; Walter, T; Wang, J J; Wang, Y M; Wanke, R; Wegener, D; Werthenbach, U; Weyers, P J; Wolters, H; Wurth, R; Würtz, A; Xella, S M; Yang, J; Zaitsev, Yu; Zavertyaev, M V; Zech, G; Zeuner, T; Zhelezov, A; Zheng, Z; Zhu, Z; Zimmermann, R; Zivko, T; Zoccoli, A; Zweizig, J

    2003-01-01

    Using data collected by the HERA-B experiment, we have measured the fraction of J\\psi's produced via radiative chi_c decays in interactions of 920 GeV protons with carbon and titanium targets. We obtained R_{\\chi_c} = 0.32 \\pm 0.06_{stat} \\pm 0.04_{sys} for the fraction of J\\psi from chi_c decays averaged over proton-carbon and proton-titanium collisions. This result is in agreement with previous measurements and is compared with theoretical predictions.

  17. Categorization of Mechanics Problems by Students in Large Introductory Physics Courses: A Comparison with the Chi, Feltovich, and Glaser Study

    CERN Document Server

    Mason, Andrew

    2016-01-01

    With inspiration from the classic study by Chi, Feltovich, and Glaser [1], we asked introductory physics students in three introductory physics classes to categorize mechanics problems based upon similarity of solutions. To evaluate the effect of problem context on students' ability to categorize, two sets of problems were developed for categorization. Some problems in one of the problem sets that students were asked to categorize included those available from the prior study by Chi et al. Our findings, which contrast from those of Chi et al., suggest that there is a much wider distribution of expertise among introductory students.

  18. The Influence of Tai Chi Exercise on Proprioception in Patients with Knee Osteoarthritis: Results from a Pilot Randomized Controlled Trial

    OpenAIRE

    Schmid, Anna; McAlindon, Timothy; Schmid, Christopher H.; Wang, Chenchen

    2013-01-01

    Purpose: Previous long-term observational studies found that Tai Chi practitioners had better knee- joint proprioceptive acuity versus controls in an older population. We evaluated the effects of Tai Chi for knee- joint proprioception in knee osteoarthritis (OA) in a randomized controlled trial. Methods: We randomized 40 eligible individuals (age > 55, BMI ≤ 40 kg/m2 with knee pain on most days of the previous month and tibiofemoral OA (K/L grade ≥2) to Tai Chi (10 modified forms from clas...

  19. Proposed Training Plan to Improve Building Energy Efficiency in Vietnam

    Energy Technology Data Exchange (ETDEWEB)

    Yu, Sha; Evans, Meredydd

    2013-01-01

    Vietnam has experienced fast growth in energy consumption in the past decade, with annual growth rate of over 12 percent. This is accompanied by the fast increase in commercial energy use, driven by rapid industrialization, expansion of motorized transport, and increasing energy use in residential and commercial buildings. Meanwhile, Vietnam is experiencing rapid urbanization at a rate of 3.4 percent per year; and the majority of the growth centered in and near major cities such as Hanoi and Ho Chi Minh City. This has resulted in a construction boom in Vietnam.

  20. Cities as development drivers

    DEFF Research Database (Denmark)

    Johnson, Bjørn; Poulsen, Tjalfe; Hansen, Jens Aage;

    2011-01-01

    There is a strong connection between economic growth and development of cities. Economic growth tends to stimulate city growth, and city economies have often shaped innovative environments that in turn support economic growth. Simultaneously, social and environmental problems related to city growth...... can be serious threats to the realization of the socio-economic contributions that cities can make. However, as a result of considerable diversity of competences combined with interactive learning and innovation, cities may also solve these problems. The ‘urban order’ may form a platform for...... innovative problem solving and potential spill-over effects, which may stimulate further economic growth and development. This paper discusses how waste problems of cities can be transformed to become part of new, more sustainable solutions. Two cases are explored: Aalborg in Denmark and Malmö in Sweden. It...

  1. Me, the City

    Directory of Open Access Journals (Sweden)

    Konstantin Lidin

    2014-09-01

    Full Text Available The search for identity of cities looks rather urgent and attracts attention of many researchers. Addressing this issue, the article draws an analogy between a human person and a city. Like a city, a human being needs to comprehend his self-identity in order to resist depressive tendencies. It is shown that a person’s depressive symptoms are similar to those of cities. The city identity necessary to resist depression can be searched for both historically and geographically. The historical aspect consists of local myths and legends about the city and the citizens. The geographical aspect of identity comprises features of the terrain, climate, flora and fauna of the region where the city is located.

  2. Search for the Z_1(4050)^+ and Z_2(4250)^+ States in bar B^0 to chi_{c1} K^- pi^+ and B^+ to chi_{c1} K^0_S pi^+

    Energy Technology Data Exchange (ETDEWEB)

    Lees, J.P.; Poireau, V.; Tisserand, V.; /Annecy, LAPP; Garra Tico, J.; Grauges, E.; /Barcelona U., ECM; Martinelli, M.; /INFN, Bari /Bari U.; Milanes, D.A.; /INFN, Bari; Palano, A.; Pappagallo, M.; /INFN, Bari /Bari U.; Eigen, G.; Stugu, B.; /Bergen U.; Brown, D.N.; Kerth, L.T.; Kolomensky, Yu.G.; Lynch, G.; /UC, Berkeley; Koch, H.; Schroeder, T.; /Ruhr U., Bochum; Asgeirsson, D.J.; Hearty, C.; Mattison, T.S.; McKenna, J.A.; /British Columbia U. /Brunel U. /Novosibirsk, IYF /UC, Irvine /UC, Riverside /UC, Santa Barbara /UC, Santa Cruz /Caltech /Cincinnati U. /Colorado U. /Colorado State U. /Dortmund U. /Dresden, Tech. U. /Ecole Polytechnique /Edinburgh U. /INFN, Ferrara /Ferrara U. /INFN, Ferrara /Ferrara U. /INFN, Ferrara /Frascati /INFN, Genoa /Genoa U. /INFN, Genoa /INFN, Genoa /Genoa U. /INFN, Genoa /Indian Inst. Tech., Guwahati /Harvard U. /Harvey Mudd Coll. /Heidelberg U. /Humboldt U., Berlin /Imperial Coll., London /Iowa State U. /Iowa State U. /Johns Hopkins U. /Paris U., VI-VII /LLNL, Livermore /Liverpool U. /Queen Mary, U. of London /Royal Holloway, U. of London /Royal Holloway, U. of London /Louisville U. /Mainz U., Inst. Kernphys. /Manchester U. /Maryland U. /Massachusetts U., Amherst /MIT /McGill U. /INFN, Milan /Milan U. /Mississippi U. /Montreal U. /INFN, Naples /Naples U. /NIKHEF, Amsterdam /NIKHEF, Amsterdam /Notre Dame U. /Ohio State U. /Oregon U. /INFN, Padua /Padua U. /INFN, Padua /INFN, Padua /Padua U. /Paris U., VI-VII /INFN, Perugia /Perugia U. /INFN, Pisa /Pisa U. /INFN, Pisa /Pisa, Scuola Normale Superiore /INFN, Pisa /Pisa U. /INFN, Pisa /INFN, Pisa /Pisa U. /INFN, Pisa /Princeton U. /INFN, Rome /INFN, Rome /Rome U. /INFN, Rome /INFN, Rome /Rome U. /INFN, Rome /Rostock U. /Rutherford /DAPNIA, Saclay /SLAC /South Carolina U. /Southern Methodist U. /Stanford U., Phys. Dept. /SUNY, Albany /Tel Aviv U. /Tennessee U. /Texas Nuclear Corp., Austin /Texas U., Dallas /INFN, Turin /Turin U. /INFN, Trieste /Trieste U. /Valencia U. /Victoria U. /Warwick U. /Wisconsin U., Madison

    2012-04-10

    We search for the Z{sub 1}(4050){sup +} and Z{sub 2}(4250){sup +} states, reported by the Belle Collaboration, decaying to {chi}{sub c1}{pi}{sup +} in the decays {bar B}{sup 0} {yields} {chi}{sub c1}K{sup -}{pi}{sup +} and B{sup +} {yields} {chi}{sub c1}K{sub S}{sup 0}{pi}{sup +} where {chi}{sub c1} {yields} J/{psi}{gamma}. The data were collected with the BABAR detector at the SLAC PEP-II asymmetric-energy e{sup +}e{sup -} collider operating at center-of-mass energy 10.58 GeV, and correspond to an integrated luminosity of 429 fb{sup -1}. In this analysis, we model the background-subtracted, efficiency-corrected {chi}{sub c1}{pi}{sup +} mass distribution using the K{pi} mass distribution and the corresponding normalized K{pi} Legendre polynomial moments, and then test the need for the inclusion of resonant structures in the description of the {chi}{sub c1}{pi}{sup +} mass distribution. No evidence is found for the Z{sub 1}(4050){sup +} and Z{sub 2}(4250){sup +} resonances, and 90% confidence level upper limits on the branching fractions are reported for the corresponding B-meson decay modes.

  3. Consumer Health Informatics in the Context of Engaged Citizens and eHealth Services - A New CHI Meta Model.

    Science.gov (United States)

    Wiesner, Martin; Griebel, Lena; Becker, Kurt; Pobiruchin, Monika

    2016-01-01

    Consumer Health Informatics (CHI) is a relatively new and interdisciplinary field in Medical Informatics. It focuses on consumer- rather than professional-centered services. However, the definitions and understanding of a) what is a "consumer"? or b) what is health technology in the context of CHI? and c) what factors and actors influence the usage of eHealth services? vary widely. The CHI special interest group (SIG) - associated with the German Association for Medical Informatics, Biometry and Epidemiology - conducted two workshops in 2015 to improve the common understanding on these topics. The workshop outcomes, the derived CHI-specific meta model and examples how to apply this model are presented in this paper. The model supports the definition of multi-actor contexts, as it not solely reflects the conventional patient-physician relationship but also allows for the description of second health market providers. PMID:27332268

  4. Exact Chi-Square and Fisher's Exact Probability Test for 3 by 2 Cross-Classification Tables.

    Science.gov (United States)

    Berry, Kenneth J.; Mielke, Paul W., Jr.

    1987-01-01

    Subroutines to calculate exact chi square and Fisher's exact probability tests are presented for 3 by 2 cross-classification tables. A nondirectional probability value for each test is computed recursively. (Author/GDC)

  5. Ly6Chi Monocytes Provide a Link between Antibiotic-Induced Changes in Gut Microbiota and Adult Hippocampal Neurogenesis

    Directory of Open Access Journals (Sweden)

    Luisa Möhle

    2016-05-01

    Full Text Available Antibiotics, though remarkably useful, can also cause certain adverse effects. We detected that treatment of adult mice with antibiotics decreases hippocampal neurogenesis and memory retention. Reconstitution with normal gut flora (SPF did not completely reverse the deficits in neurogenesis unless the mice also had access to a running wheel or received probiotics. In parallel to an increase in neurogenesis and memory retention, both SPF-reconstituted mice that ran and mice supplemented with probiotics exhibited higher numbers of Ly6Chi monocytes in the brain than antibiotic-treated mice. Elimination of Ly6Chi monocytes by antibody depletion or the use of knockout mice resulted in decreased neurogenesis, whereas adoptive transfer of Ly6Chi monocytes rescued neurogenesis after antibiotic treatment. We propose that the rescue of neurogenesis and behavior deficits in antibiotic-treated mice by exercise and probiotics is partially mediated by Ly6Chi monocytes.

  6. LUX Constraints on Magnetic Dark Matter in the $S\\bar{E} \\chi$y Model with(out) Naturality

    CERN Document Server

    Frandsen, Mads T; Shoemaker, Ian M; Svendsen, Ole

    2013-01-01

    We study phenomenological constraints in a simple $S\\bar{E} \\chi$y extension of the Standard Model (SM) with a 125 GeV Higgs, a vector-like heavy electron $(E)$, a complex scalar electron $(S)$ and a standard model singlet Dirac fermion $(\\chi)$. The interactions among the dark matter candidate $\\chi$ and the standard model particles occur via loop-induced processes involving the Yukawa interaction $S\\bar{E} \\chi$y. The model is an explicit perturbative realization of so-called magnetic dark matter. The field content allows for a cancelation of quadratic divergences in the scalar masses at one-loop, a phenomenon which we refer to as perturbative naturality. The basic model is constrained dominantly by direct detection experiments and its parameter space can be nearly entirely covered by up-coming ton-scale direct detection experiments. We conclude this work by discussing different variations of the model.

  7. Biophilic Cities Are Sustainable, Resilient Cities

    Directory of Open Access Journals (Sweden)

    Peter Newman

    2013-08-01

    Full Text Available There is a growing recognition of the need for daily contact with nature, to live happy, productive, meaningful lives. Recent attention to biophilic design among architects and designers acknowledges this power of nature. However, in an increasingly urban planet, more attention needs to be aimed at the urban scales, at planning for and moving towards what the authors call “biophilic cities”. Biophilic cities are cities that provide close and daily contact with nature, nearby nature, but also seek to foster an awareness of and caring for this nature. Biophilic cities, it is argued here, are also sustainable and resilient cities. Achieving the conditions of a biophilic city will go far in helping to foster social and landscape resilience, in the face of climate change, natural disasters and economic uncertainty and various other shocks that cities will face in the future. The paper identifies key pathways by which biophilic urbanism enhances resilience, and while some are well-established relationships, others are more tentative and suggest future research and testing.

  8. Specific depletion of Ly6C(hi inflammatory monocytes prevents immunopathology in experimental cerebral malaria.

    Directory of Open Access Journals (Sweden)

    Beatrix Schumak

    Full Text Available Plasmodium berghei ANKA (PbA infection of C57BL/6 mice leads to experimental cerebral malaria (ECM that is commonly associated with serious T cell mediated damage. In other parasitic infection models, inflammatory monocytes have been shown to regulate Th1 responses but their role in ECM remains poorly defined, whereas neutrophils are reported to contribute to ECM immune pathology. Making use of the recent development of specific monoclonal antibodies (mAb, we depleted in vivo Ly6C(hi inflammatory monocytes (by anti-CCR2, Ly6G+ neutrophils (by anti-Ly6G or both cell types (by anti-Gr1 during infection with Ovalbumin-transgenic PbA parasites (PbTg. Notably, the application of anti-Gr1 or anti-CCR2 but not anti-Ly6G antibodies into PbTg-infected mice prevented ECM development. In addition, depletion of Ly6C(hi inflammatory monocytes but not neutrophils led to decreased IFNγ levels and IFNγ+CD8+ T effector cells in the brain. Importantly, anti-CCR2 mAb injection did not prevent the generation of PbTg-specific T cell responses in the periphery, whereas anti-Gr1 mAb injection strongly diminished T cell frequencies and CTL responses. In conclusion, the specific depletion of Ly6C(hi inflammatory monocytes attenuated brain inflammation and immune cell recruitment to the CNS, which prevented ECM following Plasmodium infection, pointing out a substantial role of Ly6C+ monocytes in ECM inflammatory processes.

  9. Chinese-chi and Kundalini yoga Meditations Effects on the Autonomic Nervous System: Comparative Study

    Directory of Open Access Journals (Sweden)

    Anilesh Dey

    2016-06-01

    Full Text Available Cardiac disease is one of the major causes for death all over the world. Heart rate variability (HRV is a significant parameter that used in assessing Autonomous Nervous System (ANS activity. Generally, the 2D Poincare′ plot and 3D Poincaré plot of the HRV signals reflect the effect of different external stimuli on the ANS. Meditation is one of such external stimulus, which has different techniques with different types of effects on the ANS. Chinese Chi-meditation and Kundalini yoga are two different effective meditation techniques. The current work is interested with the analysis of the HRV signals under the effect of these two based on meditation techniques. The 2D and 3D Poincare′ plots are generally plotted by fitting respectively an ellipse/ellipsoid to the dense region of the constructed Poincare′ plot of HRV signals. However, the 2D and 3D Poincaré plots sometimes fail to describe the proper behaviour of the system. Thus in this study, a three-dimensional frequency-delay plot is proposed to properly distinguish these two famous meditation techniques by analyzing their effects on ANS. This proposed 3D frequency-delay plot is applied on HRV signals of eight persons practicing same Chi-meditation and four other persons practising same Kundalini yoga. To substantiate the result for larger sample of data, statistical Student t-test is applied, which shows a satisfactory result in this context. The experimental results established that the Chi-meditation has large impact on the HRVcompared to the Kundalini yoga.

  10. The effects of Tai-Chi-Soft-Ball training on physical functional health of Chinese older adult

    OpenAIRE

    Lam, Michael Huen Sum; Cheung, Siu Yin; Chow, Bik Chu

    2011-01-01

    This study was designed to investigate a 10-week training effects of Tai-Chi-Soft-Ball (TCSB), a novel Chinese exercise which combined the elements of Tai Chi and badminton, on physical functional health of private institutionalized older adults. Thirty-four participants were recruited in the training group with 60 minutes per session and two sessions per week TCSB training. Thirty-two participants were recruited simultaneously in the control group (no training). The measurements included the...

  11. Analysis of static and dynamic balance in healthy elderly practitioners of Tai Chi Chuan versus ballroom dancing

    Directory of Open Access Journals (Sweden)

    Miguel Antônio Rahal

    2015-03-01

    Full Text Available OBJECTIVE: To determine whether Tai Chi Chuan or ballroom dancing promotes better performance with respect to postural balance, gait, and postural transfer among elderly people. METHODS: We evaluated 76 elderly individuals who were divided into two groups: the Tai Chi Chuan Group and the Dance Group. The subjects were tested using the NeuroCom Balance Master¯ force platform system with the following protocols: static balance tests (the Modified Clinical Tests of Sensory Interaction on Balance and Unilateral Stance and dynamic balance tests (the Walk Across Test and Sit-to-stand Transfer Test. RESULTS: In the Modified Clinical Test of Sensory Interaction on Balance, the Tai Chi Chuan Group presented a lower sway velocity on a firm surface with open and closed eyes, as well as on a foam surface with closed eyes. In the Modified Clinical Test of Sensory Interaction on Unilateral Stance, the Tai Chi Chuan Group presented a lower sway velocity with open eyes, whereas the Dance Group presented a lower sway velocity with closed eyes. In the Walk Across Test, the Tai Chi Chuan Group presented faster walking speeds than those of the Dance Group. In the Sit-to-stand Transfer Test, the Tai Chi Chuan Group presented shorter transfer times from the sitting to the standing position, with less sway in the final standing position. CONCLUSION: The elderly individuals who practiced Tai Chi Chuan had better bilateral balance with eyes open on both types of surfaces compared with the Dance Group. The Dance Group had better unilateral postural balance with eyes closed. The Tai Chi Chuan Group had faster walking speeds, shorter transfer times, and better postural balance in the final standing position during the Sit-to-stand Test.

  12. A Study on the Biodiversity of Natural Food Production to Support Community Upstream of Chi Basin, Thailand

    OpenAIRE

    Pramuk Srichaiwong; Luckhana Kwewjai; Patarapong Kroeksakul

    2013-01-01

    This biodiversity study of natural food production to supporting the communities upstream of Chi River Basin aims at collecting the name and species of natural food plants in the forest around the upstream areas of Chi River Basin. This is a phenomenal study of species and potential benefits of forest food. Qualitative methodology was mainly used to collect data; the study relied on the knowledge of the local people had to recall the local data, which significantly focused on the species of n...

  13. Validation of Chinese Version of Polycystic Ovary Syndrome Health-Related Quality of Life Questionnaire (Chi-PCOSQ)

    Science.gov (United States)

    Lin, Chung-Ying; Ou, Huang-tz; Wu, Meng-Hsing; Chen, Pei-Chi

    2016-01-01

    Objectives To evaluate the responsiveness, longitudinal validity, and measurement invariance of the Chinese version of the Polycystic Ovary Syndrome Health-related Quality of Life Questionnaire (Chi-PCOSQ). Research Design and Method This prospective study was conducted in a medical center in southern Taiwan. 102 women aged 18–45 years and diagnosed with PCOS were enrolled. Objective indicators for clinical changes of PCOS included assessing the 2-hour glucose and insulin levels before and after treatment. The responsiveness of Chi-PCOSQ and WHOQOL-BREF was analyzed using paired t-tests and the standard response mean. Confirmatory factor analysis was performed to assess the measurement invariance of Chi-PCOSQ. Results With improved 2-hour glucose and insulin levels, we also found significantly increased Chi-PCOSQ total and individual domain scores (total score: t (49) = 5.20; p PCOS. Improved PCOS-specific health-related quality of life (HRQoL), as indicated by Chi-PCOSQ scores, was significantly associated with improved 2-hour glucose and insulin levels. All indices of the data-model fit of the Chi-PCOSQ structure were satisfactory, except for the slightly high standardized root mean square residual values (0.087 to 0.088). The measurement invariance of Chi-PCOSQ was supported across time. Conclusion Chi-PCOSQ is sufficiently sensitive in detecting clinical changes and its measurement structure is suitable for Chinese women with PCOS. It is thus a promising tool for assessing the HRQoL of ethnic Chinese women with PCOS. PMID:27124836

  14. To explore the prevention and treatment of Tai Chi Chuan Exercise on hypertension based on the theory of chaos

    Directory of Open Access Journals (Sweden)

    Xiang-Lin CHI

    2014-10-01

    Full Text Available In this paper,review and analysis of  the fluctuations of blood pressure and pathogenesis of hypertension were presented a review and analysed based on chaos theory. At the same time, we interpreted philosophically the special concept of Tai Chi Chuan Exercise. Furthermore, the possible mechanisms of prevention and treatment of Tai Chi Chuan on hypertension was reviewed on the basis of clinical research literature.

  15. Reconstructing Chi-squared Intra-table Distances in the Analysis of a Set of Contingency Tables

    OpenAIRE

    Zárraga Castro, María Amaya; Goitisolo Lezama, Beatriz

    2007-01-01

    To study similarities among the set of rows -and columns- of a contingency table, Correspondence Analysis uses chi-squared distances between row profiles -and column profiles- of that table. This article presents a factor analysis for the study of a set of contingency tables in which, unlike more classical methods such as the analysis of juxtaposition and Intra Analysis; the existing relationships within each table -defined across the chi-squared distances-, are not altered.

  16. Dental Caries Status and Oral Hygiene Practices of Lock Factory Workers in Aligarh City

    OpenAIRE

    Singh, Mala; Ingle, Navin Anand; Kaur, Navpreet; Yadav, Pramod; Ingle, Ekta; Charania, Zohara

    2015-01-01

    Background: The aim was to evaluate the oral hygiene practices and dental caries status of lock factory workers in Aligarh city. Materials and Methods: WHO Oral Health Assessment form (2013) was used to collect data from each subject. A total of 850 subjects constituted the final sample size. Information was obtained regarding the oral hygiene practices and clinical examinations were conducted. Descriptive analysis was done and the data were analyzed using Chi-square test. Results: The preval...

  17. Pollution and city size: can cities be too small?

    OpenAIRE

    Borck, Rainald; TABUCHI Takatoshi

    2015-01-01

    We study the optimal and equilibrium size of cities in a monocentric city model with environmental pollution. Pollution is related to city size through the effect of population on production, commuting, and housing consumption. If pollution is local, we find that equilibrium cities are too large, mirroring standard results in the theory of city systems. When pollution is global and per capita pollution declines with city size, however, equilibrium cities may be too small.

  18. Healing and the mind/body arts: massage, acupuncture, yoga, t'ai chi, and Feldenkrais.

    Science.gov (United States)

    Wanning, T

    1993-07-01

    1. The health practitioner may encounter clients who are faced with problems that do not seem to respond to traditional health care. 2. One way that some choose to confront these systemic complaints is to employ some of the health traditions of other cultures and to view the body and mind as a balanced whole. 3. Massage, acupuncture and acupressure, t'ai chi, and Feldenkrais focus on the mind/body connection to facilitate healing through relaxation, pressure points, and movement. PMID:8338610

  19. Relations for Einstein-Yang-Mills amplitudes from the CHY representation

    CERN Document Server

    de la Cruz, Leonardo; Weinzierl, Stefan

    2016-01-01

    We show that a recently discovered relation, which expresses tree-level single trace Einstein-Yang-Mills amplitudes with one graviton and $(n-1)$ gauge bosons as a linear combination of pure Yang-Mills tree amplitudes with $n$ gauge bosons, can be derived from the CHY representation. In addition we show that there is a generalisation, which expresses tree-level single trace Einstein-Yang-Mills amplitudes with $r$ gravitons and $(n-r)$ gauge bosons as a linear combination of pure Yang-Mills tree amplitudes with $n$ gauge bosons. We present a general formula for this case.

  20. Production of chi mesons in 225 GeV/c π-Be interactions

    International Nuclear Information System (INIS)

    Gamma rays associated with psi mesons have been studied in 225 GeV/c π-Be interactions. The psi-γ mass spectrum shows an excess of 47 +- 11 events above background centered at 3.531 GeV/c2 with an rms width of 22.4 MeV. Attributing this excess of events to the decay chi → psi γ implies that 38 +- 9 % of all psi mesons are produced by this mechanism. The experimental setup and results are detailed

  1. The Role of M\\"obius Constants and Scattering Functions in CHY Scalar Amplitudes

    OpenAIRE

    Lam, C. S.; Yao, York-Peng

    2015-01-01

    The integrations leading to the Cachazo-He-Yuan (CHY) double-color $n$-point massless scalar amplitude are carried out one integral at a time. M\\"obius invariance dictates the final amplitude to be independent of the three M\\"obius constants $\\sigma_r, \\sigma_s, \\sigma_t$, but their choice affects integrations and the intermediate results. The effect of the M\\"obius constants, the two colors, and the scattering functions on each integration is investigated. A systematic way to carry out the $...

  2. Complementary and alternative treatment for neck pain: chiropractic, acupuncture, TENS, massage, yoga, Tai Chi, and Feldenkrais.

    Science.gov (United States)

    Plastaras, Christopher T; Schran, Seth; Kim, Natasha; Sorosky, Susan; Darr, Deborah; Chen, Mary Susan; Lansky, Rebecca

    2011-08-01

    Of the multitude of treatment options for the management of neck pain, no obvious single treatment modality has been shown to be most efficacious. As such, the clinician should consider alternative treatment modalities if a modality is engaging, available, financially feasible, potentially efficacious, and is low risk for the patient. As evidence-based medicine for neck pain develops, the clinician is faced with the challenge of which treatments to encourage patients to pursue. Treatment modalities explored in this article, including chiropractic, acupuncture, TENS, massage, yoga, Tai Chi, and Feldenkrais, represent reasonable complementary and alternative medicine methods for patients with neck pain. PMID:21824591

  3. Formation of macrocyclic lactones in the Paternò–Büchi dimerization reaction

    Directory of Open Access Journals (Sweden)

    Manabu Abe

    2011-02-01

    Full Text Available Furan-2-ylmethyl 2-oxoacetates 1a,b, in which the furan ring and the carbonyl moiety were embedded intramolecularly, were synthesized from commercially available furan-2-ylmethanol and their photochemical reaction (hν > 290 nm was investigated. Twelve-membered macrocyclic lactones 2a,b with Ci symmetry including two oxetane-rings, which are the Paternò–Büchi dimerization products, were isolated in ca. 20% yield. The intramolecular cyclization products, such as 3-alkoxyoxetane and 2,7-dioxabicyclo[2.2.1]hept-5-ene derivatives, were not detected in the photolysate.

  4. The Effect of Tai Chi on Knee Osteoarthritis Pain in Cognitively Impaired Elders: Pilot Study

    OpenAIRE

    Tsai, Pao-Feng; Beck, Cornelia; Chang, Jason Y.; Hagen, Jody; Yong-Fang, Kuo; Roberson, Paula K.; Rosengren, Karl; Beuscher, Linda; Doan, Cathy; Anand, K. J. S.

    2008-01-01

    This article reports a pilot study of the effect of tai chi (TC), a pharmacological adjunct and mild aerobic exercise, on osteoarthritic knee pain in elders with cognitive impairment (CI). The TC program included a warm-up, 12-form Sun-style TC, and a cool-down period, for a total of 20-40 minutes per session, twice a week for 15 weeks. The results showed no significant differences in knee pain after the TC intervention in 7 elders with CI. However, more minutes of TC attendance were related ...

  5. Research on psychoneuroimmunology: tai chi as a stress management approach for individuals with HIV disease.

    Science.gov (United States)

    Robins, Jo Lynne W; McCain, Nancy L; Gray, D Patricia; Elswick, R K; Walter, Jeanne M; McDade, Elizabeth

    2006-02-01

    Psychoneuroimmunology is a framework for mind-body practice and research that combines cutting-edge scientific exploration with holistic philosophy to appreciate and understand stress responses. The rapidly growing research literature provides a foundation for building an integrative stress management model with the potential to positively influence the stress-disease relationship and, ultimately, health outcomes. This article introduces a novel tai chi intervention and provides quantitative and qualitative data from a randomized clinical trial indicating its effects on psychosocial variables in individuals living with various stages of HIV disease. PMID:16455435

  6. GraphChi-DB: Simple Design for a Scalable Graph Database System -- on Just a PC

    OpenAIRE

    Kyrola, Aapo; Guestrin, Carlos

    2014-01-01

    We propose a new data structure, Parallel Adjacency Lists (PAL), for efficiently managing graphs with billions of edges on disk. The PAL structure is based on the graph storage model of GraphChi (Kyrola et. al., OSDI 2012), but we extend it to enable online database features such as queries and fast insertions. In addition, we extend the model with edge and vertex attributes. Compared to previous data structures, PAL can store graphs more compactly while allowing fast access to both the incom...

  7. City Carbon Footprint Networks

    Directory of Open Access Journals (Sweden)

    Guangwu Chen

    2016-07-01

    Full Text Available Progressive cities worldwide have demonstrated political leadership by initiating meaningful strategies and actions to tackle climate change. However, the lack of knowledge concerning embodied greenhouse gas (GHG emissions of cities has hampered effective mitigation. We analyse trans-boundary GHG emission transfers between five Australian cities and their trading partners, with embodied emission flows broken down into major economic sectors. We examine intercity carbon footprint (CF networks and disclose a hierarchy of responsibility for emissions between cities and regions. Allocations of emissions to households, businesses and government and the carbon efficiency of expenditure have been analysed to inform mitigation policies. Our findings indicate that final demand in the five largest cities in Australia accounts for more than half of the nation’s CF. City households are responsible for about two thirds of the cities’ CFs; the rest can be attributed to government and business consumption and investment. The city network flows highlight that over half of emissions embodied in imports (EEI to the five cities occur overseas. However, a hierarchy of GHG emissions reveals that overseas regions also outsource emissions to Australian cities such as Perth. We finally discuss the implications of our findings on carbon neutrality, low-carbon city concepts and strategies and allocation of subnational GHG responsibility.

  8. THE EFFECTS OF TAI CHI CHUAN COMBINED WITH VIBRATION TRAINING ON BALANCE CONTROL AND LOWER EXTREMITY MUSCLE POWER

    Directory of Open Access Journals (Sweden)

    Pao-Hung Chung

    2013-03-01

    Full Text Available The aim of this study was to determine whether performing Tai Chi Chuan on a customized vibration platform could enhance balance control and lower extremity muscle power more efficiently than Tai Chi Chuan alone in an untrained young population. Forty-eight healthy young adults were randomly assigned to the following three groups: a Tai Chi Chuan combined with vibration training group (TCV, a Tai Chi Chuan group (TCC or a control group. The TCV group underwent 30 minutes of a reformed Tai Chi Chuan program on a customized vibration platform (32 Hz, 1 mm three times a week for eight weeks, whereas the TCC group was trained without vibration stimuli. A force platform was used to measure the moving area of a static single leg stance and the heights of two consecutive countermovement jumps. The activation of the knee extensor and flexor was also measured synchronously by surface electromyography in all tests. The results showed that the moving area in the TCV group was significantly decreased by 15.3%. The second jump height in the TCV group was significantly increased by 8.14%, and the activation of the knee extensor/flexor was significantly decreased in the first jump. In conclusion, Tai Chi Chuan combined with vibration training can more efficiently improve balance control, and the positive training effect on the lower extremity muscle power induced by vibration stimuli still remains significant because there is no cross-interaction between the two different types of training methods.

  9. Research Students' Satisfaction in Jamshoro Education City

    Directory of Open Access Journals (Sweden)

    Jagul Huma Lashari

    2014-10-01

    Full Text Available This study is performed to identify and examine research students? satisfaction in three universities; SU (University of Sindh, MUET (Mehran University of Engineering & Technology and LUMHS (Liaquat University of Medical & Health Sciences at Jamshoro Education City. Different service factors required for research students are identified and examined by using a triangulation technique (interviews and quantitative (survey questionnaire. Data is analyzed by using descriptive analysis and chi-square test to obtain the required results. In total, 27 service factors related to research students? satisfaction, identified by interviews & literature review have been organized under three clusters: ?University policies?; ?University Services? and ?Role of Supervisor?. The survey analysis revealed that all identified factors are positively related to research students? satisfaction. Result identifies difference in the research students? experiences with respect to their characteristics including (enrolled university, financial resources, employment status. The comparison of different service factors also shows differences in three clusters within the universities. The satisfaction of research students associated with ?role of supervisor? were identified as most satisfying experience in comparison to ?university policies? and ?university services? of Jamshoro Education City. In the end, research has derived a new framework of SDC (Satisfaction for Degree Completion framework to identify and examine the research students satisfaction

  10. The Sequencing and Analysis of the Genome of ChiVMV Wenchang Isolate(ChiVMV-WC)%辣椒脉斑驳病毒文昌分离物基因组测序及分析

    Institute of Scientific and Technical Information of China (English)

    龚殿; 王健华; 吴育鹏; 张雨良; 王洪星; 孙玉娟; 刘志昕

    2011-01-01

    辣椒脉斑驳病毒(Chilli veinal mottle virus,ChiVMV)近年来严重危害海南黄灯笼辣椒的产量,开展针对该病毒的研究以求达到对其有效防控迫在眉睫。本研究分7段克隆了ChiVMV文昌分离物(ChiVMV Wenchang isolate,ChiVMV-WC)的基因组。分段克隆的测序结果通过拼接,共获得ChiVMV-WC基因组9717个核苷酸(nt)序列(GenBank登录号:GQ981316)。在核苷酸序列的第164位~第9270位存在一个大的开放阅读框(ORF),编码一个多聚蛋白(分子量为350.44kD)。近年来被证实的马铃薯Y病毒科的一个新的ORF(pretty interesting potyviridae ORF,PIPO)存在于ChiVMV-WC基因组核苷酸序列的第2892位~第3110位,编码一个由72个氨基酸聚合而成的多肽(分子量为8.26kD)。ChiVMV-WC与ChiVMV其它分离物的基因组核苷酸序列比较发现该病毒存在着较高的变异率。本研究通过与同属内病毒的同源性分析以及系统进化树分析,确定了ChiVMV-WC在生物进化史上的地位。%Chilli veinal mottle virus,ChiVMV had recently brought catastrophic damages to the production of Capsicum chinense Jacp.'Yellow Lantern' in Hainan which lead to the development of the research project on this virus in order to find effective and efficient ways to prevent and control it.In the present study,we cloned the genome of ChiVMV Wenchang isolate(ChiVMV-WC) by dividing it into 7 segments.Then by assembling the results together,we obtained the genome of ChiVMV-WC of 9 717 nucleotide(GenBank Accession No.GQ9813-16).A large open reading frame(ORF) was located from the 164th to the 9 270th of the nucleotide sequence which encoding a polypeptide of 350.44 kD.Pretty Interesting Potyviridae ORF(PIPO) which was proved to be a completely novel ORF exsiting in Potyviridae was located form the 2 892th to the 3 110th of the nucleotide sequence,and encoding a 72 amino acids polypeptide of 8.26 kD.By comparing with other

  11. 辣椒脉斑驳病毒文昌分离物基因组测序及分析%The Sequencing and Analysis of the Genome of ChiVMV Wenchang Isolate (ChiVMV-WC)

    Institute of Scientific and Technical Information of China (English)

    龚殿; 王健华; 吴育鹏; 张雨良; 王洪星; 孙玉娟; 刘志昕

    2011-01-01

    辣椒脉斑驳病毒(Chilli veinal mottle virus,ChiVMV)近年来严重危害海南黄灯笼辣椒的产量,开展针对该病毒的研究以求达到对其有效防控迫在眉睫.本研究分7段克隆了ChiVMV文昌分离物(ChiVMV Wenchang isolate,ChiVMV-WC)的基因组.分段克隆的测序结果通过拼接,共获得ChiVMV-WC基因组9 717个核苷酸(nt)序列(GenBank登录号:GQ981316).在核苷酸序列的第164位~第9 270位存在一个大的开放阅读框(ORF),编码一个多聚蛋白(分子量为350.44 kD).近年来被证实的马铃薯Y病毒科的一个新的ORF (pretty interesting potyviridae ORF,PIPO)存在于ChiVMV-WC基因组核苷酸序列的第2 892位~第3 110位,编码一个由72个氨基酸聚合而成的多肽(分子量为8.26 kD).ChiVMV-WC与ChiVMV其它分离物的基因组核苷酸序列比较发现该病毒存在着较高的变异率.本研究通过与同属内病毒的同源性分析以及系统进化树分析,确定了ChiVMV-WC在生物进化史上的地位.%Chilli veinal mottle virus, ChiVMV had recently brought catastrophic damages to the production of Capsicum chinense Jacp. 'Yellow Lantern' in Hainan which lead to the development of the research project on this virus in order to find effective and efficient ways to prevent and control it. In the present study, we cloned the genome of ChiVMV Wenchang isolate (ChiVMV-WC) by dividing it into 7 segments. Then by assembling the results together, we obtained the genome of ChiVMV-WC of 9 717 nucleotide (GenBank Accession No. GQ9813-16). A large open reading frame (ORF) was located from the 164th to the 9 270th of the nucleotide sequence which encoding a polypeptide of 350.44 kD. Pretty Interesting Potyviridae ORF (PIPO) which was proved to be a com pletely novel ORF exsiting in Potyviridae was located form the 2 892th to the 3 110th of the nucleotide sequence, and encoding a 72 amino acids polypeptide of 8.26 kD. By comparing with other isolates of ChiVMV, we found that this isolate has

  12. Orientation of cohesive end site cos determines the active orientation of chi sequence in stimulating recA . recBC-mediated recombination in phage lambda lytic infections.

    OpenAIRE

    Kobayashi, I.; Murialdo, H; Crasemann, J M; Stahl, M. M.; Stahl, F. W.

    1982-01-01

    Sequence chi, 5'G-C-T-G-G-T-G-G, locally enhances homologous recombination by recA and recBC proteins of Escherichia coli. Previous work showed that, in phage lambda, chi is more active in one orientation (leftward) than in the other (rightward). Inverting cos, the sequence for the mature DNA ends of lambda, reverses this orientation dependence: the rightward chi becomes fully active, and the leftward chi becomes relatively inactive. We surmise that chi action in phage lambda is coupled with ...

  13. Cities and human security

    OpenAIRE

    Szpak, Agnieszka

    2016-01-01

    Cities have been researched mostly in terms of their economic, technological, and social value and significance. Despite some changes in this respect there is still a need to research cities as a fascinating phenomenon, also in respect of its capabilities to increase human security on a local and global scale. The article examines the role of cities for human security in the selected and representative fields such as sustainable development, human rights and environmental protection which are...

  14. Assimilation in multilingual cities

    OpenAIRE

    Ortega, Javier; Verdugo, Gregory

    2015-01-01

    International audience We characterise how the assimilation patterns of minorities into the strong and the weak language differ in a situation of asymmetric bilingualism. Using large variations in language composition in Canadian cities from the 2001 and 2006 Censuses, we show that the differences in the knowledge of English by immigrant allophones (i.e. the immigrants with a mother tongue other than English and French) in English-majority cities are mainly due to sorting across cities. In...

  15. Learning cities 2020

    OpenAIRE

    Osborne, Michael

    2014-01-01

    This article provides a brief overview of historic work in the field of Learning City development. It then proceeds to highlight two contemporary strands of work. The first is the initiative of UNESCO’s Institute for Lifelong Learning (UIL) in establishing the International Platform of Learning Cities. The second is the work of the PASCAL Observatory, currently manifested in the Learning Cities 2020 programme.

  16. Sound and the City

    OpenAIRE

    Bulley, James; Sahin, Ozden; Spinelli, Emmanuel; Tanaka, Atau; Hosang, Georgina M.; Cubitt, Sean; Drever, John L.; Kanngieser, Anja

    2014-01-01

    Imagining the future soundscape of the city. Researchers from across disciplines explore the rapidly changing urban soundscape — how do the sounds around us affect our daily life? What might a futuristic city sound like? An interactive listening experience exploring the impact that the sounds around us can have on our health, wellbeing and sense of place. Sound and the City installation was exhibited as part of the Universities Week at the Natural History Museum between June 9 — 11, 2...

  17. Assimilation in multilingual cities

    OpenAIRE

    Ortega, Javier

    2011-01-01

    Using the Public Use Microdata Files of the 2001 and 2006 Canadian Censuses, we study the determinants of the assimilation of language minorities into the city majority language. We show that official minority members (i.e. francophones in English-speaking cities and anglophones in French-speaking cities) assimilate less than the "allophones" (the individuals with a mother tongue other than English or French), and that immigrants generally assimilate less than natives. In addition, the langua...

  18. Performance test of RM CLEAN and its evaluation with chi-square value

    Science.gov (United States)

    Miyashita, Yoshimitsu; Ideguchi, Shinsuke; Takahashi, Keitaro

    2016-06-01

    RM CLEAN is a standard method to reconstruct the distribution of cosmic magnetic fields and polarized sources along the line of sight (LOS) from the observed polarization spectrum. This method is similar to the CLEAN algorithm for aperture synthesis of radio telescope images but it is rather unclear in what cases RM CLEAN works well. In this paper, we evaluate the performance of RM CLEAN by simulating spectro-polarimetric observations of two compact sources located in the same LOS, varying the relative initial polarization angle and Faraday depth systematically. In particular, we focus on whether the two polarized sources can be resolved in the Faraday depth space and how well the source parameters can be estimated. We confirm the previous studies that two sources cannot be resolved when they are closely located in the Faraday depth space for specific values of the relative initial polarization angle. Further, we calculate the chi-square value for the fit between the mock polarization spectrum data and the one from RM CLEAN. We find that the chi-square value is not always significantly large even when RM CLEAN gives wrong results.

  19. Sümeyra Tosun: Psi Chi/APA Edwin B. Newman Graduate Research Award.

    Science.gov (United States)

    2014-11-01

    The Edwin B. Newman Graduate Research Award is given jointly by Psi Chi and APA. The award was established to recognize young researchers at the beginning of their professional lives and to commemorate both the 50th anniversary of Psi Chi and the 100th anniversary of psychology as a science (dating from the founding of Wundt's laboratory). The 2014 recipient is Sümeyra Tosun. Tosun was chosen for "an outstanding research paper that examines the cognitive repercussions of obligatory versus optional marking of evidentiality, the linguistic coding of the source of information. In English, evidentiality is conveyed in the lexicon through the use of adverbs. In Turkish, evidentiality is coded in the grammar. In two experiments, it was found that English speakers were equally good at remembering and monitoring the source of firsthand information and the source of non-firsthand information. Turkish speakers were worse at remembering and monitoring non-firsthand information than firsthand information and were worse than English speakers at remembering and monitoring non-firsthand information." Tosun's award citation, biography, and a selected bibliography are presented here. PMID:25486159

  20. Search for Surface Magnetic Fields in Mira Stars. First Detection in chi Cyg

    CERN Document Server

    Lèbre, A; Fabas, N; Gillet, D; Herpin, F; Konstantinova-Antova, R; Petit, P

    2013-01-01

    In order to complete the knowledge of the magnetic field and of its influence during the transition from Asymptotic Giant Branch to Planetary Nebulae stages, we have undertaken a search for magnetic fields at the surface of Mira stars. We used spectropolarimetric observations, collected with the Narval instrument at TBL, in order to detect - with Least Squares Deconvolution method - a Zeeman signature in the visible part of the spectrum. We present the first spectropolarimetric observations of the S-type Mira star chi Cyg, performed around its maximum light. We have detected a polarimetric signal in the Stokes V spectra and we have established its Zeeman origin. We claim that it is likely to be related to a weak magnetic field present at the photospheric level and in the lower part of the stellar atmosphere. We have estimated the strength of its longitudinal component to about 2-3 Gauss. This result favors a 1/r law for the variation of the magnetic field strength across the circumstellar envelope of chi Cyg....

  1. Globe Event | Lecture by Hervé Dessimoz and Thomas Büchi | 14 May

    CERN Multimedia

    Globe Info

    2013-01-01

    At the summit of Sustainable Development, by Hervé Dessimoz and Thomas Büchi.   Globe de la science et de l'innovation Route de Meyrin, 1211 Genève Tuesday 14 May 2013 at 8:30 p.m. The lecture will be in French Refuge du Goûter. Hervé Dessimoz and Thomas Büchi have been committed to sustainable development since the 2000s. They created the Palais de l’Équilibre at Expo.02. They designed an exhibition in conjunction with the Cité de la Science et de l’Industrie (Paris) to educate visitors about sustainable development. The pavilion was donated to CERN by the Swiss Confederation and rebuilt on the CERN site in 2004. It is now known as the Globe of Science and Innovation. The Refuge du Goûter, on the slopes of Mont Blanc, is the culmination of their research into sustainable development, with the aim of demonstrating that if we can construct a building at 3835 m which is a...

  2. Performance test of RM CLEAN and its evaluation with chi-square value

    Science.gov (United States)

    Miyashita, Yoshimitsu; Ideguchi, Shinsuke; Takahashi, Keitaro

    2016-04-01

    RM CLEAN is a standard method to reconstruct the distribution of cosmic magnetic fields and polarized sources along the line of sight (LOS) from the observed polarization spectrum. This method is similar to the CLEAN algorithm for aperture synthesis of radio telescope images but it is rather unclear in what cases RM CLEAN works well. In this paper, we evaluate the performance of RM CLEAN by simulating spectro-polarimetric observations of two compact sources located in the same LOS, varying the relative initial polarization angle and Faraday depth systematically. In particular, we focus on whether the two polarized sources can be resolved in the Faraday depth space and how well the source parameters can be estimated. We confirm the previous studies that two sources cannot be resolved when they are closely located in the Faraday depth space for specific values of the relative initial polarization angle. Further, we calculate the chi-square value for the fit between the mock polarization spectrum data and the one from RM CLEAN. We find that the chi-square value is not always significantly large even when RM CLEAN gives wrong results.

  3. The Effect of Tai Chi Chuan on Obstacle Crossing Strategy in Older Adults.

    Science.gov (United States)

    Chang, Yao-Ting; Huang, Chen-Fu; Chang, Jia-Hao

    2015-01-01

    The purpose of this study was to determine the effect of Tai Chi Chuan on the strategies of obstacle-crossing behavior in older adults aged over 65 years. Fifteen Tai Chi group (TCG) participants were compared with 15 general group (GG) participants. Kinematic parameters (by Vicon motion analysis system) and ground reaction forces (by Kistler force plates) were synchronously recorded. A two-way mixed-design ANOVA (α = 0.05) was used to test the effects of the group and the obstacle height. The TCG performed significantly faster stride velocities, longer stride lengths, and shorter stride times than GG while crossing the obstacles. TCG could also produce significantly larger forward ground reaction forces to propel the body and were able to make a significantly greater flexion angle of the hip of the leading leg compared with the GG. It was concluded that the TCG adopted a different strategy with GG to cross the obstacles and completed the crossing behavior more effectively. PMID:26114218

  4. Precipitation of sigma and chi phases in δ-ferrite of Type 316FR weld metals

    International Nuclear Information System (INIS)

    The decomposition behavior and kinetics of δ-ferrite are examined using aging treatments between 873 and 1073 K for Type 316FR stainless steel weld metals with different solidification modes (316FR AF, 316FR FA). The dominant precipitates are sigma, chi, and secondary austenite nucleated at δ-ferrite/austenite interfaces or in the interior of the ferrite grains. These precipitates consume all the ferrite during isothermal aging in both 316FR AF and FA weld metals. Differences in the precipitation behavior (precipitation initiation time and precipitation speed) between weld metals can be explained by i) the degree of Cr and Mo microsegregation within δ-ferrite or austenite near ferrite and ii) the nucleation sites induced due to the solidification mode (AF or FA), such as the ferrite amount. For both weld materials, a Johnson–Mehl-type equation can express the precipitation behavior of the sigma + chi phases and quantitatively predict the behavior at the service-exposure temperatures of a fast breed reactor. - Highlights: • Precipitation of σ and χ phase in Type 316FR welds (two solidification modes) • Different precipitation behaviors: precipitation initiation time and growth speed • Johnson-Mehl–type equation is the most applicable to the precipitation behaviors • Precipitation behaviors are predicted under service conditions of FBRs

  5. Use of the Chi-square Test to Determine Significance of Cumulative Antibiogram Data

    Directory of Open Access Journals (Sweden)

    Rocco J. Perla

    2005-01-01

    Full Text Available An important function of a hospital’s Infectious Disease and Pharmacy programs is to review and compare the most recent antibiogram with that of the previous year to determine if significant changes in antibiotic susceptibility results are noted and to communicate this information and its consequences to the medical staff. However, there are currently no formal analytical (decision-making models in use to determine if the rate of resistance to an antibiotic from one year to the next has significantly changed more or less than one would expect due to sampling error and test reliability. The purpose of this article, therefore, is to demonstrate the utility of using a well-established and simple nonparametric statistical technique (chi-square for analyzing annual variations in cumulative antibiogram data and to determine whether such variations are significantly different from chance and to what to degree. The chi-square model outlined here is a simple, practical, quick, low burden and easy to understand and execute approach that greatly improves the analysis of antibiogram data and decision-making by practitioners. More work and research is needed to develop additional inferential statistical methods and models that can be applied to antibiogram data.

  6. EU Smart City Governance

    Directory of Open Access Journals (Sweden)

    Carmela Gargiulo

    2013-11-01

    Full Text Available In recent years European Commission has developed a set of documents for Members States tracing, directly or indirectly, recommendations for the transformation of the European city. The paper wants to outline which future EU draws for the city, through an integrated and contextual reading of addresses and strategies contained in the last documents, a future often suggested as Smart City. Although the three main documents (Cohesion Policy 2014-2020 of European Community, Digital Agenda for Europe and European Urban Agenda face the issue of the future development of European cities from different points of view, which are respectively cohesion social, ICT and urban dimension, each of them pays particular attention to urban and territorial dimension, identified by the name of Smart City. In other words, the paper aims at drawing the scenario of evolution of Smart Cities that can be delineated through the contextual reading of the three documents. To this end, the paper is divided into three parts: the first part briefly describes the general contents of the three European economic plan tools; the second part illustrates the scenarios for the future of the European city contained in each document; the third part seeks to trace the evolution of the Smart Cities issue developed by the set of the three instruments, in order to provide the framework of European Community for the near future of our cities

  7. Suburbs and Cities

    OpenAIRE

    William N. Goetzmann; Matthew I. Spiegel; Susan M. Wachter

    1996-01-01

    This paper addresses the issue of how closely the fortunes of suburbs are tied to the fortunes of the central city. We use similarities in residential housing price dynamics as a measure of how closely the economies of cities and suburbs are related. We develop housing price indices for most of the zip codes in California, and use these in a clustering procedure to see whether cities and suburbs naturally aggregate together, or whether they move separately. We find that central cities tend to...

  8. The City at Stake:

    Directory of Open Access Journals (Sweden)

    Sophie Esmann Andersen

    2009-12-01

    Full Text Available Studies of the city have been addressed from many different approaches such as law, political science, art history and public administration, in which the eco-nomic, political and legal status of the city have played a major role. However, a new agenda for conceptualizing the city has emerged, in which the city assumes new roles. By using stakeholder theory as a framework for conceptualizing the city, we argue that the city assumes a political-economic agenda-setting role as well as providing a stage for identity constructions and relational performances for consumers, organizations, the media, politicians and other stakeholders. Stakeholder theory allows us to conceptualize the city as being constituted by stakes and relationships between stakeholders which are approached from three analytical positions (modern, postmodern and hypermodern, respectively, thereby allowing us to grasp different stakes and types of relationships, ranging from functional and contractual relationships to individualized and emotionally driven or more non-committal and fluid forms of relationships. In order to support and illustrate the analytical potentials of our framework for conceptualizing urban living, we introduce a project which aims to turn the city of Aarhus into a CO2-neutral city by the year 2030, entitled Aarhus CO2030. We conclude that applying stakeholder theory to a hyper-complex organization such as a city opens up for a reconceptualization of the city as a web of stakes and stakeholder relations. Stakeholder theory contributes to a nuanced and elaborate understanding of the urban complexity and web of both enforced and voluntary relationships as well as the different types of relationships that characterize urban life.

  9. Measurement of the production cross section ratio $\\sigma(\\chi_{b2}(1\\mathrm{P}))/ \\sigma(\\chi_{b1}(1\\mathrm{P}))$ in pp collisions at $\\sqrt{s}$ = 8 TeV

    CERN Document Server

    Khachatryan, Vardan; Tumasyan, Armen; Adam, Wolfgang; Bergauer, Thomas; Dragicevic, Marko; Erö, Janos; Fabjan, Christian; Friedl, Markus; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Hartl, Christian; Hörmann, Natascha; Hrubec, Josef; Jeitler, Manfred; Kiesenhofer, Wolfgang; Knünz, Valentin; Krammer, Manfred; Krätschmer, Ilse; Liko, Dietrich; Mikulec, Ivan; Rabady, Dinyar; Rahbaran, Babak; Rohringer, Herbert; Schöfbeck, Robert; Strauss, Josef; Taurok, Anton; Treberer-Treberspurg, Wolfgang; Waltenberger, Wolfgang; Wulz, Claudia-Elisabeth; Mossolov, Vladimir; Shumeiko, Nikolai; Suarez Gonzalez, Juan; Alderweireldt, Sara; Bansal, Monika; Bansal, Sunil; Cornelis, Tom; De Wolf, Eddi A; Janssen, Xavier; Knutsson, Albert; Luyckx, Sten; Ochesanu, Silvia; Roland, Benoit; Rougny, Romain; Van De Klundert, Merijn; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Van Spilbeeck, Alex; Blekman, Freya; Blyweert, Stijn; D'Hondt, Jorgen; Daci, Nadir; Heracleous, Natalie; Keaveney, James; Lowette, Steven; Maes, Michael; Olbrechts, Annik; Python, Quentin; Strom, Derek; Tavernier, Stefaan; Van Doninck, Walter; Van Mulders, Petra; Van Onsem, Gerrit Patrick; Villella, Ilaria; Caillol, Cécile; Clerbaux, Barbara; De Lentdecker, Gilles; Dobur, Didar; Favart, Laurent; Gay, Arnaud; Grebenyuk, Anastasia; Léonard, Alexandre; Mohammadi, Abdollah; Perniè, Luca; Reis, Thomas; Seva, Tomislav; Thomas, Laurent; Vander Velde, Catherine; Vanlaer, Pascal; Wang, Jian; Adler, Volker; Beernaert, Kelly; Benucci, Leonardo; Cimmino, Anna; Costantini, Silvia; Crucy, Shannon; Dildick, Sven; Fagot, Alexis; Garcia, Guillaume; Mccartin, Joseph; Ocampo Rios, Alberto Andres; Ryckbosch, Dirk; Salva Diblen, Sinem; Sigamani, Michael; Strobbe, Nadja; Thyssen, Filip; Tytgat, Michael; Yazgan, Efe; Zaganidis, Nicolas; Basegmez, Suzan; Beluffi, Camille; Bruno, Giacomo; Castello, Roberto; Caudron, Adrien; Ceard, Ludivine; Da Silveira, Gustavo Gil; Delaere, Christophe; Du Pree, Tristan; Favart, Denis; Forthomme, Laurent; Giammanco, Andrea; Hollar, Jonathan; Jez, Pavel; Komm, Matthias; Lemaitre, Vincent; Nuttens, Claude; Pagano, Davide; Perrini, Lucia; Pin, Arnaud; Piotrzkowski, Krzysztof; Popov, Andrey; Quertenmont, Loic; Selvaggi, Michele; Vidal Marono, Miguel; Vizan Garcia, Jesus Manuel; Beliy, Nikita; Caebergs, Thierry; Daubie, Evelyne; Hammad, Gregory Habib; Aldá Júnior, Walter Luiz; Alves, Gilvan; Brito, Lucas; Correa Martins Junior, Marcos; Dos Reis Martins, Thiago; Mora Herrera, Clemencia; Pol, Maria Elena; Carvalho, Wagner; Chinellato, Jose; Custódio, Analu; Da Costa, Eliza Melo; De Jesus Damiao, Dilson; De Oliveira Martins, Carley; Fonseca De Souza, Sandro; Malbouisson, Helena; Matos Figueiredo, Diego; Mundim, Luiz; Nogima, Helio; Prado Da Silva, Wanda Lucia; Santaolalla, Javier; Santoro, Alberto; Sznajder, Andre; Tonelli Manganote, Edmilson José; Vilela Pereira, Antonio; Bernardes, Cesar Augusto; Dogra, Sunil; Tomei, Thiago; De Moraes Gregores, Eduardo; Mercadante, Pedro G; Novaes, Sergio F; Padula, Sandra; Aleksandrov, Aleksandar; Genchev, Vladimir; Iaydjiev, Plamen; Marinov, Andrey; Piperov, Stefan; Rodozov, Mircho; Stoykova, Stefka; Sultanov, Georgi; Tcholakov, Vanio; Vutova, Mariana; Dimitrov, Anton; Glushkov, Ivan; Hadjiiska, Roumyana; Kozhuharov, Venelin; Litov, Leander; Pavlov, Borislav; Petkov, Peicho; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Chen, Mingshui; Du, Ran; Jiang, Chun-Hua; Liang, Song; Plestina, Roko; Tao, Junquan; Wang, Xianyou; Wang, Zheng; Asawatangtrakuldee, Chayanit; Ban, Yong; Guo, Yifei; Li, Qiang; Li, Wenbo; Liu, Shuai; Mao, Yajun; Qian, Si-Jin; Wang, Dayong; Zhang, Linlin; Zou, Wei; Avila, Carlos; Chaparro Sierra, Luisa Fernanda; Florez, Carlos; Gomez, Juan Pablo; Gomez Moreno, Bernardo; Sanabria, Juan Carlos; Godinovic, Nikola; Lelas, Damir; Polic, Dunja; Puljak, Ivica; Antunovic, Zeljko; Kovac, Marko; Brigljevic, Vuko; Kadija, Kreso; Luetic, Jelena; Mekterovic, Darko; Sudic, Lucija; Attikis, Alexandros; Mavromanolakis, Georgios; Mousa, Jehad; Nicolaou, Charalambos; Ptochos, Fotios; Razis, Panos A; Bodlak, Martin; Finger, Miroslav; Finger Jr, Michael; Assran, Yasser; Ellithi Kamel, Ali; Mahmoud, Mohammed; Radi, Amr; Kadastik, Mario; Murumaa, Marion; Raidal, Martti; Tiko, Andres; Eerola, Paula; Fedi, Giacomo; Voutilainen, Mikko; Härkönen, Jaakko; Karimäki, Veikko; Kinnunen, Ritva; Kortelainen, Matti J; Lampén, Tapio; Lassila-Perini, Kati; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Mäenpää, Teppo; Peltola, Timo; Tuominen, Eija; Tuominiemi, Jorma; Tuovinen, Esa; Wendland, Lauri; Tuuva, Tuure; Besancon, Marc; Couderc, Fabrice; Dejardin, Marc; Denegri, Daniel; Fabbro, Bernard; Faure, Jean-Louis; Favaro, Carlotta; Ferri, Federico; Ganjour, Serguei; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Locci, Elizabeth; Malcles, Julie; Rander, John; Rosowsky, André; Titov, Maksym; Baffioni, Stephanie; Beaudette, Florian; Busson, Philippe; Charlot, Claude; Dahms, Torsten; Dalchenko, Mykhailo; Dobrzynski, Ludwik; Filipovic, Nicolas; Florent, Alice; Granier de Cassagnac, Raphael; Mastrolorenzo, Luca; Miné, Philippe; Mironov, Camelia; Naranjo, Ivo Nicolas; Nguyen, Matthew; Ochando, Christophe; Paganini, Pascal; Regnard, Simon; Salerno, Roberto; Sauvan, Jean-Baptiste; Sirois, Yves; Veelken, Christian; Yilmaz, Yetkin; Zabi, Alexandre; Agram, Jean-Laurent; Andrea, Jeremy; Aubin, Alexandre; Bloch, Daniel; Brom, Jean-Marie; Chabert, Eric Christian; Collard, Caroline; Conte, Eric; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Goetzmann, Christophe; Le Bihan, Anne-Catherine; Van Hove, Pierre; Gadrat, Sébastien; Beauceron, Stephanie; Beaupere, Nicolas; Boudoul, Gaelle; Bouvier, Elvire; Brochet, Sébastien; Carrillo Montoya, Camilo Andres; Chasserat, Julien; Chierici, Roberto; Contardo, Didier; Depasse, Pierre; El Mamouni, Houmani; Fan, Jiawei; Fay, Jean; Gascon, Susan; Gouzevitch, Maxime; Ille, Bernard; Kurca, Tibor; Lethuillier, Morgan; Mirabito, Laurent; Perries, Stephane; Ruiz Alvarez, José David; Sabes, David; Sgandurra, Louis; Sordini, Viola; Vander Donckt, Muriel; Verdier, Patrice; Viret, Sébastien; Xiao, Hong; Tsamalaidze, Zviad; Autermann, Christian; Beranek, Sarah; Bontenackels, Michael; Edelhoff, Matthias; Feld, Lutz; Hindrichs, Otto; Klein, Katja; Ostapchuk, Andrey; Perieanu, Adrian; Raupach, Frank; Sammet, Jan; Schael, Stefan; Weber, Hendrik; Wittmer, Bruno; Zhukov, Valery; Ata, Metin; Dietz-Laursonn, Erik; Duchardt, Deborah; Erdmann, Martin; Fischer, Robert; Güth, Andreas; Hebbeker, Thomas; Heidemann, Carsten; Hoepfner, Kerstin; Klingebiel, Dennis; Knutzen, Simon; Kreuzer, Peter; Merschmeyer, Markus; Meyer, Arnd; Millet, Philipp; Olschewski, Mark; Padeken, Klaas; Papacz, Paul; Reithler, Hans; Schmitz, Stefan Antonius; Sonnenschein, Lars; Teyssier, Daniel; Thüer, Sebastian; Weber, Martin; Cherepanov, Vladimir; Erdogan, Yusuf; Flügge, Günter; Geenen, Heiko; Geisler, Matthias; Haj Ahmad, Wael; Heister, Arno; Hoehle, Felix; Kargoll, Bastian; Kress, Thomas; Kuessel, Yvonne; Lingemann, Joschka; Nowack, Andreas; Nugent, Ian Michael; Perchalla, Lars; Pooth, Oliver; Stahl, Achim; Asin, Ivan; Bartosik, Nazar; Behr, Joerg; Behrenhoff, Wolf; Behrens, Ulf; Bell, Alan James; Bergholz, Matthias; Bethani, Agni; Borras, Kerstin; Burgmeier, Armin; Cakir, Altan; Calligaris, Luigi; Campbell, Alan; Choudhury, Somnath; Costanza, Francesco; Diez Pardos, Carmen; Dooling, Samantha; Dorland, Tyler; Eckerlin, Guenter; Eckstein, Doris; Eichhorn, Thomas; Flucke, Gero; Garay Garcia, Jasone; Geiser, Achim; Gunnellini, Paolo; Hauk, Johannes; Hempel, Maria; Horton, Dean; Jung, Hannes; Kalogeropoulos, Alexis; Kasemann, Matthias; Katsas, Panagiotis; Kieseler, Jan; Kleinwort, Claus; Krücker, Dirk; Lange, Wolfgang; Leonard, Jessica; Lipka, Katerina; Lobanov, Artur; Lohmann, Wolfgang; Lutz, Benjamin; Mankel, Rainer; Marfin, Ihar; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Mittag, Gregor; Mnich, Joachim; Mussgiller, Andreas; Naumann-Emme, Sebastian; Nayak, Aruna; Novgorodova, Olga; Nowak, Friederike; Ntomari, Eleni; Perrey, Hanno; Pitzl, Daniel; Placakyte, Ringaile; Raspereza, Alexei; Ribeiro Cipriano, Pedro M; Ron, Elias; Sahin, Mehmet Özgür; Salfeld-Nebgen, Jakob; Saxena, Pooja; Schmidt, Ringo; Schoerner-Sadenius, Thomas; Schröder, Matthias; Seitz, Claudia; Spannagel, Simon; Vargas Trevino, Andrea Del Rocio; Walsh, Roberval; Wissing, Christoph; Aldaya Martin, Maria; Blobel, Volker; Centis Vignali, Matteo; Draeger, Arne-Rasmus; Erfle, Joachim; Garutti, Erika; Goebel, Kristin; Görner, Martin; Haller, Johannes; Hoffmann, Malte; Höing, Rebekka Sophie; Kirschenmann, Henning; Klanner, Robert; Kogler, Roman; Lange, Jörn; Lapsien, Tobias; Lenz, Teresa; Marchesini, Ivan; Ott, Jochen; Peiffer, Thomas; Pietsch, Niklas; Poehlsen, Jennifer; Pöhlsen, Thomas; Rathjens, Denis; Sander, Christian; Schettler, Hannes; Schleper, Peter; Schlieckau, Eike; Schmidt, Alexander; Seidel, Markus; Sola, Valentina; Stadie, Hartmut; Steinbrück, Georg; Troendle, Daniel; Usai, Emanuele; Vanelderen, Lukas; Barth, Christian; Baus, Colin; Berger, Joram; Böser, Christian; Butz, Erik; Chwalek, Thorsten; De Boer, Wim; Descroix, Alexis; Dierlamm, Alexander; Feindt, Michael; Frensch, Felix; Giffels, Manuel; Hartmann, Frank; Hauth, Thomas; Husemann, Ulrich; Katkov, Igor; Kornmayer, Andreas; Kuznetsova, Ekaterina; Lobelle Pardo, Patricia; Mozer, Matthias Ulrich; Müller, Thomas; Nürnberg, Andreas; Quast, Gunter; Rabbertz, Klaus; Ratnikov, Fedor; Röcker, Steffen; Simonis, Hans-Jürgen; Stober, Fred-Markus Helmut; Ulrich, Ralf; Wagner-Kuhr, Jeannine; Wayand, Stefan; Weiler, Thomas; Wolf, Roger; Anagnostou, Georgios; Daskalakis, Georgios; Geralis, Theodoros; Giakoumopoulou, Viktoria Athina; Kyriakis, Aristotelis; Loukas, Demetrios; Markou, Athanasios; Markou, Christos; Psallidas, Andreas; Topsis-Giotis, Iasonas; Kesisoglou, Stilianos; Panagiotou, Apostolos; Saoulidou, Niki; Stiliaris, Efstathios; Aslanoglou, Xenofon; Evangelou, Ioannis; Flouris, Giannis; Foudas, Costas; Kokkas, Panagiotis; Manthos, Nikolaos; Papadopoulos, Ioannis; Paradas, Evangelos; Bencze, Gyorgy; Hajdu, Csaba; Hidas, Pàl; Horvath, Dezso; Sikler, Ferenc; Veszpremi, Viktor; Vesztergombi, Gyorgy; Zsigmond, Anna Julia; Beni, Noemi; Czellar, Sandor; Karancsi, János; Molnar, Jozsef; Palinkas, Jozsef; Szillasi, Zoltan; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Swain, Sanjay Kumar; Beri, Suman Bala; Bhatnagar, Vipin; Dhingra, Nitish; Gupta, Ruchi; Bhawandeep, Bhawandeep; Kalsi, Amandeep Kaur; Kaur, Manjit; Mittal, Monika; Nishu, Nishu; Singh, Jasbir; Kumar, Ashok; Kumar, Arun; Ahuja, Sudha; Bhardwaj, Ashutosh; Choudhary, Brajesh C; Kumar, Ajay; Malhotra, Shivali; Naimuddin, Md; Ranjan, Kirti; Sharma, Varun; Banerjee, Sunanda; Bhattacharya, Satyaki; Chatterjee, Kalyanmoy; Dutta, Suchandra; Gomber, Bhawna; Jain, Sandhya; Jain, Shilpi; Khurana, Raman; Modak, Atanu; Mukherjee, Swagata; Roy, Debarati; Sarkar, Subir; Sharan, Manoj; Abdulsalam, Abdulla; Dutta, Dipanwita; Kailas, Swaminathan; Kumar, Vineet; Mohanty, Ajit Kumar; Pant, Lalit Mohan; Shukla, Prashant; Topkar, Anita; Aziz, Tariq; Banerjee, Sudeshna; Bhowmik, Sandeep; Chatterjee, Rajdeep Mohan; Dewanjee, Ram Krishna; Dugad, Shashikant; Ganguly, Sanmay; Ghosh, Saranya; Guchait, Monoranjan; Gurtu, Atul; Kole, Gouranga; Kumar, Sanjeev; Maity, Manas; Majumder, Gobinda; Mazumdar, Kajari; Mohanty, Gagan Bihari; Parida, Bibhuti; Sudhakar, Katta; Wickramage, Nadeesha; Bakhshiansohi, Hamed; Behnamian, Hadi; Etesami, Seyed Mohsen; Fahim, Ali; Goldouzian, Reza; Jafari, Abideh; Khakzad, Mohsen; Mohammadi Najafabadi, Mojtaba; Naseri, Mohsen; Paktinat Mehdiabadi, Saeid; Rezaei Hosseinabadi, Ferdos; Safarzadeh, Batool; Zeinali, Maryam; Felcini, Marta; Grunewald, Martin; Abbrescia, Marcello; Barbone, Lucia; Calabria, Cesare; Chhibra, Simranjit Singh; Colaleo, Anna; Creanza, Donato; De Filippis, Nicola; De Palma, Mauro; Fiore, Luigi; Iaselli, Giuseppe; Maggi, Giorgio; Maggi, Marcello; My, Salvatore; Nuzzo, Salvatore; Pompili, Alexis; Pugliese, Gabriella; Radogna, Raffaella; Selvaggi, Giovanna; Silvestris, Lucia; Singh, Gurpreet; Venditti, Rosamaria; Verwilligen, Piet; Zito, Giuseppe; Abbiendi, Giovanni; Benvenuti, Alberto; Bonacorsi, Daniele; Braibant-Giacomelli, Sylvie; Brigliadori, Luca; Campanini, Renato; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Codispoti, Giuseppe; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Fasanella, Daniele; Giacomelli, Paolo; Grandi, Claudio; Guiducci, Luigi; Marcellini, Stefano; Masetti, Gianni; Montanari, Alessandro; Navarria, Francesco; Perrotta, Andrea; Primavera, Federica; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gian Piero; Tosi, Nicolò; Travaglini, Riccardo; Albergo, Sebastiano; Cappello, Gigi; Chiorboli, Massimiliano; Costa, Salvatore; Giordano, Ferdinando; Potenza, Renato; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Gallo, Elisabetta; Gonzi, Sandro; Gori, Valentina; Lenzi, Piergiulio; Meschini, Marco; Paoletti, Simone; Sguazzoni, Giacomo; Tropiano, Antonio; Benussi, Luigi; Bianco, Stefano; Fabbri, Franco; Piccolo, Davide; Ferro, Fabrizio; Lo Vetere, Maurizio; Robutti, Enrico; Tosi, Silvano; Dinardo, Mauro Emanuele; Fiorendi, Sara; Gennai, Simone; Gerosa, Raffaele; Ghezzi, Alessio; Govoni, Pietro; Lucchini, Marco Toliman; Malvezzi, Sandra; Manzoni, Riccardo Andrea; Martelli, Arabella; Marzocchi, Badder; Menasce, Dario; Moroni, Luigi; Paganoni, Marco; Pedrini, Daniele; Ragazzi, Stefano; Redaelli, Nicola; Tabarelli de Fatis, Tommaso; Buontempo, Salvatore; Cavallo, Nicola; Di Guida, Salvatore; Fabozzi, Francesco; Iorio, Alberto Orso Maria; Lista, Luca; Meola, Sabino; Merola, Mario; Paolucci, Pierluigi; Azzi, Patrizia; Bacchetta, Nicola; Bisello, Dario; Branca, Antonio; Carlin, Roberto; Checchia, Paolo; Dall'Osso, Martino; Dorigo, Tommaso; Dosselli, Umberto; Galanti, Mario; Gasparini, Fabrizio; Gasparini, Ugo; Giubilato, Piero; Gonella, Franco; Gozzelino, Andrea; Kanishchev, Konstantin; Lacaprara, Stefano; Margoni, Martino; Montecassiano, Fabio; Pazzini, Jacopo; Pozzobon, Nicola; Ronchese, Paolo; Simonetto, Franco; Tosi, Mia; Zotto, Pierluigi; Zucchetta, Alberto; Zumerle, Gianni; Gabusi, Michele; Ratti, Sergio P; Riccardi, Cristina; Salvini, Paola; Vitulo, Paolo; Biasini, Maurizio; Bilei, Gian Mario; Ciangottini, Diego; Fanò, Livio; Lariccia, Paolo; Mantovani, Giancarlo; Menichelli, Mauro; Romeo, Francesco; Saha, Anirban; Santocchia, Attilio; Spiezia, Aniello; Androsov, Konstantin; Azzurri, Paolo; Bagliesi, Giuseppe; Bernardini, Jacopo; Boccali, Tommaso; Broccolo, Giuseppe; Castaldi, Rino; Ciocci, Maria Agnese; Dell'Orso, Roberto; Donato, Silvio; Fiori, Francesco; Foà, Lorenzo; Giassi, Alessandro; Grippo, Maria Teresa; Ligabue, Franco; Lomtadze, Teimuraz; Martini, Luca; Messineo, Alberto; Moon, Chang-Seong; Palla, Fabrizio; Rizzi, Andrea; Savoy-Navarro, Aurore; Serban, Alin Titus; Spagnolo, Paolo; Squillacioti, Paola; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Vernieri, Caterina; Barone, Luciano; Cavallari, Francesca; D'imperio, Giulia; Del Re, Daniele; Diemoz, Marcella; Grassi, Marco; Jorda, Clara; Longo, Egidio; Margaroli, Fabrizio; Meridiani, Paolo; Micheli, Francesco; Nourbakhsh, Shervin; Organtini, Giovanni; Paramatti, Riccardo; Rahatlou, Shahram; Rovelli, Chiara; Santanastasio, Francesco; Soffi, Livia; Traczyk, Piotr; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Bellan, Riccardo; Biino, Cristina; Cartiglia, Nicolo; Casasso, Stefano; Costa, Marco; Degano, Alessandro; Demaria, Natale; Dujany, Giulio; Finco, Linda; Mariotti, Chiara; Maselli, Silvia; Migliore, Ernesto; Monaco, Vincenzo; Musich, Marco; Obertino, Maria Margherita; Ortona, Giacomo; Pacher, Luca; Pastrone, Nadia; Pelliccioni, Mario; Pinna Angioni, Gian Luca; Potenza, Alberto; Romero, Alessandra; Ruspa, Marta; Sacchi, Roberto; Solano, Ada; Staiano, Amedeo; Tamponi, Umberto; Belforte, Stefano; Candelise, Vieri; Casarsa, Massimo; Cossutti, Fabio; Della Ricca, Giuseppe; Gobbo, Benigno; La Licata, Chiara; Marone, Matteo; Montanino, Damiana; Schizzi, Andrea; Umer, Tomo; Zanetti, Anna; Chang, Sunghyun; Kropivnitskaya, Anna; Nam, Soon-Kwon; Kim, Dong Hee; Kim, Gui Nyun; Kim, Min Suk; Kong, Dae Jung; Lee, Sangeun; Oh, Young Do; Park, Hyangkyu; Sakharov, Alexandre; Son, Dong-Chul; Kim, Tae Jeong; Kim, Jae Yool; Song, Sanghyeon; Choi, Suyong; Gyun, Dooyeon; Hong, Byung-Sik; Jo, Mihee; Kim, Hyunchul; Kim, Yongsun; Lee, Byounghoon; Lee, Kyong Sei; Park, Sung Keun; Roh, Youn; Choi, Minkyoo; Kim, Ji Hyun; Park, Inkyu; Park, Sangnam; Ryu, Geonmo; Ryu, Min Sang; Choi, Young-Il; Choi, Young Kyu; Goh, Junghwan; Kim, Donghyun; Kwon, Eunhyang; Lee, Jongseok; Seo, Hyunkwan; Yu, Intae; Juodagalvis, Andrius; Komaragiri, Jyothsna Rani; Md Ali, Mohd Adli Bin; Castilla-Valdez, Heriberto; De La Cruz-Burelo, Eduard; Heredia-de La Cruz, Ivan; Lopez-Fernandez, Ricardo; Sánchez Hernández, Alberto; Carrillo Moreno, Salvador; Vazquez Valencia, Fabiola; Pedraza, Isabel; Salazar Ibarguen, Humberto Antonio; Casimiro Linares, Edgar; Morelos Pineda, Antonio; Krofcheck, David; Butler, Philip H; Reucroft, Steve; Ahmad, Ashfaq; Ahmad, Muhammad; Hassan, Qamar; Hoorani, Hafeez R; Khalid, Shoaib; Khan, Wajid Ali; Khurshid, Taimoor; Shah, Mehar Ali; Shoaib, Muhammad; Bialkowska, Helena; Bluj, Michal; Boimska, Bożena; Frueboes, Tomasz; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Romanowska-Rybinska, Katarzyna; Szleper, Michal; Zalewski, Piotr; Brona, Grzegorz; Bunkowski, Karol; Cwiok, Mikolaj; Dominik, Wojciech; Doroba, Krzysztof; Kalinowski, Artur; Konecki, Marcin; Krolikowski, Jan; Misiura, Maciej; Olszewski, Michał; Wolszczak, Weronika; Bargassa, Pedrame; Beirão Da Cruz E Silva, Cristóvão; Faccioli, Pietro; Ferreira Parracho, Pedro Guilherme; Gallinaro, Michele; Nguyen, Federico; Rodrigues Antunes, Joao; Seixas, Joao; Varela, Joao; Vischia, Pietro; Golutvin, Igor; Gorbunov, Ilya; Karjavin, Vladimir; Konoplyanikov, Viktor; Korenkov, Vladimir; Lanev, Alexander; Malakhov, Alexander; Matveev, Viktor; Mitsyn, Valeri Valentinovitch; Moisenz, Petr; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Skatchkov, Nikolai; Smirnov, Vitaly; Tikhonenko, Elena; Yuldashev, Bekhzod S; Zarubin, Anatoli; Golovtsov, Victor; Ivanov, Yury; Kim, Victor; Levchenko, Petr; Murzin, Victor; Oreshkin, Vadim; Smirnov, Igor; Sulimov, Valentin; Uvarov, Lev; Vavilov, Sergey; Vorobyev, Alexey; Vorobyev, Andrey; Andreev, Yuri; Dermenev, Alexander; Gninenko, Sergei; Golubev, Nikolai; Kirsanov, Mikhail; Krasnikov, Nikolai; Pashenkov, Anatoli; Tlisov, Danila; Toropin, Alexander; Epshteyn, Vladimir; Gavrilov, Vladimir; Lychkovskaya, Natalia; Popov, Vladimir; Safronov, Grigory; Semenov, Sergey; Spiridonov, Alexander; Stolin, Viatcheslav; Vlasov, Evgueni; Zhokin, Alexander; Andreev, Vladimir; Azarkin, Maksim; Dremin, Igor; Kirakosyan, Martin; Leonidov, Andrey; Mesyats, Gennady; Rusakov, Sergey V; Vinogradov, Alexey; Belyaev, Andrey; Boos, Edouard; Dubinin, Mikhail; Dudko, Lev; Ershov, Alexander; Gribushin, Andrey; Klyukhin, Vyacheslav; Kodolova, Olga; Lokhtin, Igor; Obraztsov, Stepan; Petrushanko, Sergey; Savrin, Viktor; Snigirev, Alexander; Azhgirey, Igor; Bayshev, Igor; Bitioukov, Sergei; Kachanov, Vassili; Kalinin, Alexey; Konstantinov, Dmitri; Krychkine, Victor; Petrov, Vladimir; Ryutin, Roman; Sobol, Andrei; Tourtchanovitch, Leonid; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Adzic, Petar; Ekmedzic, Marko; Milosevic, Jovan; Rekovic, Vladimir; Alcaraz Maestre, Juan; Battilana, Carlo; Calvo, Enrique; Cerrada, Marcos; Chamizo Llatas, Maria; Colino, Nicanor; De La Cruz, Begona; Delgado Peris, Antonio; Domínguez Vázquez, Daniel; Escalante Del Valle, Alberto; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Flix, Jose; Fouz, Maria Cruz; Garcia-Abia, Pablo; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M; Josa, Maria Isabel; Merino, Gonzalo; Navarro De Martino, Eduardo; Pérez Calero Yzquierdo, Antonio María; Puerta Pelayo, Jesus; Quintario Olmeda, Adrián; Redondo, Ignacio; Romero, Luciano; Soares, Mara Senghi; Albajar, Carmen; de Trocóniz, Jorge F; Missiroli, Marino; Moran, Dermot; Brun, Hugues; Cuevas, Javier; Fernandez Menendez, Javier; Folgueras, Santiago; Gonzalez Caballero, Isidro; Lloret Iglesias, Lara; Brochero Cifuentes, Javier Andres; Cabrillo, Iban Jose; Calderon, Alicia; Duarte Campderros, Jordi; Fernandez, Marcos; Gomez, Gervasio; Graziano, Alberto; Lopez Virto, Amparo; Marco, Jesus; Marco, Rafael; Martinez Rivero, Celso; Matorras, Francisco; Munoz Sanchez, Francisca Javiela; Piedra Gomez, Jonatan; Rodrigo, Teresa; Rodríguez-Marrero, Ana Yaiza; Ruiz-Jimeno, Alberto; Scodellaro, Luca; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Auffray, Etiennette; Auzinger, Georg; Bachtis, Michail; Baillon, Paul; Ball, Austin; Barney, David; Benaglia, Andrea; Bendavid, Joshua; Benhabib, Lamia; Benitez, Jose F; Bernet, Colin; Bianchi, Giovanni; Bloch, Philippe; Bocci, Andrea; Bonato, Alessio; Bondu, Olivier; Botta, Cristina; Breuker, Horst; Camporesi, Tiziano; Cerminara, Gianluca; Colafranceschi, Stefano; D'Alfonso, Mariarosaria; D'Enterria, David; Dabrowski, Anne; David Tinoco Mendes, Andre; De Guio, Federico; De Roeck, Albert; De Visscher, Simon; Dobson, Marc; Dordevic, Milos; Dupont-Sagorin, Niels; Elliott-Peisert, Anna; Eugster, Jürg; Franzoni, Giovanni; Funk, Wolfgang; Gigi, Dominique; Gill, Karl; Giordano, Domenico; Girone, Maria; Glege, Frank; Guida, Roberto; Gundacker, Stefan; Guthoff, Moritz; Hammer, Josef; Hansen, Magnus; Harris, Philip; Hegeman, Jeroen; Innocente, Vincenzo; Janot, Patrick; Kousouris, Konstantinos; Krajczar, Krisztian; Lecoq, Paul; Lourenco, Carlos; Magini, Nicolo; Malgeri, Luca; Mannelli, Marcello; Marrouche, Jad; Masetti, Lorenzo; Meijers, Frans; Mersi, Stefano; Meschi, Emilio; Moortgat, Filip; Morovic, Srecko; Mulders, Martijn; Musella, Pasquale; Orsini, Luciano; Pape, Luc; Perez, Emmanuelle; Perrozzi, Luca; Petrilli, Achille; Petrucciani, Giovanni; Pfeiffer, Andreas; Pierini, Maurizio; Pimiä, Martti; Piparo, Danilo; Plagge, Michael; Racz, Attila; Rolandi, Gigi; Rovere, Marco; Sakulin, Hannes; Schäfer, Christoph; Schwick, Christoph; Sharma, Archana; Siegrist, Patrice; Silva, Pedro; Simon, Michal; Sphicas, Paraskevas; Spiga, Daniele; Steggemann, Jan; Stieger, Benjamin; Stoye, Markus; Treille, Daniel; Tsirou, Andromachi; Veres, Gabor Istvan; Vlimant, Jean-Roch; Wardle, Nicholas; Wöhri, Hermine Katharina; Wollny, Heiner; Zeuner, Wolfram Dietrich; Bertl, Willi; Deiters, Konrad; Erdmann, Wolfram; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; Kotlinski, Danek; Langenegger, Urs; Renker, Dieter; Rohe, Tilman; Bachmair, Felix; Bäni, Lukas; Bianchini, Lorenzo; Bortignon, Pierluigi; Buchmann, Marco-Andrea; Casal, Bruno; Chanon, Nicolas; Deisher, Amanda; Dissertori, Günther; Dittmar, Michael; Donegà, Mauro; Dünser, Marc; Eller, Philipp; Grab, Christoph; Hits, Dmitry; Lustermann, Werner; Mangano, Boris; Marini, Andrea Carlo; Martinez Ruiz del Arbol, Pablo; Meister, Daniel; Mohr, Niklas; Nägeli, Christoph; Nessi-Tedaldi, Francesca; Pandolfi, Francesco; Pauss, Felicitas; Peruzzi, Marco; Quittnat, Milena; Rebane, Liis; Rossini, Marco; Starodumov, Andrei; Takahashi, Maiko; Theofilatos, Konstantinos; Wallny, Rainer; Weber, Hannsjoerg Artur; Amsler, Claude; Canelli, Maria Florencia; Chiochia, Vincenzo; De Cosa, Annapaola; Hinzmann, Andreas; Hreus, Tomas; Kilminster, Benjamin; Lange, Clemens; Millan Mejias, Barbara; Ngadiuba, Jennifer; Robmann, Peter; Ronga, Frederic Jean; Taroni, Silvia; Verzetti, Mauro; Yang, Yong; Cardaci, Marco; Chen, Kuan-Hsin; Ferro, Cristina; Kuo, Chia-Ming; Lin, Willis; Lu, Yun-Ju; Volpe, Roberta; Yu, Shin-Shan; Chang, Paoti; Chang, You-Hao; Chang, Yu-Wei; Chao, Yuan; Chen, Kai-Feng; Chen, Po-Hsun; Dietz, Charles; Grundler, Ulysses; Hou, George Wei-Shu; Kao, Kai-Yi; Lei, Yeong-Jyi; Liu, Yueh-Feng; Lu, Rong-Shyang; Majumder, Devdatta; Petrakou, Eleni; Tzeng, Yeng-Ming; Wilken, Rachel; Asavapibhop, Burin; Srimanobhas, Norraphat; Suwonjandee, Narumon; Adiguzel, Aytul; Bakirci, Mustafa Numan; Cerci, Salim; Dozen, Candan; Dumanoglu, Isa; Eskut, Eda; Girgis, Semiray; Gokbulut, Gul; Gurpinar, Emine; Hos, Ilknur; Kangal, Evrim Ersin; Kayis Topaksu, Aysel; Onengut, Gulsen; Ozdemir, Kadri; Ozturk, Sertac; Polatoz, Ayse; Sogut, Kenan; Sunar Cerci, Deniz; Tali, Bayram; Topakli, Huseyin; Vergili, Mehmet; Akin, Ilina Vasileva; Bilin, Bugra; Bilmis, Selcuk; Gamsizkan, Halil; Karapinar, Guler; Ocalan, Kadir; Sekmen, Sezen; Surat, Ugur Emrah; Yalvac, Metin; Zeyrek, Mehmet; Gülmez, Erhan; Isildak, Bora; Kaya, Mithat; Kaya, Ozlem; Bahtiyar, Hüseyin; Barlas, Esra; Cankocak, Kerem; Vardarli, Fuat Ilkehan; Yücel, Mete; Levchuk, Leonid; Sorokin, Pavel; Brooke, James John; Clement, Emyr; Cussans, David; Flacher, Henning; Frazier, Robert; Goldstein, Joel; Grimes, Mark; Heath, Greg P; Heath, Helen F; Jacob, Jeson; Kreczko, Lukasz; Lucas, Chris; Meng, Zhaoxia; Newbold, Dave M; Paramesvaran, Sudarshan; Poll, Anthony; Senkin, Sergey; Smith, Vincent J; Williams, Thomas; Bell, Ken W; Belyaev, Alexander; Brew, Christopher; Brown, Robert M; Cockerill, David JA; Coughlan, John A; Harder, Kristian; Harper, Sam; Olaiya, Emmanuel; Petyt, David; Shepherd-Themistocleous, Claire; Thea, Alessandro; Tomalin, Ian R; Womersley, William John; Worm, Steven; Baber, Mark; Bainbridge, Robert; Buchmuller, Oliver; Burton, Darren; Colling, David; Cripps, Nicholas; Cutajar, Michael; Dauncey, Paul; Davies, Gavin; Della Negra, Michel; Dunne, Patrick; Ferguson, William; Fulcher, Jonathan; Futyan, David; Gilbert, Andrew; Hall, Geoffrey; Iles, Gregory; Jarvis, Martyn; Karapostoli, Georgia; Kenzie, Matthew; Lane, Rebecca; Lucas, Robyn; Lyons, Louis; Magnan, Anne-Marie; Malik, Sarah; Mathias, Bryn; Nash, Jordan; Nikitenko, Alexander; Pela, Joao; Pesaresi, Mark; Petridis, Konstantinos; Raymond, David Mark; Rogerson, Samuel; Rose, Andrew; Seez, Christopher; Sharp, Peter; Tapper, Alexander; Vazquez Acosta, Monica; Virdee, Tejinder; Cole, Joanne; Hobson, Peter R; Khan, Akram; Kyberd, Paul; Leggat, Duncan; Leslie, Dawn; Martin, William; Reid, Ivan; Symonds, Philip; Teodorescu, Liliana; Turner, Mark; Dittmann, Jay; Hatakeyama, Kenichi; Kasmi, Azeddine; Liu, Hongxuan; Scarborough, Tara; Charaf, Otman; Cooper, Seth; Henderson, Conor; Rumerio, Paolo; Avetisyan, Aram; Bose, Tulika; Fantasia, Cory; Lawson, Philip; Richardson, Clint; Rohlf, James; Sperka, David; St John, Jason; Sulak, Lawrence; Alimena, Juliette; Berry, Edmund; Bhattacharya, Saptaparna; Christopher, Grant; Cutts, David; Demiragli, Zeynep; Ferapontov, Alexey; Garabedian, Alex; Heintz, Ulrich; Kukartsev, Gennadiy; Laird, Edward; Landsberg, Greg; Luk, Michael; Narain, Meenakshi; Segala, Michael; Sinthuprasith, Tutanon; Speer, Thomas; Swanson, Joshua; Breedon, Richard; Breto, Guillermo; Calderon De La Barca Sanchez, Manuel; Chauhan, Sushil; Chertok, Maxwell; Conway, John; Conway, Rylan; Cox, Peter Timothy; Erbacher, Robin; Gardner, Michael; Ko, Winston; Lander, Richard; Miceli, Tia; Mulhearn, Michael; Pellett, Dave; Pilot, Justin; Ricci-Tam, Francesca; Searle, Matthew; Shalhout, Shalhout; Smith, John; Squires, Michael; Stolp, Dustin; Tripathi, Mani; Wilbur, Scott; Yohay, Rachel; Cousins, Robert; Everaerts, Pieter; Farrell, Chris; Hauser, Jay; Ignatenko, Mikhail; Rakness, Gregory; Takasugi, Eric; Valuev, Vyacheslav; Weber, Matthias; Babb, John; Burt, Kira; Clare, Robert; Ellison, John Anthony; Gary, J William; Hanson, Gail; Heilman, Jesse; Ivova Rikova, Mirena; Jandir, Pawandeep; Kennedy, Elizabeth; Lacroix, Florent; Liu, Hongliang; Long, Owen Rosser; Luthra, Arun; Malberti, Martina; Nguyen, Harold; Olmedo Negrete, Manuel; Shrinivas, Amithabh; Sumowidagdo, Suharyo; Wimpenny, Stephen; Andrews, Warren; Branson, James G; Cerati, Giuseppe Benedetto; Cittolin, Sergio; D'Agnolo, Raffaele Tito; Evans, David; Holzner, André; Kelley, Ryan; Klein, Daniel; Lebourgeois, Matthew; Letts, James; Macneill, Ian; Olivito, Dominick; Padhi, Sanjay; Palmer, Christopher; Pieri, Marco; Sani, Matteo; Sharma, Vivek; Simon, Sean; Sudano, Elizabeth; Tadel, Matevz; Tu, Yanjun; Vartak, Adish; Welke, Charles; Würthwein, Frank; Yagil, Avraham; Yoo, Jaehyeok; Barge, Derek; Bradmiller-Feld, John; Campagnari, Claudio; Danielson, Thomas; Dishaw, Adam; Flowers, Kristen; Franco Sevilla, Manuel; Geffert, Paul; George, Christopher; Golf, Frank; Gouskos, Loukas; Incandela, Joe; Justus, Christopher; Mccoll, Nickolas; Richman, Jeffrey; Stuart, David; To, Wing; West, Christopher; Apresyan, Artur; Bornheim, Adolf; Bunn, Julian; Chen, Yi; Di Marco, Emanuele; Duarte, Javier; Mott, Alexander; Newman, Harvey B; Pena, Cristian; Rogan, Christopher; Spiropulu, Maria; Timciuc, Vladlen; Wilkinson, Richard; Xie, Si; Zhu, Ren-Yuan; Azzolini, Virginia; Calamba, Aristotle; Carlson, Benjamin; Ferguson, Thomas; Iiyama, Yutaro; Paulini, Manfred; Russ, James; Vogel, Helmut; Vorobiev, Igor; Cumalat, John Perry; Ford, William T; Gaz, Alessandro; Luiggi Lopez, Eduardo; Nauenberg, Uriel; Smith, James; Stenson, Kevin; Ulmer, Keith; Wagner, Stephen Robert; Alexander, James; Chatterjee, Avishek; Chu, Jennifer; Dittmer, Susan; Eggert, Nicholas; Mirman, Nathan; Nicolas Kaufman, Gala; Patterson, Juliet Ritchie; Ryd, Anders; Salvati, Emmanuele; Skinnari, Louise; Sun, Werner; Teo, Wee Don; Thom, Julia; Thompson, Joshua; Tucker, Jordan; Weng, Yao; Winstrom, Lucas; Wittich, Peter; Winn, Dave; Abdullin, Salavat; Albrow, Michael; Anderson, Jacob; Apollinari, Giorgio; Bauerdick, Lothar AT; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C; Burkett, Kevin; Butler, Joel Nathan; Cheung, Harry; Chlebana, Frank; Cihangir, Selcuk; Elvira, Victor Daniel; Fisk, Ian; Freeman, Jim; Gao, Yanyan; Gottschalk, Erik; Gray, Lindsey; Green, Dan; Grünendahl, Stefan; Gutsche, Oliver; Hanlon, Jim; Hare, Daryl; Harris, Robert M; Hirschauer, James; Hooberman, Benjamin; Jindariani, Sergo; Johnson, Marvin; Joshi, Umesh; Kaadze, Ketino; Klima, Boaz; Kreis, Benjamin; Kwan, Simon; Linacre, Jacob; Lincoln, Don; Lipton, Ron; Liu, Tiehui; Lykken, Joseph; Maeshima, Kaori; Marraffino, John Michael; Martinez Outschoorn, Verena Ingrid; Maruyama, Sho; Mason, David; McBride, Patricia; Mishra, Kalanand; Mrenna, Stephen; Musienko, Yuri; Nahn, Steve; Newman-Holmes, Catherine; O'Dell, Vivian; Prokofyev, Oleg; Sexton-Kennedy, Elizabeth; Sharma, Seema; Soha, Aron; Spalding, William J; Spiegel, Leonard; Taylor, Lucas; Tkaczyk, Slawek; Tran, Nhan Viet; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vidal, Richard; Whitbeck, Andrew; Whitmore, Juliana; Yang, Fan; Acosta, Darin; Avery, Paul; Bourilkov, Dimitri; Carver, Matthew; Cheng, Tongguang; Curry, David; Das, Souvik; De Gruttola, Michele; Di Giovanni, Gian Piero; Field, Richard D; Fisher, Matthew; Furic, Ivan-Kresimir; Hugon, Justin; Konigsberg, Jacobo; Korytov, Andrey; Kypreos, Theodore; Low, Jia Fu; Matchev, Konstantin; Milenovic, Predrag; Mitselmakher, Guenakh; Muniz, Lana; Rinkevicius, Aurelijus; Shchutska, Lesya; Snowball, Matthew; Yelton, John; Zakaria, Mohammed; Hewamanage, Samantha; Linn, Stephan; Markowitz, Pete; Martinez, German; Rodriguez, Jorge Luis; Adams, Todd; Askew, Andrew; Bochenek, Joseph; Diamond, Brendan; Haas, Jeff; Hagopian, Sharon; Hagopian, Vasken; Johnson, Kurtis F; Prosper, Harrison; Veeraraghavan, Venkatesh; Weinberg, Marc; Baarmand, Marc M; Hohlmann, Marcus; Kalakhety, Himali; Yumiceva, Francisco; Adams, Mark Raymond; Apanasevich, Leonard; Bazterra, Victor Eduardo; Berry, Douglas; Betts, Russell Richard; Bucinskaite, Inga; Cavanaugh, Richard; Evdokimov, Olga; Gauthier, Lucie; Gerber, Cecilia Elena; Hofman, David Jonathan; Khalatyan, Samvel; Kurt, Pelin; Moon, Dong Ho; O'Brien, Christine; Silkworth, Christopher; Turner, Paul; Varelas, Nikos; Albayrak, Elif Asli; Bilki, Burak; Clarida, Warren; Dilsiz, Kamuran; Duru, Firdevs; Haytmyradov, Maksat; Merlo, Jean-Pierre; Mermerkaya, Hamit; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Ogul, Hasan; Onel, Yasar; Ozok, Ferhat; Penzo, Aldo; Rahmat, Rahmat; Sen, Sercan; Tan, Ping; Tiras, Emrah; Wetzel, James; Yetkin, Taylan; Yi, Kai; Barnett, Bruce Arnold; Blumenfeld, Barry; Bolognesi, Sara; Fehling, David; Gritsan, Andrei; Maksimovic, Petar; Martin, Christopher; Swartz, Morris; Baringer, Philip; Bean, Alice; Benelli, Gabriele; Bruner, Christopher; Gray, Julia; Kenny III, Raymond Patrick; Malek, Magdalena; Murray, Michael; Noonan, Daniel; Sanders, Stephen; Sekaric, Jadranka; Stringer, Robert; Wang, Quan; Wood, Jeffrey Scott; Barfuss, Anne-Fleur; Chakaberia, Irakli; Ivanov, Andrew; Khalil, Sadia; Makouski, Mikhail; Maravin, Yurii; Saini, Lovedeep Kaur; Shrestha, Shruti; Skhirtladze, Nikoloz; Svintradze, Irakli; Gronberg, Jeffrey; Lange, David; Rebassoo, Finn; Wright, Douglas; Baden, Drew; Belloni, Alberto; Calvert, Brian; Eno, Sarah Catherine; Gomez, Jaime; Hadley, Nicholas John; Kellogg, Richard G; Kolberg, Ted; Lu, Ying; Marionneau, Matthieu; Mignerey, Alice; Pedro, Kevin; Skuja, Andris; Tonjes, Marguerite; Tonwar, Suresh C; Apyan, Aram; Barbieri, Richard; Bauer, Gerry; Busza, Wit; Cali, Ivan Amos; Chan, Matthew; Di Matteo, Leonardo; Dutta, Valentina; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Gulhan, Doga; Klute, Markus; Lai, Yue Shi; Lee, Yen-Jie; Levin, Andrew; Luckey, Paul David; Ma, Teng; Paus, Christoph; Ralph, Duncan; Roland, Christof; Roland, Gunther; Stephans, George; Stöckli, Fabian; Sumorok, Konstanty; Velicanu, Dragos; Veverka, Jan; Wyslouch, Bolek; Yang, Mingming; Zanetti, Marco; Zhukova, Victoria; Dahmes, Bryan; Gude, Alexander; Kao, Shih-Chuan; Klapoetke, Kevin; Kubota, Yuichi; Mans, Jeremy; Pastika, Nathaniel; Rusack, Roger; Singovsky, Alexander; Tambe, Norbert; Turkewitz, Jared; Acosta, John Gabriel; Oliveros, Sandra; Avdeeva, Ekaterina; Bloom, Kenneth; Bose, Suvadeep; Claes, Daniel R; Dominguez, Aaron; Gonzalez Suarez, Rebeca; Keller, Jason; Knowlton, Dan; Kravchenko, Ilya; Lazo-Flores, Jose; Malik, Sudhir; Meier, Frank; Snow, Gregory R; Dolen, James; Godshalk, Andrew; Iashvili, Ia; Kharchilava, Avto; Kumar, Ashish; Rappoccio, Salvatore; Alverson, George; Barberis, Emanuela; Baumgartel, Darin; Chasco, Matthew; Haley, Joseph; Massironi, Andrea; Morse, David Michael; Nash, David; Orimoto, Toyoko; Trocino, Daniele; Wang, Ren-Jie; Wood, Darien; Zhang, Jinzhong; Hahn, Kristan Allan; Kubik, Andrew; Mucia, Nicholas; Odell, Nathaniel; Pollack, Brian; Pozdnyakov, Andrey; Schmitt, Michael; Stoynev, Stoyan; Sung, Kevin; Velasco, Mayda; Won, Steven; Brinkerhoff, Andrew; Chan, Kwok Ming; Drozdetskiy, Alexey; Hildreth, Michael; Jessop, Colin; Karmgard, Daniel John; Kellams, Nathan; Lannon, Kevin; Luo, Wuming; Lynch, Sean; Marinelli, Nancy; Pearson, Tessa; Planer, Michael; Ruchti, Randy; Valls, Nil; Wayne, Mitchell; Wolf, Matthias; Woodard, Anna; Antonelli, Louis; Brinson, Jessica; Bylsma, Ben; Durkin, Lloyd Stanley; Flowers, Sean; Hill, Christopher; Hughes, Richard; Kotov, Khristian; Ling, Ta-Yung; Puigh, Darren; Rodenburg, Marissa; Smith, Geoffrey; Winer, Brian L; Wolfe, Homer; Wulsin, Howard Wells; Driga, Olga; Elmer, Peter; Hebda, Philip; Hunt, Adam; Koay, Sue Ann; Lujan, Paul; Marlow, Daniel; Medvedeva, Tatiana; Mooney, Michael; Olsen, James; Piroué, Pierre; Quan, Xiaohang; Saka, Halil; Stickland, David; Tully, Christopher; Werner, Jeremy Scott; Zenz, Seth Conrad; Zuranski, Andrzej; Brownson, Eric; Mendez, Hector; Ramirez Vargas, Juan Eduardo; Barnes, Virgil E; Benedetti, Daniele; Bolla, Gino; Bortoletto, Daniela; De Mattia, Marco; Hu, Zhen; Jha, Manoj; Jones, Matthew; Jung, Kurt; Kress, Matthew; Leonardo, Nuno; Lopes Pegna, David; Maroussov, Vassili; Merkel, Petra; Miller, David Harry; Neumeister, Norbert; Radburn-Smith, Benjamin Charles; Shi, Xin; Shipsey, Ian; Silvers, David; Svyatkovskiy, Alexey; Wang, Fuqiang; Xie, Wei; Xu, Lingshan; Yoo, Hwi Dong; Zablocki, Jakub; Zheng, Yu; Parashar, Neeti; Stupak, John; Adair, Antony; Akgun, Bora; Ecklund, Karl Matthew; Geurts, Frank JM; Li, Wei; Michlin, Benjamin; Padley, Brian Paul; Redjimi, Radia; Roberts, Jay; Zabel, James; Betchart, Burton; Bodek, Arie; Covarelli, Roberto; de Barbaro, Pawel; Demina, Regina; Eshaq, Yossof; Ferbel, Thomas; Garcia-Bellido, Aran; Goldenzweig, Pablo; Han, Jiyeon; Harel, Amnon; Khukhunaishvili, Aleko; Petrillo, Gianluca; Vishnevskiy, Dmitry; Ciesielski, Robert; Demortier, Luc; Goulianos, Konstantin; Lungu, Gheorghe; Mesropian, Christina; Arora, Sanjay; Barker, Anthony; Chou, John Paul; Contreras-Campana, Christian; Contreras-Campana, Emmanuel; Duggan, Daniel; Ferencek, Dinko; Gershtein, Yuri; Gray, Richard; Halkiadakis, Eva; Hidas, Dean; Kaplan, Steven; Lath, Amitabh; Panwalkar, Shruti; Park, Michael; Patel, Rishi; Salur, Sevil; Schnetzer, Steve; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Thomassen, Peter; Walker, Matthew; Rose, Keith; Spanier, Stefan; York, Andrew; Bouhali, Othmane; Castaneda Hernandez, Alfredo; Eusebi, Ricardo; Flanagan, Will; Gilmore, Jason; Kamon, Teruki; Khotilovich, Vadim; Krutelyov, Vyacheslav; Montalvo, Roy; Osipenkov, Ilya; Pakhotin, Yuriy; Perloff, Alexx; Roe, Jeffrey; Rose, Anthony; Safonov, Alexei; Sakuma, Tai; Suarez, Indara; Tatarinov, Aysen; Akchurin, Nural; Cowden, Christopher; Damgov, Jordan; Dragoiu, Cosmin; Dudero, Phillip Russell; Faulkner, James; Kovitanggoon, Kittikul; Kunori, Shuichi; Lee, Sung Won; Libeiro, Terence; Volobouev, Igor; Appelt, Eric; Delannoy, Andrés G; Greene, Senta; Gurrola, Alfredo; Johns, Willard; Maguire, Charles; Mao, Yaxian; Melo, Andrew; Sharma, Monika; Sheldon, Paul; Snook, Benjamin; Tuo, Shengquan; Velkovska, Julia; Arenton, Michael Wayne; Boutle, Sarah; Cox, Bradley; Francis, Brian; Goodell, Joseph; Hirosky, Robert; Ledovskoy, Alexander; Li, Hengne; Lin, Chuanzhe; Neu, Christopher; Wood, John; Clarke, Christopher; Harr, Robert; Karchin, Paul Edmund; Kottachchi Kankanamge Don, Chamath; Lamichhane, Pramod; Sturdy, Jared; Belknap, Donald; Carlsmith, Duncan; Cepeda, Maria; Dasu, Sridhara; Dodd, Laura; Duric, Senka; Friis, Evan; Hall-Wilton, Richard; Herndon, Matthew; Hervé, Alain; Klabbers, Pamela; Lanaro, Armando; Lazaridis, Christos; Levine, Aaron; Loveless, Richard; Mohapatra, Ajit; Ojalvo, Isabel; Perry, Thomas; Pierro, Giuseppe Antonio; Polese, Giovanni; Ross, Ian; Sarangi, Tapas; Savin, Alexander; Smith, Wesley H; Vuosalo, Carl; Woods, Nathaniel

    2015-01-01

    A measurement of the production cross section ratio $\\sigma(\\chi_{b2}(1\\mathrm{P}))/ \\sigma(\\chi_{b1}(1\\mathrm{P}))$ is presented. The $\\chi_{b1}(1\\mathrm{P})$ and $\\chi_{b2}(1\\mathrm{P})$ bottomonium states, promptly produced in pp collisions at $\\sqrt{s}$= 8 TeV, are detected by the CMS experiment at the CERN LHC through their radiative decays $\\chi_{b1,2}(1\\mathrm{P}) \\rightarrow \\Upsilon(1\\mathrm{S}) + \\gamma$. The emitted photons are measured through their conversion to e$^+$e$^-$ pairs, whose reconstruction allows the two states to be resolved. The $\\Upsilon(1\\mathrm{S})$ is measured through its decay to two muons. An event sample corresponding to an integrated luminosity of 20.7 fb$^{-1}$ is used to measure the cross section ratio in a phase-space region defined by the photon pseudorapidity, |$\\eta^\\gamma$| < 1.0; the $\\Upsilon(1\\mathrm{S})$ rapidity, |$y^\\Upsilon$| < 1.5; and the $\\Upsilon(1\\mathrm{S})$ transverse momentum, 7 < $p_{\\mathrm{T}}^\\Upsilon$ < 40 GeV. The cross section ratio sh...

  10. Deer City Legend

    Institute of Scientific and Technical Information of China (English)

    LIUHUANZHI; LILIKUN

    2003-01-01

    MORE and more commodities,such as clothes,shoes,millinery,lighters and shavers,now bear the “Made in Wenzhou”mark.It woule appear that Wenzhou grooms the whole nation.Lucheng(deer city)District in central Wenzhou is the nucleus of the city's thriving light industry sector.

  11. The Experience City

    DEFF Research Database (Denmark)

    Marling, Gitte; Jensen, Ole B.; Kiib, Hans

    2009-01-01

    development are discussed in the paper, as well as the problems and the new opportunities with which the ‘Experience city' is faced. The article focus on the design of the Danish Experience City with special emphasis on hybrid cultural projects and on performative urban spaces. It present the first findings...... as we engage with the discussion about the trajectory of future research....

  12. A liveable city:

    DEFF Research Database (Denmark)

    Sommerlund, Julie

    2014-01-01

    increas- ingly based in and on cities rather than nations, and cities compete for businesses, branding, tourists and talent. In the western world, urbanisation has happened simultane- ously to de-industrialisation, which has opened industrial neighbourhoods and harbours for new uses – often focus- ing on...

  13. CHONGQING, the Hot City

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    @@ Chongqing is a well-known city with a history of more than 3,000 years. It is a famous historical and cultural city in China. Chongqing is the birthplace of the Bayu Culture. At present, Chongqing is a municipality directly under the Central Government with the largest area, the most administrative districts and the largest population.

  14. Marriage and the City

    DEFF Research Database (Denmark)

    Gautier, Pieter; Svarer, Michael; Teulings, Coen

    Do people move to cities because of marriage market considerations? In cities singles can meet more potential partners than in rural areas. Singles are therefore prepared to pay a premium in terms of higher housing prices. Once married, the marriage market benefits disappear while the housing...

  15. Escaping The Big Cities

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    More white-collar workers consider leaving major metropolises to find opportunities in small and medium-sized cities The energy and excitement of first-tier cities, including Beijing, Shanghai, Guangzhou and Shenzhen in Guangdong Province, have long served as magnets attracting enthusiastic young people. But recent surveys have overturned the perception of this urban draw.

  16. Smart cities: event everywhere

    OpenAIRE

    Reboredo Penedo, Raquel

    2015-01-01

    The research attempts to provide a big picture from the literature through a Systematic Literature Review about the smart city and the existing standards topics for interchanging data through Smart City Apps. Additionally a prototype was created to analyze one of the standards found in the SLR

  17. Making Cities Better

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    Livelihood programs change the lives of urban residents For decades Chinese cities have vied with each other to top national and international development rankings. However, the triennial national list of cities with an advanced living environment judges candidates according to less conventional

  18. Walkout in Crystal City

    Science.gov (United States)

    Barrios, Greg

    2009-01-01

    When students take action, they create change that extends far beyond the classroom. In this article, the author, who was a former teacher from Crystal City, Texas, remembers the student walkout that helped launch the Latino civil rights movement 40 years ago. The Crystal City student walkout remains a high point in the history of student activism…

  19. Reflective cool cities

    NARCIS (Netherlands)

    Heidegger, V.

    2011-01-01

    This "designers' manual" is made during the TIDO-course AR0531 Smart & Bioclimatic Design. Our globe is heating, and cities are heating up much more. At the same time, cities are growing and green spaces are substituted by buildings and streets. These man-made surfaces are dark and tend to heat up

  20. Great cities look small

    CERN Document Server

    Sim, Aaron; Barahona, Mauricio; Stumpf, Michael P H

    2015-01-01

    Great cities connect people; failed cities isolate people. Despite the fundamental importance of physical, face-to-face social-ties in the functioning of cities, these connectivity networks are not explicitly observed in their entirety. Attempts at estimating them often rely on unrealistic over-simplifications such as the assumption of spatial homogeneity. Here we propose a mathematical model of human interactions in terms of a local strategy of maximising the number of beneficial connections attainable under the constraint of limited individual travelling-time budgets. By incorporating census and openly-available online multi-modal transport data, we are able to characterise the connectivity of geometrically and topologically complex cities. Beyond providing a candidate measure of greatness, this model allows one to quantify and assess the impact of transport developments, population growth, and other infrastructure and demographic changes on a city. Supported by validations of GDP and HIV infection rates ac...

  1. Universities Scale Like Cities

    CERN Document Server

    van Raan, Anthony F J

    2012-01-01

    Recent studies of urban scaling show that important socioeconomic city characteristics such as wealth and innovation capacity exhibit a nonlinear, particularly a power law scaling with population size. These nonlinear effects are common to all cities, with similar power law exponents. These findings mean that the larger the city, the more disproportionally they are places of wealth and innovation. Local properties of cities cause a deviation from the expected behavior as predicted by the power law scaling. In this paper we demonstrate that universities show a similar behavior as cities in the distribution of the gross university income in terms of total number of citations over size in terms of total number of publications. Moreover, the power law exponents for university scaling are comparable to those for urban scaling. We find that deviations from the expected behavior can indeed be explained by specific local properties of universities, particularly the field-specific composition of a university, and its ...

  2. Chi-square analysis of the reduction of ATP levels in L-02 hepatocytes by hexavalent chromium

    Directory of Open Access Journals (Sweden)

    Yang Yuan

    2012-06-01

    Full Text Available This study explored the reduction of adenosine triphosphate (ATP levels in L-02 hepatocytes by hexavalent chromium (Cr(VI using chi-square analysis. Cells were treated with 2, 4, 8, 16, or 32 μM Cr(VI for 12, 24, or 36 h. Methyl thiazolyl tetrazolium (MTT experiments and measurements of intracellular ATP levels were performed by spectrophotometry or bioluminescence assays following Cr(VI treatment. The chi-square test was used to determine the difference between cell survival rate and ATP levels. For the chi-square analysis, the results of the MTT or ATP experiments were transformed into a relative ratio with respect to the control (%. The relative ATP levels increased at 12 h, decreased at 24 h, and increased slightly again at 36 h following 4, 8, 16, 32 μM Cr(VI treatment, corresponding to a "V-shaped" curve. Furthermore, the results of the chi-square analysis demonstrated a significant difference of the ATP level in the 32-μM Cr(VI group (P < 0.05. The results suggest that the chi-square test can be applied to analyze the interference effects of Cr(VI on ATP levels in L-02 hepatocytes. The decreased ATP levels at 24 h indicated disruption of mitochondrial energy metabolism and the slight increase of ATP levels at 36 h indicated partial recovery of mitochondrial function or activated glycolysis in L-02 hepatocytes.

  3. Chemical dampening of Ly6C(hi) monocytes in the periphery produces anti-depressant effects in mice.

    Science.gov (United States)

    Zheng, Xiao; Ma, Sijing; Kang, An; Wu, Mengqiu; Wang, Lin; Wang, Qiong; Wang, Guangji; Hao, Haiping

    2016-01-01

    The involvement of systemic immunity in depression pathogenesis promises a periphery-targeting paradigm in novel anti-depressant discovery. However, relatively little is known about druggable targets in the periphery for mental and behavioral control. Here we report that targeting Ly6C(hi) monocytes in blood can serve as a strategy for anti-depressant purpose. A natural compound, ginsenoside Rg1 (Rg1), was firstly validated as a periphery-restricted chemical probe. Rg1 selectively suppressed Ly6C(hi) monocytes recruitment to the inflamed mice brain. The proinflammatory potential of Ly6C(hi) monocytes to activate astrocytes was abrogated by Rg1, which led to a blunted feedback release of CCL2 to recruit the peripheral monocytes. In vitro study demonstrated that Rg1 pretreatment on activated THP-1 monocytes retarded their ability to trigger CCL2 secretion from co-cultured U251 MG astrocytes. CCL2-triggered p38/MAPK and PI3K/Akt activation were involved in the action of Rg1. Importantly, in mice models, we found that dampening Ly6C(hi) monocytes at the periphery ameliorated depression-like behavior induced by neuroinflammation or chronic social defeat stress. Together, our work unravels that blood Ly6C(hi) monocytes may serve as the target to enable remote intervention on the depressed brain, and identifies Rg1 as a lead compound for designing drugs targeting peripheral CCL2 signals. PMID:26783261

  4. Chemical dampening of Ly6Chi monocytes in the periphery produces anti-depressant effects in mice

    Science.gov (United States)

    Zheng, Xiao; Ma, Sijing; Kang, An; Wu, Mengqiu; Wang, Lin; Wang, Qiong; Wang, Guangji; Hao, Haiping

    2016-01-01

    The involvement of systemic immunity in depression pathogenesis promises a periphery-targeting paradigm in novel anti-depressant discovery. However, relatively little is known about druggable targets in the periphery for mental and behavioral control. Here we report that targeting Ly6Chi monocytes in blood can serve as a strategy for anti-depressant purpose. A natural compound, ginsenoside Rg1 (Rg1), was firstly validated as a periphery-restricted chemical probe. Rg1 selectively suppressed Ly6Chi monocytes recruitment to the inflamed mice brain. The proinflammatory potential of Ly6Chi monocytes to activate astrocytes was abrogated by Rg1, which led to a blunted feedback release of CCL2 to recruit the peripheral monocytes. In vitro study demonstrated that Rg1 pretreatment on activated THP-1 monocytes retarded their ability to trigger CCL2 secretion from co-cultured U251 MG astrocytes. CCL2-triggered p38/MAPK and PI3K/Akt activation were involved in the action of Rg1. Importantly, in mice models, we found that dampening Ly6Chi monocytes at the periphery ameliorated depression-like behavior induced by neuroinflammation or chronic social defeat stress. Together, our work unravels that blood Ly6Chi monocytes may serve as the target to enable remote intervention on the depressed brain, and identifies Rg1 as a lead compound for designing drugs targeting peripheral CCL2 signals. PMID:26783261

  5. Prompt charmonia production and polarization at LHC in the NRQCD with kt-factorization. Part II: $\\chi_c$ mesons

    CERN Document Server

    Baranov, S P; Zotov, N P

    2015-01-01

    In the framework of kt-factorization approach,the production of prompt $\\chi_c$ mesons in pp collisions at the LHC energies is studied. Our consideration is based on the off-shell amplitudes for hard partonic subprocesses $g^*g^*\\to\\chi_{cJ}$ and non-relativistic QCD formalism for bound states. The transverse momentum dependent (unintegrated) gluon densities in a proton were derived from Ciafaloni-Catani-Fiorani-Marchesini evolution equation or, alternatively, were chosen in accordance with Kimber-Martin-Ryskin prescription. Taking into account both color singlet and color octet contributions, we deduce the corresponding non-perturbative long-distance matrix elements from the fits to the latest ATLAS data on $\\chi_{c1}$ and $\\chi_{c2}$ transverse momentum distributions at $\\sqrt s = 7$ TeV. We find that these distributions at small and moderate pt are formed mainly by the color singlet components. We successfully described the data on the differential cross sections and relative production rates $\\sigma(\\chi_...

  6. Study of the decay $B^0 \\to \\chi_{c1} K^+ \\pi^-$ and search of exotic resonances at LHCb

    CERN Document Server

    Sbordone, Francesco; Alves Junior, Antonio Augusto

    In 2008 the Belle Collaboration reported the observation of two charged resonance-like structures in the ${\\chi_c}_1 \\pi^-$ mass spectrum produced in the decay $B^0 \\to {\\chi_c}_1 K^+ \\pi^-$. These were labelled as $Z_1(4050)^-$ and $Z_2(4250)^-$. Alternatively, a single wider resonance hypothesis was also pursued by Belle, and labelled as $Z(4150)^-$. The fact that these are charged states would be a clear sample, if they really exist, of four quark bound systems; for this reason this observation has given rise to a great deal of interest. In 2012 the BABAR Collaboration has searched for these resonances in the channels $B^{0,+} \\to {\\chi_c}_1 K^{+,0} \\pi^-$ and did not find any evidence of them. In this thesis a search for these claimed exotic charmonium-like states $Z_1(4050)^-$ and $Z_2(4250)^-$ is presented, in the decay $B^0 \\to {\\chi_c}_1 K^+ \\pi^-$, where ${\\chi_c}_1 \\to J/\\psi \\gamma$ and $J/\\psi \\to \\mu^+ \\mu^-$. Charged conjugate are implied throughout the whole thesis. The analysis is performed us...

  7. Mining of unexplored habitats for novel chitinases--chiA as a helper gene proxy in metagenomics.

    Science.gov (United States)

    Cretoiu, Mariana Silvia; Kielak, Anna Maria; Abu Al-Soud, Waleed; Sørensen, Søren J; van Elsas, Jan Dirk

    2012-06-01

    The main objective of this study was to assess the abundance and diversity of chitin-degrading microbial communities in ten terrestrial and aquatic habitats in order to provide guidance to the subsequent exploration of such environments for novel chitinolytic enzymes. A combined protocol which encompassed (1) classical overall enzymatic assays, (2) chiA gene abundance measurement by qPCR, (3) chiA gene pyrosequencing, and (4) chiA gene-based PCR-DGGE was used. The chiA gene pyrosequencing is unprecedented, as it is the first massive parallel sequencing of this gene. The data obtained showed the existence across habitats of core bacterial communities responsible for chitin assimilation irrespective of ecosystem origin. Conversely, there were habitat-specific differences. In addition, a suite of sequences were obtained that are as yet unregistered in the chitinase database. In terms of chiA gene abundance and diversity, typical low-abundance/diversity versus high-abundance/diversity habitats was distinguished. From the combined data, we selected chitin-amended agricultural soil, the rhizosphere of the Arctic plant Oxyria digyna and the freshwater sponge Ephydatia fluviatilis as the most promising habitats for subsequent bioexploration. Thus, the screening strategy used is proposed as a guide for further metagenomics-based exploration of the selected habitats. PMID:22526805

  8. 2008 City of Baltimore Lidar

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — In the spring of 2008, the City of Baltimore expressed an interest to upgrade the City GIS Database with mapping quality airborne LiDAR data. The City of Baltimore...

  9. Clarification of the use of chi-square and likelihood functions in fits to histograms

    International Nuclear Information System (INIS)

    We consider the problem of fitting curves to histograms in which the data obey multinomial or Poisson statistics. Techniques commonly used by physicists are examined in light of standard results found in the statistics literature. We review the relationship between multinomial and Poisson distributions, and clarify a sufficient condition for equality of the area under the fitted curve and the number of events on the histogram. Following the statisticians, we use the likelihood ratio test to construct a general Z2 statistic, Zsub(lambda)2, which yields parameter and error estimates identical to those of the method of maximum likelihood. The Zsub(lambda)2 statistic is further useful for testing goodness-of-fit since the value of its minimum asymptotically obeys a classical chi-square distribution. One should be aware, however, of the potential for statistical bias, especially when the number of events is small. (orig.)

  10. Probing scalar meson structures in $\\chi_{c1}$ decays into pseudoscalar and scalar

    CERN Document Server

    Wang, Qian; Zhao, Qiang

    2012-01-01

    We evaluate the decay branching ratios of $\\chi_{c1}\\to PS$, in a quark model parametrization scheme, where $P$ and $S$ stand for pseudoscalar and scalar meson, respectively. An interesting feature of this decay process is that the $c\\bar{c}$ annihilate via the pQCD hair-pin diagram is supposed to be dominant. Hence, this decay process should be sensitive to the quark components of the final-state light mesons, and would provide a great opportunity for testing the mixing relations among the scalar mesons, i.e. $f_0(1370)$, $f_0(1500)$ and $f_0(1710)$, by tagging the final state pseudoscalar mesons.

  11. The Role of M\\"obius Constants and Scattering Functions in CHY Scalar Amplitudes

    CERN Document Server

    Lam, C S

    2015-01-01

    The integrations leading to the Cachazo-He-Yuan (CHY) double-color $n$-point massless scalar amplitude are carried out one integral at a time. M\\"obius invariance dictates the final amplitude to be independent of the three M\\"obius constants $\\sigma_r, \\sigma_s, \\sigma_t$, but their choice affects integrations and the intermediate results. The effect of the M\\"obius constants, the two colors, and the scattering functions on each integration is investigated. A systematic way to carry out the $n-3$ integrations is explained, each exposing one of the $n-3$ propagators of the Feynman diagrams. Two detailed examples are shown to illustrate the procedure, one a five-point amplitude, and the other a nine-point amplitude.

  12. An Efficient Algorithm for Auto Upload and Chi - Square Test on Application Software

    Directory of Open Access Journals (Sweden)

    Sampada Kembhavi

    2013-06-01

    Full Text Available In this paper weproposed a novel algorithm for autouploading the data in the cloud environment withoutanylicense considerationand suggest a novelframework where data is auto upload after a properauthentication and processing their task (gatheringand sharing inthe cloudenvironment.Here wepresent the authenticationprocess with autouploading process.We also use the traditionalmethod of data uploading, data gathering andsharing.So that we compare our statistics. We useobject orientedprograming (OOP programsas adata which is used for data sharing and gathering.We use java programs for comparison.Thenweapply Chi-Square test, to test the hypothesis forcorrectness. Then we check the program capabilityunder three parameters; first is F-measure (FM,second is odds ratio (OR and third is power (PO.Based on the three parameters we can find the betterapplication software as a service approach. Basedon the above phenomena we can compare theexecutiontimein different operating applicationwith the help of software quality metrics

  13. Chaotic Behavior of Heart Rate Signals during Chi and Kundalini Meditation

    Directory of Open Access Journals (Sweden)

    Atefeh Goshvarpour

    2012-03-01

    Full Text Available Nonlinear dynamics has been introduced to the analysis of biological data and increasingly recognized to be functionally relevant. The aim of this study is to quantify and compare the contribution of nonlinear and chaotic dynamics of human heart rate variability during two forms of meditation: (i Chinese Chi (or Qigong meditation and (ii Kundalini Yoga meditation. For this purpose, Poincare plots, Lyapunov exponents and Hurst exponents of heart rate variability signals were analyzed. In this study, we examined the different behavior of heart rate signals during two specific meditation techniques. The results show that heart rate signals became more periodic and their chaotic behavior was decreased in both techniques of meditation. Therefore, nonlinear chaotic indices may serve as a quantitative measure for psychophysiological states such as meditation. In addition, different forms of meditation appear to differentially alter specific components of heart rate signals.

  14. Attitudes of inner city patients with cardiovascular disease towards meditation

    Science.gov (United States)

    Shah, Amit J.; Ostfeld, Robert J.

    2016-01-01

    Objectives Meditation is a stress reduction intervention that is of potential benefit to patients with cardiovascular disease, but its interest in inner city cardiology patients is unknown. We surveyed patients at an inner city cardiology clinic about their interest in learning meditation and the impact of stress on their lifestyles. Methods A survey was distributed to 215 consecutive patients in an inner city cardiology clinic. Chi-square tests were used to compare those interested and not interested in meditation. Results Of the 215 surveys, 54 were excluded because of 2 or more missing responses, leaving 161 for analysis. The mean age was 61 (+/− 16.5) years; 59% were female, 37% were black non-Hispanic, and 34% were Hispanic, and 18% were white. Overall, 46% expressed interest in learning meditation, and 64% agreed that less stress would facilitate living a healthy lifestyle. In subgroup analysis, the highest levels of interest in meditation classes occurred in patients who were younger than 65 years old (69% interested) and those who agreed that less stress would facilitate living a healthy lifestyle (71% interested). Conclusion Many of the patients at an inner city cardiology clinic may have interest in learning meditation. Given the effects of stress in this population, clinical trials involving meditation are warranted.

  15. Great cities look small.

    Science.gov (United States)

    Sim, Aaron; Yaliraki, Sophia N; Barahona, Mauricio; Stumpf, Michael P H

    2015-08-01

    Great cities connect people; failed cities isolate people. Despite the fundamental importance of physical, face-to-face social ties in the functioning of cities, these connectivity networks are not explicitly observed in their entirety. Attempts at estimating them often rely on unrealistic over-simplifications such as the assumption of spatial homogeneity. Here we propose a mathematical model of human interactions in terms of a local strategy of maximizing the number of beneficial connections attainable under the constraint of limited individual travelling-time budgets. By incorporating census and openly available online multi-modal transport data, we are able to characterize the connectivity of geometrically and topologically complex cities. Beyond providing a candidate measure of greatness, this model allows one to quantify and assess the impact of transport developments, population growth, and other infrastructure and demographic changes on a city. Supported by validations of gross domestic product and human immunodeficiency virus infection rates across US metropolitan areas, we illustrate the effect of changes in local and city-wide connectivities by considering the economic impact of two contemporary inter- and intra-city transport developments in the UK: High Speed 2 and London Crossrail. This derivation of the model suggests that the scaling of different urban indicators with population size has an explicitly mechanistic origin. PMID:26179988

  16. @City: technologising Barcelona

    Directory of Open Access Journals (Sweden)

    Rojas, Jesús

    2007-05-01

    Full Text Available This article is about the concept of the contemporary city - the influence that technology has when one thinks about, plans and lives in a city. The conjunction of technology and city reformulates customs and social practices; it can even determine the way one constitutes one's own identity. One can see how close the relation is between technology (specifically, TICS and the structures of the city in a wide variety of situations: in social interactions on the street, in transport, and in ways of buying, of working and entertainment. "@City" is a concept that very well reflects the emergent properties of a current city, that is, the coexistence of a physical and a virtual urban space. The "22@Barcelona" project attempts to bring together different types of spaces. By combining the physical with the virtual, 22@Barcelona, as a neighborhood of @City, creates an uncertain and blurred border between both spaces.The article also examines the impact that these spaces have on the psycho-social processes involved in the daily life of a traditionally working-class neighborhood, now strongly limited by technological boundaries.

  17. Bacterial and fungal chitinase chiJ orthologs evolve under different selective constraints following horizontal gene transfer

    Directory of Open Access Journals (Sweden)

    Ubhayasekera Wimal

    2012-10-01

    Full Text Available Abstract Background Certain bacteria from the genus Streptomyces are currently used as biological control agents against plant pathogenic fungi. Hydrolytic enzymes that degrade fungal cell wall components, such as chitinases, are suggested as one possible mechanism in biocontrol interactions. Adaptive evolution of chitinases are previously reported for plant chitinases involved in defence against fungal pathogens, and in fungal chitinases involved in fungal-fungal interactions. In this study we investigated the molecular evolution of chitinase chiJ in the bacterial genus Streptomyces. In addition, as chiJ orthologs are previously reported in certain fungal species as a result from horizontal gene transfer, we conducted a comparative study of differences in evolutionary patterns between bacterial and fungal taxa. Findings ChiJ contained three sites evolving under strong positive selection and four groups of co-evolving sites. Regions of high amino acid diversity were predicted to be surface-exposed and associated with coil regions that connect certain α-helices and β-strands in the family 18 chitinase TIM barrel structure, but not associated with the catalytic cleft. The comparative study with fungal ChiJ orthologs identified three regions that display signs of type 1 functional divergence, where unique adaptations in the bacterial and fungal taxa are driven by positive selection. Conclusions The identified surface-exposed regions of chitinase ChiJ where sequence diversification is driven by positive selection may putatively be related to functional divergence between bacterial and fungal orthologs. These results show that ChiJ orthologs have evolved under different selective constraints following the horizontal gene transfer event.

  18. Phylogeography of recently emerged DENV-2 in southern Viet Nam.

    Directory of Open Access Journals (Sweden)

    Maia A Rabaa

    Full Text Available Revealing the dispersal of dengue viruses (DENV in time and space is central to understanding their epidemiology. However, the processes that shape DENV transmission patterns at the scale of local populations are not well understood, particularly the impact of such factors as human population movement and urbanization. Herein, we investigated trends in the spatial dynamics of DENV-2 transmission in the highly endemic setting of southern Viet Nam. Through a phylogeographic analysis of 168 full-length DENV-2 genome sequences obtained from hospitalized dengue cases from 10 provinces in southern Viet Nam, we reveal substantial genetic diversity in both urban and rural areas, with multiple lineages identified in individual provinces within a single season, and indicative of frequent viral migration among communities. Focusing on the recently introduced Asian I genotype, we observed particularly high rates of viral exchange between adjacent geographic areas, and between Ho Chi Minh City, the primary urban center of this region, and populations across southern Viet Nam. Within Ho Chi Minh City, patterns of DENV movement appear consistent with a gravity model of virus dispersal, with viruses traveling across a gradient of population density. Overall, our analysis suggests that Ho Chi Minh City may act as a source population for the dispersal of DENV across southern Viet Nam, and provides further evidence that urban areas of Southeast Asia play a primary role in DENV transmission. However, these data also indicate that more rural areas are also capable of maintaining virus populations and hence fueling DENV evolution over multiple seasons.

  19. Futures of cities

    DEFF Research Database (Denmark)

    2008-01-01

    Arkitektskole. Bogen  har 3 dele. Principles: Copenhagen Agenda for Sustainable Living, 10 principper udviklet af Ugebrevet Mandag Morgen illustreret af arkitektstuderende. Congress: Futures of Cities, Emerging Urbanisms- Emerging Practices, oplæg fra unge tegnestuer til temaet fremlagt på Student Congress......Bogen dokumenterer resultater fra den internationale kongres Futures of Cities arrangeret af IFHP International Federation of Housing and Planning, Realdania, Kunstakademiets Arkitektskole og City of Copenhagen. Kongressen blev afholdt i september 2007 i Øksnehallen og på Kunstakademiets...

  20. Making the Experience City

    DEFF Research Database (Denmark)

    Jensen, Ole B.

    2009-01-01

    This paper describes the latest research into cultural planning and architectural branding in Denmark based on the ‘Experience City' research project located at Aalborg University. The paper explores the implication of the turn towards culture and experience in the contemporary Danish city. It thus...... makes an investigation into the complex relationship between the words and policies of the ‘Experience Economy' and the actual urban transformations made in cities with reference to these changes. The paper discusses the cases researched in relation to the state, market, civil society framework as well...

  1. Smart city – future city? smart city 20 as a livable city and future market

    CERN Document Server

    Etezadzadeh, Chirine

    2016-01-01

    The concept of a livable smart city presented in this book highlights the relevance of the functionality and integrated resilience of viable cities of the future. It critically examines the progressive digitalization that is taking place and identifies the revolutionized energy sector as the basis of urban life. The concept is based on people and their natural environment, resulting in a broader definition of sustainability and an expanded product theory. Smart City 2.0 offers its residents many opportunities and is an attractive future market for innovative products and services. However, it presents numerous challenges for stakeholders and product developers.

  2. $\\chi^{\\vphantom\\dagger}_{c0}(3915)$ As the Lightest $c\\bar c s \\bar s$ State

    OpenAIRE

    Lebed, Richard F.; Polosa, Antonio D.

    2016-01-01

    The state $\\chi^{\\vphantom\\dagger}_{c0}(3915)$ has recently been demoted by the Particle Data Group from its previous status as the conventional $c\\bar c$ $2 {}^3P_0$ state, largely due to the absence of expected $D\\bar D$ decays. We propose that $\\chi^{\\vphantom\\dagger}_{c0}(3915)$ is actually the lightest $c\\bar c s \\bar s$ state, and calculate the spectrum of such states using the diquark model, identifying many of the observed charmoniumlike states that lack open-charm decay modes as $c\\b...

  3. Franchising as a Potential Growth Strategy for a Small Business : A Case of Sam-Chi Fast Food Restaurant

    OpenAIRE

    Odunsi, Sadiq

    2015-01-01

    The purpose of this study was to find out whether Sam-Chi fast food restaurant can grow through franchising as well as to give the owners recommendations on how to effectively adopt the franchising business model as a means to grow their business. Sam-Chi restaurant is situated in Lagos, Nigeria and the restaurant is owned and operated by Samuel Okore and his wife Chichi Okore. The theoretical framework of this research is separated into two sections. The first section covers the growth of a ...

  4. Green Cities : Cities and Climate Change in Brazil

    OpenAIRE

    World Bank

    2011-01-01

    Urban sources of greenhouse gas (GHG) emissions in Brazilian cities are growing. At the national level, the dominance of greenhouse gas emissions from deforestation in Brazil masks the fact that emissions from other sectors, like Energy, Transport and Waste, are growing quite rapidly in cities. Compared to other cities around the world, Brazilian cities have low per capita GHG emissions be...

  5. Cities within Cities: An Urbanization Approach in the Gulf Countries

    OpenAIRE

    Bamakhrama, Salim Salah

    2015-01-01

    Within Dubai, nineteen out of the original 112 mega-projects carried the word city in their names, a phenomenon that is common in Gulf cities such as Dubai, Riyadh and Abu Dhabi. To further explore this phenomenon, this thesis focuses on three aspects that affect the dynamic relationship between the primary city and the cities within cities (sub-cities) in the Gulf region with special emphasis on Dubai. First, the naming problem of the sub-city illustrates why the tension between competing id...

  6. Postsovkhoz City & Postsovkhoz Person

    Index Scriptorium Estoniae

    2001-01-01

    Põlvamaal Moostes mõtte- ja keskkonnakunstitalgud "Postsovkhoz City" ja "Postsovkhoz Person". Näha saab endistesse tööstushoonetesse ülespandud näitusi ja installatsioone. 11. VIII esinejad, ettekanded.

  7. Different Creative Cities

    DEFF Research Database (Denmark)

    Lorenzen, Mark; Vaarst Andersen, Kristina

    2012-01-01

    This article uses a mixed-method study of Denmark to investigate whether and how Richard Florida's creative class theory should be adapted to small welfare economies. First, we carry out an econometric analyses showing that like in North America, the Danish creative class propels economic growth...... and exhibits a tendency of congregating in major cities with diverse service and cultural offers and tolerance to non-mainstream lifestyles. However, we find that a range of smaller Danish cities also attract the creative class. Second, we undertake qualitative interviews that facilitate theory building. We...... suggest that many creatives are attracted by the smaller cities' cost advantages, specialized job offers, attractive work/life balances, and authenticity and sense of community. The article synthesizes its results into four stylized types of creative cities, and concludes by discussing the policy...

  8. OpenCities Project

    Data.gov (United States)

    US Agency for International Development — The Open Cities Project aims to catalyze the creation, management and use of open data to produce innovative solutions for urban planning and resilience challenges...

  9. WE LOVE THE CITY

    DEFF Research Database (Denmark)

    2011-01-01

    WE LOVE THE CITY Byen i bygningen, bygningen i byen Lasse Andersson, Ph.d., arkitekt maa, adjunkt ved Aalborg Universitet Med udstillingen WE LOVE THE CITY vil vi formidle mødet mellem urban design oog arkitektur. Disciplinen ’at bygge by’ har de seneste 20 år ikke tændt hjerterne hos...... fjern og ’usexet’ for unge arkitekter in spe. Det kan fremtidens by ikke være tjent med, og WE LOVE THE CITY vil derfor gerne vise alle, der færdes i byen og bruger dens arkitektur, at her er et potentiale. Med udstillingen WE LOVE THE CITY ønsker Utzon Centeret, LasseVegas Kontoret ApS og ADEPT...

  10. Should Cities Regulate Graffiti?

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Graffiti, while still a new phenomenon to most Chinese, is becoming more familiar among teenagers in big cities like Beijing and Shanghai. A recent report by Xinhua News Agency discusses the trend. The report said a small

  11. Towards Intelligently - Sustainable Cities?

    Directory of Open Access Journals (Sweden)

    Luca Salvati

    2013-04-01

    Full Text Available In the quest for achieving sustainable cities, Intelligent and Knowledge City Programmes (ICPs and KCPs represent cost-efficient strategies for improving the overall performance of urban systems. However, even though nobody argues on the desirability of making cities “smarter”, the fundamental questions of how and to what extent can ICPs and KCPs contribute to the achievement of urban sustainability lack a precise answer. In the attempt of providing a structured answer to these interrogatives, this paper presents a methodology developed for investigating the modalities through which ICPs and KCPs contribute to the achievement or urban sustainability. Results suggest that ICPs and KCPs efficacy lies in supporting cities achieve a sustainable urban metabolism through optimization, innovation and behavior changes.

  12. Other city symphonies

    OpenAIRE

    Hielscher, Eva; Jacobs, Steven

    2015-01-01

    Catalogue description of the film program curated by Eva Hielscher and Steven Jacobs on 'Other City Symphonies' during the 2015 Pordenone Silent Film Festival, including paragraphs on individual films.

  13. Simulacrum City / Triin Ojari

    Index Scriptorium Estoniae

    Ojari, Triin, 1974-

    2000-01-01

    Veneetsia 7. arhitektuuribiennaali Eesti ekspositsiooni kataloogist Simulacrum City. Tallinn : Eesti Arhitektide Liit, 2000. Teksti autorid Anders Härm, Tarmo Maiste, Andres Kurg, Harry Charrington, kujundaja Jaanus Tamme, fotod Arne Maasik

  14. Earthquakes in cities revisited

    CERN Document Server

    Wirgin, Armand

    2016-01-01

    During the last twenty years, a number of publications of theoretical-numerical nature have appeared which come to the apparently-reassuring conclusion that seismic motion on the ground in cities is smaller than what this motion would be in the absence of the buildings (but for the same underground and seismic load). Other than the fact that this finding tells nothing about the motion within the buildings, it must be confronted with the overwhelming empirical evidence (e.g, earthquakes in Sendai (2011), Kathmandu (2015), Tainan City (2016), etc.) that shaking within buildings of a city is often large enough to damage or even destroy these structures. I show, on several examples, that theory can be reconciled with empirical evidence, and suggest that the crucial subject of seismic response in cities is in need of more thorough research.

  15. Pyrite alteration and neoformed magnetic minerals in the fault zone of the Chi-Chi earthquake (Mw7.6, 1999): Evidence for frictional heating and co-seismic fluids

    Science.gov (United States)

    Chou, Yu-Min; Song, Sheng-Rong; Aubourg, Charles; Song, Yen-Fang; Boullier, Anne-Marie; Lee, Teh-Quei; Evans, Mark; Yeh, En-Chao; Chen, Yi-Ming

    2012-08-01

    During an earthquake, physical and chemical transformations lead to alteration and formation of minerals in the gouge layer. Altered and neoformed minerals can be used as tracers of some earthquake processes. In this study, we investigate pyrite and magnetic minerals within the host Chinshui siltstone and the 16-cm-thick gouge. This gouge hosts the principal slip zone of Chi-Chi earthquake (Mw7.6, 1999). In the Chinshui siltstone, pyrite framboids of various sizes and euhedral pyrite are observed. The magnetic mineral assemblage comprises stoichiometric magnetite, greigite, and fine-grained pyrrhotite. The pyrite content is generally reduced in the gouge compared to the wall rock. The magnetic mineral assemblage in the gouge consists of goethite, pyrrhotite, and partially oxidized magnetite. The pyrrhotite, goethite and some magnetite are neoformed. Pyrrhotite likely formed from high temperature decomposition of pyrite (>500°C) generated during co-seismic slip of repeated earthquakes. Goethite is inferred to have formed from hot aqueous co-seismic fluid (>350°C) in association with the 1999 Chi-Chi event. Elevated fluid temperatures can also explain the partial alteration of magnetite and the retrograde alteration of some pyrrhotite to pyrite. We suggest that characterization of neoformed magnetic minerals can provide important information for studying earthquake slip zones in sediment-derived fault gouge.

  16. 池莉小说的女性形象塑造的演变 EVOLUTION OF THE WOMEN IMAGES IN CHI LIS NOVEL

    OpenAIRE

    Mariana

    2012-01-01

    Chi Li, one of the outstanding women writers in the 1980s, portrays various images of women in her works. Female image that Chi Li describe is from obedient to tradition type until self determination and independence, and gain a clairvoyance of that females culture existence state and the value conception separately. Chi Li thinks deeply of the meaning of Chinese females life, in search of the culture value of contemporary female throughout the different female images, which figured in the...

  17. Appropriate Model for Zoning Local Fish Conservation in front of Buddhist Temple on the Bank of the Chi River by Sustainable Community Participation

    OpenAIRE

    Somchob Poo-Inna; Song-Koon Jantakajon; Terdthai Pantachai

    2009-01-01

    Problem statement: The fresh water fish in The Chi River was a major source of food of people living in this area. The objectives of this research were: (1) to study the historical background, current situation and problems of local fish conservation in front of The Chi River by community participation and (2) to find the opriate model for zoning the local fish conservation on the bank of The Chi River by sustainable community participation. Approach: The research area in Esan Reg...

  18. Effects of Tai Chi versus Proprioception Exercise Program on Neuromuscular Function of the Ankle in Elderly People: A Randomized Controlled Trial

    OpenAIRE

    Jing Liu; Xue-Qiang Wang; Jie-Jiao Zheng; Yu-Jian Pan; Ying-Hui Hua; Shang-Min Zhao; Li-Yan Shen; Shuai Fan; Jiu-Gen Zhong

    2012-01-01

    Background. Tai Chi is a traditional Chinese medicine exercise used for improving neuromuscular function. This study aimed to investigate the effects of Tai Chi versus proprioception exercise program on neuromuscular function of the ankle in elderly people. Methods. Sixty elderly subjects were randomly allocated into three groups of 20 subjects per group. For 16 consecutive weeks, subjects participated in Tai Chi, proprioception exercise, or no structured exercise. Primary outcome measures in...

  19. EFFECTS OF TAI CHI EXERCIE ON ATTENTION IN HEALTHY ELDERLY SUBJECTS AS MEASURED BY NEAR-INFRARED SPECTROSCOPY DURING THE STROOP TASK

    OpenAIRE

    Wang, Wenchao; Qiu, Chen; Ota, Toyosaku; Sawada, Masayuki; Kishimoto, Naoko; Kishimoto, Toshifumi

    2013-01-01

    Background: To our knowledge,there is no study that has examined the effect of Tai Chi exercise(Tai Chi) on attention function using functional brain imaging methodologies. Recent developments in near-infrared spectroscopy(NIRS) have enabled non-invasive clarification of brain functions by measurement of hemoglobin concentrations as cerebral blood volume. So, in the present study, we examined the effects of Tai Chi in the healthy elderly as measured by NIRS during the Stroop task. Methods: Tw...

  20. City, ICT and Policy

    OpenAIRE

    Galit Cohen; Peter Nijkamp

    2004-01-01

    New technologies tend to exert a profound influence on modern city life. This paper addresses the role of information and communication technologies (ICT) in the city. After a broad overview of the potential of ICT in a geographical setting and its possible impact on urban policy in regard to the ICT sector, the paper focusses attention on urban public policy in regard to the ICT sector. This study offers the proposition that urban ICT policy is driven by the stakeholders attitudinal and perc...

  1. Feeding the City

    OpenAIRE

    Roncaglia, Sara; Giorgio Solinas, Pier

    2015-01-01

    Every day in Mumbai 6,000 dabbawalas (literally translated as "those who carry boxes") distribute a staggering 200,000 home-cooked lunchboxes to the city's workers and students. Giving employment and status to thousands of largely illiterate villagers from Mumbai's hinterland, this co-operative has been in operation since the late nineteenth century. It provides one of the most efficient delivery networks in the world: only one lunch in six million goes astray. Feeding the City is an ethnogr...

  2. Aging City Leads Way

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    The northern city of Dalian has become a model of care for the elderly that other Chinese cities are following Chinese Minister of Civil Affairs Li Xueju has called upon civil affairs agencies in the nation to learn from Dalian’s diversified models for elderly care,ranging from running collectively owned and foreign-designed nursing homes to offering tax incentives to private households and companies serving the elderly

  3. Improving the City environment

    International Nuclear Information System (INIS)

    All around the world cities are under severe environmental pressure. Water supplies, traffic congestion, air pollution, noise and waste disposal cause very similar problems in cities that are otherwise quite diverse. And attempts to improve conditions usually run into a range of difficulties. Indeed, environmental problems often persist for years before governments -national, regional and local- make any major effort to address them. 6 refs

  4. Cities in Transition

    OpenAIRE

    Shepotylo Oleksandr

    2012-01-01

    This paper looks at the urban development of transition countries in 1991–2010, primarily focusing on the last decade. Cities in transition face a unique set of challenges that came forth due to interplay of the legacy of socialist urban policies and the transition to the market economy. The socialist urban policies restrained growth of the largest cities and distorted the spatial equilibrium towards more uniform distribution of urban population. The transition to the market economy reduces d...

  5. The Happiness of Cities

    OpenAIRE

    Florida, Richard; Mellander, Charlotta; Rentfrow, Jason

    2011-01-01

    Abstract Research on subjective well-being has focused on cross-national differences, while research on cities and regions has shown that human capital is a key factor in metropolitan income and related outcomes. This investigation tests the hypothesis that human capital will have a significant effect on well-being at the metropolitan scale. Using metropolitan level data from the 2009 Gallup-Healthways Survey, we examine the effects of human capital on city happiness alongside many...

  6. Towards smart city education

    OpenAIRE

    Wolff, Annika; Kortuem, Gerd; Cavero, Jose

    2015-01-01

    Sustainability has been an important topic in UK schools for some time, most notably since the Sustainable School Strategy was proposed by the UK Department for Education (DFES) in 2006. However, as smart city technologies emerge and show real promise in contributing to a more sustainable future, it is becoming apparent that new skills for working with the big urban data sets that drive these innovations must be taught to upcoming generations to ensure that they can be active smart city citiz...

  7. Innovation across cities

    OpenAIRE

    Soo, Kwok Tong

    2015-01-01

    This paper examines the distribution of patenting activity across cities in the OECD, using a sample of 218 cities from 2000 to 2008. We obtain three main results. First, patenting activity is more concentrated than population and GDP. Second, patenting activity is less persistent than population and GDP. Third, patenting exhibits mean-reversion, and is positively associated with GDP, the fragmentation of local government, and population density. Our results suggest that policymakers can infl...

  8. Small Cell City

    OpenAIRE

    Dehghan, S.; Steele, R.

    1997-01-01

    Traditionally, mobile operators have planned their networks to accommodate mobile terminals at ground level. Increasingly, mobile users communicate while stationary from within high-rise buildings. With mobiles operating at a variety of different heights and mobilities, plus the requirement to accommodate increasing teletraffic and multimedia services, there is a need to compact small cells into the three-dimensional city space. This article is concerned with using city buildings to act as el...

  9. Active City Administration

    OpenAIRE

    M .R. Sindhu; Viraj M. Jamle; Pramod M. Shelke; Shrikant G. Baheti

    2012-01-01

    The basic and universal corner stone of good governance are quality of service, quick response mechanisms and above all accountable and transparent process mechanism. The active city administration initiatives resulted in computerization of the legacy systems in government with limited ability to internalize the advances in information and communication technologies.By using active city administration services we able to know real time, quantitative and basic approach of the government servic...

  10. Cities and Skills

    OpenAIRE

    Glaeser, Edward L.; Mare, David C.

    1994-01-01

    This paper examines the productivity (and wage) gains from locating in dense, urban environments. We distinguish between three potential explanations of why firms are willing to pay urban workers more: (1) the urban wage premium is spurious and is the result of omitted ability measures, (2) the urban wage premium works because cities enhance productivity and (3) the urban wage premium is the result of faster skill accumulation in cities. Using a combination of standard regressions, individual...

  11. Japanese Companies Operating in South Vietnam (Japanese)

    OpenAIRE

    SEKI Mitsuhiro

    2004-01-01

    This paper analyzes the results of a survey conducted in Vietnam in late 2003 and forms part of a research project aimed at clarifying the current situation in Vietnam as the country enters a new stage in its development by interpreting the impact made by Japanese companies operating there. The first phase of the research focuses on Japanese companies with a certain amount of experience in Vietnam that operate around Ho Chi Minh City in the southern part of the country, including machinery an...

  12. Freezing Warm Christmas

    Institute of Scientific and Technical Information of China (English)

    NGUYEN; THI; CAM; PHUNG

    2007-01-01

    A lot of Beijing expats carp at Christmas here because of celebra- tion allegedly without regard for its true spirit. Not me. I’m from Ho Chi Minh City,Viet Nam,where Christmas is more like Mardi Gras than a celebration of Jesus Christ’s birth. Granted,on December 25,people gather in droves at"one particular church"in Saigon,as we still like to say.But what happens there is anything but holy. Mayhem,if not murder,ensues.

  13. Juvenile systemic lupus erythematosus onset patterns in Vietnamese children

    DEFF Research Database (Denmark)

    Dung, Nguyen Thi Ngoc; Loan, Huynh Thoai; Nielsen, Susan;

    2013-01-01

    have systemic lupus erythematosus (f/m = 4/1) were referred to the Ho Chi Minh City Children's Hospital No.1 during a 12-month period in 2009. RESULTS: The mean age at diagnosis was 12.8 years (SD = 2.5). Thirty-seven (82%) fulfilled criteria for lupus nephritis (LN). At diagnosis, impressively high...... No. 1 during a16 month period from 2008-2009. These patients had a strikingly high prevalence of Coombs positive anaemia, a high prevalence of lupus nephritis, and very high SLEDAI and ECLAM scores at the time of diagnosis. While there may be referral biases, our Vietnamese SLE patients appear to...

  14. Hackable Cities : From Subversive City Making to Systemic Change

    OpenAIRE

    de Lange, M.L.; de Waal, Martijn; Foth, Marcus; Verhoeff, Nanna; Martin, Brynskov

    2015-01-01

    The DC9 workshop takes place on June 27, 2015 in Limerick, Ireland and is titled "Hackable Cities: From Subversive City Making to Systemic Change". The notion of "hacking" originates from the world of media technologies but is increasingly often being used for creative ideals and practices of city making. "City hacking" evokes more participatory, inclusive, decentralized, playful and subversive alternatives to often top-down ICT implementations in smart city making. However, these discourses ...

  15. City marketing: online communication plan for the city of Lisbon

    OpenAIRE

    Altrichter, Benjamin

    2011-01-01

    Mestrado em Marketing City Marketing represents marketing efforts of cities in order to attract more visitors. Today, we are confronted everyday with marketing campaigns in all different communication media promoting countries, cities or events. Cities are competing for visitors on a global scale, forcing them to adapt successful marketing strategies for gaining and retaining costumers. Yet, City Marketing still remains an unknown chapter for a big part of the general public an...

  16. Cross-Sectional Comparison of Executive Attention Function in Normally Aging Long-Term T'ai Chi, Meditation, and Aerobic Fitness Practitioners Versus Sedentary Adults

    OpenAIRE

    Hawkes, Teresa D; Manselle, Wayne; Woollacott, Marjorie H

    2014-01-01

    This cross-sectional field study documented the effect of long-term t'ai chi, meditation, or aerobic exercise training versus a sedentary lifestyle on executive function. It was predicted that long-term training in t'ai chi and meditation plus exercise would produce greater benefits to executive function than aerobic exercise. T'ai chi and meditation plus exercise include mental and physical training. Fifty-four volunteers were tested: t'ai chi (n=10); meditation+exercise (n=16); aerobic exer...

  17. What have we learned from HaChi (HAZE IN CHINA) project?

    Science.gov (United States)

    Zhao, Chunsheng; Wiedensohler, Alfred

    2016-04-01

    HaChi (Haze in China) project, a joint research between Chinese NSFC and German DFG, focuses on investigating the aerosol hygroscopic properties in the North China Plain and their relationships to aerosol optics, radiation, cloud physics and ozone photochemistry. As we know, Eastern China has suffered from severe pollution caused by large concentrations of aerosol particles resulting from emissions from fossil fuel and biomass burning, transportation and some other combustion sources. Low visibility events are frequently encountered and mainly accompanied with haze as a result of either high aerosol loading or the strong hygroscopic growth of the aerosol particles. Especially at relative humidities between 90 and 99%, the aerosol particles grow exponentially. The hygroscopic behaviors at relative humidities close to 100% are also strongly linked to the particles ability to grow into cloud droplets at supersaturation. In my talk, I will present an overview of the up to date results from a serial of intensive and comprehensive field campaigns conducted at the sites of Wuqing and Xianghe, China, between 2009 and 2014. The measurements of the ambient aerosol hygroscopic properties at high RH between 90 and 98.5% are reported first. These in situ field measurements of atmospheric aerosol are unique with respect to their high RH range and especially of importance to better understand the widespread anthropogenic haze over the North China Plain. Then I will introduce the methods for calculating of aerosol hygroscopicity and their parameterization schemes derived from size-segregated chemical composition and the light scattering enhancement factor measurements in the North China Plain. A new method was proposed to retrieve the ratio of the externally mixed light absorbing carbon mass to the total mass of light absorbing carbon. A new parameterization scheme of light extinction for low visibilities on hazy days is proposed based on visibility, relative humidity, aerosol

  18. Green tea polyphenols and Tai Chi for bone health: Designing a placebo-controlled randomized trial

    Directory of Open Access Journals (Sweden)

    Chyu Ming-Chien

    2009-09-01

    Full Text Available Abstract Background Osteoporosis is a major health problem in postmenopausal women. Evidence suggests the importance of oxidative stress in bone metabolism and bone loss. Tea consumption may be beneficial to osteoporosis due to its antioxidant capability. However, lack of objective data characterizing tea consumption has hindered the precise evaluation of the association between tea ingestion and bone mineral density in previous questionnaire-based epidemiological studies. On the other hand, although published studies suggest that Tai Chi (TC exercise can benefit bone health and may reduce oxidative stress, all studies were conducted using a relatively healthy older population, instead of a high-risk one such as osteopenic postmenopausal women. Therefore, this study was designed to test an intervention including green tea polyphenol (GTP and TC exercise for feasibility, and to quantitatively assess their individual and interactive effects on postmenopausal women with osteopenia. Methods/Design One hundred and forty postmenopausal women with osteopenia (defined as bone mineral density T-score at the spine and/or hip between 1 to 2.5 SD below the reference database were randomly assigned to 4 treatment arms: (1 placebo group receiving 500 mg medicinal starch daily, (2 GTP group receiving 500 mg of GTP per day, (3 placebo+TC group receiving both placebo treatment and TC training (60-minute group exercise, 3 times per week, and (4 GTP+TC group receiving both GTP and TC training for 24 weeks. The outcome measures were bone formation biomarker (serum bone alkaline phosphatase, bone resorption biomarker (serum tartrate resistant acid phosphatase, and oxidative DNA damage biomarker (urinary 8-hydroxy-2'-deoxyguanosine. All outcome measures were determined at baseline, 4, 12, and 24 weeks. Urinary and serum GTP concentrations were also determined at baseline, 4, 12, and 24 weeks for bioavailability. Liver function was monitored monthly for safety. A

  19. Plasma YKL-40 and CHI3L1 in systemic inflammation and sepsis—Experience from two prospective cohorts

    DEFF Research Database (Denmark)

    Kornblit, Brian; Hellemann, Dorthe; Munthe-Fog, Lea;

    2013-01-01

    YKL-40, derived from the CHI3L1 gene, has been associated with outcome of infectious and inflammatory diseases. We hypothesized that plasma YKL-40 concentrations and CHI3L1 genotype could be used as prognostic biomarkers in the assessment of systemic inflammatory response syndrome (SIRS) and sepsis....... The objective of the study was to assess the prognostic value of plasma YKL-40 and CHI3L1 genotype in patients with SIRS and sepsis. Plasma YKL-40 and CHI3L1 genotype (rs4950928) were analyzed at time of admission to intensive care units (ICU), in two prospective cohorts of consecutive SIRS patients...... (cohort 1, n=272; cohort 2, n=502). The plasma YKL-40 cut-off for predicting survival was determined in cohort 1 by receiver operator characteristic analyses and validated in cohort 2. In cohort 1 patients with plasma YKL-40 ≤505ng/ml (area under the curve 0.64 (95% confidence interval (CI) 0.57-0.70), p...

  20. Observation of chi(c1) Decays into Vector Meson Pairs phi phi, omega omega, and omega phi

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; An, L.; An, Q.; An, Z. H.; Bai, J. Z.; Baldini, R.; Ban, Y.; Becker, J.; Berger, N.; Bertani, M.; Bian, J. M.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Bytev, V.; Cai, X.; Cao, G. F.; Cao, X. X.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, Y.; Chen, Y. B.; Cheng, H. P.; Chu, Y. P.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dedovich, D.; Deng, Z. Y.; Denysenko, I.; Destefanis, M.; Ding, Y.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Duan, M. Y.; Fan, R. R.; Fang, J.; Fang, S. S.; Feng, C. Q.; Fu, C. D.; Fu, J. L.; Gao, Y.; Geng, C.; Goetzen, K.; Gong, W. X.; Greco, M.; Grishin, S.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y. P.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, M.; He, Z. Y.; Heng, Y. K.; Hou, Z. L.; Hu, H. M.; Hu, J. F.; Hu, T.; Huang, B.; Huang, G. M.; Huang, J. S.; Huang, X. T.; Huang, Y. P.; Hussain, T.; Ji, C. S.; Ji, Q.; Ji, X. B.; Ji, X. L.; Jia, L. K.; Jiang, L. L.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jing, F. F.; Kavatsyuk, M.; Komamiya, S.; Kuehn, W.; Lange, J. S.; Leung, J. K. C.; Li, Cheng; Li, Cui; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, Lei; Li, N. B.; Li, Q. J.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, X. R.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Liao, X. T.; Liu, B. J.; Liu, B. J.; Liu, C. L.; Liu, C. X.; Liu, C. Y.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, G. C.; Liu, H.; Liu, H. B.; Liu, H. M.; Liu, H. W.; Liu, J. P.; Liu, K.; Liu, K. Y.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. H.; Liu, Y. B.; Liu, Y. W.; Liu, Yong; Liu, Z. A.; Liu, Z. Q.; Loehner, H.; Lu, G. R.; Lu, H. J.; Lu, J. G.; Lu, Q. W.; Lu, X. R.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Ma, C. L.; Ma, F. C.; Ma, H. L.; Ma, Q. M.; Ma, T.; Ma, X.; Ma, X. Y.; Maggiora, M.; Malik, Q. A.; Mao, H.; Mao, Y. J.; Mao, Z. P.; Messchendorp, J. G.; Min, J.; Mitchell, R. E.; Mo, X. H.; Muchnoi, N. Yu.; Nefedov, Y.; Ning, Z.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Pelizaeus, M.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Pun, C. S. J.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, X. S.; Qiu, J. F.; Rashid, K. H.; Rong, G.; Ruan, X. D.; Sarantsev, A.; Schulze, J.; Shao, M.; Shen, C. P.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, X. Y.; Sonoda, S.; Spataro, S.; Spruck, B.; Sun, D. H.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, X. D.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tang, X. F.; Tian, H. L.; Toth, D.; Varner, G. S.; Wan, X.; Wang, B. Q.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q.; Wang, S. G.; Wang, X. L.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. Y.; Wei, D. H.; Wen, Q. G.; Wen, S. P.; Wiedner, U.; Wu, L. H.; Wu, N.; Wu, W.; Wu, Z.; Xiao, Z. J.; Xie, Y. G.; Xu, G. F.; Xu, G. M.; Xu, H.; Xu, Y.; Xu, Z. R.; Xu, Z. Z.; Xue, Z.; Yan, L.; Yan, W. B.; Yan, Y. H.; Yang, H. X.; Yang, M.; Yang, T.; Yang, Y.; Yang, Y. X.; Ye, M.; Ye, M. H.; Yu, B. X.; Yu, C. X.; Yu, L.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, L.; Zhang, S. H.; Zhang, T. R.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, H. S.; Zhao, Jiawei; Zhao, Jingwei; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, X. H.; Zhao, Y. B.; Zhao, Z. G.; Zhao, Z. L.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, Y. H.; Zheng, Z. P.; Zhong, B.; Zhong, J.; Zhong, L.; Zhou, L.; Zhou, X. K.; Zhou, X. R.; Zhu, C.; Zhu, K.; Zhu, K. J.; Zhu, S. H.; Zhu, X. L.; Zhu, X. W.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Zuo, J. X.; Zweber, P.

    2011-01-01

    Using (106 +/- 4) x 10(6) psi(3686) events accumulated with the BESIII detector at the BEPCII e(+) e(-) collider, we present the first measurement of decays of chi(c1) to vector meson pairs phi phi, omega omega, and omega phi. The branching fractions are measured to be (4.4 +/- 0.3 +/- 0.5) x 10(-4)

  1. Effectiveness of a Tai-Chi Training and Detraining on Functional Capacity, Symptomatology and Psychological Outcomes in Women with Fibromyalgia

    Directory of Open Access Journals (Sweden)

    Alejandro Romero-Zurita

    2012-01-01

    Full Text Available Background. The purpose was to analyze the effects of Tai-Chi training in women with fibromyalgia (FM. Methods. Thirty-two women with FM (mean age, 51.4±6.8 years attended to Tai-Chi intervention 3 sessions weekly for 28 weeks. The outcome measures were: tenderness, body composition, functional capacity and psychological outcomes (Fibromyalgia impact questionnaire (FIQ, Short Form Health Survey 36 (SF-36. Results. Patients showed improvements on pain threshold, total number of tender points and algometer score (all <0.001. The intervention was effective on 6-min walk (=0.006, back scratch (=0.002, handgrip strength (=0.006, chair stand, chair sit & reach, 8 feet up & go and blind flamingo tests (all <0.001. Tai-Chi group improved the FIQ total score (<0.001 and six subscales: stiffness (=0.005, pain, fatigue, morning tiredness, anxiety, and depression (all <0.001. The intervention was also effective in six SF-36 subscales: bodily pain (=0.003, vitality (=0.018, physical functioning, physical role, general health, and mental health (all <0.001. Conclusions. A 28-week Tai-Chi intervention showed improvements on pain, functional capacity, symptomatology and psychological outcomes in female FM patients.

  2. A bijection which implies Melzer's polynomial identities: the $\\chi_{1,1}^{(p,p+1)}$ case

    OpenAIRE

    Foda, O.; Warnaar, S. O.

    1995-01-01

    We obtain a bijection between certain lattice paths and partitions. This implies a proof of polynomial identities conjectured by Melzer. In a limit, these identities reduce to Rogers--Ramanujan-type identities for the $\\chi_{1,1}^{(p,p+1)}(q)$ Virasoro characters, conjectured by the Stony Brook group.

  3. A bijection which implies Melzer's polynomial identities the $\\chi${1,1}^{(p,p+1)} case

    CERN Document Server

    Foda, O E; Foda, O; Warnaar, S O

    1995-01-01

    We obtain a bijection between certain lattice paths and partitions. This implies a proof of polynomial identities conjectured by Melzer. In a limit, these identities reduce to Rogers--Ramanujan-type identities for the \\chi_{1,1}^{(p,p+1)}(q) Virasoro characters, conjectured by the Stony Brook group.

  4. Measures of effect size for chi-squared and likelihood-ratio goodness-of-fit tests.

    Science.gov (United States)

    Johnston, Janis E; Berry, Kenneth J; Mielke, Paul W

    2006-10-01

    A fundamental shift in editorial policy for psychological journals was initiated when the fourth edition of the Publication Manual of the American Psychological Association (1994) placed emphasis on reporting measures of effect size. This paper presents measures of effect size for the chi-squared and the likelihood-ratio goodness-of-fit statistic tests. PMID:17165404

  5. The effects of Tai Chi on fall prevention, fear of falling and balance in older people: a meta-analysis.

    NARCIS (Netherlands)

    Logghe, I.H.; Verhagen, A.P.; Rademaker, A.C.; Bierma-Zeinstra, S.M.; Rossum, E. van; Faber, M.J.; Koes, B.W.

    2010-01-01

    OBJECTIVE: Tai Chi (TC) is an exercise training that is becoming increasingly popular as an intervention for single fall prevention. This meta-analysis was performed to evaluate the efficacy of TC on fall rate, fear of falling and balance in older people. METHODS: Randomized controlled trials publis

  6. Feasibility and effectiveness of a Chen-style Tai Chi programme for stress reduction in junior secondary school students.

    Science.gov (United States)

    Lee, Linda Y K; Chong, Yeuk Lan; Li, Ngai Yin; Li, Man Chung; Lin, Lai Na; Wong, Lee Yi; Wong, Brian Kit; Yip, Wing Ping; Hon, Cho Hang; Chung, Pui Kuen; Man, Shuk Yee

    2013-04-01

    Stress is common in junior secondary school students (JSSS). This study aimed to determine the feasibility and effectiveness of a Chen-style Tai Chi programme for stress reduction in JSSS. A non-equivalent pre-test/post-test control group design was adopted, and a convenience sample of 69 JSSS was recruited. The experimental group (n = 32) joined a Chen-style Tai Chi programme, which included 10 sessions of 80-minute Tai Chi training (one session per week). The control group (n = 37) proceeded with self-study. Participants' stress levels were assessed using the Perceived Stress Scale. Feasibility was determined as the percentage of participants completing and attending the programme. Effectiveness was measured as the significant difference in changes in stress levels before and after the intervention between the two groups. Results preliminarily supported that the programme was feasible for JSSS. Completion rate was 100%, and attendance rate was 90%. However, no significant difference was noted in changes in stress levels before and after the intervention between the two groups. The potential health benefits of Tai Chi could not be detected owing to the restrictions imposed by the research setting and study limitations. The present study represents initial efforts in this direction and serves as reference for future study. PMID:22674634

  7. Fragmentation contributions to hadroproduction of prompt $J/\\psi$ and $\\chi_{cJ}$ states

    CERN Document Server

    Bodwin, Geoffrey T; Chung, Hee Sok; Kim, U-Rae; Lee, Jungil; Ma, Yan-Qing

    2015-01-01

    We compute fragmentation corrections to hadroproduction of the quarkonium states $J/\\psi$, $\\chi_{cJ}$, and $\\psi(2S)$ at leading power in $m_c/p_T$, where $m_c$ is the charm-quark mass and $p_T$ is the quarkonium transverse momentum. The computation is carried out in the framework of nonrelativistic QCD. We include corrections to the parton-production cross sections through next-to-leading order in the strong coupling $\\alpha_s$ and corrections to the fragmentation functions through second order in $\\alpha_s$. We also sum leading logarithms of $p_T^2/m_c^2$ to all orders in perturbation theory. We find that, when we combined these leading-power fragmentation corrections with fixed-order calculations through next-to-leading order in $\\alpha_s$, we are able to obtain good fits for $p_T\\geq 10$ GeV to hadroproduction cross sections that were measured at the Tevatron and the LHC. Using values for the nonperturbative long-distance matrix elements that we extract from the cross-section fits, we make predictions fo...

  8. Impacts of Land Cover Changes on Hydrologic Responses: A Case Study of Chi River Basin, Thailand

    Science.gov (United States)

    Homdee, Tipaporn; Pongput, Kobkiat; Kanae, Shinjiro

    Land use and land cover (LULC) have been continuously changing, through human activities, leading to variations in hydrological cycle. In this study, we applied SWAT model to investigate potential impacts of LULC on water budget of the Chi river basin in Thailand. Five plausible scenarios of land use change were evaluated, including an conversion of forested area, expansion of farmland, switching of rice paddy fields to energy crops and two scenarios involving conversion of farmland to rice and sugarcane plantation. The results indicated that different land use scenarios contributed to various effects in annual and seasonal water yield and evapotranspiration (ET). Conversion of forested area and farmland showed slightly small changes on water flows and ET. Substitution of paddy fields by sugarcane plantation showed clearly reduced water flows and increased ET by almost 5.0% in dry season. Particularly, in case of expansion of rice paddy fields to farmland, small changes occur on annual flow and ET but more significant effect occur on seasonal flows. The results showed decrease in ET by nearly 12.0%, leading to increase of water yield by up to 5.1% during dry season. Finally, conversion of farmland to sugarcane plantation for biofuel production showed significant effect on seasonal ET, mainly decreasing in dry season by 4.5 % but small changes were detected on water yields.

  9. Tai chi chuan exercise for patients with breast cancer: a systematic review and meta-analysis.

    Science.gov (United States)

    Pan, Yuanqing; Yang, Kehu; Shi, Xiue; Liang, Haiqian; Zhang, Fengwa; Lv, Qingfang

    2015-01-01

    Objective. Tai Chi Chuan (TCC) is a form of aerobic exercise that may be an effective therapy for improving psychosomatic capacity among breast cancer survivors. This meta-analysis analyzed the available randomized controlled trials (RCTs) on the effects of TCC in relieving treatment-related side effects and quality of life in women with breast cancer. Methods. RCTs were searched in PubMed, Embase, Web of Science, and Cochrane Library through April 2014. Data were analyzed on pathology (pain, interleukin-6, and insulin-like growth factor 1), physical capacity (handgrip, limb physical fitness, and BMI), and well-being (physical, social, emotional, and general quality of life). Results. Nine RCTs, including a total of 322 breast cancer patients, were examined. Compared with control therapies, the pooled results suggested that TCC showed significant effects in improving handgrip dynamometer strength, limb elbow flexion (elbow extension, abduction, and horizontal adduction). No significant differences were observed in pain, interleukin-6, insulin-like growth factor, BMI, physical well-being, social or emotional well-being, or general health-related quality of life. Conclusion. The short-term effects of TCC may have potential benefits in upper limb functional mobility in patients with breast cancer. Additional randomized controlled trials with longer follow-up are needed to provide more reliable evidence. PMID:25793000

  10. Tai Chi Chuan Exercise for Patients with Breast Cancer: A Systematic Review and Meta-Analysis

    Directory of Open Access Journals (Sweden)

    Yuanqing Pan

    2015-01-01

    Full Text Available Objective. Tai Chi Chuan (TCC is a form of aerobic exercise that may be an effective therapy for improving psychosomatic capacity among breast cancer survivors. This meta-analysis analyzed the available randomized controlled trials (RCTs on the effects of TCC in relieving treatment-related side effects and quality of life in women with breast cancer. Methods. RCTs were searched in PubMed, Embase, Web of Science, and Cochrane Library through April 2014. Data were analyzed on pathology (pain, interleukin-6, and insulin-like growth factor 1, physical capacity (handgrip, limb physical fitness, and BMI, and well-being (physical, social, emotional, and general quality of life. Results. Nine RCTs, including a total of 322 breast cancer patients, were examined. Compared with control therapies, the pooled results suggested that TCC showed significant effects in improving handgrip dynamometer strength, limb elbow flexion (elbow extension, abduction, and horizontal adduction. No significant differences were observed in pain, interleukin-6, insulin-like growth factor, BMI, physical well-being, social or emotional well-being, or general health-related quality of life. Conclusion. The short-term effects of TCC may have potential benefits in upper limb functional mobility in patients with breast cancer. Additional randomized controlled trials with longer follow-up are needed to provide more reliable evidence.

  11. An Efficient Algorithm for Auto Upload and Chi-Square Test on Application Software

    Directory of Open Access Journals (Sweden)

    Sampada Kembhavi

    2013-06-01

    Full Text Available In this paper we proposed a novel algorithm for auto uploading the data in the cloud environment without any license consideration and suggest a novel framework where data is auto upload after a proper authentication and processing their task (gathering and sharing in the cloud environment. Here we present the authentication process with auto uploading process. We also use the traditional method of data uploading, data gathering and sharing. So that we compare our statistics. We use object oriented programing (OOP programs as a data which is used for data sharing and gathering. We use java programs for comparison. Then we apply Chi-Square test, to test the hypothesis for correctness. Then we check the program capability under three parameters; first is F-measure (FM, second is odds ratio (OR and third is power (PO. Based on the three parameters we can find the better application software as a service approach. Based on the above phenomena we can compare the execution time in different operating application with the help of software quality metrics.

  12. The pragmatic import of pronominal usage in chiShona discourse

    Directory of Open Access Journals (Sweden)

    Pedzisai Mashiri

    2011-08-01

    Full Text Available This article discusses the pragmatic significance of chiShona pronouns by examining the use of different pronouns: personal, enumerative, and demonstrative, and by demonstrating their address and referential value and social meanings. Two important issues are addressed.  First, we demonstrate that a purely grammatical analysis of pronouns, which emphasise the internal analysis and the anaphoric function of pronouns, fails to capture the complexity of pronominal usage in ordinary conversations. Second, the discourses that we analyse in this article demonstrate how in particular communicational contexts, specific speakers use pronouns to index referents other than the ones conventionally associated with a particular pronominal form in an analysis based on grammatical analysis. For example, besides its generic self-reference, the first person pronoun may be used to refer to a second or third person. The second person pronoun, apart from having a second person reference, can, be used as a second first or third person reference. The third person may, apart from its conventional reference, be used to mean either the first or second person. The pronoun switches also involve indirectness, reflecting a wide range of social meanings which have politeness  implications.

  13. Performance test of RM CLEAN and its evaluation with chi-square value

    CERN Document Server

    Miyashita, Yoshimitsu; Takahashi, Keitaro

    2016-01-01

    RM CLEAN is a standard method to reconstruct the distribution of cosmic magnetic fields and polarized sources along the line of sight (LOS) from observed polarization spectrum. This method is similar to the CLEAN algorithm for aperture synthesis radio telescope images but it is rather unclear in what cases RM CLEAN works well. In this paper, we evaluate the performance of RM CLEAN by simulating spectro-polarimetric observations of two compact sources located in the same LOS, varying the relative initial polarization angle and Faraday depth systematically. Especially, we focus on if the two polarized sources can be resolved in the Faraday depth space and how well the source parameters can be estimated. We confirm the previous studies that two sources cannot be resolved when they are closely located in the Faraday depth space for specific values of the relative initial polarization angle. Further, we calculate the chi-square value for the fit between the mock data of polarization spectrum and the one from RM CL...

  14. Numerical investigation and optimization of multi-pulse CHI spheromak performance

    Science.gov (United States)

    O'Bryan, J. B.; Romero-Talamas, C. A.; Woodruff, S.

    2015-11-01

    Nonlinear extended-MHD computation with the NIMROD code is used to explore spheromak formation and sustainment with multi-pulse coaxial helicity injection (CHI). The goal of this research is to optimize spheromak performance in order to find candidate modes of operation for future experimental studies. We are modeling multiple specific shots from the Sustained Spheromak Physics eXperiment (SSPX) to both diagnose the parameters that affect efficiency--in particular, how the injector current and bias flux affect plasma confinement and magnetic helicity content relative to injected power--and to validate the numerical model. Preliminary results show quantitative agreement between several synthetic and experimental diagnostic measurements. The results also find--in addition to changing the magnetic topology and being the mechanism for poloidal flux amplification [E.B. Hooper et al. PPCF 2012]--the non-axisymmetric column mode decreases the decay rate of magnetic helicity relative to the injected current. Operational regimes will eventually be extended beyond those achieved in SSPX. We are also exploring the effect of the flux conserver and injector geometries on spheromak performance. This work is supported by DARPA under grant no. N66001-14-1-4044.

  15. A Deep Spitzer Survey of Circumstellar Disks in the Young Double Cluster, h and chi Persei

    CERN Document Server

    Cloutier, Ryan; Rieke, George; Kenyon, Scott J; Balog, Zoltan; Jayawardhana, Ray

    2014-01-01

    We analyze very deep IRAC and MIPS photometry of $\\sim$ 12,500 members of the 14 Myr old Double Cluster, h and $\\chi$ Persei, building upon on our earlier, shallower Spitzer studies (Currie et al. 2007a, 2008a). Numerous likely members show infrared (IR) excesses at 8 {\\mu}m and 24 $\\mu$m indicative of circumstellar dust. The frequency of stars with 8 $\\mu$m excess is at least 2% for our entire sample, slightly lower (higher) for B/A stars (later type, lower-mass stars). Optical spectroscopy also identifies gas in about 2% of systems but with no clear trend between the presence of dust and gas. Spectral energy distribution (SED) modeling of 18 sources with detections at optical wavelengths through MIPS 24 $\\mu m$ reveals a diverse set of disk evolutionary states, including a high fraction of transitional disks, although similar data for all disk-bearing members would provide better constraints. We combine our results with those for other young clusters to study the global evolution of dust/gas disks. For nomi...

  16. A chi-squared-transformed subspace of LBP histogram for visual recognition.

    Science.gov (United States)

    Ren, Jianfeng; Jiang, Xudong; Yuan, Junsong

    2015-06-01

    Local binary pattern (LBP) and its variants have been widely used in many recognition tasks. Subspace approaches are often applied to the LBP feature in order to remove unreliable dimensions, or to derive a compact feature representation. It is well-known that subspace approaches utilizing up to the second-order statistics are optimal only when the underlying distribution is Gaussian. However, due to its nonnegative and simplex constraints, the LBP feature deviates significantly from Gaussian distribution. To alleviate this problem, we propose a chi-squared transformation (CST) to transfer the LBP feature to a feature that fits better to Gaussian distribution. The proposed CST leads to the formulation of a two-class classification problem. Due to its asymmetric nature, we apply asymmetric principal component analysis (APCA) to better remove the unreliable dimensions in the CST feature space. The proposed CST-APCA is evaluated extensively on spatial LBP for face recognition, protein cellular classification, and spatial-temporal LBP for dynamic texture recognition. All experiments show that the proposed feature transformation significantly enhances the recognition accuracy. PMID:25769153

  17. Tai Chi Chuan Optimizes the Functional Organization of the Intrinsic Human Brain Architecture in Older Adults

    Directory of Open Access Journals (Sweden)

    Gao-Xia eWei

    2014-04-01

    Full Text Available Whether Tai Chi Chuan (TCC can influence the intrinsic functional architecture of the human brain remains unclear. To examine TCC-associated changes in functional connectomes, resting-state functional magnetic resonance images were acquired from 40 older individuals including 22 experienced TCC practitioners (experts and 18 demographically matched TCC-naïve healthy controls, and their local functional homogeneities across the cortical mantle were compared. Compared to the controls, the TCC experts had significantly greater and more experience-dependent functional homogeneity in the right postcentral gyrus (PosCG and less functional homogeneity in the left anterior cingulate cortex (ACC and the right dorsal lateral prefrontal cortex (DLPFC. Increased functional homogeneity in the PosCG was correlated with TCC experience. Intriguingly, decreases in functional homogeneity (improved functional specialization in the left ACC and increases in functional homogeneity (improved functional integration in the right PosCG both predicted performance gains on attention network behavior tests. These findings provide evidence for the functional plasticity of the brain’s intrinsic architecture toward optimizing locally functional organization, with great implications for understanding the effects of TCC on cognition, behavior and health in aging population.

  18. ANAESTHETIC MANAGEMENT IN A PATIENT WITH ARNOLD-CHI ARI MALFORMATION TYPE I AND SYRINGOMYELIA

    Directory of Open Access Journals (Sweden)

    Kartika

    2013-04-01

    Full Text Available ABSTRACT: Syringomyelia is an unusual neurological condition characterised by the the presence of cystic cavity in the spinal cord resultin g in neurological manifestations. Here, we report a safe anesthetic management of patient with Arnold-Ch iari malformation type I and syringomyelia posted for foramen magnum decompression . INTRODUCTION: Arnold-Chiari malformation (ACM is a developmental malformation characterised by downward displacement of cerebellar tonsils into spinal canal due to reduced capacity of the posterior fossa. ACM may be complicate d by other malformations like Platybasia, basilar invagination and occipitalization although S yringomyelia (SM is most commonly seen. [1] There are four types of ACM; types I – IV. Type I ACM manifests with headaches, neck pain, and mild co-ordination problems mostly asymptomatic a nd discovered on brain or cervical spine MRI scans. It has adult onset characterised by downward displacement of cerebellar tonsils and medulla through the foramen magnum. [2] Syringomyelia is an unusual neurological condition characterised by the presence of fluid filled cystic cavity or syrinx within the spin al cord. Ollivies d’ Angers (1827 coined the term syringomyelia from two greek words meaning “ch annel” and “marroin”. [3] It has a prevalence of 8.4 per 100,000 and occurs more frequen tly in men than in women in the third or fourth decade of life. Rarely, it may develop in chi ldhood or late adulthood. [4

  19. Tai Chi Chuan modulates heart rate variability during abdominal breathing in elderly adults.

    Science.gov (United States)

    Wei, Gao-Xia; Li, You-Fa; Yue, Xiao-Lin; Ma, Xiao; Chang, Yu-Kai; Yi, Long-Yan; Li, Jing-Cheng; Zuo, Xi-Nian

    2016-03-01

    Tai Chi Chuan (TCC) practice is currently intentionally applied in clinical populations, especially those with cardiovascular diseases because of its potential benefits on the autonomic nervous system. The long-term effect of TCC practice on heart rate variability (HRV) remains largely unknown. In this study, we recruited 23 TCC practitioners whose experience averaged approximately 21 years and 19 controls matched by age, sex and education to examine the effect of TCC practice on the autonomic nervous system during a resting state and during an abdominal breathing state. HRV was measured by traditional electrocardiogram (ECG) recording. The results showed that the low frequency, total power frequency, and normalized low frequency components and the low-frequency/high-frequency ratio were significantly higher, whereas the normalized high frequency was significantly lower in the TCC practitioners relative to controls during the abdominal breathing state. However, we did not detect any significant difference in the HRV measures during the resting state between the two groups. Additionally, TCC experience did not correlate with HRV components either in the abdominal state or the resting state in the TCC group. Considering all of these findings, we suggest that TCC improves vagal activity and the balance between sympathetic and parasympathetic activity during the relaxation state. This study also provides direct physiological evidence for the role of TCC practice in relaxation. PMID:26377754

  20. High Resolution Rapid Response Observations of Compact Radio Sources with the Ceduna Hobart Interferometer (CHI)

    Science.gov (United States)

    Blanchard, Jay M.; Lovell, James E. J.; Ojha, Roopesh; Kadler, Matthias; Dickey, John M.; Edwards, Philip G.

    2011-01-01

    Context. Frequent, simultaneous observations across the electromagnetic spectrum are essential to the study of a range of astrophysical phenomena including Active Galactic Nuclei. A key tool of such studies is the ability to observe an object when it flares i.e. exhibits a rapid and significant increase in its flux density. Aims. We describe the specific observational procedures and the calibration techniques that have been developed and tested to create a single baseline radio interferometer. that can rapidly observe a flaring object. This is the only facility that is dedicated to rapid high resolution radio observations of an object south of -30 degrees declination. An immediate application is to provide rapid contemporaneous radio coverage of AGN flaring at y-ray frequencies detected by the Fermi Gamma-ray Space Telescope. Methods. A single baseline interferometer was formed with radio telescopes in Hobart, Tasmania and Ceduna, South Australia. A software correlator was set up at the University of Tasmania to correlate these data. Results. Measurements of the flux densities of flaring objects can be made using our observing strategy within half an hour of a triggering event. These observations can be calibrated with amplitude errors better than 20%. Lower limits to the brightness temperatures of the sources can also be calculated using CHI. Key words. instrumentation:interferometers - galaxies:active - galaxies:jets - galaxies:nuclei quasars:general gamma rays:galaxies- 1.