
Sample records for cerium 148

  1. The method of correction of irradiation history in burn-up determination using fission product cesium-137, cerium-144, and neodymium-148 as monitors

    International Nuclear Information System (INIS)

    In this paper, for cesium-137, cerium-144 and neodymium-148 nuclids the average yield, the quantity of correction for (n, γ) reaction, the quantity of correction for radioactive decay in reactor and the average fission energy of fissionable nuclide were calculated. The result improved precision of parameter and gave quite well value of burn-up

  2. Reaction chemistry of cerium

    Energy Technology Data Exchange (ETDEWEB)



    It is truly ironic that a synthetic organic chemist likely has far greater knowledge of the reaction chemistry of cerium(IV) than an inorganic colleague. Cerium(IV) reagents have long since been employed as oxidants in effecting a wide variety of organic transformations. Conversely, prior to the late 1980s, the number of well characterized cerium(IV) complexes did not extend past a handful of known species. Though in many other areas, interest in the molecular chemistry of the 4f-elements has undergone an explosive growth over the last twenty years, the chemistry of cerium(IV) has for the most part been overlooked. This report describes reactions of cerium complexes and structure.

  3. Probing the cerium/cerium hydride interface using nanoindentation

    Energy Technology Data Exchange (ETDEWEB)

    Brierley, Martin, E-mail: [Atomic Weapons Establishment, Aldermaston, Berkshire RG7 4PR (United Kingdom); University of Manchester, Manchester M13 9PL (United Kingdom); Knowles, John, E-mail: [Atomic Weapons Establishment, Aldermaston, Berkshire RG7 4PR (United Kingdom)


    Highlights: • A disparity exists between the minimum energy and actual shape of a cerium hydride. • Cerium hydride is found to be harder than cerium metal by a ratio of 1.7:1. • A zone of material under compressive stress was identified surrounding the hydride. • No distribution of hardness was apparent within the hydride. - Abstract: A cerium hydride site was sectioned and the mechanical properties of the exposed phases (cerium metal, cerium hydride, oxidised cerium hydride) were measured using nanoindentation. An interfacial region under compressive stress was observed in the cerium metal surrounding a surface hydride that formed as a consequence of strain energy generated by the volume expansion associated with precipitation of the hydride phase.

  4. Probing the cerium/cerium hydride interface using nanoindentation

    International Nuclear Information System (INIS)

    Highlights: • A disparity exists between the minimum energy and actual shape of a cerium hydride. • Cerium hydride is found to be harder than cerium metal by a ratio of 1.7:1. • A zone of material under compressive stress was identified surrounding the hydride. • No distribution of hardness was apparent within the hydride. - Abstract: A cerium hydride site was sectioned and the mechanical properties of the exposed phases (cerium metal, cerium hydride, oxidised cerium hydride) were measured using nanoindentation. An interfacial region under compressive stress was observed in the cerium metal surrounding a surface hydride that formed as a consequence of strain energy generated by the volume expansion associated with precipitation of the hydride phase

  5. Thermodynamic properties of cerium oxide

    International Nuclear Information System (INIS)

    Thermodynamic properties of cerium oxides in the CeO2-CeO1.5 composition range are studied. For this purpose method of electromotive force with solid electrolyte is used, equilibrium constants of reduction of cerium oxides by hydrogen are measured. Necessity of using atmosphere of argon or purified nitrogen to work with pyrophoric cerium oxides is stressed. The obtained results and the earlier known literary data on CeO2 and Ce2O3 thermodynamic properties are tabulated. 14 refs.; 5 tabs

  6. Mechanochemical synthesis of cerium orthophosphate

    Institute of Scientific and Technical Information of China (English)

    A.Matraszek; I.Szczygiei; L.Macalik; J.Hanuza


    A facile,simple and rapid preparation method of cerium orthophosphate was presented.The synthesis of low-crystalline CePO4 occurred upon mixing of cerium (Ⅲ) nitrate and sodium phosphate,and was an exchange-type reaction.The phase composition of the obtained powder was checked by the XRD and FTIR methods,indicating the presence of cerium phosphate.Further investigations on thermal behavior of the synthesized cerium salt had shown that the obtained onhophosphate crystallized at first in rhabdophane-type structure.It convetted to monazite (monoclinic symmetry) during heating at the temperatures of above 600 ℃.Oxidation of Ce3+ to Ce4+ was avoided during the syntheses,as confirmed by the XPS experiments.

  7. Preparation of cerium halide solvate complexes (United States)

    Vasudevan, Kalyan V; Smith, Nickolaus A; Gordon, John C; McKigney, Edward A; Muenchaussen, Ross E


    Crystals of a solvated cerium(III) halide solvate complex resulted from a process of forming a paste of a cerium(III) halide in an ionic liquid, adding a solvent to the paste, removing any undissolved solid, and then cooling the liquid phase. Diffusing a solvent vapor into the liquid phase also resulted in crystals of a solvated cerium(III) halide complex.


    Coffinberry, A.S.


    >New plutonium-base teroary alloys useful as liquid reactor fuels are described. The alloys consist of 10 to 20 atomic percent cobalt with the remainder plutonium and cerium in any desired proportion, with the plutonium not in excess of 88 atomic percent; or, of from 10 to 25 atomic percent nickel (or mixture of nickel and cobalt) with the remainder plutonium and cerium in any desired proportion, with the plutonium not in excess of 86 atomic percent. The stated advantages of these alloys over unalloyed plutonium for reactor fuel use are a lower melting point and a wide range of permissible plutonium dilution.

  9. Dissolution properties of cerium dibutylphosphate corrosion inhibitors

    NARCIS (Netherlands)

    Soestbergen, M. van; Erich, S.J.F.; Huinink, H.P.; Adan, O.C.G.


    The corrosion inhibitor cerium dibutylphosphate, Ce(dbp)3, prevents corrosion by cerium and dbp deposition at the alkaline cathode and acidic anode respectively. The pH dependent Ce(dbp)3 solubility seems to play an essential role in the inhibition degree. We found that Ce(dbp) 3 scarcely dissolves

  10. Inhibited oxidation of polymethylsiloxane, containing cerium

    International Nuclear Information System (INIS)

    The kinetics of oxidation of oligomeric polydimethylsiloxane in the presence of cerium-containing organosilicon antioxidant at 285-310 deg was investigated. High energy of activation for initiation process (around 272 kJ/mole) was established as a feature specific for chain oxidation of polydimethylsiloxane. It was found that cerium-containing antioxidant, as well as the iron-containing one, based on iron capronate, is of the ''depleting'' inhibitors, i.e. it looses its inhibiting ability during oxidation

  11. Pharmacological potential of cerium oxidenanoparticles (United States)

    Celardo, Ivana; Pedersen, Jens Z.; Traversa, Enrico; Ghibelli, Lina


    Nanotechnology promises a revolution in pharmacology to improve or create ex novo therapies. Cerium oxidenanoparticles (nanoceria), well-known as catalysts, possess an astonishing pharmacological potential due to their antioxidant properties, deriving from a fraction of Ce3+ ions present in CeO2. These defects, compensated by oxygen vacancies, are enriched at the surface and therefore in nanosized particles. Reactions involving redox cycles between the Ce3+ and Ce4+oxidation states allow nanoceria to react catalytically with superoxide and hydrogen peroxide, mimicking the behavior of two key antioxidant enzymes, superoxide dismutase and catalase, potentially abating all noxious intracellularreactive oxygen species (ROS) via a self-regenerating mechanism. Hence nanoceria, apparently well tolerated by the organism, might fight chronic inflammation and the pathologies associated with oxidative stress, which include cancer and neurodegeneration. Here we review the biological effects of nanoceria as they emerge from in vitro and in vivo studies, considering biocompatibility and the peculiar antioxidant mechanisms.

  12. 46 CFR 148.04-20 - Sulfur. (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false Sulfur. 148.04-20 Section 148.04-20 Shipping COAST GUARD... Special Additional Requirements for Certain Material § 148.04-20 Sulfur. (a) When sulfur is loaded in a deep hold with general cargo in the 'tween deck hold above the sulfur, a dust proof wooden...

  13. 19 CFR 148.4 - Accompanying articles. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Accompanying articles. 148.4 Section 148.4 Customs... (CONTINUED) PERSONAL DECLARATIONS AND EXEMPTIONS General Provisions § 148.4 Accompanying articles. (a) Generally. Articles shall be considered as accompanying a passenger or brought in by him if the...

  14. 45 CFR 148.220 - Excepted benefits. (United States)


    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Excepted benefits. 148.220 Section 148.220 Public... FOR THE INDIVIDUAL HEALTH INSURANCE MARKET Preemption; Excepted Benefits § 148.220 Excepted benefits... provision of the benefits described in paragraphs (a) and (b) of this section (or any combination of...

  15. 40 CFR 148.5 - Waste analysis. (United States)


    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Waste analysis. 148.5 Section 148.5 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) HAZARDOUS WASTE INJECTION RESTRICTIONS General § 148.5 Waste analysis. Generators of hazardous wastes that...

  16. 32 CFR 148.4 - Policy documentation. (United States)


    ... 32 National Defense 1 2010-07-01 2010-07-01 false Policy documentation. 148.4 Section 148.4 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE PERSONNEL, MILITARY AND CIVILIAN... Inspections of Facilities § 148.4 Policy documentation. Agency heads shall ensure that any policy...

  17. Nanocrystalline cerium oxide materials for solid fuel cell systems

    Energy Technology Data Exchange (ETDEWEB)

    Brinkman, Kyle S


    Disclosed are solid fuel cells, including solid oxide fuel cells and PEM fuel cells that include nanocrystalline cerium oxide materials as a component of the fuel cells. A solid oxide fuel cell can include nanocrystalline cerium oxide as a cathode component and microcrystalline cerium oxide as an electrolyte component, which can prevent mechanical failure and interdiffusion common in other fuel cells. A solid oxide fuel cell can also include nanocrystalline cerium oxide in the anode. A PEM fuel cell can include cerium oxide as a catalyst support in the cathode and optionally also in the anode.

  18. Divalent fluoride doped cerium fluoride scintillator (United States)

    Anderson, David F.; Sparrow, Robert W.


    The use of divalent fluoride dopants in scintillator materials comprising cerium fluoride is disclosed. The preferred divalent fluoride dopants are calcium fluoride, strontium fluoride, and barium fluoride. The preferred amount of divalent fluoride dopant is less than about two percent by weight of the total scintillator. Cerium fluoride scintillator crystals grown with the addition of a divalent fluoride have exhibited better transmissions and higher light outputs than crystals grown without the addition of such dopants. These scintillators are useful in radiation detection and monitoring applications, and are particularly well suited for high-rate applications such as positron emission tomography (PET).

  19. 24 CFR 100.148 - Effective date. (United States)


    ... DISCRIMINATORY CONDUCT UNDER THE FAIR HOUSING ACT Discrimination in Residential Real Estate-Related Transactions... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Effective date. 100.148 Section 100.148 Housing and Urban Development Regulations Relating to Housing and Urban Development OFFICE...

  20. 40 CFR 35.148 - Award limitations. (United States)


    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Award limitations. 35.148 Section 35.148 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GRANTS AND OTHER FEDERAL ASSISTANCE STATE AND LOCAL ASSISTANCE Environmental Program Grants Air Pollution Control (section 105) §...

  1. 19 CFR 148.39 - Rented automobiles. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Rented automobiles. 148.39 Section 148.39 Customs... automobiles. (a) Importation for temporary period. An automobile rented by a resident of the United States... (HTSUS) (19 U.S.C. 1202), without payment of duty. The automobile shall be used for the transportation...

  2. 30 CFR 14.8 - Quality assurance. (United States)


    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Quality assurance. 14.8 Section 14.8 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR TESTING, EVALUATION, AND APPROVAL OF... Quality assurance. Applicants granted an approval or an extension of approval under this Part must: (a)...

  3. 7 CFR 762.148 - Bankruptcy. (United States)


    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Bankruptcy. 762.148 Section 762.148 Agriculture Regulations of the Department of Agriculture (Continued) FARM SERVICE AGENCY, DEPARTMENT OF AGRICULTURE... protect the guaranteed loan debt and all collateral securing the loan in bankruptcy proceedings....


    Institute of Scientific and Technical Information of China (English)


    A study on existing valence state and chemical behavior of cerium element in two categories of rock weathering system in China has been carried out. In the granitoid weathering crust of Southern China,cerium as tetravalent hydroxide absorbed on clay minerals occupies 62.58 % of total amount of cerium and the cerium partitioning in the phase is 69.58 %. The depositing cerium stops its mobility downward, resulting in rare earth partitioning variation, the light rare earth partitioning is high at upper layer of weathering crust, the heavy rare earth partitioning is high at bottom layer of weathering crust, and the extracted product exists cerium lose effect. For Mn2+ as reducing agent existing in black weathering earth of Maoniuping rare earth ore,cerium is trivalent and absorbed on Mn-Fe oxide as colloid phase sediment. Colloid sediment phase can be divided into Mn-Fe combined phase and hydroxide sediment phase with cerium contents of 19.77% and 48.30%, and their cerium partitionings are 80.72% and 37.38% respectively. The Mn-Fe combined phase can selectively absorb cerium.

  5. Dicty_cDB: AFM148 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFM148 (Link to dictyBase) - - - - AFM148P (Link to Original site) AFM148F 586 AFM...148Z 765 AFM148P 1331 - - Show AFM148 Library AF (Link to library) Clone ID AFM148 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL Representative seq. ID AFM148P (Link to... Original site) Representative DNA sequence >AFM148 (AFM148Q) /CSM/AF/AFM1-B/AFM148Q.Seq.d/ AAATTAATTTTGTGTG

  6. Synthesis of Cerium-Doped Titania Nanoparticles and Nanotubes. (United States)

    Cao, Wei; Suzuki, Takuya; Elsayed-Ali, Hani E; Abdel-Fattah, Tarek M


    Cerium-doped titania nanoparticles and nanotubes were synthesized via hydrothermal processes. X-Ray Diffraction revealed that cerium-doped titania nanoparticles have an anatase crystal structure, while cerium-doped titania nanotubes have an H2Ti3O7-type structure. Scanning electron microscopy and high resolution transmission electron microscopy showed that both types of titania are well crystallized with relatively uniform size distribution. The photocatalytic degradation of methylthioninium chloride known as methylene blue dye was tested and both cerium-doped titania nanoparticles and nanotubes. The preliminary photocatalytic degradation of Methylene Blue data showed significantly improved visible light photocatalytic activities as compared to commercial titania powders.

  7. Cerium and jojoba in engines?; Cerium et jojoba dans les moteurs?

    Energy Technology Data Exchange (ETDEWEB)

    Massy-Delhotel, E.


    The Belgium company CreaTel proposes a new system, called Forac, which can lead to a 10% reduction of fuel consumption in thermal engines together with a quasi-complete reduction of CO, HC, NOx pollutants and CO{sub 2} particulates emission. The system comprises a steam production device and an admission pipe with a cerium alloy whorl inside. The steam produced is mixed with the admission air and tears cerium particles from the inside of the admission pipe to the combustion chamber. The cerium particles act as a catalyst which favours the complete combustion of the fuel. The same company proposes also lubricant additives made from liquid jojoba wax which allow the reduction of pollutant emissions, fuel consumption and noise emissions of diesel engines. (J.S.)

  8. Structural, optical, morphological and dielectric properties of cerium oxide nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Prabaharan, Devadoss Mangalam Durai Manoharadoss [Department of Physics, NPR College of Engineering and Technology, Natham, Dindigul, Tamil Nadu (India); Sadaiyandi, Karuppasamy [Department of Physics, Alagappa Government Arts College, Karaikudi, Sivaganga, Tamil Nadu (India); Mahendran, Manickam [Department of Physics, Thiagarajar College of Engineering, Madurai, Tamil Nadu (India); Sagadevan, Suresh, E-mail: [Department of Physics, AMET University (India)


    Cerium oxide (CeO{sub 2}) nanoparticles were prepared by the precipitation method. The average crystallite size of cerium oxide nanoparticles was calculated from the X-ray diffraction (XRD) pattern and found to be 11 nm. The FT-IR spectrum clearly indicated the strong presence of cerium oxide nanoparticles. Raman spectrum confirmed the cubic nature of the cerium oxide nanoparticles. The Scanning Electron Microscopy (SEM) analysis showed that the nanoparticles agglomerated forming spherical-shaped particles. The Transmission Electron Microscopic (TEM) analysis confirmed the prepared cerium oxide nanoparticles with the particle size being found to be 16 nm. The optical absorption spectrum showed a blue shift by the cerium oxide nanoparticles due to the quantum confinement effect. The dielectric properties of cerium oxide nanoparticles were studied for different frequencies at different temperatures. The dielectric constant and the dielectric loss of the cerium oxide nanoparticles decreased with increase in frequency. The AC electrical conductivity study revealed that the conduction depended on both the frequency and the temperature. (author)

  9. Formation and characterization of cerium conversion coatings on magnesium alloy

    Institute of Scientific and Technical Information of China (English)

    LI Lingjie; LEI Jinglei; YU Shenghai; TIAN Yujing; JIANG Qiquan; PAN Fusheng


    Chemical conversion treatment by rare earth metal salt solution was considered as an alternative to chromium chemical conversion treatment to improve the corrosion resistance of magnesium alloys. In this study, cerium conversion coatings formed on AZ31 magnesium alloy were characterized and the formation mechanism was discussed. X-ray photoelectron spectroscopy (XPS) analysis showed that cerium conversion coating consisted of cerium hydroxides/oxides, in which both tetravalent cerium Ce(IV) and trivalent cerium Ce(III) species co-existed. Cerium conversion coating was a two-layer structure. Atomic force microscopy (AFM) images revealed that the morphology of the inside layer was different from that of the outside one, which was responsible for the inherent adhesive weakness of the coating. Corrosion potential (Ecorr) measurements indicated that poor adhesion limited the improvement of the corrosion resistance of the coating. During the treating process, the increased pH value of the cerium salt solution led to the precipitation of cerium hydroxides/oxides. The formation kinetics of the coating followed a parabolic curve.

  10. Radiation induced color centers in cerium-doped and cerium-free multicomponent silicate glasses

    Institute of Scientific and Technical Information of China (English)

    傅鑫杰; 宋力昕; 李家成


    The effect of doped cerium on the radiation-resistance behavior of silicate glass was investigated in our work. The ultra-violet-visible absorption spectra and electron paramagnetic resonance (EPR) spectra were obtained after the cerium-rich and ce-rium-free multicomponent silicate glasses (K509 and K9) were irradiated by gamma rays with a dose range from 10 to 1000 kGy. The results showed that E’ center, oxygen deficient center (ODC) and non-bridging oxygen hole center (HC1 and HC2) were induced in K9 and K509 glasses after radiation. The concentrations of all color centers presented an exponential growth with the increase of the gamma dose. Moreover, the concentration of HC1 and HC2 in cerium-doped K509 glass was much lower than that in cerium-free K9 glass at the same dose of radiation, which could be attributed to the following mechanism:Ce3+ions capturing holes then forming Ce3++centers inhibited the formation of hole trapped color centers (HC1 and HC2) and Ce4+ions capturing electrons to form Ce3+centers suppressed the formation of electron trapped color centers like E’ center.

  11. Dicty_cDB: VFM148 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFM148 (Link to dictyBase) - - - Contig-U08795-1 VFM148P (Link... to Original site) VFM148F 479 VFM148Z 710 VFM148P 1169 - - Show VFM148 Library VF (Link to library) Clone ID VFM148 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U08795-1 Original site URL http://dict...YYFYYHKMALVLPIFATENTLLVTENDLGRGFS VDDNGANAKKSNVYICTKEDMTTVRSITDSNKLTLINDQESLTSALNVSGELSLSYGLMS GKIMGEYLDTSSS...(All Frames) Frame A: iylflnqk*fv*ITNNYFFYFLKIFCYYYFYYHKMALVLPIFATENTLLVTENDLGRGFS VDDNGANAKKSNVYICTKEDMTTVR

  12. Triaxiality in 146,148Sm nuclei

    International Nuclear Information System (INIS)

    Recently, attempts have been made to use the dynamic pairing plus quadrupole model to evaluate B(E2) values, B(E2) branching ratios, and low-lying energy levels for 146,148Sm nuclei, which are in poor agreement with experiment. Application of the boson expansion technique on 148Sm shows too much splitting and an incorrect order for the quintet states, while other properties have not been discussed. In the present work, 146,148Sm nuclei have been described using an asymmetric rotor model framework. The nonaxiality parameter γ has been evaluated using the energy ration E2+'/E6+. Remarkable success has been achieved in explaining the correct ordering of known low-lying energy levels, B(E2) values, and B(E2) branching ratios, which indicate that the so-called spherical nuclei may be treated as triaxial. (author). 8 refs., 9 tabs., 1 fig

  13. Ultrathin, epitaxial cerium dioxide on silicon

    International Nuclear Information System (INIS)

    It is shown that ultrathin, highly ordered, continuous films of cerium dioxide may be prepared on silicon following substrate prepassivation using an atomic layer of chlorine. The as-deposited, few-nanometer-thin Ce2O3 film may very effectively be converted at room temperature to almost fully oxidized CeO2 by simple exposure to air, as demonstrated by hard X-ray photoemission spectroscopy and X-ray diffraction. This post-oxidation process essentially results in a negligible loss in film crystallinity and interface abruptness

  14. Ultrathin, epitaxial cerium dioxide on silicon


    Flege, Jan Ingo; Kaemena, Björn; Höcker, Jan; Bertram, Florian; Wollschläger, Joachim; Schmidt, Thomas; Falta, Jens


    It is shown that ultrathin, highly ordered, continuous films of cerium dioxide may be prepared on silicon following substrate prepassivation using an atomic layer of chlorine. The as-deposited, few-nanometer-thin Ce2O3 film may very effectively be converted at room temperature to almost fully oxidized CeO2 by simple exposure to air, as demonstrated by hard X-ray photoemission spectroscopy and X-ray diffraction. This post-oxidation process essentially results in a negligible loss in film cryst...

  15. Crystal structure of cerium(4) - dicesium trisulfate

    International Nuclear Information System (INIS)

    Cerium(4) - dicesium trisulfate is investigated by the X-ray diffraction method. Parameters of a monoclinic cell equal: a = 9.772(2), b = 16.797(2), c = 14.812(1)A, β 96.40(1), P21. The structure is formed by interchanging of anion [Ce4(SO4)128-]∞ and cation (Cs+) layers arranged parallel (101). Atoms Ce and Cs are arranged according to the law of a cubic close packing. Coordination polyhedron Ce1 and Ce2 is the two-hat trigonal prism, nine vertices Ce3 and Ce4 are one-hat antiprism

  16. Ultrathin, epitaxial cerium dioxide on silicon (United States)

    Flege, Jan Ingo; Kaemena, Björn; Höcker, Jan; Bertram, Florian; Wollschläger, Joachim; Schmidt, Thomas; Falta, Jens


    It is shown that ultrathin, highly ordered, continuous films of cerium dioxide may be prepared on silicon following substrate prepassivation using an atomic layer of chlorine. The as-deposited, few-nanometer-thin Ce2O3 film may very effectively be converted at room temperature to almost fully oxidized CeO2 by simple exposure to air, as demonstrated by hard X-ray photoemission spectroscopy and X-ray diffraction. This post-oxidation process essentially results in a negligible loss in film crystallinity and interface abruptness.

  17. Photodissociation of Cerium Oxide Nanocluster Cations. (United States)

    Akin, S T; Ard, S G; Dye, B E; Schaefer, H F; Duncan, M A


    Cerium oxide cluster cations, CexOy(+), are produced via laser vaporization in a pulsed nozzle source and detected with time-of-flight mass spectrometry. The mass spectrum displays a strongly preferred oxide stoichiometry for each cluster with a specific number of metal atoms x, with x ≤ y. Specifically, the most prominent clusters correspond to the formula CeO(CeO2)n(+). The cluster cations are mass selected and photodissociated with a Nd:YAG laser at either 532 or 355 nm. The prominent clusters dissociate to produce smaller species also having a similar CeO(CeO2)n(+) formula, always with apparent leaving groups of (CeO2). The production of CeO(CeO2)n(+) from the dissociation of many cluster sizes establishes the relative stability of these clusters. Furthermore, the consistent loss of neutral CeO2 shows that the smallest neutral clusters adopt the same oxidation state (IV) as the most common form of bulk cerium oxide. Clusters with higher oxygen content than the CeO(CeO2)n(+) masses are present with much lower abundance. These species dissociate by the loss of O2, leaving surviving clusters with the CeO(CeO2)n(+) formula. Density functional theory calculations on these clusters suggest structures composed of stable CeO(CeO2)n(+) cores with excess oxygen bound to the surface as a superoxide unit (O2(-)). PMID:27035210


    NARCIS (Netherlands)



    High-spin states in the odd-odd nucleus Eu-148, populated by a carbon-13 induced reaction on a lanthanum target, were investigated with several different tools of in-beam nuclear spectroscopy. The low-energy levels show collective excitations, interpreted as 3- octupole-phonon couplings to multi-par

  19. 40 CFR 98.148 - Definitions. (United States)


    ... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) MANDATORY GREENHOUSE GAS REPORTING Glass Production § 98.148 Definitions. All terms used in this subpart have the same... Emission Factors for Carbonate-Based Raw Materials Carbonate-basedraw material—mineral CO2 emission...

  20. Fire retardancy of emulsion polymerized poly (methyl methacrylate)/cerium(IV) dioxide and polystyrene/cerium(IV) dioxide nanocomposites

    Energy Technology Data Exchange (ETDEWEB)

    Cai, Guipeng [Department of Chemistry and Fire Retardant Research Facility, Marquette University, PO Box 1881, Milwaukee, WI 53201 (United States); Lu, Hongdian [Department of Chemical and Materials Engineering, Hefei University, Hefei, Anhui 230022 (China); Zhou, You; Hao, Jianwei [School of Material Science and Engineering, Beijing Institute of Technology, Beijing 100081 (China); Wilkie, Charles A., E-mail: [Department of Chemistry and Fire Retardant Research Facility, Marquette University, PO Box 1881, Milwaukee, WI 53201 (United States)


    Highlights: Black-Right-Pointing-Pointer We prepare PMMA and PS containing ceria. Black-Right-Pointing-Pointer Characterization by XRD and TEM shows that some of the ceria is well-dispersed in the polymers. Black-Right-Pointing-Pointer The addition of ceria to both polymers leads to reduced thermal stability. Black-Right-Pointing-Pointer In PMMA, the fire retardancy is enhanced but there is little effect in PS. - Abstract: In situ emulsion polymerization was employed to obtain poly (methyl methacrylate) (PMMA)/cerium(IV) dioxide and polystyrene (PS)/cerium(IV) dioxide nanocomposites at two different cerium(IV) dioxide loadings (2.3 wt% and 4.6 wt%). Transmission electron microscope results indicated uniform dispersion of cerium (IV) dioxide in the polymer matrix. Both PMMA and PS nanocomposites exhibit lower thermal stability than the pristine polymers. Microscale combustion calorimeter (MCC) and cone calorimetry are used to evaluate the fire retardancy of the polymer nanocomposites. PMMA/cerium(IV) dioxide showed significant heat release rate (HRR) reduction at low loadings (<5 wt%), while PS/cerium(IV) dioxide exhibits less HRR reduction at the same loadings. An explanation of the role of cerium (IV) dioxide in fire retardancy of polymer/ceria nanocomposites based on XPS results is suggested.

  1. Preparing Process of Cerium Acetate and Rare Earth Acetate

    Institute of Scientific and Technical Information of China (English)

    Qiao Jun; Ma Ying; Xu Yanhui; Zhang Jun; Chang Shu; Hao Xianku


    Preparing process was presented and the influences of concentration of acetic acid, reaction temperature, the ratio of cerium carbonate and acetic acid, heat preservation time to the yield of cerium acetate were discussed.The crystalline cerium acetate and rare earth acetate such as ( La, Ce, Pr, Nd) (Ac) 3, ( Ce, Pr, Nd) (Ac) 3, ( Pr, Nd, Er,Y) (Ac) 3 and yttrium acetate were prepared under this condition.The shape, structure and composition of the crystals were determined by the methods of SEM, TG-DTA, X-ray diffraction and chemical analysis.The optimum prepared conditions of cerium acetate were described.This prepared process has characteristics such as simple process route, low cost, high yield, good quality, no pollution to environment, etc.

  2. Improvement in corrosion resistance of magnesium coating with cerium treatment

    Institute of Scientific and Technical Information of China (English)

    Samia Ben Hassen; Latifa Bousselmi; Patricc Bercot; El Mustafa Rezrazi; Ezzeddine Triki


    Corrosion protection afforded by a magnesium coating treated in cerium salt solution on steel substrate was investigated using open circuit potential, polarization curves, and electrochemical impedance spectroscopy (EIS) in 0.005 M sodium chloride solution (NaCl). The morphology of the surface was characterized by scanning electron microscopy (SEM), energy dispersive spectroscopy (EDS), and X-ray diffraction (XRD). The cerium treated coating was obtained by immersion in CeCl3 solution. The results showed that the corrosion resistance of the treated magnesium coating was improved. The corrosion potential of the treated coating was found to be nobler than that of the untreated magnesium coating and the corrosion current decreased significantly. Impedance results showed that the cerium treatment increased corrosion protection. The improvement of anti-corrosion properties was ataibuted to the formation of cerium oxides and hydroxides that gave to a physical barrier effect.

  3. A contribution to the radiologic findings in cerium pneumoconiosis

    International Nuclear Information System (INIS)

    Report on a 69 year old man, who had been employed as photographer in the printing industry and who had been exposed to Cerium for 40 years. The chest X-ray which was performed 9 years after the end of the exposure displayes striate densities of the lungs, which must be considered as a late stage of Cerium-pneumoconiosis. The changes which were found fulfill the code 't 1/0 RO, RM, RU, LO, LM, LU, p 0/1 RO, RM, LO, LM, em, tbu' according to the 'ILO U/C 1971 classification of pneumoconiosis'. The diagnosis could be substantiated by measureing Cerium in the lung parenchyma qualitatively and quantitatively using neutrone activating analysis. The radiolgic findings of the Cerium pneumoconiosis are discussed. (orig.)

  4. Heteroaggregation of cerium oxide nanoparticles and nanoparticles of pyrolyzed biomass (United States)

    Heteroaggregation with indigenous particles is an important process controlling the mobility of engineered nanomaterials in the environment. We studied heteroaggregation of cerium oxide nanoparticles (n-CeO2), which are widely used commercially, with nanoparticles of pyrogenic carbonaceous material ...

  5. Cerium fluoride crystals for calorimetry at LHC

    International Nuclear Information System (INIS)

    High-resolution homogeneous calorimetry is fully justified for part of the physics program at the Large Hadron Collider (LHC). The main design features of proposed CeF3 crystals for calorimetry for LHC are discussed. The severe constraints LHC imposes on detectors make the use of 'classical' crystals impossible. Therefore, a large R and D effort has been undertaken by the 'Crystal Clear' collaboration in order to find new, dense, fast and radiation hard crystals. A good candidate, cerium fluoride, has been identified and studied. It is interesting at this stage to review the specifications of scintillators for LHC and to see how well available data on CeF3 luminescence, decay time, light yield, optical transmission and resistance to radiation meet them. Milestones to reach before starting a large scale crystal production in view of the eventual construction of a calorimeter, are also discussed. (author) 15 refs., 15 figs., 1 tab

  6. Further results on cerium fluoride crystals

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, S.; Auffray, E.; Aziz, T.; Baccaro, S.; Banerjee, S.; Bareyre, P.; Barone, L.E.; Borgia, B.; Boutet, D.; Burq, J.P.; Chemarin, M.; Chipaux, R.; Dafinei, I.; D' Atanasio, P.; De Notaristefani, F.; Dezillie, B.; Dujardin, C.; Dutta, S.; Faure, J.L.; Fay, J.; Ferrere, D.; Francescangeli, O.; Fuchs, B.A.; Ganguli, S.N.; Gillespie, G.; Goyot, M.; Gupta, S.K.; Gurtu, A.; Heck, J.; Herve, A.; Hillemanns, H.; Holdener, F.; Ille, B.; Joensson, L.; Kierstead, J.; Krenz, W.; Kway, W.; Le Goff, J.M.; Lebeau, M.; Lebrun, P.; Lecoq, P.; Lemoigne, Y.; Loomis, G.; Lubelsmeyer, K.; Madjar, N.; Majni, G.; El Mamouni, H.; Mangla, S.; Mares, J.A.; Martin, J.P.; Mattioli, M.; Mauger, G.J.; Mazumdar, K.; Mengucci, P.; Merlo, J.P.; Moine, B.; Nikl, N.; Pansart, J.P.; Pedrini, C.; Poinsignon, J.; Polak, K.; Raghavan, R.; Rebourgeard, P.; Rinaldi, D.; Rosa, J.; Rosowsky, A.; Sahuc, P.; Samsonov, V.; Sarkar, S.; Schegelski, V.; Schmitz, D.; Schneegans, M.; Seliverstov, D.; Stoll, S.; Sudhakar, K.; Sven; Crystal Clear Collaboration


    A systematic investigation of the properties of cerium fluoride monocrystals has been performed by the 'Crystal Clear' collaboration in view of a possible use of such crystals for the construction of high precision electromagnetic calorimeters for the future generation of high luminosity accelerators. A large sample of different crystals grown by several producers has been studied. The spectroscopic characteristics, the transmission, luminescence and excitation spectra and the decay time curves are analysed. The light yield of the different crystals is measured with photomultipliers and Si photodiodes and compared to reference standards like BGO and NaI(Tl). The radiation damage behaviour is then presented for [gamma] and neutron irradiations, at different doses and dose rates, including thermal and optical bleaching. (orig.)

  7. Cerium intermetallics CeTX. Review III

    Energy Technology Data Exchange (ETDEWEB)

    Poettgen, Rainer; Janka, Oliver [Muenster Univ. (Germany). Inst. fuer Anorganische und Analytische Chemie; Chevalier, Bernard [Bordeaux Univ., Pessac (France). Inst. de Chimie de la Matiere Condensee de Bordeaux


    The structure-property relationships of CeTX intermetallics with structures other than the ZrNiAl and TiNiSi type are systematically reviewed. These CeTX phases form with electron-poor and electron-rich transition metals (T) and X = Mg, Zn, Cd, Hg, Al, Ga, In, Tl, Si, Ge, Sn, Pb, P, As, Sb, and Bi. The review focusses on the crystal chemistry, the chemical bonding peculiarities, and the magnetic and transport properties. Furthermore {sup 119}Sn Moessbauer spectroscopic data, high-pressure studies, hydrogenation reactions and the formation of solid solutions are reviewed. This paper is the third of a series of four reviews on equiatomic intermetallic cerium compound [Part I: R. Poettgen, B. Chevalier, Z. Naturforsch. 2015, 70b, 289; Part II: R. Poettgen, B. Chevalier, Z. Naturforsch. 2015, 70b, 695].

  8. 26 CFR 1.148-3 - General arbitrage rebate rules. (United States)


    ... 1.148-3 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Tax Exemption Requirements for State and Local Bonds § 1.148-3 General... allocable to the issue pursuant to the universal cap under § 1.148-6) or that ceases to be subject to...

  9. 19 CFR 148.53 - Exemption for tools of trade. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Exemption for tools of trade. 148.53 Section 148.53 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) PERSONAL DECLARATIONS AND EXEMPTIONS Other Exemptions § 148.53 Exemption for tools of trade. (a) Exemption....

  10. 36 CFR 406.141-406.148 - [Reserved (United States)


    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false 406.141-406.148 Section 406.141-406.148 Parks, Forests, and Public Property AMERICAN BATTLE MONUMENTS COMMISSION ENFORCEMENT OF... COMMISSION §§ 406.141-406.148...

  11. 19 CFR 148.114 - Shipment of unaccompanied articles. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Shipment of unaccompanied articles. 148.114 Section 148.114 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY... States § 148.114 Shipment of unaccompanied articles. One copy of the validated Customs Form 255 shall...

  12. 46 CFR 148.03-7 - During transport. (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false During transport. 148.03-7 Section 148.03-7 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) DANGEROUS CARGOES CARRIAGE OF SOLID HAZARDOUS MATERIALS IN BULK Minimum Transportation Requirements § 148.03-7 During transport. During the transport of...

  13. 46 CFR 148.02-1 - Shipping papers. (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false Shipping papers. 148.02-1 Section 148.02-1 Shipping... MATERIALS IN BULK Vessel Requirements § 148.02-1 Shipping papers. (a) Carriers may not accept for..., unless the hazardous materials offered for such shipment is accompanied by a shipping paper on which...

  14. Inhibition of pH fronts in corrosion cells due to the formation of cerium hydroxide

    NARCIS (Netherlands)

    Soestbergen, M. van; Erich, S.J.F.; Huinink, H.P.; Adan, O.C.G.


    The effect of cerium-based corrosion inhibitors on the pH front between the alkaline cathode and acidic anode in corrosion cells has been studied. The cerium component of these inhibitors can affect the pH front since it precipitates in an alkaline environment as cerium hydroxide, which is important

  15. Potential for recovery of cerium contained in automotive catalytic converters (United States)

    Bleiwas, Donald I.


    Catalytic converters (CATCONs) are required by Federal law to be installed in nearly all gasoline- and diesel-fueled onroad vehicles used in the United States. About 85 percent of the light-duty vehicles and trucks manufactured worldwide are equipped with CATCONs. Portions of the CATCONs (called monoliths) are recycled for their platinum-group metal (PGM) content and for the value of the stainless steel they contain. The cerium contained in the monoliths, however, is disposed of along with the slag produced from the recycling process. Although there is some smelter capacity in the United States to treat the monoliths in order to recover the PGMs, a great percentage of monoliths is exported to Europe and South Africa for recycling, and a lesser amount is exported to Japan. There is presently no commercial-scale capacity in place domestically to recover cerium from the monoliths. Recycling of cerium or cerium compounds from the monoliths could help ensure against possible global supply shortages by increasing the amount that is available in the supply chain as well as the number and geographic distribution of the suppliers. It could also reduce the amount of material that goes into landfills. Also, the additional supply could lower the price of the commodity. This report analyzes how much cerium oxide is contained in CATCONs and how much could be recovered from used CATCONs.

  16. Characterization of cerium fluoride nanocomposite scintillators

    Energy Technology Data Exchange (ETDEWEB)

    Stange, Sy [Los Alamos National Laboratory; Esch, Ernst I [Los Alamos National Laboratory; Brown, Leif O [Los Alamos National Laboratory; Couture, Aaron J [Los Alamos National Laboratory; Mckigney, Edward A [Los Alamos National Laboratory; Muenchausen, Ross E [Los Alamos National Laboratory; Del Sesto, Rico E [Los Alamos National Laboratory; Gilbertson, Robert D [Los Alamos National Laboratory; Mccleskey, T Mark [Los Alamos National Laboratory; Reifarth, Rene [Los Alamos National Laboratory


    Measurement of the neutron capture cross-sections of a number of short-lived isotopes would advance both pure and applied scientific research. These cross-sections are needed for calculation of criticality and waste production estimates for the Advanced Fuel Cycle Initiative, for analysis of data from nuclear weapons tests, and to improve understanding of nucleosynthesis. However, measurement of these cross-sections would require a detector with a faster signal decay time than those used in existing neutron capture experiments. Crystals of faster detector materials are not available in sufficient sizes and quantities to supply these large-scale experiments. Instead, we propose to use nanocomposite detectors, consisting of nanoscale particles of a scintillating material dispersed in a matrix material. We have successfully fabricated cerium fluoride (CeF{sub 3}) nanoparticles and dispersed them in a liquid matrix. We have characterized this scintillator and have measured its response to neutron capture. Results of the optical, structural, and radiation characterization will be presented.

  17. Chlorination and Carbochlorination of Cerium Oxide

    International Nuclear Information System (INIS)

    The chlorination and carbochlorination of cerium oxide were studied by thermogravimetry under controlled atmosphere (TG) in the 7000C 9500C temperature range.Both reactants and products were analyzed by X-ray diffraction (RX), scanning electronic microscopy (SEM) and energy dispersive spectroscopy (EDS). Thermodynamic calculations were performed by computer assisted software.The chlorination starts at a temperature close to 8000C.This reaction involves the simultaneous formation and evaporation of CeCl3.Both processes control the reaction rate and their kinetic may not be easily separated.The apparent chlorination activation energy in the 8500C-9500C temperature range is 172 to 5 kJ/ mole.Carbon transforms the CeO2-Cl2 into a more reactive system: CeO2-C-Cl2, where the effects of the carbon content, total flow rate and temperature were analyzed.The carbochlorination starting temperature is 7000C.This reaction is completed in one step controlled by mass transfer with an apparent activation energy of 56 to 5 kJ/mole in the 8500C-9500C temperature range

  18. Characterization of cerium fluoride nanocomposite scintillators

    International Nuclear Information System (INIS)

    Measurement of the neutron capture cross-sections of a number of short-lived isotopes would advance both pure and applied scientific research. These cross-sections are needed for calculation of criticality and waste production estimates for the Advanced Fuel Cycle Initiative, for analysis of data from nuclear weapons tests, and to improve understanding of nucleosynthesis. However, measurement of these cross-sections would require a detector with a faster signal decay time than those used in existing neutron capture experiments. Crystals of faster detector materials are not available in sufficient sizes and quantities to supply these large-scale experiments. Instead, we propose to use nanocomposite detectors, consisting of nanoscale particles of a scintillating material dispersed in a matrix material. We have successfully fabricated cerium fluoride (CeF3) nanoparticles and dispersed them in a liquid matrix. We have characterized this scintillator and have measured its response to neutron capture. Results of the optical, structural, and radiation characterization will be presented.

  19. Cerium Dioxide Thin Films Using Spin Coating

    Directory of Open Access Journals (Sweden)

    D. Channei


    Full Text Available Cerium dioxide (CeO2 thin films with varying Ce concentrations (0.1 to 0.9 M, metal basis were deposited on soda-lime-silica glass substrates using spin coating. It was found that all films exhibited the cubic fluorite structure after annealing at 500°C for 5 h. The laser Raman microspectroscopy and GAXRD analyses revealed that increasing concentrations of Ce resulted in an increase in the degree of crystallinity. FIB and FESEM images confirmed the laser Raman and GAXRD analyses results owing to the predicted increase in film thickness with increasing Ce concentration. However, porosity and shrinkage (drying cracking of the films also increased significantly with increasing Ce concentrations. UV-VIS spectrophotometry data showed that the transmission of the films decreased with increasing Ce concentrations due to the increasing crack formation. Furthermore, a red shift was observed with increasing Ce concentrations, which resulted in a decrease in the optical indirect band gap.

  20. Environmental Geochemistry of Cerium: Applications and Toxicology of Cerium Oxide Nanoparticles

    Directory of Open Access Journals (Sweden)

    Jessica T. Dahle


    Full Text Available Cerium is the most abundant of rare-earth metals found in the Earth’s crust. Several Ce-carbonate, -phosphate, -silicate, and -(hydroxide minerals have been historically mined and processed for pharmaceutical uses and industrial applications. Of all Ce minerals, cerium dioxide has received much attention in the global nanotechnology market due to their useful applications for catalysts, fuel cells, and fuel additives. A recent mass flow modeling study predicted that a major source of CeO2 nanoparticles from industrial processing plants (e.g., electronics and optics manufactures is likely to reach the terrestrial environment such as landfills and soils. The environmental fate of CeO2 nanoparticles is highly dependent on its physcochemical properties in low temperature geochemical environment. Though there are needs in improving the analytical method in detecting/quantifying CeO2 nanoparticles in different environmental media, it is clear that aquatic and terrestrial organisms have been exposed to CeO2 NPs, potentially yielding in negative impact on human and ecosystem health. Interestingly, there has been contradicting reports about the toxicological effects of CeO2 nanoparticles, acting as either an antioxidant or reactive oxygen species production-inducing agent. This poses a challenge in future regulations for the CeO2 nanoparticle application and the risk assessment in the environment.

  1. Cerium, manganese and cerium/manganese ceramic monolithic catalysts. Study of VOCs and PM removal

    Institute of Scientific and Technical Information of China (English)

    COLMAN-LERNER Esteban; PELUSO Miguel Andrs; SAMBETH Jorge; THOMAS Horacio


    Ceramic supported cerium, manganese and cerium-manganese catalysts were prepared by direct impregnation of aqueous precursor, and characterized by scanning electron microscopy (SEM), X-ray diffraction (XRD), Brunauer-Emmett-Teller method (BET), temperature programmed reduction (H2-TPR), X-ray photoelectron spectroscopy (XPS) acidity measurements and electrical conductivity. The catalytic activity was evaluated for volatile organic compounds (VOC) (ethanol, methyl ethyl ketone and toluene) oxidation. Additionally, catalysts were tested in particulate matter (PM) combustion. The characterization results indicated that Ce was in the form of Ce4+ and Ce3+, and Mn existed in the form of Mn4+and Mn3+on the surface of the Mn/AC sample and in the form of Mn4+ in the Ce/Mn/AC monolith. VOC oxidation results revealed that the Ce/Mn/AC sample showed an excellent performance compared with ceramic supported CeO2 (Ce/AC) and MnOx (Mn/AC) samples. The PM combustion was also higher on Ce/Mn/AC monoliths. The enhanced catalytic activity was mainly attributed to the Ce and Mn interaction which enhanced the acidity, conductiv-ity and the reducibility of the oxides.

  2. Cerium uptake by zeolite A synthesized from natural clinoptilolite tuffs

    International Nuclear Information System (INIS)

    Natural clinoptilolite tuffs from the Semnan region in Iran was used for the synthesis of zeolite A. The tuffs and synthesized zeolites were characterized by XRD and XRF. The sorption behavior of the synthesized zeolite toward cerium was studied. Using the Lagergren's equation, the absorption constant was calculated. The measured distribution coefficient values (Kd) indicated that cerium uptake is higher in lower initial concentrations, higher temperature and higher pH values. Thermodynamic parameters of the exchange were calculated through construction of ion-exchange isotherms at three temperatures of 298, 323 and 343 K. The dynamic absorption of cerium was also studied by passing the solution through a column in the presence and absence of sodium ions. (author)

  3. Synthesis and characterization of magnesium doped cerium oxide for the fuel cell application (United States)

    Kumar, Amit; Kumari, Monika; Kumar, Mintu; Kumar, Sacheen; Kumar, Dinesh


    Cerium oxide has attained much attentions in global nanotechnology market due to valuable application for catalytic, fuel additive, and widely as electrolyte in solid oxide fuel cell. Doped cerium oxide has large oxygen vacancies that allow for greater reactivity and faster ion transport. These properties make cerium oxide suitable material for SOFCs application. Cerium oxide electrolyte requires lower operation temperature which shows improvement in processing and the fabrication technique. In our work, we synthesized magnesium doped cerium oxide by the co-precipitation method. With the magnesium doping catalytic reactivity of CeO2 was increased. Synthesized nanoparticle were characterized by the XRD and UV absorption techniques.

  4. The PL "violet shift" of cerium dioxide on silicon

    Institute of Scientific and Technical Information of China (English)


    CeO2 thin film was fabricated by dual ion beam epitaxial technique. The phenomenon of PL violet shift at room temperature was observed, and the distance of shift was about 65 nm. After the analysis of crystal structure and valence in the compound were carried out by XRD and XPS technique, it was concluded that the PL shift was related with valence of cerium ion in the oxides. When the valence of cerium ion varied from tetravalence to trivalence, the PL peak position would move from blue region to violet region and the phenomenon of "violet shift" was observed.

  5. Optical and electrical studies of cerium mixed oxides

    Energy Technology Data Exchange (ETDEWEB)

    Sherly, T. R., E-mail: [Post Graduate Department of Physics, Sanathana Dharma College, Alappuzha, Kerala (India); Raveendran, R. [Nanoscience Research Laboratory, Sree Narayana College, Kollam, Kerala 691001 (India)


    The fast development in nanotechnology makes enthusiastic interest in developing nanomaterials having tailor made properties. Cerium mixed oxide materials have received great attention due to their UV absorption property, high reactivity, stability at high temperature, good electrical property etc and these materials find wide applications in solid oxide fuel cells, solar control films, cosmetics, display units, gas sensors etc. In this study cerium mixed oxide compounds were prepared by co-precipitation method. All the samples were doped with Zn (II) and Fe (II). Preliminary characterizations such as XRD, SEM / EDS, TEM were done. UV - Vis, Diffuse reflectance, PL, FT-IR, Raman and ac conductivity studies of the samples were performed.

  6. Membrane assisted liquid-liquid extraction of cerium

    International Nuclear Information System (INIS)

    Membrane assisted liquid-liquid extraction of cerium was investigated, with emphasis placed on the study of the reaction chemistry and the kinetics of non-dispersive solvent extraction and stripping with microporous membranes. A bulk liquid membrane process was developed for the purification of cerium(IV) from sulfate solutions containing other rare earth elements. The cerium process was studied in both a flat sheet contained liquid membrane configuration and with hollow fibre contactors. Di-2-ethylhexyl phosphoric acid (DEHPA) was identified as a suitable extractant for cerium(IV) from sulfuric acid solution, with due consideration of factors such as extraction ability, resistance to degradation, solvent selectivity and potential for sulfate transfer into a strip solution. A detailed study of the extraction of cerium(IV) with DEHPA defined the extraction reaction chemistry. The Ce/DEHPA/sulfate system was also investigated with a flat sheet bulk liquid membrane configuration, using both sulfuric and hydrochloric acid as receiver solutions. These tests identified that hydrophobic membranes provide better mass transfer for extraction and hydrophilic membranes are better for stripping. The presence of an impurity, mono 2-ethylhexyl phosphoric acid (MEHPA), was found to have a dramatic accelerating effect on the rate of the chemical extraction reaction. This was attributed to its higher interfacial activity and population compared to DEHPA, and the fact that MEHPA was also found to be an active carrier for cerium(IV). The mass transfer rate of membrane assisted extraction and stripping of cerium, using hydrophobic and hydrophilic microporous membranes, respectively, was investigated using a modified Lewis-type cell. It was quantitatively demonstrated that the extraction process was mainly controlled by membrane diffusion and the stripping process was controlled by the chemical reaction rate, with membrane diffusion becoming important at low distribution coefficients

  7. Determination of the CD148-Interacting Region in Thrombospondin-1.

    Directory of Open Access Journals (Sweden)

    Keiko Takahashi

    Full Text Available CD148 is a transmembrane protein tyrosine phosphatase that is expressed in multiple cell types, including vascular endothelial cells and duct epithelial cells. Previous studies have shown a prominent role of CD148 to reduce growth factor signals and suppress cell proliferation and transformation. Further, we have recently shown that thrombospondin-1 (TSP1 serves as a functionally important ligand for CD148. TSP1 has multiple structural elements and interacts with various cell surface receptors that exhibit differing effects. In order to create the CD148-specific TSP1 fragment, here we investigated the CD148-interacting region in TSP1 using a series of TSP1 fragments and biochemical and biological assays. Our results demonstrate that: 1 CD148 binds to the 1st type 1 repeat in TSP1; 2 Trimeric TSP1 fragments that contain the 1st type repeat inhibit cell proliferation in A431D cells that stably express wild-type CD148 (A431D/CD148wt cells, while they show no effects in A431D cells that lack CD148 or express a catalytically inactive form of CD148. The anti-proliferative effect of the TSP1 fragment in A431D/CD148wt cells was largely abolished by CD148 knockdown and antagonized by the 1st, but not the 2nd and 3rd, type 1 repeat fragment. Furthermore, the trimeric TSP1 fragments containing the 1st type repeat increased the catalytic activity of CD148 and reduced phospho-tyrosine contents of EGFR and ERK1/2, defined CD148 substrates. These effects were not observed in the TSP1 fragments that lack the 1st type 1 repeat. Last, we demonstrate that the trimeric TSP1 fragment containing the 1st type 1 repeat inhibits endothelial cell proliferation in culture and angiogenesis in vivo. These effects were largely abolished by CD148 knockdown or deficiency. Collectively, these findings indicate that the 1st type 1 repeat interacts with CD148, reducing growth factor signals and inhibiting epithelial or endothelial cell proliferation and angiogenesis.

  8. Nanoparticulate cerium dioxide and cerium dioxide-titanium dioxide composite thin films on glass by aerosol assisted chemical vapour deposition

    International Nuclear Information System (INIS)

    Two series of composite thin films were deposited on glass by aerosol assisted chemical vapour deposition (AACVD)-nanoparticulate cerium dioxide and nanoparticulate cerium dioxide embedded in a titanium dioxide matrix. The films were analysed by a range of techniques including UV-visible absorption spectroscopy, X-ray diffraction, scanning electron microscopy and energy dispersive analysis by X-rays. The AACVD prepared films showed the functional properties of photocatalysis and super-hydrophilicity. The CeO2 nanoparticle thin films displaying photocatalysis and photo-induced hydrophilicity almost comparable to that of anatase titania.

  9. Purification of cerium, neodymium and gadolinium for low background experiments (United States)

    Boiko, R. S.; Barabash, A. S.; Belli, P.; Bernabei, R.; Cappella, F.; Cerulli, R.; Danevich, F. A.; Incicchitti, A.; Laubenstein, M.; Mokina, V. M.; Nisi, S.; Poda, D. V.; Polischuk, O. G.; Tretyak, V. I.


    Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search), 136Ce (2β+ candidate with one of the highest Q2β). The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides) was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.

  10. 40 CFR 721.8657 - Cerium, hydroxy oleate propionate complexes. (United States)


    ... complexes. 721.8657 Section 721.8657 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... Specific Chemical Substances § 721.8657 Cerium, hydroxy oleate propionate complexes. (a) Chemical substance..., hydroxy oleate propionate complexes (PMN P-99-0026) is subject to reporting under this section for...

  11. Determination of Impurity Elements in Pure Cerium Oxide Product

    Institute of Scientific and Technical Information of China (English)

    Li Peizhong; Chen Limin; Li Jie


    Determination of the rare earth impurity in pure cerium oxide is done by ICP-MS.The interference and other factors which affect analytical results were discussed.The accuracy are between 0.81% ~ 11.98% and the recoveries of standard addition are 96% ~ 112.5%.This method can meet the demand for product inspection.

  12. Electrorheological Effects of Cerium-Doped TiO2

    Institute of Scientific and Technical Information of China (English)

    尹剑波; 赵晓鹏


    It is found that the doping of cerium ion into anatase TiO2 can improve the electrorheological (ER) effects of TiO2 and broaden the operational temperature range. Especially, the substitution of 7-11 mol% of the cerium dopant for Ti can obtain a relatively high shear stress, t-7.4kPa (at 4kV/mm), which is ten times larger than that of pure TiO2 ER fluid. Also, the typical Ce-doped TiO2 ER fluid shows the highest shear stress at 80℃, but 40℃ for pure TiO2 ER fluid. The dielectric loss and dielectric constant at a low frequency of TiO2 is improved by the doping of cerium, and the temperature dependence of the dielectric properties shows an obvious differnce between pure and doped TiO2 ER fluids. These can well explain the ER behaviour of doped TiO2. Furthermore, the change of rheological and dielectric properties is discussed on the basis of the lattice distortion and defects in TiO2 arising from the doping of cerium.

  13. Purification of cerium, neodymium and gadolinium for low background experiments

    Directory of Open Access Journals (Sweden)

    Boiko R.S.


    Full Text Available Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search, 136Ce (2β+ candidate with one of the highest Q2β. The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.

  14. 34 CFR 303.148 - Transition to preschool programs. (United States)


    ... 34 Education 2 2010-07-01 2010-07-01 false Transition to preschool programs. 303.148 Section 303.148 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION AND REHABILITATIVE SERVICES, DEPARTMENT OF EDUCATION EARLY INTERVENTION PROGRAM FOR INFANTS...

  15. 19 CFR 148.26 - Collection of internal revenue taxes. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Collection of internal revenue taxes. 148.26... Collection of Duties and Taxes § 148.26 Collection of internal revenue taxes. (a) Cigars and cigarettes. The internal revenue tax on taxable cigars and cigarettes in a passenger's baggage shall be paid to...

  16. 19 CFR 148.46 - Sale of exempted articles. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Sale of exempted articles. 148.46 Section 148.46... exempted articles. (a) Sale resulting in forfeiture. The following articles or their value (to be recovered... paragraph (b) of this section is followed: (1) Any jewelry or similar articles of personal adornment...

  17. Preparation, Characterization and Antibacterial Property of Cerium Substituted Hydroxyapatite Nanoparticles

    Institute of Scientific and Technical Information of China (English)

    Lin Yingguang; Yang Zhuoru; Cheng Jiang


    Nanoparticles of hydroxyapatite (HAP) and cerium substituted hydroxyapatite (CeHAP) with the atomic ratio of Ce/[Ca+Ce] (xCe) from 0 to 0.2 were prepared by sol-gel-supercritical fluid drying (SCFD) method. The nanoparticles were characterized by TEM, XRD, and FT-IR, and the effects of cerium on crystal structure, crystallinity, and particle shape were discussed. With the tests of bacterial inhibition zone and antibacterial ratio, the antibacterial property of HAP and CeHAP nanoparticles on Escherichia coli, Staphylococcus aureus, Lactobacillus were researched. Results showed that the nanoparticles of HAP and CeHAP could be made by sol-gel-SCFD, cerium could partially substitute for calcium and enter the structure of HAP. After substitution, the crystallinity, the IR wavenumbers of bonds in CeHAP decreased gradually with increase of cerium substitution, and the morphology of the nanoparticles changed from the short rod-shaped HAP to the needle-shaped CeHAP. The nanoparticles of HAP and CeHAP with xCe below 0.08 had antibacterial property only forcibly contacting with the test bacteria at the test concentration of 0.1 g·ml-1, however, the CeHAP nanoparticles had antibacterial ability at that concentration no matter statically or dynamically contacting with the test bacteria when xCe was above 0.08, and the antibacterial ability gets better with the increase of xCe, indicating that the antibacterial property was improved after calcium was partially substituted by cerium. The improved antibacterial effects of CeHAP nanoparticle on Lactobacillus showed its potential ability to anticaries.

  18. Cerium as a surrogate in the plutonium immobilization waste form (United States)

    Marra, James Christopher

    In the aftermath of the Cold War, approximately 50 tonnes (MT) of weapons useable plutonium (Pu) has been identified as excess. The U.S. Department of Energy (DOE) has decided that at least a portion of this material will be immobilized in a titanate-based ceramic for final disposal in a geologic repository. The baseline formulation was designed to produce a ceramic consisting primarily of a highly substituted pyrochlore with minor amounts of brannerite and hafnia-substituted rutile. Since development studies with actual actinide materials is difficult, surrogates have been used to facilitate testing. Cerium has routinely been used as an actinide surrogate in actinide chemistry and processing studies. Although cerium appeared as an adequate physical surrogate for powder handling and general processing studies, cerium was found to act significantly different from a chemical perspective in the Pu ceramic form. The reduction of cerium at elevated temperatures caused different reaction paths toward densification of the respective forms resulting in different phase assemblages and microstructural features. Single-phase fabrication studies and cerium oxidation state analyses were performed to further quantify these behavioral differences. These studies indicated that the major phases in the final phase assemblages contained point defects likely leading to their stability. Additionally, thermochemical arguments predicted that the predominant pyrochlore phase in the ceramic was metastable. The apparent metastabilty associated with primary phase in the Pu ceramic form indicated that additional studies must be performed to evaluate the thermodynamic properties of these compounds. Moreover, the metastability of this predominant phase must be considered in assessment of long-term behavior (e.g. radiation stability) of this ceramic.

  19. [Determination of silver and cerium in the liver and the kidney from a severely burned infant treated with silver sulfadiazine and cerium nitrate]. (United States)

    Hirakawa, K


    Silver and cerium in the liver and the kidney from severely burned infant were analyzed by neutron activation method. The patient was treated topically with cerium nitrate/silver sulfadiazine cream and cerium nitrate solution for 3 months. Then, the treatment with these drugs was stopped because of abdominal distention. The patient died 1 month after the cessation of the treatment with these drugs. The tissue specimens, blank liver sample and reference standards were irradiated with TRIGA MARK II Reactor of Rikkyo University. About 1 month after the irradiation, the activities were measured with a Ge(Li) detector coupled to a 4096 channel pulse height analyzer. A large amount of silver was detected both in the liver and in the kidney and a trace of cerium only in the liver. A considerable amount of silver was detected in the liver and its quantity was about 1600 times more than that of normal livers reported by Hamilton, Minski and Cleary (1972-73). Neither silver nor cerium were detected in the blank liver. These results suggest that prolonged topical chemotherapy of cerium nitrate/silver sulfadiazine cream and cerium nitrate solution for the extensive burn injuries causes considerable absorption of silver and cerium into the liver and the kidney. PMID:6867381

  20. Fundamental aspects of regenerative cerium oxide nanoparticles and their applications in nanobiotechnology (United States)

    Patil, Swanand D.

    Cerium oxide has been used extensively for various applications over the past two decades. The use of cerium oxide nanoparticles is beneficial in present applications and can open avenues for future applications. The present study utilizes the microemulsion technique to synthesize uniformly distributed cerium oxide nanoparticles. The same technique was also used to synthesize cerium oxide nanoparticles doped with trivalent elements (La and Nd). The fundamental study of cerium oxide nanoparticles identified variations in properties as a function of particle size and also due to doping with trivalent elements (La and Nd). It was found that the lattice parameter of cerium oxide nanoparticles increases with decrease in particle size. Also Raman allowed mode shift to lower energies and the peak at 464 cm-1 becomes broader and asymmetric. The size dependent changes in cerium oxide were correlated to increase in oxygen vacancy concentration in the cerium oxide lattice. The doping of cerium oxide nanoparticles with trivalent elements introduces more oxygen vacancies and expands the cerium oxide lattice further (in addition to the lattice expansion due to the size effect). The lattice expansion is greater for La-doped cerium oxide nanoparticles compared to Nd-doping due to the larger ionic radius of La compared to Nd, the lattice expansion is directly proportional to the dopant concentration. The synthesized cerium oxide nanoparticles were used to develop an electrochemical biosensor of hydrogen peroxide (H2O2). The sensor was useful to detect H2O2 concentrations as low as 1muM in water. Also the preliminary testing of the sensor on tomato stem and leaf extracts indicated that the sensor can be used in practical applications such as plant physiological studies etc. The nanomolar concentrations of cerium oxide nanoparticles were also found to be useful in decreasing ROS (reactive oxygen species) mediated cellular damages in various in vitro cell cultures. Cerium oxide

  1. Effect of cerium modification on microstructure and properties of hypereutectic high chromium cast iron

    Energy Technology Data Exchange (ETDEWEB)

    Zhi, Xiaohui, E-mail: [School of Mechanical Engineering, Shijiazhuang Tiedao University, Shijiazhuang 050043, Hebei Province (China); Liu, Jinzhi [School of Mechanical Engineering, Shijiazhuang Tiedao University, Shijiazhuang 050043, Hebei Province (China); Xing, Jiandong; Ma, Shengqiang [State Key Laboratory Mechanical Behavior of Materials, School of Materials Science and Engineering, Xi' an Jiaotong University, Xi' an 710049, Shaanxi Province (China)


    The effect of cerium modification on the microstructure and properties of hypereutectic high chromium cast iron primarily containing 4.0 wt% C and 20.0 wt% Cr was studied by means of optical microscopy, transmission electron microscope, scanning electron microscope, and energy dispersive X-ray spectrometry. The primary M{sub 7}C{sub 3} carbides were refined obviously when cerium was added in the melt. Ce{sub 2}S{sub 3} was found in the primary M{sub 7}C{sub 3} carbides and acted as the heterogeneous substrate of M{sub 7}C{sub 3} carbides. The impact toughness of the specimen modified with 0.5 wt% cerium increased by 50% compared with the specimen without cerium modification. The hardness of the alloy modified with cerium increased slightly compared with the specimen without cerium modification.

  2. Synthesis and crystal kinetics of cerium oxide nanocrystallites prepared by co-precipitation process

    Energy Technology Data Exchange (ETDEWEB)

    Shih, C.J., E-mail: [Department of Fragrance and Cosmetics Science, Kaohsiung Medical University, 100 Shi-Chuan 1st Road, Kaohsiung 807, Taiwan (China); Chen, Y.J. [Institute of Biomedical Sciences, National Sun Yat-Sen University, Kaohsiung 804, Taiwan (China); Hon, M.H. [Department of Materials Science and Engineering, National Cheng Kung University, Tainan 701, Taiwan (China)


    Cerium oxide nanocrystallites were synthesized at a relatively low temperature using cerium nitrate as starting materials in a water solution by a co-precipitation process. Effect of calcination temperature on the crystallite growth of cerium oxide nano-powders was investigated by X-ray diffraction, transmission electron microscopy and electron diffraction. The crystallization temperature of the cerium oxide powders was estimated to be about 273 K by XRD analysis. When calcined from 473 to 1273 K, the crystallization of the face-centered cubic phase was observed by XRD. The crystallite size of the cerium oxide increased from 10.0 to 43.8 nm with calcining temperature increasing from 673 to 1273 K. The activation energy for growth of cerium oxide nanoparticles was found to be 16.0 kJ mol{sup -1}.

  3. Synthesis and crystal kinetics of cerium oxide nanocrystallites prepared by co-precipitation process

    International Nuclear Information System (INIS)

    Cerium oxide nanocrystallites were synthesized at a relatively low temperature using cerium nitrate as starting materials in a water solution by a co-precipitation process. Effect of calcination temperature on the crystallite growth of cerium oxide nano-powders was investigated by X-ray diffraction, transmission electron microscopy and electron diffraction. The crystallization temperature of the cerium oxide powders was estimated to be about 273 K by XRD analysis. When calcined from 473 to 1273 K, the crystallization of the face-centered cubic phase was observed by XRD. The crystallite size of the cerium oxide increased from 10.0 to 43.8 nm with calcining temperature increasing from 673 to 1273 K. The activation energy for growth of cerium oxide nanoparticles was found to be 16.0 kJ mol-1.

  4. Solubility of cerium in LaCoO3-influence on catalytic activity. (United States)

    French, S A; Catlow, C R A; Oldman, R J; Rogers, S C; Axon, S A


    The recent interest in the catalytic properties of lanthanum perovskites for methane combustion and three way catalysis has led to considerable debate as to their structure and defect chemistry. We have investigated the doping of LaCoO3 with the tetravalent cerium cation using atomistic simulation techniques. We have compared three routes for cerium insertion and identified the favoured doping mechanism, which explain experimental observations relating to the effect of cerium on catalytic activity.

  5. Critical indices for reversible gamma-alpha phase transformation in metallic cerium (United States)

    Soldatova, E. D.; Tkachenko, T. B.


    Critical indices for cerium have been determined within the framework of the pseudobinary solution theory along the phase equilibrium curve, the critical isotherm, and the critical isobar. The results obtained verify the validity of relationships proposed by Rushbrook (1963), Griffiths (1965), and Coopersmith (1968). It is concluded that reversible gamma-alpha transformation in metallic cerium is a critical-type transformation, and cerium has a critical point on the phase diagram similar to the critical point of the liquid-vapor system.

  6. The effect of cerium valence states at cerium oxide nanoparticle surfaces on cell proliferation

    KAUST Repository

    Naganuma, Tamaki


    Understanding and controlling cell proliferation on biomaterial surfaces is critical for scaffold/artificial-niche design in tissue engineering. The mechanism by which underlying integrin ligates with functionalized biomaterials to induce cell proliferation is still not completely understood. In this study, poly-l-lactide (PL) scaffold surfaces were functionalized using layers of cerium oxide nanoparticles (CNPs), which have recently attracted attention for use in therapeutic application due to their catalytic ability of Ce4+ and Ce3+ sites. To isolate the influence of Ce valance states of CNPs on cell proliferation, human mesenchymal stem cells (hMSCs) and osteoblast-like cells (MG63) were cultured on the PL/CNP surfaces with dominant Ce4+ and Ce3+ regions. Despite cell type (hMSCs and MG63 cells), different surface features of Ce4+ and Ce3+ regions clearly promoted and inhibited cell spreading, migration and adhesion behavior, resulting in rapid and slow cell proliferation, respectively. Cell proliferation results of various modified CNPs with different surface charge and hydrophobicity/hydrophilicity, indicate that Ce valence states closely correlated with the specific cell morphologies and cell-material interactions that trigger cell proliferation. This finding suggests that the cell-material interactions, which influence cell proliferation, may be controlled by introduction of metal elements with different valence states onto the biomaterial surface. © 2014 Elsevier Ltd.

  7. 33 CFR 148.722 - Should the construction plan incorporate best available technology and recommended industry... (United States)


    ... incorporate best available technology and recommended industry practices? 148.722 Section 148.722 Navigation... plan incorporate best available technology and recommended industry practices? Each applicant must... industry practices as directed in § 148.730....

  8. Study of cerium diffusion in undoped lithium-6 enriched glass with Rutherford backscattering spectrometry (United States)

    Zhang, Xiaodong; Moore, Michael E.; Lee, Kyung-Min; Lukosi, Eric D.; Hayward, Jason P.


    Undoped lithium-6 enriched glasses coated with pure cerium (99.9%) with a gold protection layer on top were heated at three different temperatures (500, 550, and 600 °C) for varied durations (1, 2, and 4 h). Diffusion profiles of cerium in such glasses were obtained with the conventional Rutherford backscattering technique. Through fitting the diffusion profiles with the thin-film solution of Fick's second law, diffusion coefficients of cerium with different annealing temperatures and durations were solved. Then, the activation energy of cerium for the diffusion process in the studied glasses was found to be 114 kJ/mol with the Arrhenius equation.

  9. Adsorption of Fluoride Ion by Inorganic Cerium Based Adsorbent

    Institute of Scientific and Technical Information of China (English)

    Jiao Zhongzhi(焦中志); Chen Zhonglin; Yang Min; Zhang Yu; Li Guibai


    Excess of fluoride in drinking water is harmful to human health, the concentration of F- ions must be maintained in the range of 0.5 to 1.5 mg/L. An inorganic cerium based adsorbent (CTA) is developed on the basis of research of adsorption of fluoride on cerium oxide hydrate. Some adsorption of fluoride by CTA adsorbent experiments were carried out, and results showed that CTA adsorbent has a quick adsorption speed and a large adsorption capacity. Adsorption follows Freundlich isotherm, and low pH value helps fluoride removal. Some physical-chemical characteristics of CTA adsorbent were experimented, fluoride removal mechanism was explored, and results showed that hydroxyl group of CTA adsorbent played an important role in the fluoride removal.

  10. Antioxidant activity of levan coated cerium oxide nanoparticles. (United States)

    Kim, Sun-Jung; Chung, Bong Hyun


    Levan coated cerium oxide nanoparticles (LCNPs) with the enhanced antioxidant activity were successfully synthesized and characterized. Levan and their derivatives are attractive for biomedical applications attributable to their antioxidant, anti-inflammation and anti-tumor properties. LCNPs were synthesized using the one-pot and green synthesis system with levan. For production of nanoparticles, levan plays a role as a stabilizing and reducing agent. Fourier transform infrared spectroscopy (FT-IR) analysis showed that LCNPs successfully synthesized. The morphology and size of nanoparticles were confirmed by transmission electron microscopy (TEM) and dynamic light scattering (DLS). LCNPs have good water solubility and stability. The conjugation of levan with cerium oxide nanoparticles improved antioxidant activity. Moreover the level of ROS was reduced after treatment of LCNPs to H2O2 stimulated NIH3T3 cells. These results demonstrate that the LCNPs are useful for applying of treatment of ROS induced diseases. PMID:27312651

  11. Synthesis and characterization of cerium sulfide thin film

    Institute of Scientific and Technical Information of China (English)

    Ιshak Afsin Kariper


    Cerium sulfide (CexSy) polycrystalline thin film is coated with chemical bath deposition on substrates (commercial glass). Transmittance, absorption, optical band gap and refractive index are examined by using UV/VIS. Spectrum. The hexagonal form is observed in the structural properties in XRD. The structural and optical properties of cerium sulfide thin films are analyzed at different pH. SEM and EDX analyses are made for surface analysis and elemental ratio in films. It is observed that some properties of films changed with different pH values. In this study, the focus is on the observed changes in the properties of films. The pH values were scanned at 6–10. The optical band gap changed with pH between 3.40 to 3.60 eV. In addition, the film thickness changed with pH at 411 nm to 880 nm.

  12. Far infrared properties of PbTe doped with cerium

    Energy Technology Data Exchange (ETDEWEB)

    Nikolic, P.M. [Institute of Technical Sciences SASA, Knez Mihailova 35/IV, 11000 Belgrade (Serbia)]. E-mail:; Koenig, W. [Max Planck Institut fuer Festkoerperforschung, Heisenbergstrasse 1, 7000 Stuttgart 80 (Germany); Vujatovic, S.S. [Institute of Technical Sciences SASA, Knez Mihailova 35/IV, 11000 Belgrade (Serbia); Blagojevic, V. [Faculty of Electronic Engineering, University of Belgrade, Bulevar Kralja Aleksandra 73, 11000 Belgrade (Serbia); Lukovic, D. [Institute of Technical Sciences SASA, Knez Mihailova 35/IV, 11000 Belgrade (Serbia); Savic, S. [Institute of Technical Sciences SASA, Knez Mihailova 35/IV, 11000 Belgrade (Serbia); Radulovic, K. [Institute of Technical Sciences SASA, Knez Mihailova 35/IV, 11000 Belgrade (Serbia); Urosevic, D. [Mathematical Institute SASA, Knez Mihailova 35/I, 11000 Belgrade (Serbia); Nikolic, M.V. [Center for Multidisciplinary Studies of the University of Belgrade, Kneza Viseslava 1, Belgrade (Serbia)


    Single crystal samples of lead telluride doped with cerium were made using the Bridgman method. Far infrared reflectivity spectra in the temperature range from 10 to 300 K are presented. The experimental data were numerically analyzed using a fitting procedure based on the plasmon-phonon interaction model and optical parameters were determined. Two additional local modes were observed at about 138 and 337 cm{sup -1}. The origin of these local vibrational impurity modes was discussed.

  13. Monomers, Dimers, and Helices: Complexities of Cerium and Plutonium Phenanthrolinecarboxylates. (United States)

    Cary, Samantha K; Ferrier, Maryline G; Baumbach, Ryan E; Silver, Mark A; Lezama Pacheco, Juan; Kozimor, Stosh A; La Pierre, Henry S; Stein, Benjamin W; Arico, Alexandra A; Gray, Danielle L; Albrecht-Schmitt, Thomas E


    The reaction of Ce(III) or Pu(III) with 1,10-phenanthroline-2,9-dicarboxylic acid (PDAH2) results in the formation of new f-element coordination complexes. In the case of cerium, Ce(PDA)(H2O)2Cl·H2O (1) or [Ce(PDAH)(PDA)]2[Ce(PDAH)(PDA)] (2) was isolated depending on the Ce/ligand ratio in the reaction. The structure of 2 is composed of two distinct substructures that are constructed from the same monomer. This monomer is composed of a Ce(III) cation bound by one PDA(2-) dianionic ligand and one PDAH(-) monoanionic ligand, both of which are tetradentate. Bridging by the carboxylate moieties leads to either [Ce(PDAH)(PDA)]2 dimers or [Ce(PDAH)(PDA)]1∞ helical chains. For plutonium, Pu(PDA)2 (3) was the only product isolated regardless of the Pu/ligand ratio employed in the reaction. During the reaction of plutonium with PDAH2, Pu(III) is oxidized to Pu(IV), generating 3. This assignment is consistent with structural metrics and the optical absorption spectrum. Ambiguity in the assignment of the oxidation state of cerium in 1 and 2 from UV-vis-near-IR spectra invoked the use of Ce L3,2-edge X-ray absorption near-edge spectroscopy, magnetic susceptibility, and heat capacity measurements. These experiments support the assignment of Ce(III) in both compounds. The bond distances and coordination numbers are also consistent with these assignments. 3 contains 8-coordinate Pu(IV), whereas the cerium centers in 1 and 2 are 9- and/or 10-coordinate, which correlates with the increased size of Ce(III) versus Pu(IV). Taken together, these data provide an example of a system where the differences in the redox behavior between these f elements creates more complex chemistry with cerium than with plutonium. PMID:27070401

  14. 26 CFR 1.148-1A - Definitions and elections. (United States)


    ... hedge (within the meaning of § 1.148-4(h)) except that it contains a significant investment element. (c... maintain a working capital reserve borrows to fund such a reserve, the issuer will have...

  15. 4 CFR 28.148 - Reporting of communications. (United States)


    ... allowed. If the communication was oral, a memorandum stating the substance of the discussion shall be... ACCOUNTABILITY OFFICE Ex Parte Communications § 28.148 Reporting of communications. Any communication made...

  16. Jet formation in cerium metal to examine material strength

    Energy Technology Data Exchange (ETDEWEB)

    Jensen, B. J., E-mail:; Cherne, F. J.; Prime, M. B.; Yeager, J. D.; Ramos, K. J.; Hooks, D. E.; Cooley, J. C.; Dimonte, G. [Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States); Fezzaa, K. [Argonne National Laboratory, Argonne, Illinois 60439 (United States); Iverson, A. J.; Carlson, C. A. [National Security Technologies LLC, Los Alamos, New Mexico 87544 (United States)


    Examining the evolution of material properties at extreme conditions advances our understanding of numerous high-pressure phenomena from natural events like meteorite impacts to general solid mechanics and fluid flow behavior. Recent advances in synchrotron diagnostics coupled with dynamic compression platforms have introduced new possibilities for examining in-situ, spatially resolved material response with nanosecond time resolution. In this work, we examined jet formation from a Richtmyer-Meshkov instability in cerium initially shocked into a transient, high-pressure phase, and then released to a low-pressure, higher-temperature state. Cerium's rich phase diagram allows us to study the yield stress following a shock induced solid-solid phase transition. X-ray imaging was used to obtain images of jet formation and evolution with 2–3 μm spatial resolution. From these images, an analytic method was used to estimate the post-shock yield stress, and these results were compared to continuum calculations that incorporated an experimentally validated equation-of-state (EOS) for cerium coupled with a deviatoric strength model. Reasonable agreement was observed between the calculations and the data illustrating the sensitivity of jet formation on the yield stress values. The data and analysis shown here provide insight into material strength during dynamic loading which is expected to aid in the development of strength aware multi-phase EOS required to predict the response of matter at extreme conditions.

  17. Enhancing cerium and plutonium solubility by reduction in borosilicate glass (United States)

    Cachia, J.-N.; Deschanels, X.; Den Auwer, C.; Pinet, O.; Phalippou, J.; Hennig, C.; Scheinost, A.


    High-level radioactive wastes produced by spent fuel reprocessing containing fission and activation products as well as actinides are incorporated in a borosilicate glass. To ensure optimum radionuclide containment, the resulting glass must be as homogeneous as possible. Microscopic heterogeneity can arise from various processes including the excess loading of an element above its solubility limit. The current actinide loading limit is 0.4 wt%. Work is in progress to assess the actinide solubility in these glasses, especially for plutonium. Initially the actinides were simulated by lanthanides and hafnium. The results show that trivalent elements (La, Gd) exhibit greater solubility than tetravalent elements (Pu, Hf). Cerium is an interesting element because its oxidation state varies from IV to III depending on the process conditions, such as the temperature and redox potential of the melt. In order to quantify the solubility increase, cerium-doped glass samples were melted under reducing conditions by adding a reducing agent. The solubility observed at 1473 K increased significantly from 0.95 to 13.00 wt%. Several reducing compounds have been tested. This paper deals with this study and the application to reduce Pu(IV) to Pu(III). The reduction state was characterized by X-ray absorption spectroscopy (XANES) for plutonium and by chemical analysis for cerium. The material homogeneity was verified by optical and scanning electron microscopy. Preliminary findings concerning the reduction of Pu-doped glasses fabricated in hot cells are also discussed.

  18. Coulomb excitation of 144,146,148,150Nd

    NARCIS (Netherlands)

    Ahmad, A.; Bomar, G.; Crowell, H.; Hamilton, J. H.; Kawakami, H.; Maguire, C. F.; Nettles, W. G.; Piercey, R. B.; Ramayya, A. V.; Soundranayagam, R.; Ronningen, R. M.; Scholten, O.; Stelson, P. H.


    Coulomb excitation of 144,146,148,1605060Nd by 10.5 and 11 MeV alpha particles was studied by magnetic analysis of particles scattered into 150°. Values of B(E20+-->2+) for the 2+ states at 696, 454, 302, and 130 keV are 0.58(1), 0.78(1), 1.390(20), and 2.816(35) e2b2, respectively. For 148,150Nd, v

  19. The developments and challenges of cerium half-cell in zinc–cerium redox flow battery for energy storage

    International Nuclear Information System (INIS)

    Zinc–cerium redox flow batteries (ZCBs) are emerging as a very promising new technology with the potential to store a large amount of energy economically and efficiently, thanking to its highest thermodynamic open-circuit cell voltage among all the currently studied aqueous redox flow batteries. However, there are numerous scientific and technical challenges that must be overcome if this alluring promise is to turn into reality, from designing the battery structure, to optimizing the electrolyte compositions and elucidating the complex chemical reactions that occur during charge and discharge. This review article is the first summary of the most significant developments and challenges of cerium half-cell and the current understanding of their chemistry. We are certain that this review will be of great interest to audience over a broad range, especially in fields of energy storage, electrochemistry, and chemical engineering

  20. Induction of pulmonary fibrosis by cerium oxide nanoparticles

    International Nuclear Information System (INIS)

    Cerium compounds have been used as a diesel engine catalyst to lower the mass of diesel exhaust particles, but are emitted as cerium oxide (CeO2) nanoparticles in the diesel exhaust. In a previous study, we have demonstrated a wide range of CeO2-induced lung responses including sustained pulmonary inflammation and cellular signaling that could lead to pulmonary fibrosis. In this study, we investigated the fibrogenic responses induced by CeO2 in a rat model at various time points up to 84 days post-exposure. Male Sprague Dawley rats were exposed to CeO2 by a single intratracheal instillation. Alveolar macrophages (AM) were isolated by bronchial alveolar lavage (BAL). AM-mediated cellular responses, osteopontin (OPN) and transform growth factor (TGF)-β1 in the fibrotic process were investigated. The results showed that CeO2 exposure significantly increased fibrotic cytokine TGF-β1 and OPN production by AM above controls. The collagen degradation enzymes, matrix metalloproteinase (MMP)-2 and -9 and the tissue inhibitor of MMP were markedly increased in the BAL fluid at 1 day- and subsequently declined at 28 days after exposure, but remained much higher than the controls. CeO2 induced elevated phospholipids in BAL fluid and increased hydroxyproline content in lung tissue in a dose- and time-dependent manner. Immunohistochemical analysis showed MMP-2, MMP-9 and MMP-10 expressions in fibrotic regions. Morphological analysis noted increased collagen fibers in the lungs exposed to a single dose of 3.5 mg/kg CeO2 and euthanized at 28 days post-exposure. Collectively, our studies show that CeO2 induced fibrotic lung injury in rats, suggesting it may cause potential health effects. -- Highlights: ► Cerium oxide exposure significantly affected the following parameters in the lung. ► Induced fibrotic cytokine OPN and TGF-β1 production and phospholipidosis. ► Caused imbalance of the MMP-9/ TIMP-1 ratio that favors fibrosis. ► Cerium oxide particles were detected in

  1. Induction of pulmonary fibrosis by cerium oxide nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Ma, Jane Y., E-mail: [Health Effects Laboratory Division, National Institute for Occupational Safety and Health, Morgantown, WV 26505 (United States); Mercer, Robert R.; Barger, Mark; Schwegler-Berry, Diane; Scabilloni, James [Health Effects Laboratory Division, National Institute for Occupational Safety and Health, Morgantown, WV 26505 (United States); Ma, Joseph K. [School of Pharmacy, West Virginia University, Morgantown, WV 26506 (United States); Castranova, Vincent [Health Effects Laboratory Division, National Institute for Occupational Safety and Health, Morgantown, WV 26505 (United States)


    Cerium compounds have been used as a diesel engine catalyst to lower the mass of diesel exhaust particles, but are emitted as cerium oxide (CeO{sub 2}) nanoparticles in the diesel exhaust. In a previous study, we have demonstrated a wide range of CeO{sub 2}-induced lung responses including sustained pulmonary inflammation and cellular signaling that could lead to pulmonary fibrosis. In this study, we investigated the fibrogenic responses induced by CeO{sub 2} in a rat model at various time points up to 84 days post-exposure. Male Sprague Dawley rats were exposed to CeO{sub 2} by a single intratracheal instillation. Alveolar macrophages (AM) were isolated by bronchial alveolar lavage (BAL). AM-mediated cellular responses, osteopontin (OPN) and transform growth factor (TGF)-β1 in the fibrotic process were investigated. The results showed that CeO{sub 2} exposure significantly increased fibrotic cytokine TGF-β1 and OPN production by AM above controls. The collagen degradation enzymes, matrix metalloproteinase (MMP)-2 and -9 and the tissue inhibitor of MMP were markedly increased in the BAL fluid at 1 day- and subsequently declined at 28 days after exposure, but remained much higher than the controls. CeO{sub 2} induced elevated phospholipids in BAL fluid and increased hydroxyproline content in lung tissue in a dose- and time-dependent manner. Immunohistochemical analysis showed MMP-2, MMP-9 and MMP-10 expressions in fibrotic regions. Morphological analysis noted increased collagen fibers in the lungs exposed to a single dose of 3.5 mg/kg CeO{sub 2} and euthanized at 28 days post-exposure. Collectively, our studies show that CeO{sub 2} induced fibrotic lung injury in rats, suggesting it may cause potential health effects. -- Highlights: ► Cerium oxide exposure significantly affected the following parameters in the lung. ► Induced fibrotic cytokine OPN and TGF-β1 production and phospholipidosis. ► Caused imbalance of the MMP-9/ TIMP-1 ratio that favors fibrosis

  2. Cerium doped red mud catalytic ozonation for bezafibrate degradation in wastewater: Efficiency, intermediates, and toxicity. (United States)

    Xu, Bingbing; Qi, Fei; Sun, Dezhi; Chen, Zhonglin; Robert, Didier


    In this study, the performance of bezafibrate (BZF) degradation and detoxification in the aqueous phase using cerium-modified red mud (RM) catalysts prepared using different cerium sources and synthesis methods were evaluated. Experimental results showed that the surface cerium modification was responsible for the development of the catalytic activity of RM and this was influenced by the cerium source and the synthesis method. Catalyst prepared from cerium (IV) by precipitation was found to show the best catalytic activity in BZF degradation and detoxification. Reactive oxygen species including peroxides, hydroxyl radicals, and super oxide ions were identified in all reactions and we proposed the corresponding catalytic reaction mechanism for each catalyst that prepared from different cerium source and method. This was supported by the intermediates profiles that were generated upon BZF degradation. The surface and the structural properties of cerium-modified RM were characterized in detail by several analytical methods. Two interesting findings were made: (1) the surface texture (specific surface area and mesoporous volume) influenced the catalytic reaction pathway; and (2) Ce(III) species and oxygen vacancies were generated on the surface of the catalyst after cerium modification. This plays an important role in the development of the catalytic activity. PMID:26706928

  3. Tuning Reactivity and Electronic Properties through Ligand Reorganization within a Cerium Heterobimetallic Framework

    Energy Technology Data Exchange (ETDEWEB)

    Robinson, Jerome R.; Gordon, Zachary; Booth, Corwin H.; Carroll, Patrick J.; Walsh, Patrick J.; Schelter, Eric J.


    Cerium compounds have played vital roles in organic, inorganic, and materials chemistry due to their reversible redox chemistry between trivalent and tetravalent oxidation states. However, attempts to rationally access molecular cerium complexes in both oxidation states have been frustrated by unpredictable reactivity in cerium(III) oxidation chemistry. Such oxidation reactions are limited by steric saturation at the metal ion, which can result in high energy activation barriers for electron transfer. An alternative approach has been realized using a rare earth/alkali metal/1,1'-BINOLate (REMB) heterobimetallic framework, which uses redox-inactive metals within the secondary coordination sphere to control ligand reorganization. The rational syntheses of functionalized cerium(IV) products and a mechanistic examination of the role of ligand reorganization in cerium(III) oxidation are presented.

  4. Combinations of 148 navigation stars and the star tracker (United States)

    Duncan, R.


    The angular separation of all star combinations for 148 nav star on the onboard software for space transportation system-3 flight and following missions is presented as well as the separation of each pair that satisfies the viewing constraints of using both star trackers simultaneously. Tables show (1) shuttle star catalog 1980 star position in M 1950 coordinates; (2) two star combination of 148 nav stars; and (3) summary of two star-combinations of the star tracker 5 deg filter. These 148 stars present 10,875 combinations. For the star tracker filters of plus or minus 5 deg, there are 875 combinations. Formalhaut (nav star 26) has the best number of combinations, which is 33.

  5. The recrystallization and texture of magnesium-zinc-cerium alloys

    Energy Technology Data Exchange (ETDEWEB)

    Mackenzie, L.W.F. [Novelis Global Technology Centre, 945 Princess Street, Kingston, Ontario, K7L 5L9 (Canada); Department of Mining and Materials Engineering, McGill University, 3610 University, Montreal, Quebec, H3A 2B2 (Canada)], E-mail:; Pekguleryuz, M.O. [Department of Mining and Materials Engineering, McGill University, 3610 University, Montreal, Quebec, H3A 2B2 (Canada)


    Optical microscopy, electron backscatter diffraction and X-ray diffraction are employed to characterize the microstructures and textures of as-rolled and annealed Mg-1Zn and Mg-1Zn-xCe. Mg-1Zn exhibited 'basal' textures: the basal poles aligned with the sheet normal direction. With the addition of cerium, the texture was basal when recrystallization was limited; during recrystallization, the basal texture component weakened, to be replaced by a component with basal poles rotated {approx}45 deg. towards the transverse direction. Deformation, recrystallization and texture are discussed.

  6. The recrystallization and texture of magnesium-zinc-cerium alloys

    International Nuclear Information System (INIS)

    Optical microscopy, electron backscatter diffraction and X-ray diffraction are employed to characterize the microstructures and textures of as-rolled and annealed Mg-1Zn and Mg-1Zn-xCe. Mg-1Zn exhibited 'basal' textures: the basal poles aligned with the sheet normal direction. With the addition of cerium, the texture was basal when recrystallization was limited; during recrystallization, the basal texture component weakened, to be replaced by a component with basal poles rotated ∼45 deg. towards the transverse direction. Deformation, recrystallization and texture are discussed

  7. Electrochemical studies on cerium(Ⅲ) in molten fluoride mixtures

    Institute of Scientific and Technical Information of China (English)



    This study aims to determine the principal electrochemical characteristics of the electrodeposition of cerium metal from molten fluoride systems.The cathodic process of Ce3+ ions in LiF-NaF and LiF-NaF-CaF2 molten salts was studied using electrochemical techniques as steady state and cyclic voltammetry methods.The decomposition potential(Ed) and the overvoltage(η) were determined for NaCeF4 using current-potential curves under galvanostatic conditions.The Ed was found to be 2.025 V in LiF-NaF and 2.045 V in...

  8. Options for the recovery of cerium by solvent extraction

    Energy Technology Data Exchange (ETDEWEB)

    Soldenhoff, K.H. [Australian Nuclear Science and Technology Organisation, Lucas Heights, NSW (Australia)


    This paper reports the results of an experimental program to examine the use of various commercial reagents for the extraction of cerium (IV) from sulphate solutions. Extractants tested include organophosphorus esters (TOPO, Cyanex 923 and Cyanex 925), organophosphorus acids (DEHPA, lonquest 801 and Cyanex 272) and high molecular weight amine, Alamine 336. The suitability of reagents is assessed in terms of process relevant criteria such as extraction dependence on acidity, selectivity over other rare earths and thorium, stability of reagent towards oxidation and loading characteristics. (author) 15 refs., 2 tabs., 5 figs.

  9. Properties of hot liquid cerium by LDA + U molecular dynamics. (United States)

    Siberchicot, Bruno; Clérouin, Jean


    We present ab initio simulations of liquid cerium in the framework of the LDA + U formulation. The liquid density has been determined self-consistently by searching for the zero pressure equilibrium state at 1320 K with the same set of parameters (U and J) and occupation matrices as those optimized for the γ phase. We have computed static and transport properties. The liquid produced by the simulations appears more structured than the available measurements. This raises questions regarding the ability of the theory to describe such a complex liquid. Conductivity calculations and temperature dependences are nevertheless in reasonable agreement with data.

  10. Hexadecapole deformation studies in 148,150Nd

    Indian Academy of Sciences (India)

    B S Nara Singh; V Nanal; R G Pillay


    The -ray yields from inelastically excited 2± and 4± levels of 144,146,148,150Nd nuclei using 16O beam at near barrier energies in coincidence with the back-scattered projectiles were measured. The 2± and 4± level cross-sections were deduced from the measured -ray yields and fitted to the DWBA calculations to obtain the reduced transition matrix elements (4:0± → 4±). The deduced (4) values for 148Nd and 150Nd nuclei, 0.16(0.05) and 0.22(0.12) eb2, respectively are consistent with theoretical predictions.

  11. Soil organic matter influences cerium translocation and physiological processes in kidney bean plants exposed to cerium oxide nanoparticles. (United States)

    Majumdar, Sanghamitra; Peralta-Videa, Jose R; Trujillo-Reyes, Jesica; Sun, Youping; Barrios, Ana C; Niu, Genhua; Margez, Juan P Flores-; Gardea-Torresdey, Jorge L


    Soil organic matter plays a major role in determining the fate of the engineered nanomaterials (ENMs) in the soil matrix and effects on the residing plants. In this study, kidney bean plants were grown in soils varying in organic matter content and amended with 0-500mg/kg cerium oxide nanoparticles (nano-CeO2) under greenhouse condition. After 52days of exposure, cerium accumulation in tissues, plant growth and physiological parameters including photosynthetic pigments (chlorophylls and carotenoids), net photosynthesis rate, transpiration rate, and stomatal conductance were recorded. Additionally, catalase and ascorbate peroxidase activities were measured to evaluate oxidative stress in the tissues. The translocation factor of cerium in the nano-CeO2 exposed plants grown in organic matter enriched soil (OMES) was twice as the plants grown in low organic matter soil (LOMS). Although the leaf cover area increased by 65-111% with increasing nano-CeO2 concentration in LOMS, the effect on the physiological processes were inconsequential. In OMES leaves, exposure to 62.5-250mg/kg nano-CeO2 led to an enhancement in the transpiration rate and stomatal conductance, but to a simultaneous decrease in carotenoid contents by 25-28%. Chlorophyll a in the OMES leaves also decreased by 27 and 18% on exposure to 125 and 250mg/kg nano-CeO2. In addition, catalase activity increased in LOMS stems, and ascorbate peroxidase increased in OMES leaves of nano-CeO2 exposed plants, with respect to control. Thus, this study provides clear evidence that the properties of the complex soil matrix play decisive roles in determining the fate, bioavailability, and biological transport of ENMs in the environment. PMID:27343939

  12. Characterization of microstructure and catalytic of cerium oxide obtained by colloidal solution

    International Nuclear Information System (INIS)

    This study investigated to obtain particles of cerium oxide, for use as catalysts for the combustion of methane using the technique of through polymeric colloidal solution. Obtaining the colloidal system is based on hydrolysis of salts such as cerium acetylacetonate, cerium nitrate in the presence of additives such as polyvinylbutyral (PVB), polyvinylpyrrolidone (PVP) and polyvinyl acetate (PVA), at concentrations of 5, 10 and 15% in aqueous or alcoholic medium. These solutions containing ions of interest were subjected to a heat treatment at 650° C for 30 minutes, with heating rate of 2 ° C/ min. After heat treatment, the fibers were characterized according to their morphology, surface area, crystallinity, weight loss and catalytic activity. Samples obtained from cerium acetylacetonate were more reactive than the cerium nitrate to the combustion of methane, as showed greater conversions and higher temperatures reached during the process, which is of utmost importance since the combustion catalytic methane is used for generating thermal energy. After the reaction with methane, the samples underwent significant change in surface area, probably due to the intensity of combustion reactions of the nitrate and the generation of heat involved in this reaction, which gave rise to coarse particles. During the combustion process using the obtained from particles of cerium acetylacetonate, there was the release of large quantities of nitrogen compared to the results of assays with the particles obtained with cerium nitrate. (author)

  13. Cerium fluoride nanoparticles protect cells against oxidative stress

    Energy Technology Data Exchange (ETDEWEB)

    Shcherbakov, Alexander B.; Zholobak, Nadezhda M. [Zabolotny Institute of Microbiology and Virology, National Academy of Sciences of Ukraine, Kyiv D0368 (Ukraine); Baranchikov, Alexander E. [Kurnakov Institute of General and Inorganic Chemistry of the Russian Academy of Sciences, Moscow 119991 (Russian Federation); Ryabova, Anastasia V. [Prokhorov General Physics Institute of the Russian Academy of Sciences, Moscow 119991 (Russian Federation); National Research Nuclear University MEPhI (Moscow Engineering Physics Institute), Moscow 115409 (Russian Federation); Ivanov, Vladimir K., E-mail: [Kurnakov Institute of General and Inorganic Chemistry of the Russian Academy of Sciences, Moscow 119991 (Russian Federation); National Research Tomsk State University, Tomsk 634050 (Russian Federation)


    A novel facile method of non-doped and fluorescent terbium-doped cerium fluoride stable aqueous sols synthesis is proposed. Intense green luminescence of CeF{sub 3}:Tb nanoparticles can be used to visualize these nanoparticles' accumulation in cells using confocal laser scanning microscopy. Cerium fluoride nanoparticles are shown for the first time to protect both organic molecules and living cells from the oxidative action of hydrogen peroxide. Both non-doped and terbium-doped CeF{sub 3} nanoparticles are shown to provide noteworthy protection to cells against the vesicular stomatitis virus. - Highlights: • Facile method of CeF{sub 3} and CeF{sub 3}:Tb stable aqueous sols synthesis is proposed. • Naked CeF{sub 3} nanoparticles are shown to be non-toxic and to protect cells from the action of H{sub 2}O{sub 2}. • CeF{sub 3} and CeF{sub 3}:Tb nanoparticles are shown to protect living cells against the vesicular stomatitis virus.

  14. New sunscreen materials based on amorphous cerium and titanium phosphate

    International Nuclear Information System (INIS)

    Cerium-titanium pyrophosphates Ce1-xTi xP2O7 (with x = 0, 0.50, and 1.0), which are novel phosphate materials developed as UV-shielding agents for use in cosmetics, were characterized by X-ray diffraction, X-ray fluorescent analysis, UV-vis reflectance, and Raman spectroscopy. Since the optical reflectance shifted to lower wavelengths by the crystallization of the phosphates and the stabilization of the amorphous state of the cerium-titanium pyrophosphates was carried out by doping niobium (Nb). Raman spectroscopic study of the phosphate showed that P-O-P bending and stretching modes decreased with the loading of Nb, accompanying with the formation of Nb-O stretching mode. Therefore, the increase in the amount of the non-bridging oxygen in the amorphous phosphate should be the reason for the inhibition of the crystallization. This stabilization is a significant improvement, which enables to apply these amorphous phosphates not only to cosmetics and paints, but also plastics and films

  15. Mesoscopic structure of cerium waste loaded hydrated cement by SANS

    International Nuclear Information System (INIS)

    Cementation is one of the most commonly used methods for conditioning radioactive wastes. It provides a cost-effective solution for encapsulation of low and intermediate level radioactive wastes into suitable solid form for long term safety storage. Cerium is used for decontamination of alpha contaminated metallic waste and after this decontamination process, secondary wastes with corrosion products are created, which must be managed properly and cemented for near surface disposal. In the present work, modification of mesoscopic structure in hydrated cement due to addition of simulated cerium waste at different concentrations has been investigated by small-angle neutron scattering (SANS). Structural modifications, in mesoscopic length scale, have been observed. The scattering profiles for three kinds of cement blocks (virgin, 10 g/l and 20 g/l of corrosion product (C.P.) with 4 mm thickness) are shown. Data have been analyzed in the light of polydisperse spherical particles model assuming a log-normal distribution. Widely separated bimodal particle size distributions best represent the present data. Further, it has been observed that the scattering profile obeys power-law (Q-n) behaviour in two domains of Q, which reflects the self-similar/self-affined morphology of the inhomogeneities. Estimated parameters from SANS data are tabulated. A comparison is shown mentioning the value of scattering radius of gyration, exponent values (η) and average particle size for each kind of hydrated cement sample. (author)

  16. 26 CFR 1.148-11 - Effective dates. (United States)


    ... to any issue issued on or before June 30, 1993. (3) No elective retroactive application for hedges of fixed rate issues. The provisions of § 1.148-4(h)(2)(i)(B) (relating to hedges of fixed rate issues) may... provisions retroactively. (d) Transition rule excepting certain state guarantee funds from the definition...

  17. 19 CFR 148.103 - Family grouping of allowances. (United States)


    ... allowance shall not include an allowance for a family member not entitled to it in his own right, nor shall a group allowance be applied to any property of that member. (b) Members of a family residing in one... 19 Customs Duties 2 2010-04-01 2010-04-01 false Family grouping of allowances. 148.103 Section...

  18. 19 CFR 148.2 - Residence status of arriving persons. (United States)


    ... Residence status of arriving persons. (a) General. Persons arriving from foreign countries shall be divided... 19 Customs Duties 2 2010-04-01 2010-04-01 false Residence status of arriving persons. 148.2... established a home elsewhere. For this purpose, the residence of a wife shall be deemed to be that of...

  19. 45 CFR 1706.141-1706.148 - [Reserved (United States)



  20. 19 CFR 148.111 - Written declaration for unaccompanied articles. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Written declaration for unaccompanied articles... of the United States § 148.111 Written declaration for unaccompanied articles. The baggage... covers articles which do not accompany him and: (a) The articles are entitled to free entry under the...

  1. 19 CFR 148.90 - Foreign military personnel. (United States)


    ... International Organizations and Special Treatment for Returning Individuals § 148.90 Foreign military personnel... be referred to the Commissioner of Customs for instructions. (3) Retention and verification of the warehouse proprietors' records. The warehouse proprietor shall retain all records relating to the entry...

  2. 33 CFR 157.148 - COW system: Evidence for inspections. (United States)


    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false COW system: Evidence for... CARRYING OIL IN BULK Crude Oil Washing (COW) System on Tank Vessels Inspections § 157.148 COW system... inspector evidence that the COW system has been installed in accordance with the plans accepted under §...

  3. 33 CFR 110.148 - Johnsons River at Bridgeport, Conn. (United States)


    ... SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.148 Johnsons River at Bridgeport, Conn... beginning. (b) The regulations. The anchorage is for use by commercial and pleasure craft. Temporary floats... temporary anchors or mooring piles are under the jurisdiction of the local harbor master. Fixed...

  4. 42 CFR 433.148 - Denial or termination of eligibility. (United States)


    ... Assignment of Rights to Benefits § 433.148 Denial or termination of eligibility. In administering the assignment of rights provision, the agency must: (a) Deny or terminate eligibility for any applicant or recipient who— (1) Refuses to assign his own rights or those of any other individual for whom he can...

  5. Ion exchange reactions in amorphous and crystalline aluminium silicates from solution of cerium salts

    International Nuclear Information System (INIS)

    Reactions of ion-exchange of Na+ by Ce3+ and NH4+ on the zeolite containing catalyst, amorphous silica alumina and zeolite Y have been studied. The cerium cations are shown to be exchanged by the Na+ cations with more selectivity than the anmonia cations. In the case of the zeolite containing catalyst and amorphous silica alumina the region of the staggered ion-exchange from the mixture of the solutions of cerium and ammonium sulphates was been detected. This is explained by the formation fo cerium complexes with the sulphate ions

  6. Effect of Cerium on Mechanical Properties and Morphology of ZZn4-1 Alloy

    Institute of Scientific and Technical Information of China (English)


    Effect of the addition of cerium in appropriate amount on the mechanical properties and morphology of ZZn4-1 alloy was investigated. In the case of samples collected from metal mould, the results show that the addition of cerium in appropriate amount can increase tensile strength and HB hardness, and can refine the microstructure of ZZn4-1 alloy considerably. In the case of samples collected from pressure die-casting, the addition of cerium in appropriate amount can refine the primary η-phase and the eutectic structure of pressure die-casting and improve mechanical and processing properties of the alloy.

  7. Studies of solution deposited cerium oxide thin films on textured Ni-alloy substrates for YBCO superconductor

    International Nuclear Information System (INIS)

    Cerium oxide (CeO2) buffer layers play an important role for the development of YBa2Cu3O7-x (YBCO) based superconducting tapes using the rolling assisted biaxially textured substrates (RABiTS) approach. The chemical solution deposition (CSD) approach has been used to grow epitaxial CeO2 films on textured Ni-3 at.% W alloy substrates with various starting precursors of ceria. Precursors such as cerium acetate, cerium acetylacetonate, cerium 2-ethylhexanoate, cerium nitrate, and cerium trifluoroacetate were prepared in suitable solvents. The optimum growth conditions for these cerium precursors were Ar-4% H2 gas processing atmosphere, solution concentration levels of 0.2-0.5 M, a dwell time of 15 min, and a process temperature range of 1050-1150 deg. C. X-ray diffraction, AFM, SEM, and optical microscopy were used to characterize the CeO2 films. Highly textured CeO2 layers were obtained on Ni-W substrates with both cerium acetate and cerium acetylacetonate as starting precursors. YBCO films with a J c of 1.5 MA/cm2 were obtained on cerium acetylacetonate-based CeO2 films with sputtered YSZ and CeO2 cap layers

  8. Study on Catalysts with Rhodium Loading on Different Cerium-Zirconium Mixed Oxides

    Institute of Scientific and Technical Information of China (English)


    The catalysts with Rh loading on different cerium-zirconium mixed oxides were characterized by BET, H2-TPR and OSC. The effects of different cerium-zirconium mixed oxides on catalytic performance and thermal stability of Rh loaded catalyst were studied. The results show that: (1) Rh can enhance cerium-zirconium mixed oxides OSC and catalytic reaction rates; (2) cerium-zirconium mixed oxides with high Ce contents and low Zr contents are more favorable to the stability of catalysts. Moreover, the contents of CeO2 have important effect on catalysts characteristics, and the addition of some rare earth components, such as La, Pr and Nd also have some influences.

  9. Immobilization of simulated radioactive soil waste containing cerium by self-propagating high-temperature synthesis

    Energy Technology Data Exchange (ETDEWEB)

    Mao, Xianhe, E-mail:; Qin, Zhigui; Yuan, Xiaoning; Wang, Chunming; Cai, Xinan; Zhao, Weixia; Zhao, Kang; Yang, Ping; Fan, Xiaoling


    A simulated radioactive soil waste containing cerium as an imitator element has been immobilized by a thermite self-propagating high-temperature synthesis (SHS) process. The compositions, structures, and element leaching rates of products with different cerium contents have been characterized. To investigate the influence of iron on the chemical stability of the immobilized products, leaching tests of samples with different iron contents with different leaching solutions were carried out. The results showed that the imitator element cerium mainly forms the crystalline phases CeAl{sub 11}O{sub 18} and Ce{sub 2}SiO{sub 5}. The leaching rate of cerium over a period of 28 days was 10{sup −5}–10{sup −6} g/(m{sup 2} day). Iron in the reactants, the reaction products, and the environment has no significant effect on the chemical stability of the immobilized SHS products.

  10. Immobilization of simulated radioactive soil waste containing cerium by self-propagating high-temperature synthesis (United States)

    Mao, Xianhe; Qin, Zhigui; Yuan, Xiaoning; Wang, Chunming; Cai, Xinan; Zhao, Weixia; Zhao, Kang; Yang, Ping; Fan, Xiaoling


    A simulated radioactive soil waste containing cerium as an imitator element has been immobilized by a thermite self-propagating high-temperature synthesis (SHS) process. The compositions, structures, and element leaching rates of products with different cerium contents have been characterized. To investigate the influence of iron on the chemical stability of the immobilized products, leaching tests of samples with different iron contents with different leaching solutions were carried out. The results showed that the imitator element cerium mainly forms the crystalline phases CeAl11O18 and Ce2SiO5. The leaching rate of cerium over a period of 28 days was 10-5-10-6 g/(m2 day). Iron in the reactants, the reaction products, and the environment has no significant effect on the chemical stability of the immobilized SHS products.

  11. The low gas flow rate foam separation of cerium(III) from dilute aqueous solutions

    International Nuclear Information System (INIS)

    Two low gas flow rate foam separation techniques, ion and precipitate flotation, have been investigated for the separation of trivalent cerium from solutions with initial cerium concentrations ranging from 1 x 10-8 to 1 x 10-4M in the pH range of 1.8 to 12 using the anionic collector sodium lauryl sulphate and the cationic surfactant cetyl trymethyl ammonium bromide. In addition to the type of collector, the pH and the cerium ion concentration, and other factors which can affect flotation results, viz. the time period of bubbling, the rate of gas flow, the ageing of both the cerium and the collector ions, the ionic strength, and the concentration of the collector ions have been investigated and optimum conditions have been established. Under optimum conditions removals as high a 98.5% can be achieved. (author)

  12. Inhibition of pH fronts in corrosion cells due to the formation of cerium hydroxide

    International Nuclear Information System (INIS)

    The effect of cerium-based corrosion inhibitors on the pH front between the alkaline cathode and acidic anode in corrosion cells has been studied. The cerium component of these inhibitors can affect the pH front since it precipitates in an alkaline environment as cerium hydroxide, which is important since the corrosion inhibition mechanism of the cerium component is a result of its deposition as a highly electrical resistive (passivation) layer on the cathode. It is studied whether the cerium can reach the cathode when fed into the corrosion cell from an external source after the onset of corrosion. To this end a simulation model was set up that includes the Poisson–Nernst–Planck theory to describe ion transport and the Frumkin–Butler–Volmer equation to describe charge transfer at the electrodes. In this model both the self-dissociation of water and the formation of cerium hydroxide are taken into account. To support our findings experimentally a corrosion cell consisting of an aluminum and copper electrode was used, in which the pH fronts were visualized using a pH-indicator. Two types of inhibitors were used; namely, highly soluble CeCl3 and sparsely soluble cerium dibutylphosphate, Ce(dbp)3. The results show that CeCl3 can reduce the size of the alkaline region and reach the cathode to form a passivation layer, whereas the solubility in case of Ce(dbp)3 is too low to supply sufficient amounts of trivalent cerium cations to penetrate the alkaline region. This behavior can be explained by the simulation results, which reveal a threshold for the corrosion inhibitor solubility below which no passivation of the cathode occurs

  13. Catalysts with Cerium in a Membrane Reactor for the Removal of Formaldehyde Pollutant from Water Effluents


    Mirella Gutiérrez-Arzaluz; Luis Noreña-Franco; Saúl Ángel-Cuevas; Violeta Mugica-Álvarez; Miguel Torres-Rodríguez


    We report the synthesis of cerium oxide, cobalt oxide, mixed cerium, and cobalt oxides and a Ce–Co/Al2O3 membrane, which are employed as catalysts for the catalytic wet oxidation (CWO) reaction process and the removal of formaldehyde from industrial effluents. Formaldehyde is present in numerous waste streams from the chemical industry in a concentration low enough to make its recovery not economically justified but high enough to create an environmental hazard. Common biological degradation ...

  14. Protein adsorption and cellular uptake of cerium oxide nanoparticles as a function of zeta potential


    Patil, Swanand; Sandberg, Amanda; Heckert, Eric; Self, William; Seal, Sudipta


    The surface chemistry of biomaterials can have a significant impact on their performance in biological applications. Our recent work suggests that cerium oxide nanoparticles are potent antioxidants in cell culture models and we have evaluated several therapeutic applications of these nanoparticles in different biological systems. Knowledge of protein adsorption and cellular uptake will be very useful in improving the beneficial effects of cerium oxide nanoparticles in biology. In the present ...

  15. Effects of Morphology of Cerium Oxide Catalysts for Reverse Water Gas Shift Reaction


    Kovasevic, M.; Mojet, B.L.; Ommen, van, B.; Lefferts, L.


    Reverse water gas shift reaction (RWGS) was investigated over cerium oxide catalysts of distinct morphologies: cubes, rods and particles. Catalysts were characterized by X-ray diffraction, Raman spectroscopy and temperature programmed reduction (TPR) in hydrogen. Nanoshapes with high concentration of oxygen vacancies contain less surface oxygen removable in TPR. Cerium oxide cubes exhibited two times higher activity per surface area as compared to rods and particles. Catalytic activity of the...

  16. A chemical cleaning process with Cerium (IV)-sulfuric acid

    International Nuclear Information System (INIS)

    A chemical cleaning process with a high decontamination factor (DF) is requested for decommissioning. Usually, the process should be qualified with the features, such as the feasibility of treating large or complicated form waste, the minimization of secondary waste. Therefore, a powerful technique of redox decontamination process with Ce+4/Ce+3 has been studied at INER. First, the redox of cerium ion with electrolytic method was developed. Two kinds of home-made electrolyzer were used. One is with an ion-exchange membrane, and the other one is with a ceramic separator. Second, factors influencing the decontamination efficiency, such as the concentration of Ce+4, regeneration current density, temperature, acidity of solution were all studied experimentally, and the optimum conditions were specified too. Third, the liquid waste recycling and treatment were developed with electrodialysis and ion-exchange absorption methods. Finally, the hot test was proceeded with the contaminated metals from DCR of nuclear facility. (author)

  17. Effect of Surface Modification on Behaviors of Cerium Oxide Nanopowders

    Institute of Scientific and Technical Information of China (English)

    Li Mei; Shi Zhenxue; Liu Zhaogang; Hu Yanhong; Wang Mitang; Li Hangquan


    Study was made on the effect of surface modification on the behaviors of cerium oxide nanopowders. A surfactant-sodium dodecyl sulfate(C12H25SO4Na) was used to modify the surface of CeO2 powder particles. The unmodified and modified CeO2 powders were characterized by using a powder comprehensive characteristic tester, laser particle size analyzer, specific surface area tester, X-ray diffraction tester, and a scanning electron microscope. The testing and analysis results showed that C12H25SO4Na surface modification might increase the flowability and dispersity, and decrease the specific surface area and agglomeration of CeO2 powders. The mechanism of the surface modification of CeO2 powder particles was also discussed.

  18. Modification mechanism of cerium on the Al-18Si alloy

    Institute of Scientific and Technical Information of China (English)


    The effect of the rare earth cerium (Ce) on the hypereutectic Al-Si alloy under different casting states have been studied by optical microscope and quantitative image analysis. It is found that the size and the quantity of primary silicon in castings decrease with the increase of added Ce in the melt. Meanwhile primary silicon changes from branched shape to fine facetted shape. Although the modification on eutectic silicon in castings also improves with the increase of added Ce in the melt, the effect of modification on eutectic silicon away from primary silicon is more obvious than that on eutectic silicon close to primary silicon. The modification mechanism was analyzed in detail by means of scanning electron microscope equipped with energy dispersive analysis of X-ray and thermodynamics analysis, which included the analysis on the change in standard Gibbs energy of reaction and reaction equilibrium.

  19. Cerium intermetallics with TiNiSi-type structure

    Energy Technology Data Exchange (ETDEWEB)

    Janka, Oliver; Niehaus, Oliver; Poettgen, Rainer [Muenster Univ. (Germany). Inst. fuer Anorganische und Analytische Chemie; Chevalier, Bernard [Bordeaux Univ. CNRS (UPR 9048), Pessac (France). Inst. de Chimie de la Matiere Condensee de Bordeaux (ICMCB)


    Intermetallic compounds with the equiatomic composition CeTX that crystallize with the orthorhombic TiNiSi-type structure can be synthesized with electron-rich transition metals (T) and X = Zn, Al, Ga, Si, Ge, Sn, As, Sb, and Bi. The present review focusses on the crystal chemistry and chemical bonding of these CeTX phases and on their physical properties, {sup 119}Sn and {sup 121}Sb Moessbauer spectra, high-pressure effects, hydrogenation reactions and the formation of solid solutions in order to elucidate structure-property relationships. This paper is the final one of a series of four reviews on equiatomic intermetallic cerium compounds [Part I: Z. Naturforsch. 2015, 70b, 289; Part II: Z. Naturforsch. 2015, 70b, 695; Part III: Z. Naturforsch. 2016, 71b, 165].

  20. On the mixed nature of cerium conversion coatings

    Energy Technology Data Exchange (ETDEWEB)

    Botana, F.J.; Aballe, A.; Bethencourt, M.; Cano, M.J. [Cadiz Univ. (Spain). Dept. de Ciencia de los Materiales e Ingenieria Metalurgica y Quimica Inorganica; Marcos, M. [Cadiz Univ. (Spain). Dept. de Ingenieria Mecanica y Diseno Industrial


    Alternative pretreatments are currently under development in order to avoid the environmental impact produced by using surface finishing processes based on chromates. Some of the environmentally friendly alternatives proposed involve the use of lanthanide based compounds. In this study, conversion coatings on AA5083 (Al-Mg) samples developed using full immersion pretreatments in 500 ppm CeCl{sub 3} aqueous solutions have been investigated. Their microscopic and compositional features have been analyzed using SEM images and EDS spectra. From this analysis it has been determined that this layer over the surface of the samples is of a heterogeneous composition. This coating is formed by an alumina coating covering the aluminum matrix and dispersed cerium-rich islands deposited over the cathodic sites of the alloy. A characterization methodology is proposed based on the utilization of different electrochemical techniques, such as open circuit potential monitoring (OCP), linear polarization (LP) and electrochemical impedance spectroscopy (EIS). (orig.)

  1. Characterization of a zinc-cerium flow battery (United States)

    Leung, P. K.; Ponce-de-León, C.; Low, C. T. J.; Shah, A. A.; Walsh, F. C.

    The performance of a divided, parallel-plate zinc-cerium redox flow battery using methanesulfonic acid electrolytes was studied. Eight two and three-dimensional electrodes were tested under both constant current density and constant cell voltage discharge. Carbon felt and the three-dimensional platinised titanium mesh electrodes exhibited superior performance over the 2-dimensional electrodes. The charge and discharge characteristics of the redox flow battery were studied under different operating conditions and Zn/Ce reactant, as well as methansulfonic acid concentration. The cell performance improved at higher operating temperatures and faster electrolyte flow velocities. The number of possible cycles increased at reduced states of charge. During 15 min charge/discharge per cycle experiment, 57 cycles were obtained and the zinc reaction was found to be the limiting process during long term operation.

  2. Interplay of spin-orbit and entropic effects in cerium

    Energy Technology Data Exchange (ETDEWEB)

    Lanata, Nicola [Rutgers University; Yao, Yong-Xin [Ames Laboratory; Wang, Cai-Zhuang [Ames Laboratory; Ho, Kai-Ming [Ames Laboratory; Kotliar, Gabriel [Rutgers University


    We perform first-principles calculations of elemental cerium and compute its pressure-temperature phase diagram, finding good quantitative agreement with the experiments. Our calculations indicate that, while a signature of the volume-collapse transition appears in the free energy already at low temperatures, at higher temperatures this signature is enhanced because of the entropic effects, and originates an actual thermodynamical instability. Furthermore, we find that the catalyst determining this feature is—in all temperature regimes—a pressure-induced effective reduction of the f-level degeneracy due to the spin-orbit coupling. Our analysis suggests also that the lattice vibrations might be crucial in order to capture the behavior of the pressure-temperature transition line at large temperatures.

  3. Growth of transition metals on cerium tungstate model catalyst layers (United States)

    Skála, T.; Tsud, N.; Stetsovych, V.; Mysliveček, J.; Matolín, V.


    Two model catalytic metal/oxide systems were investigated by photoelectron spectroscopy and scanning tunneling microscopy. The mixed-oxide support was a cerium tungstate epitaxial thin layer grown in situ on the W(1 1 0) single crystal. Active particles consisted of palladium and platinum 3D islands deposited on the tungstate surface at 300 K. Both metals were found to interact weakly with the oxide support and the original chemical state of both support and metals was mostly preserved. Electronic and morphological changes are discussed during the metal growth and after post-annealing at temperatures up to 700 K. Partial transition-metal coalescence and self-cleaning from the CO and carbon impurities were observed.

  4. Mechanochemical synthesis and spark plasma sintering of the cerium silicides

    International Nuclear Information System (INIS)

    Highlights: • Ce5Si3, Ce3Si2, CeSi, CeSi2−x and CeSi2 were mechanochemically synthesized. • Temperature and pressure were monitored to investigate reaction progress. • All syntheses proceeded through a MSR event followed by rapid solid-state diffusion. • Milling time before MSR correlates well with effective heat of formation. • Some synthesized material was densified by spark plasma sintering. - Abstract: The cerium silicides, Ce5Si3, Ce3Si2, CeSi, CeSi2−y, and CeSi2−x, have been prepared from the elements by mechanochemical processing in a planetary ball mill. Preparation of the cerium silicide Ce5Si4 was unsuccessfully attempted and potential reasons for this are discussed. Temperature and pressure of the milling vial were monitored in situ to gain insight into the mechanochemical reaction kinetics, which include a mechanically-induced self-propagating reaction (MSR). Some prepared powders were consolidated by spark plasma sintering to high density. Starting materials, as-milled powders, and consolidated samples were characterized by X-ray diffraction, scanning electron microscopy, and energy dispersive spectroscopy. The results obtained help elucidate key questions in mechanochemical processing of intermetallics, showing first phase formation similar to thin films, MSR ignition times that are composition- and milling speed-dependent, and sensitivity of stable compound formation on the impact pressure. The results demonstrate mechanochemical synthesis as a viable technique for rare earth silicides

  5. Mechanochemical synthesis and spark plasma sintering of the cerium silicides

    Energy Technology Data Exchange (ETDEWEB)

    Alanko, Gordon A.; Jaques, Brian; Bateman, Allyssa [Department of Materials Science and Engineering, College of Engineering, Boise State University, 1910 University Drive, Boise, ID 83725 (United States); Butt, Darryl P., E-mail: [Department of Materials Science and Engineering, College of Engineering, Boise State University, 1910 University Drive, Boise, ID 83725 (United States); Center for Advanced Energy Studies, 995 University Boulevard, Idaho Falls, ID 83401 (United States)


    Highlights: • Ce{sub 5}Si{sub 3}, Ce{sub 3}Si{sub 2}, CeSi, CeSi{sub 2−x} and CeSi{sub 2} were mechanochemically synthesized. • Temperature and pressure were monitored to investigate reaction progress. • All syntheses proceeded through a MSR event followed by rapid solid-state diffusion. • Milling time before MSR correlates well with effective heat of formation. • Some synthesized material was densified by spark plasma sintering. - Abstract: The cerium silicides, Ce{sub 5}Si{sub 3}, Ce{sub 3}Si{sub 2}, CeSi, CeSi{sub 2−y}, and CeSi{sub 2−x}, have been prepared from the elements by mechanochemical processing in a planetary ball mill. Preparation of the cerium silicide Ce{sub 5}Si{sub 4} was unsuccessfully attempted and potential reasons for this are discussed. Temperature and pressure of the milling vial were monitored in situ to gain insight into the mechanochemical reaction kinetics, which include a mechanically-induced self-propagating reaction (MSR). Some prepared powders were consolidated by spark plasma sintering to high density. Starting materials, as-milled powders, and consolidated samples were characterized by X-ray diffraction, scanning electron microscopy, and energy dispersive spectroscopy. The results obtained help elucidate key questions in mechanochemical processing of intermetallics, showing first phase formation similar to thin films, MSR ignition times that are composition- and milling speed-dependent, and sensitivity of stable compound formation on the impact pressure. The results demonstrate mechanochemical synthesis as a viable technique for rare earth silicides.

  6. Thermal Treatment of Cerium Oxide and Its Properties: Adsorption Ability versus Degradation Efficiency

    Directory of Open Access Journals (Sweden)

    Pavel Janoš


    Full Text Available Cerium oxide belongs to the most important heterogeneous catalysts, but its applicability as so-called reactive sorbent for the degradation of toxic chemicals was only recently discovered. For these purposes, cerium oxide is prepared by precipitation of insoluble cerium salts (carbonates with a subsequent thermal decomposition. Properties of cerium oxide prepared from the carbonate precursor are strongly affected by the temperature during the calcination. Main physicochemical properties of cerium oxide (specific surface area, crystallinity, and surface chemistry were examined in dependence on the calcination temperature. As the adsorptive properties of CeO2 are undoubtedly of great importance in the abovementioned applications, the adsorption ability was studied using an azo dye Acid Orange 7 (AO7 as a model compound. The highest sorption efficiency towards AO7 exhibited sorbents prepared at temperatures below 700°C, which was attributed mainly to the presence of hydroxyl groups on the oxide surface. A strong correlation was found between an adsorption efficiency of cerium oxides and their degradation efficiency for organophosphate pesticide parathion methyl. The >Ce–OH groups on the sorbent surface are responsible for the dye binding by the surface-complexation mechanism, and probably also for the nucleophilic cleavage of the P–O–aryl bond in the pesticide molecule.

  7. ’n Eko-billike beoordeling van Psalm 148

    Directory of Open Access Journals (Sweden)

    H. Viviers


    Full Text Available An eco-just evaluation of Psalm 148Eco-justness determines whether the earth and her inhabitants are treated in their own right as subjects, and not only as objects to be acted upon. At first glance it seems as if Psalm 148 is eco-just. The poet encompasses all of creation in this hymn of praise to Yahweh. However, it does not pass the test of eco-justness. Many (older commentators go along with the male ideological thrust of the psalm, without questioning the maleness of Yahweh. The construct of Yahweh as the “super” male, symbolising Israel’s success as a nation, is not good news for eco-sensitivity and eco-responsibility. Female earth becomes very vulnerable within this shaping of society always aimed at serving male hegemony, values and interests. To uncritically reinscribe Psalm 148’s androcentric, ideological stance will simultaneously lead to an impoverishment and a one dimensional view of life in general.

  8. 46 CFR 148.04-15 - Petroleum coke, uncalcined; petroleum coke, uncalcined and calcined (mixture). (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false Petroleum coke, uncalcined; petroleum coke, uncalcined and calcined (mixture). 148.04-15 Section 148.04-15 Shipping COAST GUARD, DEPARTMENT OF HOMELAND... Requirements for Certain Material § 148.04-15 Petroleum coke, uncalcined; petroleum coke, uncalcined...

  9. 46 CFR 148.04-21 - Coconut meal pellets (also known as copra pellets). (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false Coconut meal pellets (also known as copra pellets). 148.04-21 Section 148.04-21 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) DANGEROUS... § 148.04-21 Coconut meal pellets (also known as copra pellets). (a) Coconut meal pellets; (1)...

  10. 19 CFR 148.3 - Customs treatment after transiting the Panama Canal. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Customs treatment after transiting the Panama Canal. 148.3 Section 148.3 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND... § 148.3 Customs treatment after transiting the Panama Canal. Passengers' baggage and effects...

  11. 19 CFR 148.15 - Inclusion of articles not for personal or household use. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Inclusion of articles not for personal or household use. 148.15 Section 148.15 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF... § 148.15 Inclusion of articles not for personal or household use. Articles not personal in character,...

  12. 26 CFR 1.148-6A - General allocation and accounting rules. (United States)


    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false General allocation and accounting rules. 1.148-6A Section 1.148-6A Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED... July 8, 1997 § 1.148-6A General allocation and accounting rules. (a) through (d)(3)(iii)(B) ....

  13. Copper, Boron, and Cerium Additions in Type 347 Austenitic Steel to Improve Creep Rupture Strength (United States)

    Laha, Kinkar; Kyono, J.; Shinya, Norio


    Type 347 austenitic stainless steel (18Cr-12Ni-Nb) was alloyed with copper (3 wt pct), boron (0.01 to 0.06 wt pct), and cerium (0.01 wt pct) with an aim to increase the creep rupture strength of the steel through the improved deformation and cavitation resistance. Short-term creep rupture strength was found to increase with the addition of copper in the 347 steel, but the long-term strength was inferior. Extensive creep cavitation deprived the steel of the beneficial effect of creep deformation resistance induced by nano-size copper particles. Boron and cerium additions in the copper-containing steel increased its creep rupture strength and ductility, which were more for higher boron content. Creep deformation, grain boundary sliding, and creep cavity nucleation and growth in the steel were found to be suppressed by microalloying the copper-containing steel with boron and cerium, and the suppression was more for higher boron content. An auger electron spectroscopic study revealed the segregation of boron instead of sulfur on the cavity surface of the boron- and cerium-microalloyed steel. Cerium acted as a scavenger for soluble sulfur in the steels through the precipitation of cerium sulfide (CeS). This inhibited the segregation of sulfur and facilitated the segregation of boron on cavity surface. Boron segregation on the nucleated cavity surface reduced its growth rate. Microalloying the copper-containing 347 steel with boron and cerium thus enabled to use the full extent of creep deformation resistance rendered by copper nano-size particle by increase in creep rupture strength and ductility.

  14. Exposure, Health and Ecological Effects Review of Engineered Nanoscale Cerium and Cerium Oxide Associated with its Use as a Fuel Additive (United States)

    Advances of nanoscale science have produced nanomaterials with unique physical and chemical properties at commercial levels which are now incorporated into over 1000 products. Nanoscale cerium (di) oxide (CeO(2)) has recently gained a wide range of applications which includes coa...

  15. Exposure and Health Effects Review of Engineered Nanoscale Cerium and Cerium Dioxide Associated with its Use as a Fuel Additive - NOW IN PRINT IN THE JOURNAL (United States)

    Advances of nanoscale science have produced nanomaterials with unique physical and chemical properties at commercial levels that are now incorporated into over 1000 products. Nanoscale cerium (di) oxide (Ce02) has recently gained a wide range of applications which includes coatin...

  16. Catalysts with Cerium in a Membrane Reactor for the Removal of Formaldehyde Pollutant from Water Effluents. (United States)

    Gutiérrez-Arzaluz, Mirella; Noreña-Franco, Luis; Ángel-Cuevas, Saúl; Mugica-Álvarez, Violeta; Torres-Rodríguez, Miguel


    We report the synthesis of cerium oxide, cobalt oxide, mixed cerium, and cobalt oxides and a Ce-Co/Al₂O₃ membrane, which are employed as catalysts for the catalytic wet oxidation (CWO) reaction process and the removal of formaldehyde from industrial effluents. Formaldehyde is present in numerous waste streams from the chemical industry in a concentration low enough to make its recovery not economically justified but high enough to create an environmental hazard. Common biological degradation methods do not work for formaldehyde, a highly toxic but refractory, low biodegradability substance. The CWO reaction is a recent, promising alternative that also permits much lower temperature and pressure conditions than other oxidation processes, resulting in economic benefits. The CWO reaction employing Ce- and Co-containing catalysts was carried out inside a slurry batch reactor and a membrane reactor. Experimental results are reported. Next, a mixed Ce-Co oxide film was supported on an γ-alumina membrane used in a catalytic membrane reactor to compare formaldehyde removal between both types of systems. Catalytic materials with cerium and with a relatively large amount of cerium favored the transformation of formaldehyde. Cerium was present as cerianite in the catalytic materials, as indicated by X-ray diffraction patterns. PMID:27231888

  17. Thermal expansion and stability of cerium-doped Lu2SiO5

    International Nuclear Information System (INIS)

    In-situ X-ray diffraction, differential scanning calorimetry and dilatometry were used to measure the thermal expansion and thermal stability of cerium-doped Lu2SiO5. The thermal expansion of Lu2SiO5 was highly anisotropic, with expansion along the b- and c-axes 5-10 times greater than expansion along the a-axis. There were no measurable differences in the thermal expansion between undoped Lu2SiO5, cerium-doped Lu2SiO5 with high scintillation efficiency, cerium-doped Lu2SiO5 with low scintillation efficiency and annealed cerium-doped Lu2SiO5. Lu2SiO5 decomposed at temperatures as low as 1350 deg. C in 2, while the presence of 100-150 ppm O2 stabilized Lu2SiO5 at temperatures up to 1760 deg. C. No bulk defects were identified to account for the difference between high scintillation efficiency and low scintillation efficiency cerium-doped Lu2SiO5 samples

  18. Effect of cerium loading on structure and morphology of modified Ce-USY zeolites

    Energy Technology Data Exchange (ETDEWEB)

    Garcia, Fillipe A.C.; Araujo, Daniel R.; Silva, Junia C.M.; Macedo, Julio L. de; Dias, Silvia C.L.; Dias, Jose A., E-mail:, E-mail: [Laboratorio de Catalise, Instituto de Quimica, Faculdade UnB-Gama, Universidade de Brasilia, DF (Brazil); Ghesti, Grace F. [Engenharia de Energia, Faculdade UnB-Gama, Universidade de Brasilia, DF (Brazil); Filho, Geraldo N.R. [Centro de Ciencias Exatas e Naturais, Universidade Federal do Para, Belem, PA (Brazil)


    This work describes comprehensibly the effect of cerium loading on the structure and morphology of NH{sub 4}USY zeolite. The Ce-USY (2-25 wt.% of CeO{sub 2}) was obtained by wet impregnation of CeCl{sub 3} followed by calcination at 550 deg C for 8 h. At low loadings (2-10%), cerium species are mainly located at ion exchange positions in the framework, whereas at higher loadings (15.25%), small aggregates were formed on the HUSY surface. X-ray diffractograms (XRD) exhibited only the reflections related to HUSY, demonstrating the high dispersion of cerium species, but Fourier transform Raman spectroscopy (FT-Raman) detected CeO{sub x} for the materials above 10%. Reaction of CeCl{sub 3} with NH{sub 4}USY produced NH{sub 4}Cl, which decomposed to form HCl, leading to framework dealumination. The materials showed an increased Lewis/Bronsted ratio with increasing cerium loadings due to the interaction between the excess cerium and the OH groups of USY, and the consequent formation of CeO{sub x} species. (author)

  19. Exposure of cerium oxide nanoparticles to kidney bean shows disturbance in the plant defense mechanisms. (United States)

    Majumdar, Sanghamitra; Peralta-Videa, Jose R; Bandyopadhyay, Susmita; Castillo-Michel, Hiram; Hernandez-Viezcas, Jose-Angel; Sahi, Shivendra; Gardea-Torresdey, Jorge L


    Overwhelming use of engineered nanoparticles demands rapid assessment of their environmental impacts. The transport of cerium oxide nanoparticles (nCeO2) in plants and their impact on cellular homeostasis as a function of exposure duration is not well understood. In this study, kidney bean plants were exposed to suspensions of ∼ 8 ± 1 nm nCeO2 (62.5 to 500 mg/L) for 15 days in hydroponic conditions. Plant parts were analyzed for cerium accumulation after one, seven, and 15 days of nCeO2 exposure. The primary indicators of stress like lipid peroxidation, antioxidant enzyme activities, total soluble protein and chlorophyll contents were studied. Cerium in tissues was localized using scanning electron microscopy and synchrotron μ-XRF mapping, and the chemical forms were identified using μ-XANES. In the root epidermis, cerium was primarily shown to exist as nCeO2, although a small fraction (12%) was biotransformed to Ce(III) compound. Cerium was found to reach the root vascular tissues and translocate to aerial parts with time. Upon prolonged exposure to 500 mg nCeO2/L, the root antioxidant enzyme activities were significantly reduced, simultaneously increasing the root soluble protein by 204%. In addition, leaf's guaiacol peroxidase activity was enhanced with nCeO2 exposure in order to maintain cellular homeostasis. PMID:24981679

  20. Electrochemical deposition of cerium on porous silicon to improve photoluminescence properties

    Energy Technology Data Exchange (ETDEWEB)

    Atyaoui, Malek, E-mail: [Laboratoire de Photovoltaieque, Centre de Recherches et des Technologies de l' energie, PB:95, Hammam Lif 2050 (Tunisia); Dimassi, Wissem; Monther, Ghrib; Chtourou, Radhouane; Ezzaouia, Hatem [Laboratoire de Photovoltaieque, Centre de Recherches et des Technologies de l' energie, PB:95, Hammam Lif 2050 (Tunisia)


    In this work, we present results for Cerium (Ce) doping effects on photoluminescence (PL) properties of porous silicon (PS). Cerium was deposited using electrochemical deposition on porous silicon prepared by electrochemical anodization of P-type (100) Si. From the photoluminescence spectroscopy, it was shown that porous silicon treated with cerium can lead to an increase of photoluminescence when they are irradiated by light compared to the porous silicon layer without cerium. In order to understand the contribution of cerium to the enhanced photoluminescence, energy dispersive X-ray (EDX) spectroscopy, Fourier transmission infrared spectroscopy (FTIR), X-ray diffraction (XRD) and atomic force microscopy (AFM) were performed, and it was shown that the improved photoluminescence may be attributed to the change of Si-H bonds into Si-O-Ce bonds and to a newly formed PS layer during electrochemical Ce coating. - Highlights: Black-Right-Pointing-Pointer Degradation of the surface structures and the PL properties of PS remains a key issue for industrial production. Black-Right-Pointing-Pointer In order to solve this problem, the passivation of the PS surface by treating it with Ce is investigated. Black-Right-Pointing-Pointer To understand the effects of Ce on PL properties, EDX, FTIR, XRD, AFM and UV-vis analysis were performed.

  1. Catalysts with Cerium in a Membrane Reactor for the Removal of Formaldehyde Pollutant from Water Effluents

    Directory of Open Access Journals (Sweden)

    Mirella Gutiérrez-Arzaluz


    Full Text Available We report the synthesis of cerium oxide, cobalt oxide, mixed cerium, and cobalt oxides and a Ce–Co/Al2O3 membrane, which are employed as catalysts for the catalytic wet oxidation (CWO reaction process and the removal of formaldehyde from industrial effluents. Formaldehyde is present in numerous waste streams from the chemical industry in a concentration low enough to make its recovery not economically justified but high enough to create an environmental hazard. Common biological degradation methods do not work for formaldehyde, a highly toxic but refractory, low biodegradability substance. The CWO reaction is a recent, promising alternative that also permits much lower temperature and pressure conditions than other oxidation processes, resulting in economic benefits. The CWO reaction employing Ce- and Co-containing catalysts was carried out inside a slurry batch reactor and a membrane reactor. Experimental results are reported. Next, a mixed Ce–Co oxide film was supported on an γ-alumina membrane used in a catalytic membrane reactor to compare formaldehyde removal between both types of systems. Catalytic materials with cerium and with a relatively large amount of cerium favored the transformation of formaldehyde. Cerium was present as cerianite in the catalytic materials, as indicated by X-ray diffraction patterns.

  2. Effects of precipitate aging time on the cerium-zirconium composite oxides

    Institute of Scientific and Technical Information of China (English)

    钟强; 崔梅生; 岳梅; 王琦; 王磊; 郭荣贵; 龙志奇; 黄小卫


    Cerium-zirconium composite oxides with high performance were synthesized by a co-precipitation method, using zirco-nium oxychloride and rare earth chloride as raw materials. The effects of precipitate aging time on the properties of cerium-zirconium composite oxides were investigated. The prepared cerium-zirconium composite oxides were characterized by X-ray diffraction (XRD), BET specific surface area, pulsed oxygen chemical adsorption, H2 temperature-programmed-reduction (H2-TPR), scanning electron microscopy (SEM), etc. The results showed that the precipitate aging time caused great effects on the properties of cerium zirconium composite oxides. With the increase of aging time, the cerium zirconium composite oxides showed enhanced specific sur-face area, good thermal stability, and high oxygen storage capacity (OSC). The best performance sample was obtained while the pre-cipitate aging time up to 48 h, with the specific surface area of 140.7 m2/g, and OSC of 657.24μmolO2/g for the fresh sample. Even after thermal aged under 1000 ºC for 4 h, the aged specific surface area was 41.6 m2/g, moreover with a good OSC of 569.9μmolO2/g.

  3. Antioxidant Cerium Oxide Nanoparticles in Biology and Medicine. (United States)

    Nelson, Bryant C; Johnson, Monique E; Walker, Marlon L; Riley, Kathryn R; Sims, Christopher M


    Previously, catalytic cerium oxide nanoparticles (CNPs, nanoceria, CeO2-x NPs) have been widely utilized for chemical mechanical planarization in the semiconductor industry and for reducing harmful emissions and improving fuel combustion efficiency in the automobile industry. Researchers are now harnessing the catalytic repertoire of CNPs to develop potential new treatment modalities for both oxidative- and nitrosative-stress induced disorders and diseases. In order to reach the point where our experimental understanding of the antioxidant activity of CNPs can be translated into useful therapeutics in the clinic, it is necessary to evaluate the most current evidence that supports CNP antioxidant activity in biological systems. Accordingly, the aims of this review are three-fold: (1) To describe the putative reaction mechanisms and physicochemical surface properties that enable CNPs to both scavenge reactive oxygen species (ROS) and to act as antioxidant enzyme-like mimetics in solution; (2) To provide an overview, with commentary, regarding the most robust design and synthesis pathways for preparing CNPs with catalytic antioxidant activity; (3) To provide the reader with the most up-to-date in vitro and in vivo experimental evidence supporting the ROS-scavenging potential of CNPs in biology and medicine. PMID:27196936

  4. Antioxidant Cerium Oxide Nanoparticles in Biology and Medicine

    Directory of Open Access Journals (Sweden)

    Bryant C. Nelson


    Full Text Available Previously, catalytic cerium oxide nanoparticles (CNPs, nanoceria, CeO2-x NPs have been widely utilized for chemical mechanical planarization in the semiconductor industry and for reducing harmful emissions and improving fuel combustion efficiency in the automobile industry. Researchers are now harnessing the catalytic repertoire of CNPs to develop potential new treatment modalities for both oxidative- and nitrosative-stress induced disorders and diseases. In order to reach the point where our experimental understanding of the antioxidant activity of CNPs can be translated into useful therapeutics in the clinic, it is necessary to evaluate the most current evidence that supports CNP antioxidant activity in biological systems. Accordingly, the aims of this review are three-fold: (1 To describe the putative reaction mechanisms and physicochemical surface properties that enable CNPs to both scavenge reactive oxygen species (ROS and to act as antioxidant enzyme-like mimetics in solution; (2 To provide an overview, with commentary, regarding the most robust design and synthesis pathways for preparing CNPs with catalytic antioxidant activity; (3 To provide the reader with the most up-to-date in vitro and in vivo experimental evidence supporting the ROS-scavenging potential of CNPs in biology and medicine.

  5. Catalytic properties and biomedical applications of cerium oxide nanoparticles

    KAUST Repository

    Walkey, Carl D.


    Cerium oxide nanoparticles (nanoceria) have shown promise as catalytic antioxidants in the test tube, cell culture models and animal models of disease. However given the reactivity that is well established at the surface of these nanoparticles, the biological utilization of nanoceria as a therapeutic still poses many challenges. Moreover the form that these particles take in a biological environment, such as the changes that can occur due to a protein corona, are not well established. This review aims to summarize the existing literature on biological use of nanoceria, and to raise questions about what further study is needed to apply this interesting catalytic material to biomedical applications. These questions include: 1) How does preparation, exposure dose, route and experimental model influence the reported effects of nanoceria in animal studies? 2) What are the considerations to develop nanoceria as a therapeutic agent in regards to these parameters? 3) What biological targets of reactive oxygen species (ROS) and reactive nitrogen species (RNS) are relevant to this targeting, and how do these properties also influence the safety of these nanomaterials?

  6. Antioxidant Cerium Oxide Nanoparticles in Biology and Medicine (United States)

    Nelson, Bryant C.; Johnson, Monique E.; Walker, Marlon L.; Riley, Kathryn R.; Sims, Christopher M.


    Previously, catalytic cerium oxide nanoparticles (CNPs, nanoceria, CeO2-x NPs) have been widely utilized for chemical mechanical planarization in the semiconductor industry and for reducing harmful emissions and improving fuel combustion efficiency in the automobile industry. Researchers are now harnessing the catalytic repertoire of CNPs to develop potential new treatment modalities for both oxidative- and nitrosative-stress induced disorders and diseases. In order to reach the point where our experimental understanding of the antioxidant activity of CNPs can be translated into useful therapeutics in the clinic, it is necessary to evaluate the most current evidence that supports CNP antioxidant activity in biological systems. Accordingly, the aims of this review are three-fold: (1) To describe the putative reaction mechanisms and physicochemical surface properties that enable CNPs to both scavenge reactive oxygen species (ROS) and to act as antioxidant enzyme-like mimetics in solution; (2) To provide an overview, with commentary, regarding the most robust design and synthesis pathways for preparing CNPs with catalytic antioxidant activity; (3) To provide the reader with the most up-to-date in vitro and in vivo experimental evidence supporting the ROS-scavenging potential of CNPs in biology and medicine. PMID:27196936

  7. Cerium toxicity, uptake and translocation in Arabidopsis thaliana seedlings

    Institute of Scientific and Technical Information of China (English)

    WANG Xue; LIN Yousheng; LIU Dongwu; XU Hengjian; LIU Tao; ZHAO Fengyun


    Arabidopsis thaliana seedlings were cultivated in 0-500 μmol/L of extraneous cerium (Ce) for 7 d to investigate the toxicity,uptake and translocation of rare earth elements (REEs).The results showed that Ce could be largely absorbed by the roots of A.thaliana and translocated to the shoots.But the uptake rates of Ce by the roots were much higher than the translocation rates from roots to shoots.Ultrastructural analysis revealed that Ce was mainly distributed on the cell wall.At higher concentration,Ce could also enter cell,destroy the ultrastructure of cells and disturb the intrinsic balance of nutrient elements of A.thaliana.Addition of Ce (50-500 μmol/L) to the culture medium significantly inhibited the elongation of primary roots,decreased chlorophyll content,rosette diameter and fresh mass of plants.The damage increased with the increase of Ce concentration in culture medium,although primary root elongation,chlorophyll content,and rosette diameter were stimulated by relatively low concentration (0.5 μmol/L) of Ce.Thus,it is speculated that REEs may become a new type contamination if we don't well control the release of REEs into the environment.

  8. Toenail cerium levels and risk of a first acute myocardial infarction: The EURAMIC and heavy metals study

    NARCIS (Netherlands)

    Gomez-Aracena, J.; Riemersma, R.A.; Veer, van 't P.; Kok, F.J.


    The association between cerium status and risk of first acute myocardial infarction (AMI) was examined in a case-control study in 10 centres from Europe and Israel. Cerium in toenails was assessed by neutron activation analysis in 684 cases and 724 controls aged 70years or younger. Mean concentratio

  9. Non-collective high-spin states in 148Dy

    International Nuclear Information System (INIS)

    General physical concepts regarding nuclear high-spin states are given. The high-spin states in 148Dy(Z = 66, N = 82) were produced via the reaction 112Cd(Pb-backed)(40Ar,4n) at E/sub lab/ = 175, at the 88-inch Cyclotron at Lawrence Berkeley Laboratory. Methods for placing gates on various transitions above and below the 480 nsec isomer at 10+(known from previous work), as well as for calculating transition intensities and their associated errors, are given. Calculations of angular correlations for multiple γ-ray cascades, assuming non-zero-width distributions in m-states for some given spin state, were done and compared to experimental values. Analysis of RF - Ge and Ge - Ge TAC spectra for transitions above the 480 nsec isomer implied lifetimes of less than or equal to 5 nsec (except for the 327.2 keV transition). Using such analysis, some 19 new γ-ray transitions were discovered above the isomer, thereby extending the 148Dy level scheme up to spin I = 31 h-bar. Assignments of spins and parities for the new levels are made based on information obtained from angular correlations and the lifetime limits. Previous work on the 11 transitions below the 480 nsec isomer is confirmed

  10. miR-148 regulates Mitf in melanoma cells.

    Directory of Open Access Journals (Sweden)

    Benedikta S Haflidadóttir

    Full Text Available The Microphthalmia associated transcription factor (Mitf is an important regulator in melanocyte development and has been shown to be involved in melanoma progression. The current model for the role of Mitf in melanoma assumes that the total activity of the protein is tightly regulated in order to secure cell proliferation. Previous research has shown that regulation of Mitf is complex and involves regulation of expression, splicing, protein stability and post-translational modifications. Here we show that microRNAs (miRNAs are also involved in regulating Mitf in melanoma cells. Sequence analysis revealed conserved binding sites for several miRNAs in the Mitf 3'UTR sequence. Furthermore, miR-148 was shown to affect Mitf mRNA expression in melanoma cells through a conserved binding site in the 3'UTR sequence of mouse and human Mitf. In addition we confirm the previously reported effects of miR-137 on Mitf. Other miRNAs, miR-27a, miR-32 and miR-124 which all have conserved binding sites in the Mitf 3'UTR sequence did not have effects on Mitf. Our data show that miR-148 and miR-137 present an additional level of regulating Mitf expression in melanocytes and melanoma cells. Loss of this regulation, either by mutations or by shortening of the 3'UTR sequence, is therefore a likely factor in melanoma formation and/or progression.

  11. Morphology Controlling of the Ultrafine Cerium Dioxide (CeO2) Precursor

    Institute of Scientific and Technical Information of China (English)

    Jianqing CHEN; Zhigang CHEN; Jinchun LI


    The synthesis of ultrafine cerium dioxide precursor via homogeneous precipitation was studied. Mixed aqueous solution of anhydrous cerium nitrate and urea was first heated to 85℃ for 2 h, and the prepared suspension was then aged at room temperature for various periods of time. White precipitate was finally collected by centrifuging and washed with distilled water and anhydrous ethanol. The obtained cerium dioxide (CeO2) precursor was observed with SEM. It was found that the morphology and size of the precursor were strongly affected by aging time and stirring conditions (with or without stirring).The precipitated fine spherical particles of the precursor changed their shape from ellipse to slice or directly to slice. Fine spherical monodispersed (300 nm) precursor powders could be obtained by controlling the aging time. Stirring the solution also could change the reaction process and thus the morphology and size of the precursor were changed.

  12. Mesoporous cerium oxide nanospheres for the visible-light driven photocatalytic degradation of dyes

    Directory of Open Access Journals (Sweden)

    Subas K. Muduli


    Full Text Available A facile, solvothermal synthesis of mesoporous cerium oxide nanospheres is reported for the purpose of the photocatalytic degradation of organic dyes and future applications in sustainable energy research. The earth-abundant, relatively affordable, mixed valence cerium oxide sample, which consists of predominantly Ce7O12, has been characterized by powder X-ray diffraction, X-ray photoelectron and UV–vis spectroscopy, and transmission electron microscopy. Together with N2 sorption experiments, the data confirms that the new cerium oxide material is mesoporous and absorbs visible light. The photocatalytic degradation of rhodamin B is investigated with a series of radical scavengers, suggesting that the mechanism of photocatalytic activity under visible-light irradiation involves predominantly hydroxyl radicals as the active species.

  13. Fabrication of Cerium Oxide and Uranium Oxide Microspheres for Space Nuclear Power Applications

    Energy Technology Data Exchange (ETDEWEB)

    Jeffrey A. Katalenich; Michael R. Hartman; Robert C. O' Brien


    Cerium oxide and uranium oxide microspheres are being produced via an internal gelation sol-gel method to investigate alternative fabrication routes for space nuclear fuels. Depleted uranium and non-radioactive cerium are being utilized as surrogates for plutonium-238 (Pu-238) used in radioisotope thermoelectric generators and for enriched uranium required by nuclear thermal rockets. While current methods used to produce Pu-238 fuels at Los Alamos National Laboratory (LANL) involve the generation of fine powders that pose a respiratory hazard and have a propensity to contaminate glove boxes, the sol-gel route allows for the generation of oxide microsphere fuels through an aqueous route. The sol-gel method does not generate fine powders and may require fewer processing steps than the LANL method with less operator handling. High-quality cerium dioxide microspheres have been fabricated in the desired size range and equipment is being prepared to establish a uranium dioxide microsphere production capability.

  14. Magnetic ordering in the static intermediate-valent cerium compound Ce2RuZn4 (United States)

    Eyert, Volker; Scheidt, Ernst-Wilhelm; Scherer, Wolfgang; Hermes, Wilfried; Pöttgen, Rainer


    The low-temperature behavior of Ce2RuZn4 has been investigated. Specific-heat and magnetic-susceptibility data reveal an antiferromagnetic transition at a Néel temperature of 2 K. Ce2RuZn4 is a static intermediate-valent compound with two crystallographically independent cerium atoms. The magnetic data clearly show that only one cerium site is magnetic (Ce3+) , while the second one carries no magnetic moment. The experimental data are interpreted with the help of first-principles electronic structure calculations using density-functional theory and the augmented spherical wave method. The calculations reveal the occurrence of two different cerium sites, which are characterized by strongly localized magnetic moments and strong Ce-Ru bonding.

  15. Green synthesized cerium oxide nanoparticle: A prospective drug against oxidative harm. (United States)

    Dutta, Debanjan; Mukherjee, Riya; Patra, Mousumi; Banik, Milon; Dasgupta, Rakhi; Mukherjee, Manabendra; Basu, Tarakdas


    Cerium oxide nanoparticle (CeONP) of size 2-3nm was synthesized by a new, simple and green method at ambient temperature, using cerium nitrate as prime precursor and Aloe vera leaf extract as stabilizing agent. Of the two oxidation states (+3) and (+4) of cerium, it was dominantly present in (+3) state in CeONP and cyclic conversion of Ce(III)O→Ce(IV)O→Ce(III)O by reaction with H2O2 implied uninterrupted antioxidant property of CeONP. Moreover, the higher oxygen defect in the crystal lattice produced particles with higher antioxidant activity. CeONP was found to neutralize the deleterious effects of H2O2 viz., cell death, generation of intracellular reactive oxygen species and loss of connectivity in mouse neural cells. Therefore, CeONP might have potential use in future as an anti-oxidant drug. PMID:27478962

  16. Oxochloroalkoxide of the Cerium (IV and Titanium (IV as oxides precursor

    Directory of Open Access Journals (Sweden)

    Machado Luiz Carlos


    Full Text Available The Cerium (IV and Titanium (IV oxides mixture (CeO2-3TiO2 was prepared by thermal treatment of the oxochloroisopropoxide of Cerium (IV and Titanium (IV. The chemical route utilizing the Cerium (III chloride alcoholic complex and Titanium (IV isopropoxide is presented. The compound Ce5Ti15Cl16O30 (iOPr4(OH-Et15 was characterized by elemental analysis, FTIR and TG/DTG. The X-ray diffraction patterns of the oxides resulting from the thermal decomposition of the precursor at 1000 degreesC for 36 h indicated the formation of cubic cerianite (a = 5.417Å and tetragonal rutile (a = 4.592Å and (c = 2.962 Å, with apparent crystallite sizes around 38 and 55nm, respectively.

  17. Cathodic electrolysis method of depositing cerium conversion films on industrial pure aluminum

    Institute of Scientific and Technical Information of China (English)


    Two two-step techniques, called TS2/TS7 and TS3/TS7, respectively, have been developed to form cerium conversion films on the surface of industrial pure aluminum. The tested material was cathodically electrolyzed in the alkaline solution containing cerium salt, and uniform films containing cerium were obtained after the two-step treatment. It is found that the films obtained by TS2/TS7 and TS3/TS7 techniques are about 4.0 and 3.0 m in thickness, respectively. The material has better corrosion resistance in the chloride solution after the two-step electrolysis treatment compared with the one-step treated and naked specimens.

  18. Effect of Impurities and Cerium on Stress Concentration Sensitivity of Al-Li Based Alloys

    Institute of Scientific and Technical Information of China (English)

    孟亮; 田丽


    A notch sensitivity factor was derived in order to evaluate the stress concentration sensitivity of Al-Li based alloys. The factor values for the Al-Li alloy sheets containing various contents of impurities and cerium addition were evaluated by determining the mechanical properties. It is found that the impurities Fe, Si, Na and K significantly enhance the stress concentration sensitivity of the alloys 2090 and 8090, whereas cerium addition reduces the stress concentration sensitivity to a certain degree for the high strength alloys. However, an excess amount of cerium addition in the high ductility alloy 1420 can significantly increase the stress concentration sensitivity. As compared with conventional aluminum alloys, the Al-Li based alloys generally show high stress concentration sensitivity. Therefore, a special attention must be paid to this problem in the practical application of Al-Li based alloys.

  19. Study of phase transitions in cerium in shock-wave experiments

    Directory of Open Access Journals (Sweden)

    Zhernokletov M.V.


    Full Text Available Cerium has a complex phase diagram that is explained by the presence of structure phase transitions. Planar gauges were used in various combinations in experiments for determination of sound velocity dependence on pressure in cerium by the technique of PVDF gauge. The data of time dependence on pressure profiles with use of x(t diagrams and the D(u relation for cerium allowed the definition of the Lagrangian velocity of the unloading wave CLagr and the Eulerian velocity CEul by taking into account the compression σ. These results accords with data obtained by using the technique of VISAR and a manganin-based gauge, and calculated pressure dependence of isentropic sound velocity according to the VNIITF EOS. Metallography analysis of post-experimental samples did not find any changes in a phase composition.

  20. Catalytic spectrophotometric determination of cerium by ion exchange separation coupled to a flow injection system

    International Nuclear Information System (INIS)

    A flow injection method is described intended for the determination of cerium based on its catalytic effect on the oxidation of gallocyanine by peroxydisulfate in acidic media. The proposed flow injection manifold incorporates a ion exchange separation system in the carrier stream. The decolorisation of gallocyanine due to its oxidation was used to monitor the reaction by spectrophotometry at 524 nm. The variables which affected the reaction rate were fully investigated. By this method cerium(4) can be determined in the range of 0.30-10.0 μg with a limit of detection of 0.25 μg. The relative standard deviation for ten replicate determinations of 1.0 μg of cerium(4) was 1.8 %

  1. Excitation induced spectroscopic study and quenching effect in cerium samarium codoped lithium aluminoborate glasses (United States)

    Kaur, Parvinder; Kaur, Simranpreet; Singh, Gurinder Pal; Arora, Deepawali; Kumar, Sunil; Singh, D. P.


    Lithium aluminium borate host has been codoped with cerium and samarium to prepare glass by conventional melt quench technique. Their structural and spectroscopic investigation has been carried out using XRD, FTIR and density measurements. The UV-Vis absorption spectra and fluorescence spectra (λexc.=380 nm and 400 nm) have been studied for spectroscopic analysis. The amorphous nature of the prepared samples is shown by XRD. The density is increasing with addition of cerium at the expense of aluminium, keeping other components constant. FTIR study also shows the presence of compact and stable tetrahedral BO4 units thus supporting the density results. The UV- Vis absorption spectra show a shift of optical absorption edge towards longer wavelength along with an increase in intensity of peaks with rising samarium concentration. The fluorescence spectra show a blue shift and subsequent suppression of cerium peaks with addition of samarium.

  2. Exposure of cerium oxide nanoparticles to kidney bean shows disturbance in the plant defense mechanisms

    International Nuclear Information System (INIS)

    Graphical abstract: - Highlights: • Kidney bean roots uptake nCeO2 primarily without biotransformation. • Cerium reached the root vascular tissues through gaps in the Casparian strip. • On longer exposure to high concentration, roots demonstrate stress response. • In leaves, guaiacol peroxidase plays a major role in ROS scavenging. - Abstract: Overwhelming use of engineered nanoparticles demands rapid assessment of their environmental impacts. The transport of cerium oxide nanoparticles (nCeO2) in plants and their impact on cellular homeostasis as a function of exposure duration is not well understood. In this study, kidney bean plants were exposed to suspensions of ∼8 ± 1 nm nCeO2 (62.5 to 500 mg/L) for 15 days in hydroponic conditions. Plant parts were analyzed for cerium accumulation after one, seven, and 15 days of nCeO2 exposure. The primary indicators of stress like lipid peroxidation, antioxidant enzyme activities, total soluble protein and chlorophyll contents were studied. Cerium in tissues was localized using scanning electron microscopy and synchrotron μ-XRF mapping, and the chemical forms were identified using μ-XANES. In the root epidermis, cerium was primarily shown to exist as nCeO2, although a small fraction (12%) was biotransformed to Ce(III) compound. Cerium was found to reach the root vascular tissues and translocate to aerial parts with time. Upon prolonged exposure to 500 mg nCeO2/L, the root antioxidant enzyme activities were significantly reduced, simultaneously increasing the root soluble protein by 204%. In addition, leaf's guaiacol peroxidase activity was enhanced with nCeO2 exposure in order to maintain cellular homeostasis

  3. Exposure of cerium oxide nanoparticles to kidney bean shows disturbance in the plant defense mechanisms

    Energy Technology Data Exchange (ETDEWEB)

    Majumdar, Sanghamitra [Department of Chemistry, The University of Texas at El Paso, 500 West University Ave., El Paso, TX 79968 (United States); University of California Center for Environmental Implications of Nanotechnology (UC CEIN) (United States); Peralta-Videa, Jose R. [Department of Chemistry, The University of Texas at El Paso, 500 West University Ave., El Paso, TX 79968 (United States); Environmental Science and Engineering PhD Program, The University of Texas at El Paso, 500 West University Ave., El Paso, TX 79968 (United States); University of California Center for Environmental Implications of Nanotechnology (UC CEIN) (United States); Bandyopadhyay, Susmita [Environmental Science and Engineering PhD Program, The University of Texas at El Paso, 500 West University Ave., El Paso, TX 79968 (United States); University of California Center for Environmental Implications of Nanotechnology (UC CEIN) (United States); Castillo-Michel, Hiram [European Synchrotron Radiation Facility, B.P. 220-38043 Grenoble, Cedex (France); Hernandez-Viezcas, Jose-Angel [Department of Chemistry, The University of Texas at El Paso, 500 West University Ave., El Paso, TX 79968 (United States); University of California Center for Environmental Implications of Nanotechnology (UC CEIN) (United States); Sahi, Shivendra [Department of Biology, Western Kentucky University, Bowling Green, KY 42101 (United States); Gardea-Torresdey, Jorge L., E-mail: [Department of Chemistry, The University of Texas at El Paso, 500 West University Ave., El Paso, TX 79968 (United States); Environmental Science and Engineering PhD Program, The University of Texas at El Paso, 500 West University Ave., El Paso, TX 79968 (United States); University of California Center for Environmental Implications of Nanotechnology (UC CEIN) (United States)


    Graphical abstract: - Highlights: • Kidney bean roots uptake nCeO{sub 2} primarily without biotransformation. • Cerium reached the root vascular tissues through gaps in the Casparian strip. • On longer exposure to high concentration, roots demonstrate stress response. • In leaves, guaiacol peroxidase plays a major role in ROS scavenging. - Abstract: Overwhelming use of engineered nanoparticles demands rapid assessment of their environmental impacts. The transport of cerium oxide nanoparticles (nCeO{sub 2}) in plants and their impact on cellular homeostasis as a function of exposure duration is not well understood. In this study, kidney bean plants were exposed to suspensions of ∼8 ± 1 nm nCeO{sub 2} (62.5 to 500 mg/L) for 15 days in hydroponic conditions. Plant parts were analyzed for cerium accumulation after one, seven, and 15 days of nCeO{sub 2} exposure. The primary indicators of stress like lipid peroxidation, antioxidant enzyme activities, total soluble protein and chlorophyll contents were studied. Cerium in tissues was localized using scanning electron microscopy and synchrotron μ-XRF mapping, and the chemical forms were identified using μ-XANES. In the root epidermis, cerium was primarily shown to exist as nCeO{sub 2}, although a small fraction (12%) was biotransformed to Ce(III) compound. Cerium was found to reach the root vascular tissues and translocate to aerial parts with time. Upon prolonged exposure to 500 mg nCeO{sub 2}/L, the root antioxidant enzyme activities were significantly reduced, simultaneously increasing the root soluble protein by 204%. In addition, leaf's guaiacol peroxidase activity was enhanced with nCeO{sub 2} exposure in order to maintain cellular homeostasis.

  4. AGR-2 Data Qualification Report for ATR Cycles 147A, 148A, 148B, and 149A

    Energy Technology Data Exchange (ETDEWEB)

    Michael L. Abbott; Keith A. Daum


    This report presents the data qualification status of fuel irradiation data from the first four reactor cycles (147A, 148A, 148B, and 149A) of the on-going second Advanced Gas Reactor (AGR-2) experiment as recorded in the NGNP Data Management and Analysis System (NDMAS). This includes data received by NDMAS from the period June 22, 2010 through May 21, 2011. AGR-2 is the second in a series of eight planned irradiation experiments for the AGR Fuel Development and Qualification Program, which supports development of the very high temperature gas-cooled reactor (VHTR) under the Next Generation Nuclear Plant (NGNP) Project. Irradiation of the AGR-2 test train is being performed at the Advanced Test Reactor (ATR) at the Idaho National Laboratory (INL) and is planned for 600 effective full power days (approximately 2.75 calendar years) (PLN-3798). The experiment is intended to demonstrate the performance of UCO (uranium oxycarbide) and UO2 (uranium dioxide) fuel produced in a large coater. Data qualification status of the AGR-1 experiment was reported in INL/EXT-10-17943 (Abbott et al. 2010).


    Duffield, R.B.; Stoughton, R.W.


    A method is presented for separating plutonium from the cerium sub-group of rare earths when both are present in an aqueous solution. The method consists in adding an excess of alkali metal carbonate to the solution, which causes the formation of a soluble plutonium carbonate precipitate and at the same time forms an insoluble cerium-group rare earth carbonate. The pH value must be adjusted to bctween 5.5 and 7.5, and prior to the precipitation step the plutonium must be reduced to the tetravalent state since only tetravalent plutonium will form the soluble carbonate complex.

  6. Feasibility of Substituting Cerium-Rich Metal by La-Pr-Ce Alloy in Magnesium Alloy

    Institute of Scientific and Technical Information of China (English)

    伏思静; 赵平


    In magnesium alloy ZM3, using cheap Lanthanum-praseodymium-cerium (LPC) rare earth as a substitute for rich-cerium rare earth was studied. The experimental results show that when the adding amount of LPC is between 2.53% and 3.33%, the tensile strength increases as the adding amount of LPC increases; when the amount of RE is 2.53% and 3.33%, the average tensile strength is 142.35, 153.65 MPa respectively. The results show that LPC rare earth replacing rich Ce rare earth is feasible for the tensile strength of ZM3.

  7. Dissociation of outer membrane for Escherichia coli cell caused by cerium nitrate

    Institute of Scientific and Technical Information of China (English)

    陈爱美; 施庆珊; 冯劲; 欧阳友生; 陈仪本; 谭绍早


    The biological effect of cerium nitrate on the outer membrane(OM) of Escherichia coli(E.coli) cell was studied,and the antim-icrobial mechanism of rare earth elements was explored.The antimicrobial effect of cerium nitrate on E.coli cell was valued by plate count method,and the morphology change of E.coli cell was observed with scanning electron microscopy(SEM) and transmission electron microscopy(TEM).The results showed that the E.coli cell suspension was flocculated when the concentration of Ce(NO3)3?6H2O...

  8. Synthesis and characterization of two dimensional metal organic framework of cerium with tetraaza macrocyclic

    Energy Technology Data Exchange (ETDEWEB)

    Bt Safiin, Nurul Atikah; Yarmo, Ambar; Yamin, Bohari M. [School of Chemical Science and Food Technology. Faculty Science and Technology, Universiti Kebangsaan Malaysia, 43600 Bangi, Selangor Darul Ehsan (Malaysia)


    A two dimensional metal organic framework containing cerium sufate layers and ethylenediaminium between layers was obtained by refluxing the mixture of cerium sulphate and 5,5,7,12,12,14-hexamethyl-1,4,8,11-tetraazacyclotetradeca-7, 14-diene bromide. The complex was characterized by infrared spectroscopy and microelemental analysis. X-ray study showed that the complex adopts eleven coordination environments about the central atom. Thermogravimetric study showed the removal of water molecules at about 70°C followed by a gradual mass loss until the whole structure collapsed at about 400°C.

  9. Photocatalytic action of cerium molybdate and iron-titanium oxide hollow nanospheres on Escherichia coli

    International Nuclear Information System (INIS)

    This study is focused on the production of hollow nanospheres that reveal antibacterial action. Cerium molybdate and iron-titanium oxide hollow nanospheres with a diameter of 175 ± 15 and 221 ± 10 nm, respectively, were synthesized using emulsion polymerization and the sol–gel process. Their morphology characterization was accomplished using scanning electron microscopy. Their antibacterial action was examined on pure culture of Escherichia coli considering the loss of their viability. Both hollow nanospheres presented photocatalytic action after illumination with blue–black light, but those of cerium molybdate also demonstrated photocatalytic action in the dark. Therefore, the produced nanospheres can be used for antibacterial applications.

  10. A corrosion resistant cerium oxide based coating on aluminum alloy 2024 prepared by brush plating

    Energy Technology Data Exchange (ETDEWEB)

    Tang Junlei; Han Zhongzhi [School of Materials Science and Engineering, Beijing University of Chemical Technology, Beijing 100029 (China); Zuo Yu, E-mail: [School of Materials Science and Engineering, Beijing University of Chemical Technology, Beijing 100029 (China); Tang Yuming [School of Materials Science and Engineering, Beijing University of Chemical Technology, Beijing 100029 (China)


    Cerium oxide based coatings were prepared on AA2024 Al alloy by brush plating. The characteristic of this technology is that hydrogen peroxide, which usually causes the plating solution to be unstable, is not necessary in the plating electrolyte. The coating showed laminated structures and good adhesive strength with the substrate. X-ray diffraction and X-ray photoelectron spectroscopy analysis showed that the coatings were composed of Ce(III) and Ce(IV) oxides. The brush plated coatings on Al alloys improved corrosion resistance. The influence of plating parameters on structure and corrosion resistance of the cerium oxide based coating was studied.

  11. [Laser resonance ionization spectroscopy of even-parity autoionization states of cerium atom]. (United States)

    Li, Zhi-ming; Zhu, Feng-rong; Zhang, Zi-bin; Ren, Xiang-jun; Deng, Hu; Zhai, Li-hua; Zhang, Li-xing


    This paper describes the investigation of even-parity autoionization states of cerium atoms by three-step three-color resonance ionization spectroscopy (RIS). Twenty-seven odd-parity highly excited levels, whose transition probability is high, were used in this research. One hundred and forty-one autoionization states were found by these channels with the third-step laser scanning in the wavelength range of 634-670 nm. The ionization probabilities of different channels, which had higher cross sections, were compared. On the basis of this, eight optimal photoionization schemes of cerium atom have been given. PMID:15828309

  12. Comparative Study of Magnetic Instabilities in Cerium Compounds

    International Nuclear Information System (INIS)

    The variety of new phases and physical phenomena discovered in intermetallic compounds containing Rare Earths or Actinides has motivated, during the last four decades, the sustained study of their magnetic phase diagrams.The current interest is focused on the investigation of the region of the phase diagram where the magnetic order of Cerium, Ytterbium and Uranium based systems is destabilized.In this region different behaviours have been detected, such as non conventional superconductivity and the anomalous dependencies of the thermal, magnetic and transport properties at very low temperatures, associated to non-Fermi liquid behaviour.A simple model, the Doniach diagram, has guided the interpretation of the destabilization of the magnetic order in the previously mentioned systems.However, most of the systems that have been studied so far cannot be described within this model.This fact has motivated the development of a phenomenological classification of phase diagrams that has been mostly applied to cerium based compounds.This classification defines three types of phase diagrams, that can be distinguished by the way in which the magnetic transition is suppressed when a control parameter (such as doping or pressure) is driven towards its critical value.Within this scenario, we study the suppression of the antiferromagnetic order of the intermetallic compounds CeIn3, CeRh2Si2 and CePd2Al3 as a function of Ce-ligand alloying.The resulting systems, CeIn3-xSnx, Ce(CuxRh1-x)2Si2 and CePd2-xNixAl3, present different crystalline structures and the effects produced by the alloying process are different in each case.We analyse the resulting magnetic phase diagrams, and compare them with the above mentioned phenomenological classification.With such a purpose, we study in detail the region in which the magnetic instability takes place, in the proximity of the respective critical concentrations.Taking into account both our results and those reported in the literature, we

  13. Effects of Cerium Oxide Nanoparticles on Sorghum Plant Traits (United States)

    Mu, L.; Chen, Y.; Darnault, C. J. G.; Rauh, B.; Kresovich, S.; Korte, C.


    Nanotechnology and nanomaterials are considered as the development of the modern science. However, besides with that wide application, nanoparticles arouse to the side effects on the environment and human health. As the catalyst of ceramics and fuel industry, Cerium (IV) oxide nanoparticles (CeO2 NPs) can be found in the environment following their use and life-cycle. Therefore, it is critical to assess the potential effects that CeO2 NPs found in soils may have on plants. In this study, CeO2 NPs were analyzed for the potential influence on the sorghum [Sorghum bicolor (L.) Moench] (Reg. no. 126) (PI 154844) growth and traits. The objectives of this research were to determine whether CeO2 NPs impact the sorghum germination and growth characteristics. The sorghum was grown in the greenhouse located at Biosystems Research Complex, Clemson University under different CeO2 NPs treatments (0mg; 100mg; 500mg; 1000mg CeO2 NPs/Kg soil) and harvested around each month. At the end of the each growing period, above ground vegetative tissue was air-dried, ground to 2mm particle size and compositional traits estimated using near-infrared spectroscopy. Also, the NPK value of the sorghum tissue was tested by Clemson Agriculture Center. After the first harvest, the result showed that the height of above ground biomass under the nanoparticles stress was higher than that of control group. This difference between the control and the nanoparticles treatments was significant (F>F0.05; LSD). Our results also indicated that some of the compositional traits were impacted by the different treatments, including the presence and/or concentrations of the nanoparticles.

  14. Fate of cerium dioxide nanoparticles in endothelial cells: exocytosis

    International Nuclear Information System (INIS)

    Although cytotoxicity and endocytosis of nanoparticles have been the subject of numerous studies, investigations regarding exocytosis as an important mechanism to reduce intracellular nanoparticle accumulation are rather rare and there is a distinct lack of knowledge. The current study investigated the behavior of human microvascular endothelial cells to exocytose cerium dioxide (CeO2) nanoparticles (18.8 nm) by utilization of specific inhibitors [brefeldin A; nocodazole; methyl-β-cyclodextrin (MβcD)] and different analytical methods (flow cytometry, transmission electron microscopy, inductively coupled plasma mass spectrometry). Overall, it was found that endothelial cells were able to release CeO2 nanoparticles via exocytosis after the migration of nanoparticle containing endosomes toward the plasma membrane. The exocytosis process occurred mainly by fusion of vesicular membranes with plasma membrane resulting in the discharge of vesicular content to extracellular environment. Nevertheless, it seems to be likely that nanoparticles present in the cytosol could leave the cells in a direct manner. MβcD treatment led to the strongest inhibition of the nanoparticle exocytosis indicating a significant role of the plasma membrane cholesterol content in the exocytosis process. Brefeldin A (inhibitor of Golgi-to-cell-surface-transport) caused a higher inhibitory effect on exocytosis than nocodazole (inhibitor of microtubules). Thus, the transfer from distal Golgi compartments to the cell surface influenced the exocytosis process of the CeO2 nanoparticles more than the microtubule-associated transport. In conclusion, endothelial cells, which came in contact with nanoparticles, e.g., after intravenously applied nano-based drugs, can regulate their intracellular nanoparticle amount, which is necessary to avoid adverse nanoparticle effects on cells

  15. Variations in Reactivity on Different Crystallographic Orientations of Cerium Oxide

    Energy Technology Data Exchange (ETDEWEB)

    Mullins, David R [ORNL; Albrecht, Peter M [ORNL; Calaza, Florencia C [ORNL


    Cerium oxide is a principal component in many heterogeneous catalytic processes. One of its key characteristics is the ability to provide or remove oxygen in chemical reactions. The different crystallographic faces of ceria present significantly different surface structures and compositions that may alter the catalytic reactivity. The structure and composition determine the number of coordination vacancies surrounding surface atoms, the availability of adsorption sites, the spacing between adsorption sites and the ability to remove O from the surface. To investigate the role of surface orientation on reactivity, CeO2 films were grown with two different orientations. CeO2(100) films were grown ex situ by pulsed laser deposition on Nb-doped SrTiO3(100). CeO2(111) films were grown in situ by thermal deposition of Ce metal onto Ru(0001) in an oxygen atmosphere. The chemical reactivity was characterized by the adsorption and decomposition of various molecules such as alcohols, aldehydes and organic acids. In general the CeO2(100) surface was found to be more active, i.e. molecules adsorbed more readily and reacted to form new products, especially on a fully oxidized substrate. However the CeO2(100) surface was less selective with a greater propensity to produce CO, CO2 and water as products. The differences in chemical reactivity are discussed in light of possible structural terminations of the two surfaces. Recently nanocubes and nano-octahedra have been synthesized that display CeO2(100) and CeO2(111) faces, respectively. These nanoparticles enable us to correlate reactions on high surface area model catalysts at atmospheric pressure with model single crystal films in a UHV environment.

  16. Thermoluminescence of cerium and terbium -doped calcium pyrophosphate

    Energy Technology Data Exchange (ETDEWEB)

    Roman L, J.; Cruz Z, E. [UNAM, Instituto de Ciencias Nucleares, Circuito Exterior, Ciudad Universitaria, 04510 Mexico D. F. (Mexico); Lozano R, I. B.; Diaz G, J. A. I., E-mail: [IPN, Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada, Av. Legaria No. 694, 11500 Mexico D. F. (Mexico)


    The aim of this work is to report the thermoluminescence (Tl) response of Calcium Pyrophosphate phosphor doped with Cerium and Terbium impurities (Ca{sub 2}P{sub 2}O{sub 7}:Ce{sup 3+},Tb{sup 3+}). The phosphors were synthesized using the co-precipitation method and annealed at 900 degrees C by two hours for obtain the β phase. The intentional doping with Ce and Tb ions was 1 at.% and 0.1 at.%, whereas in the EDS results the concentration of impurities was 0.39 at.% and 0.05 at.%, respectively. The superficial morphology of phosphor is mainly composed by thin wafers of different size. All samples were exposed to gamma rays from {sup 60}Co in the Gammacell-200 irradiator. The Tl response of the phosphor was measured from Rt up to 350 degrees C and under nitrogen atmosphere in a Harshaw TLD 3500 reader. The glow curves of the Ca{sub 2}P{sub 2}O{sub 7}:Ce{sup 3+},Tb{sup 3+} powders showed a broad intense Tl peak centered at 165 degrees C and a shoulder at approximate 260 degrees C was observed. A linear Tl response in the range of absorbed dose of 0.2 to 10 Gy was obtained. Tl glow curves were analyzed using the initial rise (IR)and computerized glow curve deconvolution methods to evaluate the kinetics parameters such as activation energy (E), frequency factor (s) and kinetic order (b). (Author)

  17. Fate of cerium dioxide nanoparticles in endothelial cells: exocytosis

    Energy Technology Data Exchange (ETDEWEB)

    Strobel, Claudia, E-mail: [Jena University Hospital – Friedrich Schiller University Jena, Department of Experimental Radiology, Institute of Diagnostic and Interventional Radiology (Germany); Oehring, Hartmut [Jena University Hospital – Friedrich Schiller University Jena, Institute of Anatomy II (Germany); Herrmann, Rudolf [University of Augsburg, Department of Physics (Germany); Förster, Martin [Jena University Hospital – Friedrich Schiller University Jena, Department of Internal Medicine I, Division of Pulmonary Medicine and Allergy/Immunology (Germany); Reller, Armin [University of Augsburg, Department of Physics (Germany); Hilger, Ingrid, E-mail: [Jena University Hospital – Friedrich Schiller University Jena, Department of Experimental Radiology, Institute of Diagnostic and Interventional Radiology (Germany)


    Although cytotoxicity and endocytosis of nanoparticles have been the subject of numerous studies, investigations regarding exocytosis as an important mechanism to reduce intracellular nanoparticle accumulation are rather rare and there is a distinct lack of knowledge. The current study investigated the behavior of human microvascular endothelial cells to exocytose cerium dioxide (CeO{sub 2}) nanoparticles (18.8 nm) by utilization of specific inhibitors [brefeldin A; nocodazole; methyl-β-cyclodextrin (MβcD)] and different analytical methods (flow cytometry, transmission electron microscopy, inductively coupled plasma mass spectrometry). Overall, it was found that endothelial cells were able to release CeO{sub 2} nanoparticles via exocytosis after the migration of nanoparticle containing endosomes toward the plasma membrane. The exocytosis process occurred mainly by fusion of vesicular membranes with plasma membrane resulting in the discharge of vesicular content to extracellular environment. Nevertheless, it seems to be likely that nanoparticles present in the cytosol could leave the cells in a direct manner. MβcD treatment led to the strongest inhibition of the nanoparticle exocytosis indicating a significant role of the plasma membrane cholesterol content in the exocytosis process. Brefeldin A (inhibitor of Golgi-to-cell-surface-transport) caused a higher inhibitory effect on exocytosis than nocodazole (inhibitor of microtubules). Thus, the transfer from distal Golgi compartments to the cell surface influenced the exocytosis process of the CeO{sub 2} nanoparticles more than the microtubule-associated transport. In conclusion, endothelial cells, which came in contact with nanoparticles, e.g., after intravenously applied nano-based drugs, can regulate their intracellular nanoparticle amount, which is necessary to avoid adverse nanoparticle effects on cells.

  18. Cerium Oxide Nanoparticles and Bulk Cerium Oxide Leading to Different Physiological and Biochemical Responses in Brassica rapa. (United States)

    Ma, Xingmao; Wang, Qiang; Rossi, Lorenzo; Zhang, Weilan


    Cerium oxide nanoparticles (CeO2NPs) have been incorporated into many commercial products, and their potential release into the environment through the use and disposal of these products has caused serious concerns. Despite the previous efforts and rapid progress on elucidating the environmental impact of CeO2NPs, the long-term impact of CeO2NPs to plants, a key component of the ecosystem, is still not well understood. The potentially different impact of CeO2NPs and their bulk counterparts to plants is also unclear. The main objectives of this study were (1) to investigate whether continued irrigation with solutions containing different concentrations of CeO2NPs (0, 10, and 100 mg/L) would induce physiological and biochemical adjustments in Brassica rapa in soil growing conditions and (2) to determine whether CeO2NPs and bulk CeO2 particles exert different impacts on plants. The results indicated that bulk CeO2 at 10 and 100 mg/L enhanced plant biomass by 28% and 35%, respectively, while CeO2NPs at equivalent concentrations did not. While the bulk CeO2 treatment resulted in significantly higher concentrations of hydrogen peroxide (H2O2) in plant tissues at the vegetative stage, CeO2NPs led to significantly higher H2O2 levels in plant tissues at the floral stage. The activity of superoxide dismutase (SOD) in Brassica rapa also displayed a growth-stage dependent response to different sizes of CeO2 while catalase (CAT) activity was not affected by either size of CeO2 throughout the life cycle of Brassica rapa. Altogether, the results demonstrated that plant responses to CeO2 exposure varied with the particle sizes and the growth stages of plants. PMID:26691446

  19. The effects of cerium doping on the size, morphology, and optical properties of α-hematite nanoparticles for ultraviolet filtration

    International Nuclear Information System (INIS)

    Highlights: • Possible application of cerium-doped α-hematite as ultraviolet filter. • Nanoparticles obtained through co-precipitation technique using various cerium doping levels followed by annealing. • Comprehensive materials characterisation utilizing XRD, DSC/TGA, STEM, UV–vis spectroscopy. • Increasing cerium content reduces particle sizing and alters morphology. • Solubility of cerium in hematite seen between 5 and 10% doping, 10% cerium doping greatly enhances attenuation in ultraviolet region and increases optical bandgap. - Abstract: Metal oxide nanoparticles have potential use in energy storage, electrode materials, as catalysts and in the emerging field of nanomedicine. Being able to accurately tailor the desirable properties of these nanoceramic materials, such as particle size, morphology and optical bandgap (Eg) is integral in the feasibility of their use. In this study we investigate the altering of both the structure and physical properties through the doping of hematite (α-Fe2O3) nanocrystals with cerium at a range of concentrations, synthesised using a one-pot co-precipitation method. This extremely simple synthesis followed by thermal treatment results in stable Fe2−xCexOy nanoceramics resulting from the burning of any unreacted precursors and transformation of goethite-cerium doped nanoparticle intermediate. The inclusion of Ce into the crystal lattice of these α-Fe2O3 nanoparticles causes a significantly large reduction in mean crystalline size and alteration in particle morphology with increasing cerium content. Finally we report an increase optical semiconductor bandgap, along with a substantial increase in the ultraviolet attenuation found for a 10% Ce-doping concentration which shows the potential application of cerium-doped hematite nanocrystals to be used as a pigmented ultraviolet filter for cosmetic products

  20. The effects of cerium doping on the size, morphology, and optical properties of α-hematite nanoparticles for ultraviolet filtration

    Energy Technology Data Exchange (ETDEWEB)

    Cardillo, Dean [Institute for Superconducting and Electronic Materials, AIIM Facility, University of Wollongong Innovation Campus, Squires Way, North Wollongong, NSW 2500 (Australia); Konstantinov, Konstantin, E-mail: [Institute for Superconducting and Electronic Materials, AIIM Facility, University of Wollongong Innovation Campus, Squires Way, North Wollongong, NSW 2500 (Australia); Devers, Thierry [Centre de Recherche sur la Matière Divisée, Institut de Physique, site de Chartres, Université d’Orléans (France)


    Highlights: • Possible application of cerium-doped α-hematite as ultraviolet filter. • Nanoparticles obtained through co-precipitation technique using various cerium doping levels followed by annealing. • Comprehensive materials characterisation utilizing XRD, DSC/TGA, STEM, UV–vis spectroscopy. • Increasing cerium content reduces particle sizing and alters morphology. • Solubility of cerium in hematite seen between 5 and 10% doping, 10% cerium doping greatly enhances attenuation in ultraviolet region and increases optical bandgap. - Abstract: Metal oxide nanoparticles have potential use in energy storage, electrode materials, as catalysts and in the emerging field of nanomedicine. Being able to accurately tailor the desirable properties of these nanoceramic materials, such as particle size, morphology and optical bandgap (E{sub g}) is integral in the feasibility of their use. In this study we investigate the altering of both the structure and physical properties through the doping of hematite (α-Fe{sub 2}O{sub 3}) nanocrystals with cerium at a range of concentrations, synthesised using a one-pot co-precipitation method. This extremely simple synthesis followed by thermal treatment results in stable Fe{sub 2−x}Ce{sub x}O{sub y} nanoceramics resulting from the burning of any unreacted precursors and transformation of goethite-cerium doped nanoparticle intermediate. The inclusion of Ce into the crystal lattice of these α-Fe{sub 2}O{sub 3} nanoparticles causes a significantly large reduction in mean crystalline size and alteration in particle morphology with increasing cerium content. Finally we report an increase optical semiconductor bandgap, along with a substantial increase in the ultraviolet attenuation found for a 10% Ce-doping concentration which shows the potential application of cerium-doped hematite nanocrystals to be used as a pigmented ultraviolet filter for cosmetic products.

  1. Evolution of the local environment of cerium and neodymium during simplified SON68 glass alteration

    Energy Technology Data Exchange (ETDEWEB)

    Jollivet, Patrick [Commissariat a l' Energie Atomique (CEA), Rhone Valley Research Center, BP 17171, 30207 Bagnols-sur-Ceze (France)]. E-mail:; Lopez, Christophe [Commissariat a l' Energie Atomique (CEA), Rhone Valley Research Center, BP 17171, 30207 Bagnols-sur-Ceze (France); Auwer, Christophe Den [Commissariat a l' Energie Atomique (CEA), Rhone Valley Research Center, BP 17171, 30207 Bagnols-sur-Ceze (France); Simoni, Eric [Institut de Physique Nucleaire, Batiment 100, 91406 Orsay cedex (France)


    The evolution of the sites occupied by cerium and neodymium (coordination numbers and Ce, Nd-O distances) during alteration of simplified SON68 glass specimens was determined by L{sub III}-edge XAS. Cerium and neodymium are situated in a silicate environment in the glass, surrounded by eight oxygen atoms at an average distance of 2.44 and 2.48 A, respectively. These two rare earth elements exhibit different leaching behavior, however. The main environment of cerium becomes a silicate (d {sub Ce-O} = 2.19 A) with a second oxide or more probably oxyhydroxide site (d {sub Ce-O} = 2.32 A). The cerium coordination number increases by 1 to 3 compared with the glass, depending on the leaching conditions. Neodymium is found mainly in a hydroxycarbonate environment (d {sub Nd-O} = 2.46 A); the second site is a silicate (d {sub Nd-O} = 2.54 A). The neodymium coordination number increases by 1 compared with the glass. When glass containing neodymium is doped with phosphorus, Nd is situated in a phosphate environment; this change is also reflected in the coordination number and Nd-O distance (seven oxygen atoms at 2.42 A). During glass leaching, neodymium is present at two different sites, phosphate (d {sub Nd-O} = 2.52 A) and hydroxycarbonate (d {sub Nd-O} = 2.40 A)

  2. Effects of Cerium on Alloy Elements Distribution in Ferrous Matrix Material

    Institute of Scientific and Technical Information of China (English)

    刘英才; 刘俊友; 尹衍生; 刘国权


    The effect of the addition of rare earths in Fe-based high chromium alloy powders on elements distribution in matrix materials and mechanical properties were studied. The results show that the addition of cerium can increase the chromium amount in carbonides and increase the micro-hardness after carbonization and the wear-resistant property of materials.

  3. Transient Dynamics of Fluoride-Based High Concentration Erbium/Cerium Co-Doped Fiber Amplifier

    Institute of Scientific and Technical Information of China (English)

    S. S-H. Yam; Y. Akasaka; Y. Kubota; R. Huang; D. L. Harris; J. Pan


    We designed and evaluated a fluoride-based high concentration erbium/ cerium co-doped fiber amplifier. It is suitable for Metropolitan Area Networks due to faster transient, flatter (unfiltered) gain, smaller footprint and gain excursion than its silica-based counterpart.

  4. Release of cerium dibutylphosphate corrosion inhibitors from highly filled epoxy coating systems

    NARCIS (Netherlands)

    Soestbergen, M. van; Baukh, V.; Erich, S.J.F.; Huinink, H.P.; Adan, O.C.G.


    Carcinogenic chromates are phased out as corrosion inhibitors in organic coatings, and are replaced by benign alternatives. Cerium-based compounds are excellent corrosion inhibitors in an aqueous environment. However, whether they are effective as corrosion inhibitor in an organic coating also depen

  5. Colloidal stabilization of cerium-gadolinium oxide (CGO) suspensions via rheology

    DEFF Research Database (Denmark)

    Marani, Debora; Sudireddy, Bhaskar Reddy; Bentzen, Janet Jonna;


    colloidally stable state. The method was applied to explore the ability of four commercial dispersants (acidic affine, neutral, basic affine, and polyvinylpyrrolidone (PVP)) to disperse cerium-gadolinium oxide (CGO) in ethanol. Only the acidic affine and the PVP dispersants were found to efficiently disperse...

  6. Characteristics of cerium-gadolinium oxide (CGO) suspensions as a function of dispersant and powder properties

    DEFF Research Database (Denmark)

    Phair, John; Lönnroth, Nadja; Lundberg, Mats;


    A series of concentrated suspensions ( = 0.18–0.34) of cerium-gadolinium oxide (CGO) in terpineol were prepared as a function of dispersant, powder surface area and solids concentration. The stability of the suspensions was assessed by rheological measurements including viscosity and oscillatory...

  7. Photochemical precipitation of thorium and cerium and their separation from other ions in aqueous solution. (United States)

    Das, M; Heyn, A H; Hoffman, M Z; Agarwal, R P


    Thorium was precipitated from homogeneous solution by exposing solutions of thorium and periodate in dilute perchloric acid to 253.7 nm radiation from a low-pressure mercury lamp. Periodate is reduced photochemically to iodate which causes the formation of a dense precipitate of the basic iodate of thorium(IV). The precipitate was redissolved, the iodate reduced, the thorium precipitated first as the hydroxide, then as the oxalate and ignited to the dioxide for weighing. Thorium(IV) solutions containing 8-200 mg of ThO(2) gave quantitative results with a standard deviation (s) of 0.2 mg. Separations from 25 mg each of iron, calcium, magnesium, 50 mg of yttrium and up to 500 mg of uranium(VI) were quantitative (s = 0.25 mg). Separations from rare earths, except cerium, were accomplished by using hexamethylenetetramine rather than ammonia for the precipitation of the hydroxide. Cerium(III) was similarly precipitated and converted into CeO(2) for weighing. Quantitative results were obtained for 13-150 mg of CeO(2) with a standard deviation of 0.2 mg. Separations from 200 mg of uranium were quantitative. Other rare earths and yttrium interfered seriously. The precipitates of the basic cerium(IV) and thorium iodates obtained are more compact than those obtained by direct precipitation and can be handled easily. Attempts to duplicate Suzuki's method for separating cerium from neodymium and yttrium were not successful. PMID:18960820

  8. Separation of cerium from high level waste solution of Purex origin

    International Nuclear Information System (INIS)

    A simple solvent extraction procedure for the separation of 144Ce from Purex high level waste (HLW) is described. 2-ethylhexyl 2-ethylhexyl phosphonic acid (KSM-17) has been used as extractant. About 10 mCi of cerium was separated from HLW using this technique. This method is amenable for automation and scale up. (author)

  9. Growth and characterization of Sm3+ doped cerium oxalate single crystals

    Directory of Open Access Journals (Sweden)

    Minu Mary C


    Full Text Available Single crystals of Sm3+ doped cerium oxalate decahydrate were synthesized using single diffusion gel technique and the conditions influencing the size, morphology, nucleation density and quality of the crystals were optimized. Highly transparent single crystals of average size 3 mm × 2 mm × 1 mm with well-defined hexagonal morphology were grown during a time period of two weeks. X-ray powder diffraction analysis revealed that the grown crystals crystallize in the monoclinic system with space group P21/c as identical with the pure cerium oxalate. The various functional groups of the oxalate ligand and the water of crystallization were identified by Fourier transform infrared spectroscopy. The photoluminescence spectrum of the Sm3+ doped cerium oxalate indicated that the Sm3+ ions are optically active in the cerium oxalate matrix. The crystal has a strong and efficient orange red emission with a wavelength peak at 595 nm and hence can be effectively used for optical amplification. Microhardness measurements of the crystal revealed that they belong to the soft material category.

  10. Growth and characterization of cerium lanthanum oxalate crystals grown in hydro-silica gel

    Energy Technology Data Exchange (ETDEWEB)

    John, M.V.; Ittyachen, M.A. [Mahatma Gandhi Univ., Kerala (India). School of Pure and Applied Physics


    Single crystals of mixed cerium lanthanum oxalate (CLO) are grown by gel method. Over the hydrosilica gel prepared by mixing oxalic acid and sodium meta silicate, a mixture of aqueous solutions of cerium nitrate and lanthanum nitrate are poured gently. Cerium and lanthanum ions diffuse into the gel and react with oxalic acid to give colorless, transparent cerium lanthanum oxalate crystals with in a few days. Different growth parameters give crystals of various dimensions. Infrared (IR) spectrum confirms the presence of water molecules and carboxylic acid. X-ray diffraction (XRD) pattern of these samples reveals the crystalline nature. Diffraction peaks are indexed. Unit cell parameters are determined. Thermogravimetric analysis (TGA) and differential thermal analysis (DTA) data support the presence of 9 H{sub 2}O molecules attached to the CLO crystal lattice which are lost around 200 C as revealed by the endotherm record. Exothermic peak around 350 C-425 C shows the release of CO and CO{sub 2}. Elemental analysis done by energy dispersive X-ray fluorescence analysis (EDXRF) for the mixed rare earth compound is almost in good agreement with experimental and theoretical values. (orig.)

  11. Phenotypic and genomic responses to titanium dioxide and cerium oxide nanoparticles in Arabidopsis germinants (United States)

    The effects of exposure to two nanoparticles (NPs) -titanium dioxide (nano-titania) and cerium oxide (nano-ceria) at 500 mg NPs L-1 on gene expression and growth in Arabidopsis thaliana germinants were studied using microarrays and phenotype studies. After 12 days post treatment,...

  12. Cerium (IV) oxide nanotubes prepared by low temperature deposition at normal pressure

    Energy Technology Data Exchange (ETDEWEB)

    Boehme, M; Fu, G; Ionescu, E; Ensinger, W, E-mail: [Department of Materials Science, Darmstadt University of Technology, D-64287 Darmstadt (Germany)


    This paper reports the synthesis of cerium dioxide nanotubes (CeNTs) by electroless deposition using ion-track-etched polycarbonate templates. To achieve nanotubes with thin walls and small surface roughness the tubes were generated by a several-step-containing procedure under aqueous conditions. The approach reported below will process open end nanotubes with well-defined outer diameter and wall thickness.

  13. Cerium (IV) oxide nanotubes prepared by low temperature deposition at normal pressure. (United States)

    Boehme, M; Fu, G; Ionescu, E; Ensinger, W


    This paper reports the synthesis of cerium dioxide nanotubes (CeNTs) by electroless deposition using ion-track-etched polycarbonate templates. To achieve nanotubes with thin walls and small surface roughness the tubes were generated by a several-step-containing procedure under aqueous conditions. The approach reported below will process open end nanotubes with well-defined outer diameter and wall thickness.

  14. 4d → 4f resonance in photoabsorption of cerium ion Ce3+ and endohedral cerium in fullerene complex {\\rm{Ce}}@{{{\\rm{C}}}_{82}}^{+} (United States)

    Schrange-Kashenock, G.


    The theoretical investigation of the single-photoionization spectra in the 4d-resonance region (120-150 eV) for the ionic cerium Ce3+ and cerium in the endohedral complex {{Ce}}@{{{{C}}}82}+ (in practice, {{{Ce}}}3+@{{{{C}}}82}2-) is presented. The fullerene cage is modeled by ab initio spherical jellium shell with an accurate account for the real distribution of carbon electron density. The oscillator strengths are calculated within the multiconfiguration Dirac-Fock (MCDF) approach for phototransitions from the outermost shells of the ion Ce3+ with and without the influence of the potential generated by a fullerene cage. It is shown that the integrated oscillator strengths have the main contribution from the Ce3+ 4d → 4f (ten possible from the phototransitions {}2F{7/2,5/2}\\to {}2D{3/2,5/2},{}2F{5/2,7/2},{}2G{5/2,7/2}) resonance photoexcitations. The corresponding precise MCDF values for the oscillator strengths and the transition energies are presented for the first time. It is demonstrated that the resonance {f}4d\\to 4f oscillator strengths are slightly affected by the presence of the cage potential, despite the fact that the spectral levels structure is changed when the effect of this potential is included. The Auger 4d -1 decay from the cerium free ion Ce3+ and the encapsulated endohedral ion Ce3+@ are considered within the two-step model and the corresponding Lorentzian profiles are presented. This model clearly reveals the correspondence of the complex resonance profile in the Ce3+ photoabsorption to the fine structure of ion energy levels. The smoothing of the resonance profile in the photoabsorption of the endohedral system {{Ce}}@{{{{C}}}82}+ compared with the free ion Ce3+ is attributed to increasing the linewidths of the Auger transitions. This increase is estimated from the relevant experiment (Müller et al 2008 Phys. Rev. Lett. 101 133001) to be strong; as at least three times the value for an isolated ion. The presence of the confining fullerene

  15. 4d → 4f resonance in photoabsorption of cerium ion Ce3+ and endohedral cerium in fullerene complex {\\rm{Ce}}@{{{\\rm{C}}}_{82}}^{+} (United States)

    Schrange-Kashenock, G.


    The theoretical investigation of the single-photoionization spectra in the 4d-resonance region (120–150 eV) for the ionic cerium Ce3+ and cerium in the endohedral complex {{Ce}}@{{{{C}}}82}+ (in practice, {{{Ce}}}3+@{{{{C}}}82}2-) is presented. The fullerene cage is modeled by ab initio spherical jellium shell with an accurate account for the real distribution of carbon electron density. The oscillator strengths are calculated within the multiconfiguration Dirac–Fock (MCDF) approach for phototransitions from the outermost shells of the ion Ce3+ with and without the influence of the potential generated by a fullerene cage. It is shown that the integrated oscillator strengths have the main contribution from the Ce3+ 4d → 4f (ten possible from the phototransitions {}2F{7/2,5/2}\\to {}2D{3/2,5/2},{}2F{5/2,7/2},{}2G{5/2,7/2}) resonance photoexcitations. The corresponding precise MCDF values for the oscillator strengths and the transition energies are presented for the first time. It is demonstrated that the resonance {f}4d\\to 4f oscillator strengths are slightly affected by the presence of the cage potential, despite the fact that the spectral levels structure is changed when the effect of this potential is included. The Auger 4d ‑1 decay from the cerium free ion Ce3+ and the encapsulated endohedral ion Ce3+@ are considered within the two-step model and the corresponding Lorentzian profiles are presented. This model clearly reveals the correspondence of the complex resonance profile in the Ce3+ photoabsorption to the fine structure of ion energy levels. The smoothing of the resonance profile in the photoabsorption of the endohedral system {{Ce}}@{{{{C}}}82}+ compared with the free ion Ce3+ is attributed to increasing the linewidths of the Auger transitions. This increase is estimated from the relevant experiment (Müller et al 2008 Phys. Rev. Lett. 101 133001) to be strong; as at least three times the value for an isolated ion. The presence of the confining

  16. Magnetic hysteresis of cerium doped bismuth ferrite thin films

    Energy Technology Data Exchange (ETDEWEB)

    Gupta, Surbhi [Department of Physics and Astrophysics, University of Delhi (India); Tomar, Monika [Physics Department, Miranda House, University of Delhi (India); Gupta, Vinay, E-mail: [Department of Physics and Astrophysics, University of Delhi (India)


    The influence of Cerium doping on the structural and magnetic properties of BiFeO{sub 3} thin films have been investigated. Rietveld refinement of X-ray diffraction data and successive de-convolution of Raman scattering spectra of Bi{sub 1−x}Ce{sub x}FeO{sub 3} (BCFO) thin films with x=0–0.20 reflect the single phase rhombohedral (R3c) formation for x<0.08, whereas concentration-driven gradual structural phase transition from rhombohedral (R3c) to partial tetragonal (P4mm) phase follows for x≥0.08. All low wavenumber Raman modes (<300 cm{sup −1}) showed a noticeable shift towards higher wavenumber with increase in doping concentration, except Raman E-1 mode (71 cm{sup −1}), shows a minor shift. Sudden evolution of Raman mode at 668 cm{sup −1}, manifested as A{sub 1}-tetragonal mode, accompanied by the shift to higher wavenumber with increase in doping concentration (x) affirm partial structural phase transition. Anomalous wasp waist shaped (M–H) hysteresis curves with improved saturation magnetization (M{sub s}) for BCFO thin films is attributed to antiferromagnetic interaction/hybridization between Ce 4f and Fe 3d electronic states. The contribution of both hard and soft phase to the total coercivity is calculated. Polycrystalline Bi{sub 0.88}Ce{sub 0.12}FeO{sub 3} thin film found to exhibit better magnetic properties with M{sub s}=15.9 emu/g without any impure phase. - Highlights: • Synthesis of single phase Bi{sub 1−x}Ce{sub x}FeO{sub 3} thin films with (x=0–0.2) on cost effective corning glass and silicon substrates using CSD technique. • Structural modification studies using Rietveld refinement of XRD and de-convolution of Raman spectra revealed partial phase transition from rhombohedral (R3c) to tetragonal (P4mm) phase. • Possible reasons for origin of pinched magnetic behavior of BCFO thin films are identified. • Contribution of both hard and soft magnetic phase in coercivity of BCFO thin films is calculated and practical

  17. Magnetic hysteresis of cerium doped bismuth ferrite thin films

    International Nuclear Information System (INIS)

    The influence of Cerium doping on the structural and magnetic properties of BiFeO3 thin films have been investigated. Rietveld refinement of X-ray diffraction data and successive de-convolution of Raman scattering spectra of Bi1−xCexFeO3 (BCFO) thin films with x=0–0.20 reflect the single phase rhombohedral (R3c) formation for x<0.08, whereas concentration-driven gradual structural phase transition from rhombohedral (R3c) to partial tetragonal (P4mm) phase follows for x≥0.08. All low wavenumber Raman modes (<300 cm−1) showed a noticeable shift towards higher wavenumber with increase in doping concentration, except Raman E-1 mode (71 cm−1), shows a minor shift. Sudden evolution of Raman mode at 668 cm−1, manifested as A1-tetragonal mode, accompanied by the shift to higher wavenumber with increase in doping concentration (x) affirm partial structural phase transition. Anomalous wasp waist shaped (M–H) hysteresis curves with improved saturation magnetization (Ms) for BCFO thin films is attributed to antiferromagnetic interaction/hybridization between Ce 4f and Fe 3d electronic states. The contribution of both hard and soft phase to the total coercivity is calculated. Polycrystalline Bi0.88Ce0.12FeO3 thin film found to exhibit better magnetic properties with Ms=15.9 emu/g without any impure phase. - Highlights: • Synthesis of single phase Bi1−xCexFeO3 thin films with (x=0–0.2) on cost effective corning glass and silicon substrates using CSD technique. • Structural modification studies using Rietveld refinement of XRD and de-convolution of Raman spectra revealed partial phase transition from rhombohedral (R3c) to tetragonal (P4mm) phase. • Possible reasons for origin of pinched magnetic behavior of BCFO thin films are identified. • Contribution of both hard and soft magnetic phase in coercivity of BCFO thin films is calculated and practical applications of such materials exhibiting pinching behavior are conferred

  18. 26 CFR 1.148-9 - Arbitrage rules for refunding issues. (United States)


    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Arbitrage rules for refunding issues. 1.148-9...-9 Arbitrage rules for refunding issues. (a) Scope of application. This section contains special arbitrage rules for refunding issues. These rules apply for all purposes of section 148 and...

  19. 27 CFR 478.148 - Armor piercing ammunition intended for sporting or industrial purposes. (United States)


    ... intended for sporting or industrial purposes. 478.148 Section 478.148 Alcohol, Tobacco Products, and... ammunition intended for sporting or industrial purposes. The Director may exempt certain armor piercing... for any such ammunition which is primarily intended for sporting purposes or intended for...

  20. 33 CFR 148.320 - How is a license enforced, suspended, or revoked? (United States)


    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false How is a license enforced, suspended, or revoked? 148.320 Section 148.320 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... enforced, suspended, or revoked? MARAD may enforce, suspend, or revoke a license under 33 U.S.C. 1507(c)....

  1. Zinc finger protein 148 is dispensable for primitive and definitive hematopoiesis in mice.

    Directory of Open Access Journals (Sweden)

    Anna Nilton

    Full Text Available Hematopoiesis is regulated by transcription factors that induce cell fate and differentiation in hematopoietic stem cells into fully differentiated hematopoietic cell types. The transcription factor zinc finger protein 148 (Zfp148 interacts with the hematopoietic transcription factor Gata1 and has been implicated to play an important role in primitive and definitive hematopoiesis in zebra fish and mouse chimeras. We have recently created a gene-trap knockout mouse model deficient for Zfp148, opening up for analyses of hematopoiesis in a conventional loss-of-function model in vivo. Here, we show that Zfp148-deficient neonatal and adult mice have normal or slightly increased levels of hemoglobin, hematocrit, platelets and white blood cells, compared to wild type controls. Hematopoietic lineages in bone marrow, thymus and spleen from Zfp148 (gt/gt mice were further investigated by flow cytometry. There were no differences in T-cells (CD4 and CD8 single positive cells, CD4 and CD8 double negative/positive cells in either organ. However, the fraction of CD69- and B220-positive cells among lymphocytes in spleen was slightly lower at postnatal day 14 in Zfp148 (gt/gt mice compared to wild type mice. Our results demonstrate that Zfp148-deficient mice generate normal mature hematopoietic populations thus challenging earlier studies indicating that Zfp148 plays a critical role during hematopoietic development.

  2. 46 CFR 148.04-13 - Ferrous metal borings, shavings, turnings, or cuttings (excluding stainless steel). (United States)


    ... (excluding stainless steel). 148.04-13 Section 148.04-13 Shipping COAST GUARD, DEPARTMENT OF HOMELAND... stainless steel). (a) This section applies to the stowage and transportation in bulk of hazardous materials... steel). However, unmanned barges on which the article is stowed for or transported on a voyage...

  3. 9 CFR 381.148 - Processing and handling requirements for frozen poultry products. (United States)


    ... for frozen poultry products. 381.148 Section 381.148 Animals and Animal Products FOOD SAFETY AND... products by prompt and efficient freezing. Adequate freezing facilities shall be provided within the... moved from the official establishment prior to freezing: Provided, That the official establishment...

  4. High temperature condensation and thermal radiation properties of cerium dioxide in solid and liquid states

    International Nuclear Information System (INIS)

    Full Text: Measuring thermal radiation properties of cerium dioxide at high temperatures is very complicated problem from experimental point of view. It is connected with high evaporation of this material at high temperatures. In order to solve this problem with a subsecond laser technique the excess pressure of inert atmosphere is maintained in the working chamber to suppress surface evaporation in the focal area of the sample. In this paper it is shown that in this case the dense vapor phase formed above the investigated sample actively interacts with the sample surface and the laser radiation and distorts the experimental results. The developed polychromatic reflectometer with laser heating enabled one to discover the interesting phenomenon of the interaction of the vapor, liquid and solid phases in cerium dioxide under CO2 laser irradiation. This phenomenon is exhibited in the form of the exothermic peak of the condensation on the cooling curves moreover the temperature level of this transition is regulated by experimental parameters. The possibility of the change of the position of this floating phase transition on the temperature scale permits one to model the interaction of liquid-vapor and solid-vapor to estimate the contribution of the dense vapor phase formed above the sample to the thermal radiation properties of cerium dioxide at high temperatures. The experimental data on thermal radiation properties of stoichiometric cerium dioxide in the spectral range 0.4-1.1 μm and in the temperature region 2000-3500 K measured by the method developed are presented. Reflectivity and emissivity measurement error does not exceed ±3 %. The experimental results obtained are compared with the data of other authors and the recommended values for spectral reflectivity and emissivity of cerium dioxide at high temperatures are given. (author)

  5. Using cerium anomaly as an indicator of redox reactions in constructed wetland (United States)

    Liang, R.


    The study area, Chiayi County located in southern Taiwan, has highly developed livestock. The surface water has very low dissolved oxygen and high NH4. Under the situation, constructed wetland becomes the most effective and economic choice to treat the wastewater in the natural waterways. Hebao Island free surface constructed wetland started to operate in late 2006. It covers an area of 0.28 km2 and is subdivided into 3 major cells, which are sedimentation cell, 1st aeration cell with rooted plants and 2nd aeration cell with float plants. The water depth of cells ranges from 0.6 m to 1.2 m. The total hydraulic retention time is about a half day. In this study, the water samples were sequentially collected along the flow path. The results of hydrochemical analysis show that the untreated inflow water can be characterized with enriched NH4 (11 ppm), sulfate (6 ppm) and arsenic (50 ppb). The removal efficiency of NH4 in the first two cells is pollutants from the wastewater; therefore, dissolved oxygen is traditionally considered as an important indicator to evaluate the operation efficiency of wetland. However, it would need longer time to achieve equilibrium state of redox reaction involving dissolved oxygen due to the slower reaction rate. For example, the input water in this study has fairly high dissolved oxygen (5 ppm) but the NH4 content is still high, which indicates a non-equilibrium condition. In this study, the cerium anomaly is alternatively utilized to evaluate the water redox state. The results demonstrate that the input water has the negative cerium anomaly of -0.16. Along the flow path, the cerium negative anomaly does not change in the first two cells and dramatically becomes -0.23 in cell 3. The trend of cerium anomaly is more close to the removal efficiency of NH4 rather than dissolve oxygen. Accordingly, cerium anomaly could become a better indicator of removal efficiency of constructed wetland.

  6. Reactions between cerium(IV) and methyl-6-x-derivatives of aniline in perchloric acid solutions

    International Nuclear Information System (INIS)

    The oxidation of 2,6-dimethyl-, 2-isopropyl-6-methyl, 2-chloro-6-methyl-and 2-methyl-6-nitro aniline with cerium(IV) in perchloric acid solutions has been examined. It has been found that the concentration of hydrogen ions and the basicity of nitrogen atom in the amine group decide about the resultant intermediate products. Some of these products can be practically prepared using cerium(IV) as an oxidizing agent. (author). 16 refs, 1 tab

  7. Titrimetric and Spectrophotometric Assay of Ganciclovir in Pharmaceuticals Using Cerium(IV) Sulphate as the Oxidimetric Agent


    Pavagada J. Ramesh; Kanakapura Basavaiah; Cijo M. Xavier; Prashanth, Kudige N.; Raghu, Madihalli S.; Kanakapura B. Vinay


    Titrimetric and spectrophotometric assay of ganciclovir (GNC) is described using cerium(IV) sulphate as the oxidimetric reagent. The methods are based on the oxidation of GNC with a measured excess of cerium(IV) sulphate in acid medium followed by determination of the unreacted oxidant by two different reaction schemes. In titrimetry, the unreacted oxidant was determined by back titration with ferrous ammonium sulphate (FAS) in sulphuric acid medium, and spectrophotometry involves the reactio...

  8. Chromatographic separation of cerium(Ⅲ) in L-valine medium using poly[dibenzo-18-crown-6

    Institute of Scientific and Technical Information of China (English)

    SABALE Sandip R; MOHITE Baburao S


    A column chromatographic method has been developed for the separation and determination of cerium(Ⅲ) using poly[dibenzo-18-crown-6]. The separation was carried out in L-valine medium. The adsorption of cerium(Ⅲ) was quantitative from 1×10-1 to 1×10-4 mol/L L-valine. Amongst the various eluents, 1.0-8.0 mol/L hydrochloric acid, 1.0-8.0 mol/L hydrobromic acid, 1.0-8.0 mol/L perchloric acid, 1.0-2.0 mol/L sulfuric acid and 4.0-5.0 mol/L acetic acid, were found to be the efficient eluents for cerium(Ⅲ). The capacity of poly[dibenzo-18-crown-6] for cerium(Ⅲ) was (0.428±0.01) mmol/g. The method was applied to the separation of cerium(Ⅲ) from associated elements link uranium(Ⅵ) and thorium(Ⅳ). It was also applied for the determination of cerium(Ⅲ) in geological samples. The method is simple, rapid and selective with good reproducibility (approximately±2% ).

  9. 33 CFR 148.410 - What are the conditions for conducting site evaluation and pre-construction testing? (United States)


    ... conducting site evaluation and pre-construction testing? 148.410 Section 148.410 Navigation and Navigable... Site Evaluation and Pre-Construction Testing § 148.410 What are the conditions for conducting site evaluation and pre-construction testing? (a) No person may conduct site evaluation and...

  10. 24 CFR 943.148 - What procurement standards apply to PHAs selecting partners for a joint venture? (United States)


    ... PHAs selecting partners for a joint venture? 943.148 Section 943.148 Housing and Urban Development... VENTURES Subsidiaries, Affiliates, Joint Ventures in Public Housing § 943.148 What procurement standards apply to PHAs selecting partners for a joint venture? (a) The requirements of part 85 of this title...

  11. 33 CFR 148.246 - When is a document considered filed and where should I file it? (United States)


    ... filed and where should I file it? 148.246 Section 148.246 Navigation and Navigable Waters COAST GUARD... Formal Hearings § 148.246 When is a document considered filed and where should I file it? (a) If a document to be filed is submitted by mail, it is considered filed on the date it is postmarked. If...

  12. 46 CFR 148.04-9 - Fishmeal or scrap, ground or pelletized; fishmeal or scrap, ground and pelletized (mixture). (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false Fishmeal or scrap, ground or pelletized; fishmeal or scrap, ground and pelletized (mixture). 148.04-9 Section 148.04-9 Shipping COAST GUARD, DEPARTMENT OF... Additional Requirements for Certain Material § 148.04-9 Fishmeal or scrap, ground or pelletized; fishmeal...

  13. 胰腺损伤148例诊治分析%Pancreatic trauma: an analysis of 148 cases

    Institute of Scientific and Technical Information of China (English)

    高劲谋; 赵山红; 杨俊; 林曦; 曾剑波


    目的 探讨胰腺损伤的早期诊断、手术方式和并发症防治.方法 回顾分析20年间收治的胰腺损伤病历资料,包括性别、年龄、伤因、AAST分级、术式和疗效、并发症和死因等,并作统计学处理.结果 全组148例,手术132例,包括修补或仅引流、远端胰切除、远端胰(或囊肿)空肠Roux-n-Y吻合或其他内引流、憩室化、Whipple手术和损伤控制外科方法等术式.术后并发症发生率27.83%.Ⅲ~Ⅴ级与Ⅰ~Ⅱ级伤的胰瘘发生率差异有统计学意义(P<0.01).病死率11.49%,死因主要为合并伤大出血(76.47%);而胰腺损伤级别间差异无统计学意义(P>0.05).结论 首先控制合并伤大出血是提高胰腺损伤生存率的关键;术式取决于主胰管是否损伤,清除失活组织、充分外、内引流是胰腺损伤治疗的核心;早期诊断和正确的术式将明显减少并发症.%Objective To explore the early diagnosis, option of the surgical procedures, preven-tion and treatment of the complications in patients with pancreatic trauma.Methods All patients with pancreatic trauma during the past 20 years were studied retrospectively in respect of sex, age, cause of injury, grade by AAST, style of operation, therapeutic efficacy, complications and factors for death etc.Statistical analysis was made with Chi-square test.Results In all 148 cases of the present series, 132 underwent surgical interventions including simple suture or external drainage alone, distal pancre-atectomy, distal pancreaticojejunostomy or other internal drainage, diverticularization, Whipple's pro-cedure, and Damage Control Surgery (DCS) etc.Postoperative morbidity was 27.83% with a signifi-cant difference of the incidence of pancreatic fistula between pancreas grade Ⅲ-Ⅴ injuries and grade Ⅰ-Ⅱ(P<0.01).The mortality rate was 11.49%.The cause of the deaths was mainly massive bleed-ing due to severe associated injuries(76.47%).Among various grades, the difference

  14. Color-Fading Spectrophotometric Determination of Cerium with DBC-Arsenazo

    Institute of Scientific and Technical Information of China (English)

    翟庆洲; 张晓霞


    In the medium of 0.18~1.08 mol·L-1 sulfuric acid, cerium(Ⅳ) has the color-fading effect on DBC-arsenazo. The apparent molar absorptivity of the color-fading reaction is ε530 nm=1.03×104 L·mol-1·cm-1. Beer′s law is obeyed over the range of 1.20~12.0 μg·ml-1 of Ce (Ⅳ) which shows a linear relationship with the decrease in the absorbance of the colored solution. The effect of thirty-six coexisting ions was studied. The method was applied to the determination of the trace amount of cerium in water samples and has the advantage of high accuracy and good selectivity.

  15. Improvement and analysis of the hydrogen-cerium redox flow cell (United States)

    Tucker, Michael C.; Weiss, Alexandra; Weber, Adam Z.


    The H2-Ce redox flow cell is optimized using commercially-available cell materials. Cell performance is found to be sensitive to the upper charge cutoff voltage, membrane boiling pretreatment, methanesulfonic-acid concentration, (+) electrode surface area and flow pattern, and operating temperature. Performance is relatively insensitive to membrane thickness, Cerium concentration, and all features of the (-) electrode including hydrogen flow. Cell performance appears to be limited by mass transport and kinetics in the cerium (+) electrode. Maximum discharge power of 895 mW cm-2 was observed at 60 °C; an energy efficiency of 90% was achieved at 50 °C. The H2-Ce cell is promising for energy storage assuming one can optimize Ce reaction kinetics and electrolyte.

  16. Deposition of cerium contained conversion films on LC4 alloy with square wave pulse method

    Institute of Scientific and Technical Information of China (English)

    ZHANG Wei; LI Jiuqing; WU Yinshun; ZHANG Pei; HE Jianping


    Cerium contained conversion films were deposited on LC4 aluminum alloy using square wave pulse (SWP) in a CeC13 solution with KMnO4 as the oxidant. Energy dispersive spectroscopy (EDS) and scanning electron microscopy (SEM) were adopted to study the composition and the morphology of the film. It is found that the film is composed of Al, Zn, Cu,and small amount of cerium. The polarization curves of the specimens treated with SWP technique measured in 3.5% (mass fraction) NaCl solution reveal that the film thus formed inhibits both the anodic and cathodic process of the corrosion of the specimen. The immersion tests of treated specimens in 3.5% NaCl solution indicate that the corrosion resistance of the SWP treated specimen is better than that of the untreated and is equivalent to or even better than that of the traditionally electrochemically treated specimens.

  17. Monte Carlo radiative transfer simulation of a cavity solar reactor for the reduction of cerium oxide

    Energy Technology Data Exchange (ETDEWEB)

    Villafan-Vidales, H.I.; Arancibia-Bulnes, C.A.; Dehesa-Carrasco, U. [Centro de Investigacion en Energia, Universidad Nacional Autonoma de Mexico, Privada Xochicalco s/n, Col. Centro, A.P. 34, Temixco, Morelos 62580 (Mexico); Romero-Paredes, H. [Departamento de Ingenieria de Procesos e Hidraulica, Universidad Autonoma Metropolitana-Iztapalapa, Av. San Rafael Atlixco No.186, Col. Vicentina, A.P. 55-534, Mexico D.F 09340 (Mexico)


    Radiative heat transfer in a solar thermochemical reactor for the thermal reduction of cerium oxide is simulated with the Monte Carlo method. The directional characteristics and the power distribution of the concentrated solar radiation that enters the cavity is obtained by carrying out a Monte Carlo ray tracing of a paraboloidal concentrator. It is considered that the reactor contains a gas/particle suspension directly exposed to concentrated solar radiation. The suspension is treated as a non-isothermal, non-gray, absorbing, emitting, and anisotropically scattering medium. The transport coefficients of the particles are obtained from Mie-scattering theory by using the optical properties of cerium oxide. From the simulations, the aperture radius and the particle concentration were optimized to match the characteristics of the considered concentrator. (author)

  18. Growth of monodisperse nanocrystals of cerium oxide during synthesis and annealing

    International Nuclear Information System (INIS)

    Monodisperse cerium oxide nanocrystals have been successfully synthesised using simple ammonia precipitation technique from cerium(III) nitrate solution at different temperatures in the range 35-80 oC. The activation energy for growth of CeO2 nanocrystals during the precipitation is calculated as 11.54 kJ/mol using Arrhenius plot. Average crystal diameter was obtained from XRD analysis, HR-TEM and light scattering (PCS). The analysis of size data from HR-TEM images and PCS clearly indicated the formation of highly crystalline CeO2 particles in narrow size range. CeO2 nanocrystals precipitated at 35 oC were further annealed at temperatures in the range 300-700 oC. The activation energy for crystal growth during annealing is also calculated and is close to the reported values. An effort is made to predict the mechanism of crystal growth during the precipitation and annealing.

  19. A cerium-lead redox flow battery system employing supporting electrolyte of methanesulfonic acid (United States)

    Na, Zhaolin; Xu, Shengnan; Yin, Dongming; Wang, Limin


    A novel cerium-lead redox flow battery (RFB) employing Ce(IV)/Ce(III) and Pb(II)/Pb redox couples in the supporting electrolyte of methanesulfonic acid (MSA) is developed and preliminarily investigated. The RFB requires no additional catalyst and uses kinetically favorable reactions between low-cost reactants, and provides a desirable discharge voltage of approximately 1.7 V, with high average coulombic efficiency (CE) of 92% and energy efficiency (EE) of 86% over 800 cycles at 298 K. Stable cycling with an acceptable performance is achieved for a board operating temperature range of 253 K-313 K. The excellent performance obtained from the preliminary study suggests that the cerium-lead RFB promises to be applicable to large-scale energy storage for electricity grids.

  20. Synthesis of mesoporous cerium-zirconium mixed oxides by hydrothermal templating method

    Institute of Scientific and Technical Information of China (English)


    Mesoporous cerium-zirconium mixed oxides were prepared by hydrothermal method using cetyl trimethyl ammonium bromide (CTAB) as template.The effects of amount of template,pH value of solution and hydrothermal temperature on mesostructure of samples were systematically investigated.The final products were characterized by XRD,TEM,FT-IR,and BET.The results indicate that all the cerium-zirconium mixed oxides present a meso-structure.At molar ratio of n(CTAB)/n((Ce)+(Zr))=0.15,pH value of 9,and hydrothermal temperature of 120 ℃,the samples obtained possess a specific surface area of 207.9 m2/g with pore diameter of 3.70 nm and pore volume of 0.19 cm3/g.

  1. Energy transfer and thermal studies of Pr3+ doped cerium oxalate crystals

    Indian Academy of Sciences (India)

    R Pragash; Gijo Jose; N V Unnikrishnan; C Sudarsanakumar


    Energy transfer process at room temperature for cerium (sensitizer) oxalate single crystals doped with different concentrations (10, 13, 15, 17 and 20%) of praseodymium ions (activator) grown by hydro silica gel method has been evaluated. The analysis of energy level diagrams of cerium and praseodymium ions indicates that the energy gap between the sensitizer and the activator ions varies in a small range suggesting a possible energy transfer from the Ce3+ to Pr3+. The emission and absorption spectra of these crystals were recorded. The overlapping of the absorption spectra of Pr3+ and emission spectra of Ce3+ at wavelengths 484 and 478 nm, respectively, strongly supports the possible energy transfer process in this system. From the absorption spectra, oscillator strength, electric dipole moment, branching ratio and Judd–Ofelt parameters of this system were evaluated by least square programming. The quantum efficiency, energy transfer probabilities and thermal properties have been studied.

  2. Reduction behavior of cerium(Ⅲ) ions in NaCl-2CsCl melt

    Institute of Scientific and Technical Information of China (English)

    QI Xue; ZHU Hongmin


    The cathodic process of cerium(Ⅲ) ions in NaCl-2CsCl melt was studied by cyclic voltammetry and square wave voltammetry with tungsten and gold electrodes at 873 K. The two electroanalytical methods yield similar results. The cathodic process of cerium(Ⅲ) ions consists of two reversible steps: Ce3+ + e-= Ce2+ and Ce2+ + 2e-= Ce. The half wave potentials of Ce3+/Ce2+ and Ce2+/Ce were determined as -2.525 V vs. Cl2/Cl- and -2.975 V vs. Cl2/Cl-, respectively. The diffusion coefficient of Ce3+ was also determined as 5.5 × 10-5 cm2·s-1.

  3. Thermodynamics of the α -γ transition in cerium studied by an LDA + Gutzwiller method (United States)

    Tian, Ming-Feng; Song, Hai-Feng; Liu, Hai-Feng; Wang, Cong; Fang, Zhong; Dai, Xi


    Utilizing the local-density approximation (LDA) + Gutzwiller method, we have studied the α -γ transition in cerium. Our results indicate that the volume collapse transition between α and γ phases is present at zero temperature with negative pressure. By further providing a newly finite temperature generalization of the LDA + Gutzwiller method (using the mean-field potential approach), the entropy contributed by both electronic quasiparticles and lattice vibration included, we obtain the Gibbs free energy at a given volume and temperature, from which we get the α -γ transition at finite temperature and pressure. Our results indicate that the electronic entropy and lattice vibrational entropy both play important roles in the α -γ transition. We also calculated the equation of state and phase diagram of cerium, finding good agreement with the experiments.

  4. Effect of cerium oxide addition on electrical and physical properties of alkali borosilicate glasses

    International Nuclear Information System (INIS)

    The study of electrical conductivity, density and coefficient of thermal expansion (CTE) of Na2O:K2O:B2O3:SiO2:BaO glass samples with addition of cerium oxide has been carried out. It has been observed that the addition of cerium oxide affects the electrical conductivity, density and CTE. The results have been explained on the basis of the variation in number of bridging oxygens (BOs) and non-bridging oxygens (NBOs) present in the glass. In general, the glass with more NBOs has a weak network which exhibits higher electrical conductivity. The weakening of the network has been supported by the observed decrease in density and increase in CTE for the glasses.

  5. Effect of cerium addition on microstructure and texture of aluminum foil for electrolytic capacitors

    Institute of Scientific and Technical Information of China (English)

    王海燕; 李文学; 任慧平; 黄丽颖; 王向阳


    Anode foil of aluminum electrolytic capacitor,which requires large surface area for high capacitance,were prepared by rolling,annealing and electrochemical etching.Effects of cerium addition on the capacitance of aluminum electrolytic capacitors were investigated.Microstructure of the aluminum foil surface was observed by optical microscopy(OM) and scanning electron microscopy(SEM).Electron back scattered diffraction(EBSD) was also employed to reveal texture evolvement of cold-rolled aluminum foil after ann...

  6. A cerium glass fiber-optic active target for high energy physics experiments

    International Nuclear Information System (INIS)

    A fiber-optic plate imaging system has been developed for active target and tracking applications, in which the active element is Ce(3+) in a silicate glass. Particle tracks and interactions have been recorded with a hit density of greater than or equal to 4/mm for minimum ionizing particles and with a spatial resolution sigma approx. = 28μ m.) The properties of cerium scintillation glass are discussed

  7. Untangling the biological effects of cerium oxide nanoparticles: the role of surface valence states


    Gerardo Pulido-Reyes; Ismael Rodea-Palomares; Soumen Das; Tamil Selvan Sakthivel; Francisco Leganes; Roberto Rosal; Sudipta Seal; Francisca Fernández-Piñas


    Cerium oxide nanoparticles (nanoceria; CNPs) have been found to have both pro-oxidant and anti-oxidant effects on different cell systems or organisms. In order to untangle the mechanisms which underlie the biological activity of nanoceria, we have studied the effect of five different CNPs on a model relevant aquatic microorganism. Neither shape, concentration, synthesis method, surface charge (ζ-potential), nor nominal size had any influence in the observed biological activity. The main drive...

  8. Theoretical modeling of heterogeneous catalysts based on platinum and cerium oxide


    Bruix Fusté, Albert


    This thesis focuses on the computational study of models for platinum catalysts supported on cerium oxide (CeO2) which are of technological relevance. In these catalysts, ceria is often found acting as a non-inert support, leading to complex metal-support interactions (MSI) that modify the properties of both the oxide and the supported metal. First principles computational methods based on the Density functional Theory (DFT) have been used to study the nature of these interactions and their e...

  9. Redox-active cerium oxide nanoparticles protect human dermal fibroblasts from PQ-induced damage


    Claudia von Montfort; Lirija Alili; Sarah Teuber-Hanselmann; Peter Brenneisen


    Recently, it has been published that cerium (Ce) oxide nanoparticles (CNP; nanoceria) are able to downregulate tumor invasion in cancer cell lines. Redox-active CNP exhibit both selective pro-oxidative and antioxidative properties, the first being responsible for impairment of tumor growth and invasion. A non-toxic and even protective effect of CNP in human dermal fibroblasts (HDF) has already been observed. However, the effect on important parameters such as cell death, proliferation and red...

  10. Nanocrystalline cerium dioxide efficacy for gastrointestinal motility: potential for prokinetic treatment and prevention in elderly


    Yefimenko, Olena Yu; Savchenko, Yuliya O; Tetyana M. Falalyeyeva; Beregova, Tetyana V; Zholobak, Nadiya M; Spivak, Mykola Ya; Shcherbakov, Oleksandr B; Bubnov, Rostyslav V


    Background Constipation is a common condition, with prevalence after 65 years, is a major colorectal cancer risk factor. Recent works have demonstrated advances in personalized, preventive nanomedicine, leading to the construction of new materials and nanodrugs, in particular, nanocrystalline cerium dioxide (NCD), having strong antioxidative prebiotic effect. The aim of our study was to investigate the influence of NCD on motor function of the stomach and colon in vivo and contractive activit...

  11. Cerium regulates expression of alternative methanol dehydrogenases in Methylosinus trichosporium OB3b. (United States)

    Farhan Ul Haque, Muhammad; Kalidass, Bhagyalakshmi; Bandow, Nathan; Turpin, Erick A; DiSpirito, Alan A; Semrau, Jeremy D


    Methanotrophs have multiple methane monooxygenases that are well known to be regulated by copper, i.e., a "copper switch." At low copper/biomass ratios the soluble methane monooxygenase (sMMO) is expressed while expression and activity of the particulate methane monooxygenase (pMMO) increases with increasing availability of copper. In many methanotrophs there are also multiple methanol dehydrogenases (MeDHs), one based on Mxa and another based on Xox. Mxa-MeDH is known to have calcium in its active site, while Xox-MeDHs have been shown to have rare earth elements in their active site. We show here that the expression levels of Mxa-MeDH and Xox-MeDH in Methylosinus trichosporium OB3b significantly decreased and increased, respectively, when grown in the presence of cerium but the absence of copper compared to the absence of both metals. Expression of sMMO and pMMO was not affected. In the presence of copper, the effect of cerium on gene expression was less significant, i.e., expression of Mxa-MeDH in the presence of copper and cerium was slightly lower than in the presence of copper alone, but Xox-MeDH was again found to increase significantly. As expected, the addition of copper caused sMMO and pMMO expression levels to significantly decrease and increase, respectively, but the simultaneous addition of cerium had no discernible effect on MMO expression. As a result, it appears Mxa-MeDH can be uncoupled from methane oxidation by sMMO in M. trichosporium OB3b but not from pMMO. PMID:26296730

  12. Yeast Interacting Proteins Database: YPR148C, YDL237W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YPR148C - Protein of unknown function that may interact with ribosomes, based on co-purification experiments... with ribosomes, based on co-purification experiments; green fluorescent protein

  13. Cerium Biomagnification in a Terrestrial Food Chain: Influence of Particle Size and Growth Stage. (United States)

    Majumdar, Sanghamitra; Trujillo-Reyes, Jesica; Hernandez-Viezcas, Jose A; White, Jason C; Peralta-Videa, Jose R; Gardea-Torresdey, Jorge L


    Mass-flow modeling of engineered nanomaterials (ENMs) indicates that a major fraction of released particles partition into soils and sediments. This has aggravated the risk of contaminating agricultural fields, potentially threatening associated food webs. To assess possible ENM trophic transfer, cerium accumulation from cerium oxide nanoparticles (nano-CeO2) and their bulk equivalent (bulk-CeO2) was investigated in producers and consumers from a terrestrial food chain. Kidney bean plants (Phaseolus vulgaris var. red hawk) grown in soil contaminated with 1000-2000 mg/kg nano-CeO2 or 1000 mg/kg bulk-CeO2 were presented to Mexican bean beetles (Epilachna varivestis), which were then consumed by spined soldier bugs (Podisus maculiventris). Cerium accumulation in plant and insects was independent of particle size. After 36 days of exposure to 1000 mg/kg nano- and bulk-CeO2, roots accumulated 26 and 19 μg/g Ce, respectively, and translocated 1.02 and 1.3 μg/g Ce, respectively, to shoots. The beetle larvae feeding on nano-CeO2 exposed leaves accumulated low levels of Ce since ∼98% of Ce was excreted in contrast to bulk-CeO2. However, in nano-CeO2 exposed adults, Ce in tissues was higher than Ce excreted. Additionally, Ce content in tissues was biomagnified by a factor of 5.3 from the plants to adult beetles and further to bugs.

  14. The role of hydrogen peroxide in the deposition of cerium-based conversion coatings

    International Nuclear Information System (INIS)

    Cerium-based conversion coatings are progressing as an effective alternative to hazardous chromate-based systems used in the treatment of metal surfaces. However, there is still considerable debate over the mechanism by which these coatings are formed. Here, titrations of cerium-based conversion coating solutions were carried out in order to model the reactions that occur at the metal-solution interface during coating, with a particular emphasis on investigating the role of hydrogen peroxide (H2O2). The titration curves obtained support the proposed formation of Ce(III) peroxo complexes such as Ce(H2O2)3+ as an initial step, followed by deprotonation, oxidation and precipitation to form peroxo-containing Ce(IV) species such as Ce(IV)(O2)(OH)2. The precipitates resulting from titrations were characterised by Raman spectroscopy, X-ray diffraction and thermogravimetric analysis, confirming the presence of peroxo bonds, and nano-sized CeO2 crystallites that decreased in size with increasing H2O2 concentration. Characterisation of cerium conversion coatings on aluminium alloy surfaces confirmed the presence of peroxo species in the coatings, thereby supporting the titration model

  15. Synthesis and Characterization of Cerium Doped Titanium Catalyst for the Degradation of Nitrobenzene Using Visible Light

    Directory of Open Access Journals (Sweden)

    Padmini Ellappan


    Full Text Available Cerium doped catalyst was synthesized using Titanium isopropoxide as the Titanium source. The metal doped nanoparticles semiconductor catalyst was prepared by sol-sol method with the sol of Cerium. The synthesized catalyst samples were characterized by powder X-ray diffraction, BET surface area, thermogravimetric analysis (TGA, scanning electron microscopy (SEM, and UV-vis diffuse reflectance measurements (DRS and compared with undoped TiO2 catalyst. The photocatalytic activity of the sample was investigated for the decomposition of nitrobenzene (NB using visible light as the artificial light source. Cerium doped catalyst was found to have better degradation of nitrobenzene owing to its shift in the band gap from UV to visible region as compared to undoped TiO2 catalyst. The operational parameters were optimized with catalyst dosage of 0.1 g L−1, pH of 9, and light intensity of 500 W. The degradation mechanism followed the Langmuir Hinshelwood kinetic model with the rate constant depending nonlinearly on the operational parameters as given by the relationship Kapp (theoretical = 2.29 * 10−4 * Intensity0.584 * Concentration−0.230 * Dosage0.425 * pH0.336.

  16. Infrared, thermal and X-ray diffraction analysis of cerium soaps

    Energy Technology Data Exchange (ETDEWEB)

    Mehrotra, K.N. [Agra Univ. (India). Dept. of Chemistry; Chauhan, M. [Agra Univ. (India). Dept. of Chemistry; Shukla, R.K. [R.B.S. Coll., Agra (India)


    The physico-chemical characteristics of cerium soaps (Caproate and caprate) in solid state were investigated by IR, thermal and X-ray diffraction measurements. The IR results reveal that the fatty acids exist in dimeric state through hydrogen bonding and soaps possess partial ionic character. The decomposition reaction was found kinetically of zero order with energy of activation 6.7 and 7.3 K cal mol{sup -1} for cerium caproate and caprate, respectively. The X-ray diffraction measurements were used to calculate the long spacings and the results confirm the double layer structure of cerium soaps. (orig.) [Deutsch] Mit Hilfe von IR-, thermischen und Roentgendiffraktionsmessungen wurden die physikalisch-chemischen Eigenschaften von Cerseifen (Capron- und Caprylsaeuresalze)in festem Zustand bestimmt. Die IR-Untersuchungen zeigen, dass die Fettseifen in dimerem Zustand, gebunden durch Wasserstoffbruecken vorliegen und partiell ionischen Charakter haben. Die Zersetzungsreaktion war von einer Kinetik nullter Ordnung, die Aktivierungsenergien lagen bei 6,7 K cal mol{sup -1} fuer Capronsaeuresalze und 7,3 K cal mol{sup -1} fuer Caprylsaeuresalze. Mit Hilfe von Roentgendiffraktionsmessungen wurden die grossen Zwischenraeume bestimmt. Die Ergebnisse lassen auf eine Doppelschichtstruktur der Cerseifen schliessen. (orig.)

  17. Cerium, gallium and zinc containing mesoporous bioactive glass coating deposited on titanium alloy (United States)

    Shruti, S.; Andreatta, F.; Furlani, E.; Marin, E.; Maschio, S.; Fedrizzi, L.


    Surface modification is one of the methods for improving the performance of medical implants in biological environment. In this study, cerium, gallium and zinc substituted 80%SiO2-15%CaO-5%P2O5 mesoporous bioactive glass (MBG) in combination with polycaprolactone (PCL) were coated over Ti6Al4 V substrates by dip-coating method in order to obtain an inorganic-organic hybrid coating (MBG-PCL). Structural characterization was performed using XRD, nitrogen adsorption, SEM-EDXS, FTIR. The MBG-PCL coating uniformly covered the substrate with the thickness found to be more than 1 μm. Glass and polymer phases were detected in the coating along with the presence of biologically potent elements cerium, gallium and zinc. In addition, in vitro bioactivity was investigated by soaking the coated samples in simulated body fluid (SBF) for up to 30 days at 37 °C. The apatite-like layer was monitored by FTIR, SEM-EDXS and ICP measurements and it formed in all the samples within 15 days except zinc samples. In this way, an attempt was made to develop a new biomaterial with improved in vitro bioactive response due to bioactive glass coating and good mechanical strength of Ti6Al4 V alloy along with inherent biological properties of cerium, gallium and zinc.

  18. Specifics of new phase crystal nucleation during isostructural γ↔α transformation in cerium

    International Nuclear Information System (INIS)

    Specifics of new phase nucleation and subsequent growth under γ-α-transformation in cerium near the surface of the sample is suggested. It is assumed that this specifics can effect mechanical behaviour of a laminar sample under transition at three-point bend. Measurement of deflection of cerium samples at the sensitivity of ∼ 10-6 m at three-point loading was carried out in the 4.2-300 K temperature range at p=10-4 GPa as well as in a chamber of high pressure (in the range of hydrostatic pressures up to 1.0 GPa at T=293 K). It is shown that the effects of change in the form experimentally discovered in the given paper and accompanying isostructural γ-α-transformation in cerium may be explained by the fact that crystal nucleation of γ- and α-phases differing by the volume takes place mainly from the surface of the sample and not in its volume

  19. Cerium modified Y/SBA-15 composite molecular sieve catalyzed synthesis ofn-butyl acetate

    Institute of Scientific and Technical Information of China (English)

    史春薇; 吴文远; 边雪; 裴明远; 赵杉林; 陈平


    A novel Ce-Y/SBA-15 catalyst was prepared by modifying HY/SBA-15 microporous-mesoporous composite molecular sieve with cerium using the impregnation method. The characterization results from scanning electron microscopy/energy dispersive X-ray dispersive spectroscopy (SEM/EDS), transmission electron microscopy (TEM), and X-ray fluorescence (XRF) studies indi-cated that the Ce-modified catalyst maintained the microporous-mesoporous structure of Y/SBA-15. The Ce ions were found to be uniformly dispersed in the pores of the molecular sieve without aggregation. The results from pyrolysis coupled-Fourier transform in-frared spectroscopy (Pyridine-FTIR) and temperature programmed desorption of ammonia (NH3-TPD) showed that the loading of ce-rium caused the hydroxyl group in the catalyst to display stronger Bronsted acidity. The efficiency of the modified Ce-Y/SBA-15 catalyst was evaluated by using it to catalyze the synthesis ofn-butyl acetate. The optimal synthesis conditions were determined by orthogonal experiments. The highest esterification yield of 94.4% was obtained when the reaction time was 2.0 h, with acid/alcohol molar ratio of 1:1.2, and catalyst loading of 10 wt.%. The results in this study demonstrated that the loading of cerium and the structure of Y/SBA-15 microporous-mesoporous composite molecular sieve helped in improving the catalytic activity of this acidic catalyst.

  20. Controlled Redox Chemistry at Cerium within a Tripodal Nitroxide Ligand Framework. (United States)

    Bogart, Justin A; Lippincott, Connor A; Carroll, Patrick J; Booth, Corwin H; Schelter, Eric J


    Ligand reorganization has been shown to have a profound effect on the outcome of cerium redox chemistry. Through the use of a tethered, tripodal, trianionic nitroxide ligand, [((2-tBuNOH)C6 H4 CH2 )3 N](3-) (TriNOx (3-) ), controlled redox chemistry at cerium was accomplished, and typically reactive complexes of tetravalent cerium were isolated. These included rare cationic complexes [Ce(TriNOx )thf][BAr(F) 4 ], in which Ar(F) =3,5-(CF3 )2 -C6 H3 , and [Ce(TriNOx )py][OTf]. A rare complete Ce-halide series, Ce(TriNOx )X, in which X=F(-) , Cl(-) , Br(-) , I(-) , was also synthesized. The solution chemistry of these complexes was explored through detailed solution-phase electrochemistry and (1) H NMR experiments and showed a unique shift in the ratio of species with inner- and outer-sphere anions with size of the anionic X(-) group. DFT calculations on the series of calculations corroborated the experimental findings.

  1. Chromium VI adsorption on cerium oxide nanoparticles and morphology changes during the process

    International Nuclear Information System (INIS)

    In this study, suspended cerium oxide nanoparticles stabilized with hexamethylenetetramine were used for the removal of dissolved chromium VI in pure water. Several concentrations of adsorbent and adsorbate were tested, trying to cover a large range of possible real conditions. Results showed that the Freundlich isotherm represented well the adsorption equilibrium reached between nanoparticles and chromium, whereas adsorption kinetics could be modeled by a pseudo-second-order expression. The separation of chromium-cerium nanoparticles from the medium and the desorption of chromium using sodium hydroxide without cerium losses was obtained. Nanoparticles agglomeration and morphological changes during the adsorption-desorption process were observed by TEM. Another remarkable result obtained in this study is the low toxicity in the water treated by nanoparticles measured by the Microtox commercial method. These results can be used to propose this treatment sequence for a clean and simple removal of drinking water or wastewater re-use when a high toxicity heavy metal such as chromium VI is the responsible for water pollution.

  2. Effect of cerium oxide addition on electrical properties of ZnO

    Energy Technology Data Exchange (ETDEWEB)

    Ibrahim, D.M. [National Research Center, Dokki, Giza (Egypt). Dept. of Ceramics; Mounir, M. [Dept. of Physics, Cairo Univ., Giza (Egypt); Mahgoub, A.S. [Cairo Univ., Giza (Egypt). Dept. of Chemistry; Turky, G. [Dept. of Physics, National Research Center, Dokki, Giza (Egypt); El-Desouky, O.A. [Cer. Cleopatra Co., Ramadan City (Egypt)


    Mixtures of ZnO and Ce{sub 6} O{sub 11} as additive were prepared by solid state reaction from the calcined oxides with the following proportions: 0.03, 0.08, 0.1, 0.2 and 0.4 mole. Disc specimens 1.2 cm 5 cm in diameter and 0.3 cm thickness were processed under a force of 70 kN and fired at 1150 C/ 30 minutes. XRD revealed the presence of limited solid solution of cerium in ZnO, as evident from the shift in the peaks [0.03-0.04 A ] up to 0.1 mole addition and remains constant. SEM revealed the presence of inter-granular phase. EDAX showed it to be a mixture of ZnO and Ce{sub 6}O{sub 11}. Also cerium was detected in the ZnO grains confirming the XRD results. RCL circuit was used to measure the capacitance and resistance at different frequencies at room temperature. The dielectric constant and conductivity were calculated. The change in resistivity with temperature was followed up to 523 K. The change in dielectric strength with temperature at spot frequency of 10 kHz is demonstrated. The electrical conductivity was found to increase with the proportion of cerium oxide up to 0.2 mole then decreased. (orig.)

  3. Laser ablated plasma plume diagnostics of cerium oxide: effect of oxygen partial pressure

    International Nuclear Information System (INIS)

    This paper describes the spatial and temporal investigation of laser ablated plasma plume of cerium oxide target using Langmuir probe to measure the plasma parameters. Cerium oxide target was ablated using a KrF (λ ∼ 248 nm) gas laser at an energy of 300 mJ per pulse. Experimental studies confirmed that oxygen partial pressure of 2 x 10-2 mbar is sufficient enough to get good quality films of cerium oxide. At this pressure, plume was diagnosed for their spatial and temporal behaviour. The tungsten probe tip was inserted along the length of the plasma to collect the ions and electrons effectively. A thin probe tip (about 0.4 mm diameter) was used to avoid plasma perturbation during measurements. A variable voltage was applied to the tip and corresponding current due to electrons and ions was collected. Spatial distribution was investigated at a regular interval of 15 mm from the target up maximum distance 45 mm and the temporal behaviour was recorded in the range of 0 to 50 μS with an interval of 0.5 μS. The ion and average electron density are found to be maximum at 30 mm from the target position and the plasma current of ceria is found to be maximum at 22 μS. (author)

  4. Development of Stable Cerium Zirconium Mixed Oxide Nanoparticle Additive for Emission Reduction in Biodiesel Blends

    Directory of Open Access Journals (Sweden)

    Sajith V


    Full Text Available Harmful emissions associated with the use of biodiesel is a serious issue and various fuel additives are being used for the reduction of emissions as well as for the improvement of engine performance. Use of cerium oxide nanoparticles as fuel additive is one of the methods for the reduction of emissions, due to its peculiar redox functionality and oxygen buffering capability. Doping of ceria with transition metals such as zirconium improves its Oxygen storage capacity and thermal stability, thereby enhancing simultaneous oxidation and reduction reactions. The present work focuses on the development of cerium zirconium mixed oxide nanoparticle based additive for the reduction of emissions from diesel engine fuelled with biodiesel - diesel blends. Cerium zirconium mixed oxide was synthesized by means of co precipitation method. The stability of the nanofluids was improved by the addition of surfactant, namely Oleic acid. The optimum concentration of surfactant was determined based on estimation of critical micelle concentration, by means of standard tests. Stability of catalytic nanoparticle in fuel was evaluated from the measurement of Zeta potential. Various properties were determined as per ASTM standards to investigate the effect of the nanoparticles on fuel properties. Addition of catalytic nanoparticle in diesel - biodiesel blends does not significantly affect the fuel properties. Engine performance and emission tests were conducted on single cylinder diesel engine to assess the potential of synthesized nanofuel and 15% average reduction of NO emissions was observed for B5 and B10 blends with 15 ppm of catalytic nanoparticle concentration.

  5. Microstructure and electrochemical behavior of cerium conversion coating modified with silane agent on magnesium substrates (United States)

    Lei, Li; Shi, Jing; Wang, Xin; Liu, Dan; Xu, Haigang


    The cerium conversion coating with and without different concentrations of silane agent bis-(γ-triethoxysilylpropyl)-tetrasulfide (BTESPT) modification is obtained on magnesium alloys. Detailed properties of the coatings and the role of BTESPT as an additive are studied and followed with careful discussion. The coating morphology, wettability, chemical composition and corrosion resistance are characterized by scanning electronic microscope (SEM), water contact-angle, X-ray photoelectron spectroscopy (XPS), potentiodynamic measurements and electrochemical impedance spectroscopy (EIS). The electrochemical behavior of the coatings is investigated using EIS. The results indicate that the coating morphology and composition can be controlled by changing silane concentration. The combination of cerium ions and silane molecules could promote the formation of more homogenous and higher hydrophobic coating. The coating turns to be more compact and the adhesive strength between the coating and the magnesium substrate are strongly improved with the formation of Sisbnd Osbnd Si and Sisbnd Osbnd M chemical bonds. The optimum corrosion resistance of the coating in the corrosive media is obtained by 25 ml L-1 BTESPT modification. This whole study implies that the cerium conversion coating modified with certain silane agent deserves cautiousness before its application for corrosion resistance.

  6. Effect of coating parameters on the microstructure of cerium oxide conversion coatings

    International Nuclear Information System (INIS)

    The microstructure and morphology of cerium oxide conversion coatings prepared under different deposition conditions were characterized by transmission electron microscopy (TEM). The coatings were formed by a spontaneous reaction between a water-based solution containing CeCl3 and aluminum alloy 7075-T6 substrates. Microstructural characterization was performed to determine the crystallinity of the coatings and to obtain a better understanding of the deposition parameters on coating microstructure. The results of TEM imaging and electron diffraction analysis indicated that the as-deposited coating was composed of nanocrystalline particles of a previously unreported cerium compound. The particles of the coatings produced using glycerol as an additive were found to be much finer than those of the coatings prepared in the absence of glycerol. This indicates that glycerol may act as a grain refiner and/or growth inhibitor during coating deposition. After deposition, the coated panels were treated for 5 min in a phosphate sealing solution. The sealing treatment converted the as-deposited coating into hydrated cerium phosphate. Panels coated from solutions containing no glycerol followed by phosphate sealing performed poorly in salt fog tests. With glycerol addition, the corrosion resistance of the coatings that were phosphate sealed improved considerably, achieving an average passing rate of 85%

  7. Cerium Biomagnification in a Terrestrial Food Chain: Influence of Particle Size and Growth Stage. (United States)

    Majumdar, Sanghamitra; Trujillo-Reyes, Jesica; Hernandez-Viezcas, Jose A; White, Jason C; Peralta-Videa, Jose R; Gardea-Torresdey, Jorge L


    Mass-flow modeling of engineered nanomaterials (ENMs) indicates that a major fraction of released particles partition into soils and sediments. This has aggravated the risk of contaminating agricultural fields, potentially threatening associated food webs. To assess possible ENM trophic transfer, cerium accumulation from cerium oxide nanoparticles (nano-CeO2) and their bulk equivalent (bulk-CeO2) was investigated in producers and consumers from a terrestrial food chain. Kidney bean plants (Phaseolus vulgaris var. red hawk) grown in soil contaminated with 1000-2000 mg/kg nano-CeO2 or 1000 mg/kg bulk-CeO2 were presented to Mexican bean beetles (Epilachna varivestis), which were then consumed by spined soldier bugs (Podisus maculiventris). Cerium accumulation in plant and insects was independent of particle size. After 36 days of exposure to 1000 mg/kg nano- and bulk-CeO2, roots accumulated 26 and 19 μg/g Ce, respectively, and translocated 1.02 and 1.3 μg/g Ce, respectively, to shoots. The beetle larvae feeding on nano-CeO2 exposed leaves accumulated low levels of Ce since ∼98% of Ce was excreted in contrast to bulk-CeO2. However, in nano-CeO2 exposed adults, Ce in tissues was higher than Ce excreted. Additionally, Ce content in tissues was biomagnified by a factor of 5.3 from the plants to adult beetles and further to bugs. PMID:26690677

  8. Cerium Modified Pillared Montmorillonite Supported Cobalt Catalysts for Fischer Tropsch Synthesis

    International Nuclear Information System (INIS)

    Fischer-Tropsch (FT) synthesis was accomplished over Al-pillared Montmorillonite supported 20 wt% Co modified with different weight% of cerium catalysts. These catalysts were prepared by impregnation method while structural characterizations of the prepared samples were performed by XRD, TPR, NH/sub 3/TPD, TGA, BET, XRF and SEM techniques. The Fischer Tropsch reaction was studied in fixed bed micro catalytic reactor at temperature range of 220, 260 and 275 degree C and at different pressure (1, 5 and 10 bars). From the activity results, it was found that by pillaring NaMMT with Al higher catalytic activity and lower methane selectivity of NaMMT was achieved. Furthermore, the results of FT synthesis reaction revealed that cerium incorporation increased the dispersion of Co/sub 3/O/sub 4/ on the surface and consequently resulted in enhanced catalytic activity. Additionally, the C/sub 5/-C/sub 12/ hydrocarbons and methane selectivity increased while C/sub 22+/ hydrocarbons selectivity was decreased over cerium modified catalysts. Higher reaction temperature (>220 degree C) resulted in significant enhancement in CO conversion and methane selectivity. Though, increase in pressure from 1 to 10 bars eventually resulted in increase in C/sub 5+/ hydrocarbons and decrease in methane and C/sub 2/-C/sub 5/ hydrocarbons selectivity. (author)

  9. Cerium valence change in the solid solutions Ce(Rh1-xRux)Sn

    International Nuclear Information System (INIS)

    The solid solutions Ce(Rh1-xRux)Sn were investigated by means of susceptibility measurements, specific heat, electrical resistivity, X-ray absorption spectroscopy (XAS), and 119Sn Moessbauer spectroscopy. Magnetic measurements as well as XAS data show a cerium valence change in dependence on the ruthenium content. Higher ruthenium content causes an increase from 3.22 to 3.45 at 300 K. Furthermore χ and χ-1 data indicate valence fluctuation for cerium as a function of temperature. For example, Ce(Rh0.8Ru0.2)Sn exhibits valence fluctuations between 3.42 and 3.32 in the temperature range of 10 to 300 K. This could be proven by using the interconfiguration fluctuation (ICF) model introduced by Sales and Wohlleben. Cerium valence change does not influence the tin atoms as proven by 119Sn Moessbauer spectroscopy, but it influences the electrical properties. Ce(Rh0.9Ru0.1)Sn behaves like a typical valence fluctuating compound, and higher ruthenium content causes an increase of the metallic behavior. (orig.)

  10. The rescue of miR-148a expression in pancreatic cancer: an inappropriate therapeutic tool.

    Directory of Open Access Journals (Sweden)

    Yannick Delpu

    Full Text Available MicroRNAs are small non-coding RNAs that physiologically modulate proteins expression, and regulate numerous cellular mechanisms. Alteration of microRNA expression has been described in cancer and is associated to tumor initiation and progression. The microRNA 148a (miR-148a is frequently down-regulated in cancer. We previously demonstrated that its down-regulation by DNA hypermethylation is an early event in pancreatic ductal adenocarcinoma (PDAC carcinogenesis, suggesting a tumor suppressive function. Here, we investigate the potential role of miR-148a over-expression in PDAC as a therapeutic tool. We first report the consequences of miR-148a over-expression in PDAC cell lines. We demonstrate that miR-148a over-expression has no dramatic effect on cell proliferation and cell chemo-sensitivity in four well described PDAC cell lines. We also investigate the modulation of protein expression by a global proteomic approach (2D-DIGE. We show that despite its massive over-expression, miR-148a weakly modulates protein expression, thus preventing the identification of protein targets in PDAC cell lines. More importantly, in vivo data demonstrate that modulating miR-148a expression either in the epithelia tumor cells and/or in the tumor microenvironment does not impede tumor growth. Taken together, we demonstrate herein that miR-148a does not impact PDAC proliferation both in vitro and in vivo thus suggesting a weak potential as a therapeutic tool.

  11. 26 CFR 1.148-9A - Arbitrage rules for refunding issues. (United States)


    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Arbitrage rules for refunding issues. 1.148-9A..., 1997 § 1.148-9A Arbitrage rules for refunding issues. (a) through (c)(2)(ii)(A) . For guidance see § 1... amounts in a mixed escrow that are not proceeds of a refunding issue may be allocated to the...

  12. Experimental cross section of {sup 144}Sm({alpha},{gamma}){sup 148}Gd

    Energy Technology Data Exchange (ETDEWEB)

    Somorjai, E. [Atomki, Debrecen (Hungary); Fueloep, Zs. [Atomki, Debrecen (Hungary); Kiss, A.Z. [Atomki, Debrecen (Hungary); Rolfs, C. [Ruhr-Universitaet, Bochum (Germany); Trautvetter, H.-P. [Ruhr-Universitaet, Bochum (Germany); Greife, U. [Ruhr-Universitaet, Bochum (Germany); Junker, M. [Ruhr-Universitaet, Bochum (Germany); Arnould, M. [Universite Libre de Bruxelles, Bruxelles (Belgium); Rayet, M. [Universite Libre de Bruxelles, Bruxelles (Belgium); Oberhummer, H. [Technische Universitaet, Vienna (Austria)


    The cross section of the {sup 144}Sm({alpha},{gamma}){sup 148} Gd reaction has been measured in the bombarding energy range of 10.5-13.4 MeV, using activation method based on the off-line {alpha}-activity measurement of the {sup 148}Gd residual nucleus. The long measuring time of the alpha decay demanded the utilization of solid state nuclear track detectors (SSNTD). The first results are compared to the latest statistical model calculations. (orig.).

  13. Identification of miR-148a as a novel regulator of cholesterol metabolism (United States)

    Goedeke, Leigh; Rotllan, Noemi; Canfrán-Duque, Alberto; Aranda, Juan F.; Ramírez, Cristina M.; Araldi, Elisa; Lin, Chin-Sheng; Anderson, Norma N.; Wagschal, Alexandre; de Cabo, Rafael; Horton, Jay D.; Lasunción, Miguel A.; Näär, Anders M.; Suárez, Yajaira; Fernández-Hernando, Carlos


    The hepatic low-density lipoprotein receptor (LDLR) pathway is essential for clearing circulating LDL-cholesterol (LDL-C). While the transcriptional regulation of LDLR is well-characterized, the post-transcriptional mechanisms which govern LDLR expression are just beginning to emerge. Here, we developed a high-throughput genome-wide screening assay to systematically identify microRNAs (miRNAs) that regulate LDLR activity in human hepatic cells. From this screen, we characterize miR-148a as a negative regulator of LDLR expression and activity, and define a novel SREBP1-mediated pathway by which miR-148a regulates LDL-C uptake. Importantly, inhibition of miR-148a increases hepatic LDLR expression and decreases plasma LDL-C in vivo. We also provide evidence that miR-148a regulates hepatic ABCA1 expression and circulating HDL-C levels. Collectively, these studies uncover miR-148a as an important regulator of hepatic LDL-C clearance through direct regulation of LDLR expression, and demonstrate the therapeutic potential of inhibiting miR-148a to ameliorate the elevated LDL-C/HDL-C ratio, a prominent risk factor for cardiovascular disease. PMID:26437365

  14. MicroRNA-148b promotes proliferation of hair follicle cells by targeting NFAT5

    Directory of Open Access Journals (Sweden)

    Wanbao YANG,Qinqun LI,Bo SU,Mei YU


    Full Text Available MicroRNAs (miRNAs, small non-coding RNAs, are involved in many aspects of biological processes. Previous studies have indicated that miRNAs are important for hair follicle development and growth. In our study, we found by qRT-PCR that miR-148b was significantly upregulated in sheep wool follicle bulbs in anagen phase compared with the telogen phase of the hair follicle cycle. Overexpression of miR-148b promoted proliferation of both HHDPC and HHGMC. By using the TOPFlash system we demonstrated that miR-148b could activate Wnt/β-catenin pathway and b-catenin, cycD, c-jun and PPARD were consistently upregulated accordingly. Furthermore, transcript factor nuclear factor of activated T cells type 5 (NFAT5 and Wnt10b were predicted to be the target of miR-148b and this was substantiated using a Dual-Luciferase reporter system. Subsequently NFAT5 was further identified as the target of miR-148b using western blotting. These results were considered to indicate that miR-148b could activate the Wnt/β-catenin signal pathway by targeting NFAT5 to promote the proliferation of human hair follicle cells.

  15. Proteome analysis of the Mycobacterium tuberculosis Beijing B0/W148 cluster. (United States)

    Bespyatykh, Julia; Shitikov, Egor; Butenko, Ivan; Altukhov, Ilya; Alexeev, Dmitry; Mokrousov, Igor; Dogonadze, Marine; Zhuravlev, Viacheslav; Yablonsky, Peter; Ilina, Elena; Govorun, Vadim


    Beijing B0/W148, a "successful" clone of Mycobacterium tuberculosis, is widespread in the Russian Federation and some countries of the former Soviet Union. Here, we used label-free gel-LC-MS/MS shotgun proteomics to discover features of Beijing B0/W148 strains that could explain their success. Qualitative and quantitative proteome analyses of Beijing B0/W148 strains allowed us to identify 1,868 proteins, including 266 that were differentially abundant compared with the control strain H37Rv. To predict the biological effects of the observed differences in protein abundances, we performed Gene Ontology analysis together with analysis of protein-DNA interactions using a gene regulatory network. Our results demonstrate that Beijing B0/W148 strains have increased levels of enzymes responsible for long-chain fatty acid biosynthesis, along with a coincident decrease in the abundance of proteins responsible for their degradation. Together with high levels of HsaA (Rv3570c) protein, involved in steroid degradation, these findings provide a possible explanation for the increased transmissibility of Beijing B0/W148 strains and their survival in host macrophages. Among other, we confirmed a very low level of the SseA (Rv3283) protein in Beijing B0/W148 characteristic for all «modern» Beijing strains, which could lead to increased DNA oxidative damage, accumulation of mutations, and potentially facilitate the development of drug resistance. PMID:27356881

  16. Influence of agglomeration of cerium oxide nanoparticles and speciation of cerium(III) on short term effects to the green algae Chlamydomonas reinhardtii

    International Nuclear Information System (INIS)

    Highlights: • Phosphate-dispersed CeO2 NP did not affect photosynthetic yield in C. reinhardtii. • Agglomerated CeO2 NP slightly decreased photosynthetic yield. • Cerium(III) was shown to affect photosynthetic yield and intracellular ROS level. • Slight effects of CeO2 NP were caused by dissolved Ce3+ ions present in suspensions. • Wild type and cell wall free mutant of C. reinhardtii showed the same sensitivity. - Abstract: Cerium oxide nanoparticles (CeO2 NP) are increasingly used in industrial applications and may be released to the aquatic environment. The fate of CeO2 NP and effects on algae are largely unknown. In this study, the short term effects of CeO2 NP in two different agglomeration states on the green algae Chlamydomonas reinhardtii were examined. The role of dissolved cerium(III) on toxicity, its speciation and the dissolution of CeO2 NP were considered. The role of cell wall of C. reinhardtii as a barrier and its influence on the sensitivity to CeO2 NP and cerium(III) was evaluated by testing both, the wild type and the cell wall free mutant of C. reinhardtii. Characterization showed that CeO2 NP had a surface charge of ∼0 mV at physiological pH and agglomerated in exposure media. Phosphate stabilized CeO2 NP at pH 7.5 over 24 h. This effect was exploited to test CeO2 NP dispersed in phosphate with a mean size of 140 nm and agglomerated in absence of phosphate with a mean size of 2000 nm. The level of dissolved cerium(III) in CeO2 NP suspensions was very low and between 0.1 and 27 nM in all tested media. Exposure of C. reinhardtii to Ce(NO3)3 decreased the photosynthetic yield in a concentration dependent manner with EC50 of 7.5 ± 0.84 μM for wild type and EC50 of 6.3 ± 0.53 μM for the cell wall free mutant. The intracellular level of reactive oxygen species (ROS) increased upon exposure to Ce(NO3)3 with effective concentrations similar to those inhibiting photosynthesis. The agglomerated CeO2 NP caused a slight decrease of

  17. Influence of agglomeration of cerium oxide nanoparticles and speciation of cerium(III) on short term effects to the green algae Chlamydomonas reinhardtii

    Energy Technology Data Exchange (ETDEWEB)

    Röhder, Lena A. [Eawag, Swiss Federal Institute of Aquatic Science and Technology, Department of Environmental Toxicology, Dübendorf 8600 (Switzerland); ETH-Zurich, Institute of Biogeochemistry and Pollutant Dynamics, Zürich 8092 (Switzerland); Brandt, Tanja [Eawag, Swiss Federal Institute of Aquatic Science and Technology, Department of Environmental Toxicology, Dübendorf 8600 (Switzerland); Sigg, Laura [Eawag, Swiss Federal Institute of Aquatic Science and Technology, Department of Environmental Toxicology, Dübendorf 8600 (Switzerland); ETH-Zurich, Institute of Biogeochemistry and Pollutant Dynamics, Zürich 8092 (Switzerland); Behra, Renata, E-mail: [Eawag, Swiss Federal Institute of Aquatic Science and Technology, Department of Environmental Toxicology, Dübendorf 8600 (Switzerland)


    Highlights: • Phosphate-dispersed CeO₂ NP did not affect photosynthetic yield in C. reinhardtii. • Agglomerated CeO₂ NP slightly decreased photosynthetic yield. • Cerium(III) was shown to affect photosynthetic yield and intracellular ROS level. • Slight effects of CeO₂ NP were caused by dissolved Ce³⁺ ions present in suspensions. • Wild type and cell wall free mutant of C. reinhardtii showed the same sensitivity. - Abstract: Cerium oxide nanoparticles (CeO₂ NP) are increasingly used in industrial applications and may be released to the aquatic environment. The fate of CeO₂ NP and effects on algae are largely unknown. In this study, the short term effects of CeO₂ NP in two different agglomeration states on the green algae Chlamydomonas reinhardtii were examined. The role of dissolved cerium(III) on toxicity, its speciation and the dissolution of CeO₂ NP were considered. The role of cell wall of C. reinhardtii as a barrier and its influence on the sensitivity to CeO₂ NP and cerium(III) was evaluated by testing both, the wild type and the cell wall free mutant of C. reinhardtii. Characterization showed that CeO₂ NP had a surface charge of ~0 mV at physiological pH and agglomerated in exposure media. Phosphate stabilized CeO₂ NP at pH 7.5 over 24 h. This effect was exploited to test CeO₂ NP dispersed in phosphate with a mean size of 140 nm and agglomerated in absence of phosphate with a mean size of 2000 nm. The level of dissolved cerium(III) in CeO₂ NP suspensions was very low and between 0.1 and 27 nM in all tested media. Exposure of C. reinhardtii to Ce(NO₃)₃ decreased the photosynthetic yield in a concentration dependent manner with EC₅₀ of 7.5 ± 0.84 μM for wild type and EC₅₀ of 6.3 ± 0.53 μM for the cell wall free mutant. The intracellular level of reactive oxygen species (ROS) increased upon exposure to Ce(NO₃)₃ with effective concentrations similar to those inhibiting photosynthesis. The agglomerated Ce

  18. Evaluation of mechanically treated cerium (IV) oxides as corrosion inhibitors for galvanized steel

    International Nuclear Information System (INIS)

    The use of cerium salts as corrosion inhibitors for hot dip galvanized steel has been object of a numerous studies in the last few years. The role of cerium ions as corrosion inhibitors was proved: cerium is able to block the cathodic sites of the metal, forming insoluble hydroxides and oxides on the zinc surface. This fact leads to a dramatic decrease of the cathodic current densities and, therefore, to a reduction the overall corrosion processes. On the other hand, the potential of cerium oxides as corrosion inhibitors was also proposed. However, the real effectiveness of this kind of anticorrosive pigments has not been clarified yet. In this work cerium (IV) oxides are considered as corrosion inhibitors for galvanized steel. The corrosion inhibition mechanism of mechanically treated (milled) CeO2 alone and in combination with milled SiO2 nanoparticles was investigated. For this purpose milled CeO2, CeO2 and SiO2 milled together and milled SiO2 particles were studied as corrosion inhibitors in water solution. Therefore, the different mechanically treated particles were dispersed in 0.1 M NaCl solution to test their effectiveness as corrosion inhibitors for galvanized steel. The galvanized steel was immersed in the different solutions and the corrosion inhibition efficiency of the different particles was measured by means of electrochemical techniques. For this purpose, electrochemical impedance spectroscopy (EIS) measurements were carried out, monitoring the evolution of the corrosion processes occurring at the metal surface with the immersion time in the solution. The effect of the different pigments was also investigated by carrying out anodic and cathodic polarization measurements. The polarization curves were acquired under conditions of varied pH. The experimental measurements suggest that the mechanical treatment performed on the SiO2 and CeO2 particles promote the formation of an effective corrosion pigment. The tests evidence also the beneficial effect of

  19. Cyanex 923 as the extractant in a rare earth element impurity analysis of high-purity cerium oxide. (United States)

    Duan, Taicheng; Li, Hongfei; Kang, JianZhen; Chen, Hangting


    In this work, the feasibility of employing Cyanex 923 as an extractant into the non-cerium REE (rare earth elements) impurity analysis of high-purity cerium oxide was investigated. Through investigations on the choice of the extraction medium, the optimium extraction acidity, matrix Ce4+ effect on the non-cerium REE ion extraction, the optimium extractant concentration and suitable extracting time, and oscillation strengh, it was found that when the phase ratio was at 1:1 and the acicidity was about 2% H2SO4, by gently shaking by hand for about 2 min, 10 mL of 30% Cyanex 923 could not extract even for a 20 ng amount of non-cerium REE3+ ions. However, the extraction efficiency for Ce4+ of 100 mg total amount under the same conditions was about 96%, indicating that a 25-fold preconcentration factor could be achieved. Thus, it was concluded that Cyanex 923 could be used in a REE impurity analysis of 99.9999% or so pure cerium oxide for primary sepapation to elimilate matrix-induced interferences encountered in an ICP-MS (inductively coupled plasma mass spectroscopy) determination.

  20. Self-poled transparent and flexible UV light-emitting cerium complex-PVDF composite: a high-performance nanogenerator. (United States)

    Garain, Samiran; Sinha, Tridib Kumar; Adhikary, Prakriti; Henkel, Karsten; Sen, Shrabanee; Ram, Shanker; Sinha, Chittaranjan; Schmeißer, Dieter; Mandal, Dipankar


    Cerium(III)-N,N-dimethylformamide-bisulfate [Ce(DMF)(HSO4)3] complex is doped into poly(vinylidene fluoride) (PVDF) to induce a higher yield (99%) of the electroactive phases (β- and γ-phases) of PVDF. A remarkable enhancement of the output voltage (∼32 V) of a nanogenerator (NG) based on a nonelectrically poled cerium(III) complex containing PVDF composite film is achieved by simple repeated human finger imparting, whereas neat PVDF does not show this kind of behavior. This high electrical output resembles the generation of self-poled electroactive β-phase in PVDF due to the electrostatic interactions between the fluoride of PVDF and the surface-active positive charge cloud of the cerium complex via H-bonding and/or bipolar interaction among the opposite poles of cerium complex and PVDF, respectively. The capacitor charging capability of the flexible NG promises its applicability as piezoelectric-based energy harvester. The cerium(III) complex doped PVDF composite film exhibit an intense photoluminescence in the UV region, which might be due to a participation of electron cloud from negative pole of bipolarized PVDF. This fact may open a new area for prospective development of high-performance energy-saving flexible solid-state UV light emitters. PMID:25523039

  1. Effect of cerium additive and secondary phase analysis on Ag0.5Bi0.5TiO3 ceramics

    Indian Academy of Sciences (India)

    S Supriya; Antonio J Dos Santos-García; F Fernández-Martinez


    Cerium-doped silver bismuth titanate—Ag0.5Bi0.5TiO3 (ABT) ceramics have been synthesized by the high-temperature solid-state reaction method. The structure and elemental examination of the prepared ceramic was analysed by X-ray diffraction (XRD), Fourier transform infrared, scanning electron microscopy and energydispersive spectroscopy. XRD analysis showed the presence of pyrochlore structure and secondary phase when more than 5 mol% cerium was added. The impact of temperature on cerium-doped silver bismuth titanate samples was analysed by differential thermal analysis and differential scanning calorimetry. Cerium doping caused the flaky morphology comparing with undoped sample. The homogeneity of all the samples was discussed in detail by diffuse reflectance spectrum. This is the first time the reflection process is analysed for the cerium-doped ABT system to the best of our knowledge.

  2. Lack of association between the APEX1 Asp148Glu polymorphism and sporadic amyotrophic lateral sclerosis. (United States)

    Coppedè, Fabio; Lo Gerfo, Annalisa; Carlesi, Cecilia; Piazza, Selina; Mancuso, Michelangelo; Pasquali, Livia; Murri, Luigi; Migliore, Lucia; Siciliano, Gabriele


    Impairments in DNA repair enzymes have been observed in amyotrophic lateral sclerosis (ALS) tissues, particularly in the activity of the apurinic/apyrimidinic endonuclease 1 (APEX1). Moreover, it was suggested that the common APEX1 Asp148Glu polymorphism might be associated with ALS risk. To further address this question we performed the present study aimed at evaluating the contribution of the APEX1 Asp148Glu polymorphism in sporadic ALS (sALS) risk and clinical presentation, including age and site of onset and disease progression. We screened 134 sALS Italian patients and 129 matched controls for the presence of the APEX1 Asp148Glu polymorphism. No difference in APEX1 Asp148Glu allele and genotype frequencies was found between the groups, nor was the polymorphism associated with age and site of onset or disease progression. Present results do not support a role for the APEX1 Asp148Glu polymorphism in sALS pathogenesis in the Italian population. PMID:18482781

  3. Ab initio molecular dynamics study of the properties of cerium in liquid sodium at 1000 K temperature

    Energy Technology Data Exchange (ETDEWEB)

    Samin, Adib; Li, Xiang; Zhang, Jinsuo [Nuclear Engineering Program, Department of Mechanical and Aerospace Engineering, The Ohio State University, 201 W 19th Avenue, Columbus, Ohio 43210 (United States); Mariani, R. D. [Idaho National Laboratory, Materials and Fuels Complex, Idaho Falls, Idaho 83415 (United States); Unal, Cetin [Los Alamos National Laboratory, P.O. Box 1663, Los Alamos, New Mexico 87545 (United States)


    For liquid-sodium-cooled fast nuclear reactor systems, it is crucial to understand the behavior of lanthanides and other potential fission products in liquid sodium or other liquid metal solutions such as liquid cesium-sodium. In this study, we focus on lanthanide behavior in liquid sodium. Using ab initio molecular dynamics, we found that the solubility of cerium in liquid sodium at 1000 K was less than 0.78 at. %, and the diffusion coefficient of cerium in liquid sodium was calculated to be 5.57 × 10{sup −9} m{sup 2}/s. Furthermore, it was found that cerium in small amounts may significantly alter the heat capacity of the liquid sodium system. Our results are consistent with the experimental results for similar materials under similar conditions.

  4. Ab initio molecular dynamics study of the properties of cerium in liquid sodium at 1000 K temperature (United States)

    Samin, Adib; Li, Xiang; Zhang, Jinsuo; Mariani, R. D.; Unal, Cetin


    For liquid-sodium-cooled fast nuclear reactor systems, it is crucial to understand the behavior of lanthanides and other potential fission products in liquid sodium or other liquid metal solutions such as liquid cesium-sodium. In this study, we focus on lanthanide behavior in liquid sodium. Using ab initio molecular dynamics, we found that the solubility of cerium in liquid sodium at 1000 K was less than 0.78 at. %, and the diffusion coefficient of cerium in liquid sodium was calculated to be 5.57 × 10-9 m2/s. Furthermore, it was found that cerium in small amounts may significantly alter the heat capacity of the liquid sodium system. Our results are consistent with the experimental results for similar materials under similar conditions.

  5. Crystallization behavior of electroless Co-Ni-B alloy plated in magnetic field in presence of cerium

    Institute of Scientific and Technical Information of China (English)

    XUAN Tian-peng; ZHANG Lei; HUANG Qin-hua


    The electrochemical property, chemical composition and crystal structure of electroless Co-Ni-B-Ce alloy plated in general state as well as in magnetic field were studied using potentiometer, plasma emission spectrometer, X-ray diffractometer,transmission electron microscope. The results show that the static potential and polarizability of electroless Co-Ni-B alloy are remarkably improved as the plating is carried out in magnetic field in the presence of a little amount of cerium in plating bath.Because of the action of magnetic field and rare earth element cerium, the boron content in alloy decreases, while cobalt and nickel contents increase. As a result, the amorphous Co-Ni-B alloy transforms to the microcrystalline Co-Ni-B-Ce alloy when the plating is in general state, and the Co-Ni-B alloy makes a crystalline transformation because of the action of magnetic field and rare earth element cerium.

  6. Implementation of a complex multi-phase equation of state for cerium and its correlation with experiment

    Energy Technology Data Exchange (ETDEWEB)

    Cherne, Frank J [Los Alamos National Laboratory; Jensen, Brian J [Los Alamos National Laboratory; Elkin, Vyacheslav M [VNIITF


    The complexity of cerium combined with its interesting material properties makes it a desirable material to examine dynamically. Characteristics such as the softening of the material before the phase change, low pressure solid-solid phase change, predicted low pressure melt boundary, and the solid-solid critical point add complexity to the construction of its equation of state. Currently, we are incorporating a feedback loop between a theoretical understanding of the material and an experimental understanding. Using a model equation of state for cerium we compare calculated wave profiles with experimental wave profiles for a number of front surface impact (cerium impacting a plated window) experiments. Using the calculated release isentrope we predict the temperature of the observed rarefaction shock. These experiments showed that the release state occurs at different magnitudes, thus allowing us to infer where dynamic {gamma} - {alpha} phase boundary is.

  7. An application of secondary ion mass spectrometry (SIMS) in studies of internal contamination micro localization of cerium

    International Nuclear Information System (INIS)

    Secondary Ion Mass Spectrometry (SIMS) permits the detection of stable and radioactive elements in micro volume. Based on the ablation of specimens by ion bombardment, this mass spectrometry method allows a rapid assessment of trace elements in biological samples. Its resolving mass power provides an efficient analytical method and, in particular, it makes possible accurate isotopic ratio determination. In this work, a particular example is presented on the basis of results obtained as a result of analyses of duodenal tissue sections from rats contaminated with cerium. Tests were performed with SIMS to localize cerium in tissue sections obtained from rats 12, 24 and 48 hours after contamination with this element. In all specimens groups, cerium was found in apical region of micro villus, with the exception of those obtained 48 h after contamination. In this report, strengths and limitations of SIMS are pointed out as well as the potential of SIMS in biological research. (author)

  8. Corrosion resistance of flaky aluminum pigment coated with cerium oxides/hydroxides in chloride and acidic electrolytes (United States)

    Niroumandrad, S.; Rostami, M.; Ramezanzadeh, B.


    The objective of this study was to enhance the corrosion resistance of lamellar aluminum pigment through surface treatment by cerium oxides/hydroxides. The surface composition of the pigments was studied by energy-dispersive spectroscopy (EDS) and X-ray photoelectron spectroscopy (XPS). The corrosion resistance of the pigment was evaluated by conventional hydrogen evolution measurements in acidic solution and electrochemical impedance spectroscopy (EIS) in 3.5% NaCl solution. Results showed that the Ce-rich coating composed of Ce2O3 and CeO2 was precipitated on the pigment surface after immersion in the cerium solution. The corrosion resistance of pigment was significantly enhanced after modification with cerium layer.

  9. Catalytic activity of cerium-doped Ru/Al2O3 during ozonation of dimethyl phthalate

    Institute of Scientific and Technical Information of China (English)

    Yunrui ZHOU; Wanpeng ZHU; Xun CHEN


    In this paper, factors influencing the mineraliza-tion of dimethyl phthalate (DMP) during catalytic ozona-tion with a cerium-doped Ru/Al2O3 catalyst were studied. The catalytic contribution was calculated through the results of a companrison experiment. It showed that doping cerium significantly enhanced catalytic activity. The total organic carbon (TOC) removal over the doped catalyst at 100 rain reached 75.1%, 61.3% using Ru/Al2O3 catalyst and only 14.0% using ozone alone. Catalytic activity reached the maximum when 0.2% of ruthenium and 1.0% of cerium'were simultaneously loaded onto Al2O3 support. Results of experiments on oxidation by ozone alone, adsorption of the catalyst, Ce ion's and heterogeneous catalytic ozonation confirmed that the contribution of het-erogeneous catalytic ozonation was about 50%, which showed the obvious effect of Ru-Ce/Al2O3 on catalytic activity.

  10. 148例小儿胆道蛔虫症临床分析%A Clinical Analysis of 148 Children With Biliary Ascaris Lumbricoides

    Institute of Scientific and Technical Information of China (English)

    魏建宁; 祝俊峰



  11. Microstructure and mechanical properties of the Al-Ti alloy with cerium addition

    Directory of Open Access Journals (Sweden)

    L.A. Dobrzański


    Full Text Available Purpose: In this work there are presented the investigation results of mechanical properties and microstructure concerning mainly intermetallic phases of the aluminium – titanium alloy with a defined content of 2 and 4 % of cerium addition. The purpose of this work was also to determine the heat treatment conditions for solution heat treatment of the investigation alloys.Design/methodology/approach: The reason of this work was to determine the heat treatment influence, particularly solution heat treatment time to the changes of the microstructure, as well to determine which intermetallic phases occur after the heat treatment performed, and how is the morphology of these particles.Findings: After solution heat treatment for 4 hours the structure changes. The grains are larger and no more uniform as showed before. The most stable intermetallic in the Al-Ti system is the Al3Ti phase. The solution heat treatment time should be greater than 4 hours to ensure a proper solution of titanium and cerium in the Al-α solid solution.Research limitations/implications: The investigated aluminium samples were examined metallographically using optical microscope with different image techniques, scanning electron microscope and also analyzed using a Vickers micro-hardness tester, also EDS microanalysis was made.Practical implications: As an implication for the practice a new alloy can be developed, some other investigation should be performed in the future, but the knowledge found in this research shows an interesting investigation direction.Originality/value: The combination of light weight and high strength Ti-based alloys is very attractive for aerospace and automotive industries. Furthermore, the presence of calcium cerium into existence new unknown phases as well can enhance the thermal stability of ternary Al-Ti-Ce alloy because of its higher melting point then Al-Ti.

  12. Adsorption of arsenate and arsenite from aqueous solutions by cerium-loaded cation exchange resin

    Institute of Scientific and Technical Information of China (English)

    HE Zongliang; TIAN Senlin; NING Ping


    The removal of arsenic from water and wastewater is obligatory.Resin is one of the most effective adsorbents for the removal of arsenic.In order to improve the adsorption capacity of resin,a new cerium-loaded cation exchange resin arsenic adsorbent was prepared by impregnating cerium into the cation exchange resin.Batch adsorption experiments under various conditions,such as time,temperature,pH and with coexisting ions were carried out to evaluate the adsorption characteristics of cerium-loaded resin in the removal of As(Ⅴ) and As(Ⅲ) from aqueous solutions.The results showed that the adsorption kinetics of As(Ⅴ) and As(Ⅲ) obeyed a pseudo second-order kinetic model and the adsorption rate constants were 0.3159 and 0.5215 g·mg-1·min-1,respectively.The adsorption of As(Ⅴ) followed the Freundlich adsorption isotherm model and the adsorption isotherm data for As(Ⅲ) fitted well to the Langmuir equation model.The adsorption capacities were 1.0278 mg/g for As(Ⅴ) and 2.5297 mg/g for As(Ⅲ).Both the adsorption of As(Ⅴ) and As(Ⅲ) were found to be pH sensitive and the optimum pH was found to be 5-6.Except for the phosphate ion,the coexisting anionics,such as nitrate,chlorate,sulphate and carbonate,showed no remarkable effect on AS(Ⅴ) and As(Ⅲ) adsorption.The desorption and regeneration study showed that the adsorption capacity of Ce-loaded resin for As(Ⅴ) and As(Ⅲ) could be restored to 97.80% and 69.61%,respectively,using 0.5 mol/L sodium hydroxide solution.

  13. High temperature stability of a 316 austenitic stainless steel coated with cerium oxide nanoparticles (United States)

    Mendoza Del Angel, Humberto

    Cerium oxide (CeO2-x) nanoparticles were used for coating protection on a 316 Austenitic Stainless Steel (Aust. SS) to enhance the thermal stability of the oxide films formed at high temperatures. Three simple coating methods were used, dipping, spraying and spinning in order to explore the coating film morphology, nanoparticle distribution and its effect on thermal stability of the steel substrates. Experimentally, the selected steel was exposed to 800°C/1000°C under dry air conditions. Weight changes (DeltaW/A) were monitored as a function of time and the results were compared with uncoated alloys tested under similar conditions. The cerium oxide nanoparticles used on the three methods were synthesized in the laboratory obtaining nanoparticles in the range of 3.5 to 6.2 nanometers. It was found that cerium oxide particle size is affected by temperature. In this case, the activation energy for particle growth was estimated to be around 21,1 kJ/mol. Characterization of the film morphologies before and after oxidation were carried out using Atomic Force Microscopy (AFM), Surface Profilometry, Scanning Electron Microscopy (SEM) and X-ray Diffraction (XRD). A comparison of the three coating methods was carried out for the particular case of the 316 Aust. SS coupons. In addition, the oxidation kinetics was experimentally investigated for the coated samples. For this purpose thermal gravimetric determinations were made at 800°C, 900°C, and 1000°C and oxidation rate constants were calculated at each temperature.

  14. Catalytic wet peroxidation of pyridine bearing wastewater by cerium supported SBA-15

    Energy Technology Data Exchange (ETDEWEB)

    Subbaramaiah, V. [Department of Chemical Engineering, Indian Institute of Technology Roorkee, Roorkee 247667 Uttarakhand (India); Srivastava, Vimal Chandra, E-mail: [Department of Chemical Engineering, Indian Institute of Technology Roorkee, Roorkee 247667 Uttarakhand (India); Mall, Indra Deo [Department of Chemical Engineering, Indian Institute of Technology Roorkee, Roorkee 247667 Uttarakhand (India)


    Highlights: ► Cerium supported SBA-15 (Ce/SBA-15) synthesized by two-step synthesis. ► Characterization of Ce/SBA-15 by FTIR, XRD and BET surface area. ► Catalytic peroxidation of pyridine by Ce/SBA-15. ► Optimization of parameters like catalyst dose, H{sub 2}O{sub 2} dose, initial concentration and temperature. ► Catalyst reusability and leaching study performed. -- Abstract: Cerium supported SBA-15 (Ce/SBA-15) was synthesized by two-step synthesis method in acidic medium. It was further characterized by various characterization techniques such as X-ray diffraction, field-emission scanning electron microscopy, Fourier transform infrared spectroscopy and N{sub 2} adsorption–desorption pore size distribution analysis. The Ce/SBA-15 showed highly ordered meso-structure with pore diameter ≈ 70–100 A and pore volume ≈ 0.025 cm{sup 3}/g. Ce/SBA-15 was further evaluated as a catalyst for the oxidation of highly toxic and non-biodegradable material, pyridine, by catalytic wet-peroxidation method. The effects of various operating parameters such as catalyst dose (0.5–6 g/l), stoichiometric ratio of H{sub 2}O{sub 2}/pyridine (1–6), initial pyridine concentration (50–800 mg/l) and temperature (313–358 K) have been evaluated and optimized. Ce/SBA-15 showed stable performance during reuse for six cycles with negligible cerium leaching. Kinetic and thermodynamic parameters and operation cost have also been determined.

  15. Changes in Physiological and Agronomical Parameters of Barley (Hordeum vulgare) Exposed to Cerium and Titanium Dioxide Nanoparticles


    Luca Marchiol; Alessandro Mattiello; Filip Pošćić; Guido Fellet; Costanza Zavalloni; Elvio Carlino; Rita Musetti


    The aims of our experiment were to evaluate the uptake and translocation of cerium and titanium oxide nanoparticles and to verify their effects on the growth cycle of barley (Hordeum vulgare L.). Barley plants were grown to physiological maturity in soil enriched with either 0, 500 or 1000 mg·kg−1 cerium oxide nanoparticles (nCeO2) or titanium oxide nanoparticles (nTiO2) and their combination. The growth cycle of nCeO2 and nTiO2 treated plants was about 10 days longer than the controls. In nC...

  16. Biosorption of lanthanum and cerium from aqueous solutions using tangerine (Citrus reticulata) peel: Equilibrium, kinetic, and thermodynamic studies


    Torab-Mostaedi Meisam


    Biosorption of lanthanum (III) and cerium (III) from aqueous solution by tangerine (Citrus reticulate) peel has been investigated in a batch system as a function of pH, biosorbent dosage, contact time, and temperature. The equilibrium pH was found to severely affect the biosorption performance; pH 5.0 is found to be an optimum pH for favorable biosorption of La (III) and Ce (III). The biosorption of lanthanum and cerium was investigated by the Langmuir, Freundlich and Dubinin-Radushkevi...

  17. Iranian natural clinoptilolite and its synthetic zeolite P for removal of cerium and thorium from nuclear wastewaters

    International Nuclear Information System (INIS)

    The ion-exchange behaviors of an Iranian natural clinoptilolite and its modified forms as well as a relevant synthetic zeolite P were investigated toward cerium and thorium from nuclear wastewaters. Column experiments were performed on different exchangers in various conditions and the effect of parameters such as particle size, pH, temperature, and time were considered. The distribution coefficient, cation exchange capacity and some thermodynamic parameters were calculated. Ion-exchange isotherms and break-through curves were plotted. As a result, the selectivity of synthetic zeolite P from Iranian natural clinoptilolite toward cerium and thorium was compared with that of natural and cationic forms of clinoptilolite. (author)

  18. In situ growth of blue-emitting thin films of cerium-doped barium chloride hydrate at low temperatures


    J. Hao; LOU, Z; Cocivera, M


    Blue emission was observed from thin films of barium chloride hydrate doped with cerium. The films were deposited by spray pyrolysis of aqueous solutions with substrate temperatures between 250 and 450°C. The cathodoluminescence (CL) spectrum consists of two peaks at 443 and 485 nm due to 4f-5d transitions of cerium ion. The dependence of the emission band on deposition temperature and Ce/Ba ratio is discussed. The CL luminance and luminous efficiency at 5 kV were 120 cd/m² and 0.48 lm/W, res...

  19. Improvement of corrosion resistance of AZ31 Mg alloy by anodizing with co-precipitation of cerium oxide

    Institute of Scientific and Technical Information of China (English)

    Salah Abdelghany SALMAN; Ryoichi ICHINO; Masazumi OKIDO


    Anodizing of AZ31 Mg alloy in NaOH solution by co-precipitation of cerium oxide was investigated. The chemical composition and phase structure of the coating film were determined via optical microscopy, SEM and XRD. The corrosion properties of the anodic film were characterized by using potentiodynamic polarization curves in 17 mmol/L NaCl and 0.1 mol/L Na2SO4 solution at 298 K. The corrosion resistance of AZ31 magnesium alloy is significantly improved by adding cerium oxide to alkaline solution. In addition, the surface properties are enhanced and the film contains no crack.


    Institute of Scientific and Technical Information of China (English)

    SuZhengquan; FengHuixia; 等


    The tetravalent metal salts of monoalkyl phosphates [M(O3POR)2]are a new kind of stationary phases of Chromatography-homogeneous bonded phases.This paper deals with the application of cerium bis(monomyristylphosphate)as support to reversed phase liquid chromatography.The results show that the best mobil phase is CH3CN:H2O=95:5.The good separation to the mixture containing six aromatic hydrocarbons and the determination of naphthalene in a group samples have been achieved.The regression analysis shows that detect limits,linearities and precision for six aromatic hydrocarbons are good.

  1. Trace electrochemical analysis of Europium, Ytterbium, and Cerium at their joint presence in solution

    Directory of Open Access Journals (Sweden)

    Rema Matakova


    Full Text Available In the course of several decades at the department of analytical chemistry and chemistry of rare elements there were studied the electrode processes with participation of rare-earth metals (REM in accordance with the long awaiting problem of the development of rare-metal and rare-earth branch of non-ferrous metallurgy of Kazakhstan. With the aim of express and highly sensitive analytical control of raw materials and final product of rare-earth industry there were developed the methods of inversion-voltamperometric determination of low concentrations of europium, ytterbium and cerium under the conditions of their individual and combined presence in the solution.

  2. The low-aluminium cast iron of reduced silicon content treated with cerium mischmetal


    M. S. Soiński; P. Susek; Hübner, K.; P. Mierzwa


    The work presents the effect of cerium mischmetal used in quantities of 0.1 and 0.2 wt-% and ferrosilicon used in quantities from 0.5% to 1.5% on the alloy matrix and the shape of graphite precipitates in the low-aluminium cast iron from seven heats, basing on the examination of its structure. The hypereutectic cast iron of the relatively high carbon content (4.0÷4.2%) at the prior-to-treatment silicon and manganese content equal to ca. 0.6% and ca. 0.04%, respectively, has been examined.It h...

  3. Relationship between surface area and crystal size of pure and doped cerium oxides

    Institute of Scientific and Technical Information of China (English)

    C.; Bueno-Ferrer; S.; Parres-Esclapez; D.; Lozano-Castelló; A.; Bueno-López


    Pure and Zr, La or Pr-doped cerium oxides were characterised by transmission electron microscopy (TEM), N2 adsorption-desorption at -196 oC and X-ray diffraction (XRD). For crystal sizes calculation, the Scherrer and Williamson-Hall equations were compared, and the relationship between surface area and crystal size was critically discussed. It was demonstrated that the Williamson-Hall equation must be used instead of the Scherrer equation to calculate crystal sizes, since the latter equation underestimated ...

  4. Surface structures of cerium oxide nanocrystalline particles from the size dependence of the lattice parameters (United States)

    Tsunekawa, S.; Ito, S.; Kawazoe, Y.


    Cerium oxide nanocrystalline particles are synthesized and monodispersed in the size range from 2 to 8nm in diameter. The dependence of the lattice parameters on particle size is obtained by x-ray and electron diffraction analyses. The size dependence well coincides with the estimation based on the assumption that the surface is composed of one layer of Ce2O3 and the inside consists of CeO2. The effect of particle size on lattice parameters is discussed from the differences in the fabrication method and the surface structure.

  5. Performance of a Tungsten-Cerium Fluoride Sampling Calorimeter in High-Energy Electron Beam Tests

    CERN Document Server

    Becker, R; Dissertori, G; Djambazov, L; Donegà, M; Lustermann, W; Marini, A C; Nessi-Tedaldi, F; Pandolfi, F; Peruzzi, M; Schönenberger, M; Cavallari, F; Dafinei, I; Diemoz, M; Lope, C Jorda; Meridiani, P; Nuccetelli, M; Paramatti, R; Pellegrino, F; Micheli, F; Organtini, G; Rahatlou, S; Soffi, L; Brianza, L; Govoni, P; Martelli, A; de Fatis, T Tabarelli; Monti, V; Pastrone, N; Trapani, P P; Candelise, V; Della Ricca, G


    A prototype for a sampling calorimeter made out of cerium fluoride crystals interleaved with tungsten plates, and read out by wavelength-shifting fibres, has been exposed to beams of electrons with energies between 20 and 150 GeV, produced by the CERN Super Proton Synchrotron accelerator complex. The performance of the prototype is presented and compared to that of a Geant4 simulation of the apparatus. Particular emphasis is given to the response uniformity across the channel front face, and to the prototype's energy resolution.

  6. Preparation and electrochemical study of cerium-silica sol-gel thin films

    International Nuclear Information System (INIS)

    Design and development of suitable multilayered systems for delaying corrosion advance in metals requires that both the alteration mechanisms of the metal and the behaviour and properties of the protective coatings be known. Coatings prepared by the sol-gel method provide a good approach as protective layers on metallic surfaces. This kind of coatings can be prepared from pure chemical reagents at room temperature and atmospheric pressure, with compositions in a very wide range of environmentally non-aggressive precursors. Sol-gel coatings based on siloxane bonded units were prepared starting from an organic-inorganic hybrid system. The precursors were γ-methacryloxypropyltrimethoxysilane (MAP) and tetramethoxysilane (TMOS). Cerium nitrate hexahydrate in three different concentrations was added. Cerium salts may perform a similar protective effect to that carried out by the well-known lead oxides and chromium salts, even though in this case a negative environmental impact is not expected. Application of coatings upon pure zinc substrates and common glass slides were performed by spinning. Coated samples were heat treated at 40 deg. C for 6 days. Optical measurements (UV-Vis absorption and diffuse reflectance spectroscopies) pointed out that the coatings were colourless and transparent, reducing the diffuse reflectance of the metallic surface up to ∼60%. Optical and scanning electron microscopies (SEM) allowed observation of the texture and microstructure of the coated samples, both before and after the corrosion tests were carried out. Likewise, the remaining sols were kept to gelify at 60 deg. C for 4 days and then powdered to obtain suitable samples for analysing them by other characterisation techniques (Fourier transformed infrared, FTIR and differential thermal analysis, DTA). Electrochemical measurements were performed by impedance spectroscopy. This technique was used to clarify the anticorrosive protection role of cerium ions incorporated into the hybrid

  7. Sequence-specific Hydrolysis of Single-stranded DNA by PNA-Cerium (Ⅳ) Adduct

    Institute of Scientific and Technical Information of China (English)

    He Bai SHEN; Feng WANG; Yong Tao YANG


    A novel artificial site specific cleavage reagent, with peptide nucleic acid (PNA) as sequence-recognizing moiety and cerium (Ⅳ) ions as "scissors" for cleaving target DNA, was synthesized. Subsequently, it was employed in the cleavage of target 26-mer single-stranded DNA (ssDNA), which has 10-mer sequence complementary with PNA recognizer in the hybrids,under physiological conditions. Reversed-phase high-performance liquid chromatogram (RPHPLC) experiments indicated that the artificial site specific cleavage reagent could cleave the target DNA specifically.

  8. β Coronae Bolealis: Lithium and Cerium Contribution to the Blend at 6708 Å (United States)

    Drake, N. A.; Hubrig, S.; Polosukhina, N. S.; de La Reza, R.


    We analyze the Li I 6708 Å spectral region of the chemically peculiar Ap star βCrB using high resolution, high signal-to-noise spectra obtained at different rotation phases. Our study shows that the Ce II line at 6708.099 Å is a main contributor to the spectral feature at 6708 Å. This fact explains the observed red shift of the Li I doublet of about 0.2 Å found by Hack et al. (1997). We derive the values of lithium and cerium abundances for different rotation phases and show that βCrB has ``cosmic'' Li abundance.

  9. Kinetic spectrophotometric method for the determination of cerium(Ⅳ) with naphthol green B

    Institute of Scientific and Technical Information of China (English)

    LIU Yuying; WANG Ping


    A simple and sensitive spectrophotometric method was described for the determination of cerium(Ⅳ) based on its catalytic effect on the oxidation of naphthol green B by potassium periodate in the medium of sulfuric acid. The influences of acidity, concentration of reactants, reaction time, reaction temperature, and foreign ions were discussed, and the optimum reaction conditions were established. The reaction was monitored spectrophotometrically by measuring the decrease in absorbance of naphthol green B at 710 nm after a fixed time (8 min). The separation. Recovery experiments were also performed, and the recovery was between 95.7%-111.0%.

  10. UV-Shielding and Catalytic Characteristics of Nanoscale Zinc-Cerium Oxides

    Institute of Scientific and Technical Information of China (English)


    Fine particles of zinc-cerium oxides (ZCO) used as an ultraviolet filter were prepared via combustion synthesis route. The catalytic activity, UV-shielding performance, surface modification and application of ZCO in polyester varnish were discussed in detail. The experimental results indicate that the photo-catalytic activity of ZCO is much smaller than these of ZnO and TiO2; the oxidation catalytic activity of ZCO is far lower than that of CeO2; the ZCO has shown excellent ultraviolet absorption in the range of UV;addition modified ZCO (MZCO) into polyester will enhance the UV-shielding capability of polyester.

  11. Characterization of microstructure and catalytic of cerium oxide obtained by colloidal solution; Caracterizacao da microestrutura e da atividade catalitica de oxido de cerio obtido por solucao coloidal

    Energy Technology Data Exchange (ETDEWEB)

    Senisse, C.A.L.; Bergmann, C.P.; Alves, A.K., E-mail: [Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alege, RS (Brazil). Lab. de Materiais Ceramicos


    This study investigated to obtain particles of cerium oxide, for use as catalysts for the combustion of methane using the technique of through polymeric colloidal solution. Obtaining the colloidal system is based on hydrolysis of salts such as cerium acetylacetonate, cerium nitrate in the presence of additives such as polyvinylbutyral (PVB), polyvinylpyrrolidone (PVP) and polyvinyl acetate (PVA), at concentrations of 5, 10 and 15% in aqueous or alcoholic medium. These solutions containing ions of interest were subjected to a heat treatment at 650° C for 30 minutes, with heating rate of 2 ° C/ min. After heat treatment, the fibers were characterized according to their morphology, surface area, crystallinity, weight loss and catalytic activity. Samples obtained from cerium acetylacetonate were more reactive than the cerium nitrate to the combustion of methane, as showed greater conversions and higher temperatures reached during the process, which is of utmost importance since the combustion catalytic methane is used for generating thermal energy. After the reaction with methane, the samples underwent significant change in surface area, probably due to the intensity of combustion reactions of the nitrate and the generation of heat involved in this reaction, which gave rise to coarse particles. During the combustion process using the obtained from particles of cerium acetylacetonate, there was the release of large quantities of nitrogen compared to the results of assays with the particles obtained with cerium nitrate. (author)

  12. Effect of cerium on structure modifications of a hybrid sol–gel coating, its mechanical properties and anti-corrosion behavior

    Energy Technology Data Exchange (ETDEWEB)

    Cambon, Jean-Baptiste, E-mail: [Institut Carnot CIRIMAT, Université de Toulouse, UMR CNRS 5085, 118 Route de Narbonne, 31062 Toulouse Cedex 9 (France); Esteban, Julien; Ansart, Florence; Bonino, Jean-Pierre; Turq, Viviane [Institut Carnot CIRIMAT, Université de Toulouse, UMR CNRS 5085, 118 Route de Narbonne, 31062 Toulouse Cedex 9 (France); Santagneli, S.H.; Santilli, C.V.; Pulcinelli, S.H. [Departamento Fısico-Química, Instituto de Química, Universidade Estadual Paulista, UNESP, CP 355, 14801-970 Araraquara, SP (Brazil)


    Highlights: ► New sol–gel routes to replace chromates for corrosion protection of aluminum. ► Effect of cerium concentration on the microstructure of xerogel. ► Electrochemical and mechanical performances of hybrid coating with different cerium contents. ► Good correlation between the different results with an optimal cerium content of 0.01 M. -- Abstract: An organic–inorganic hybrid coating was developed to improve the corrosion resistance of the aluminum alloy AA 2024-T3. Organic and inorganic coatings derived from glycidoxypropyl-trimethoxysilane (GPTMS) and aluminum tri-sec-butoxide Al(O{sup s}Bu){sub 3}, with different cerium contents, were deposited onto aluminum by dip-coating process. Corrosion resistance and mechanical properties were investigated by electrochemical impedance measurements and nano-indentation respectively. An optimal cerium concentration of 0.01 M was evidenced. To correlate and explain the hybrid coating performances in relation to the cerium content, NMR experiments were performed. It has been shown that when the cerium concentration in the hybrid is higher than 0.01 M there are important modifications in the hybrid structure that account for the mechanical properties and anti-corrosion behavior of the sol–gel coating.

  13. Effects of cerium oxide supplementation to laying hen diets on performance, egg quality, some antioxidant enzymes in serum and lipid oxidation in egg yolk. (United States)

    Bölükbaşı, S C; Al-Sagan, A A; Ürüşan, H; Erhan, M K; Durmuş, O; Kurt, N


    This study was conducted to determine the effects of dietary cerium oxide levels (0, 100, 200, 300 or 400 mg/kg) on the laying performance, egg quality, some blood serum parameters and egg lipid peroxidation of laying hen. In total, one hundred and twenty 22-week-old brown Lohman LSL laying hens were randomly assigned to five groups equally (n = 24). Each treatment was replicated six times. Dietary supplementation of cerium oxide had no significant effect on feed intake and egg weight. The addition of cerium oxide to the laying hens' feed improved feed conversion ratio and increased (p laying hens feed led to a significant (p hen diets. It was also observed that serum superoxide dismutase (SOD) activity and malondialdehyde (MDA) concentration decreased significantly with supplementation of cerium oxide in diets. Inclusion of cerium oxide resulted in a significant reduction in thiobarbituric acid reactive substance (TBARS) values in egg yolk in this study. It can be concluded that the addition of cerium oxide had positive effects on egg production, feed conversion ratio and egg shelf life. Based on the results of this study, it could be advised to supplement laying hens feed with cerium oxide as feed additives. PMID:26847677

  14. The evolution mechanism of the dislocation loops in irradiated lanthanum doped cerium oxide

    Energy Technology Data Exchange (ETDEWEB)

    Miao, Yinbin, E-mail: [Department of Nuclear, Plasma and Radiological Engineering, University of Illinois at Urbana-Champaign, IL 61801 (United States); Aidhy, Dilpuneet [Materials Science and Technology Division, Oak Ridge National Laboratory, TN 37831 (United States); Chen, Wei-Ying; Mo, Kun; Oaks, Aaron [Department of Nuclear, Plasma and Radiological Engineering, University of Illinois at Urbana-Champaign, IL 61801 (United States); Wolf, Dieter [Material Science Division, Argonne National Laboratory, IL 60439 (United States); Stubbins, James F. [Department of Nuclear, Plasma and Radiological Engineering, University of Illinois at Urbana-Champaign, IL 61801 (United States)


    Cerium dioxide, a non-radioactive surrogate of uranium dioxide, is useful for simulating the radiation responses of uranium dioxide and mixed oxide fuel (MOX). Controlled additions of lanthanum can also be used to form various levels of lattice oxide or anion vacancies. In previous transmission electron microscopy (TEM) experimental studies, the growth rate of dislocation loops in irradiated lanthanum doped ceria was reported to vary with lanthanum concentration. This work reports findings of the evolution mechanisms of the dislocation loops in cerium oxide with and without lanthanum dopants based on a combination of molecular statics and molecular dynamics simulations. These dislocation loops are found to be b=1/3〈111〉 interstitial type Frank loops. Calculations of the defect energy profiles of the dislocation loops with different structural configurations and radii reveal the basis for preference of nucleation as well as the driving force of growth. Frenkel pair evolution simulations and displacement cascade overlaps simulations were conducted for a variety of lanthanum doping conditions. The nucleation and growth processes of the Frank loop were found to be controlled by the mobility of cation interstitials, which is significantly influenced by the lanthanum doping concentration. Competition mechanisms coupled with the mobility of cation point defects were discovered, and can be used to explain the lanthanum effects observed in experiments.

  15. The evolution mechanism of the dislocation loops in irradiated lanthanum doped cerium oxide (United States)

    Miao, Yinbin; Aidhy, Dilpuneet; Chen, Wei-Ying; Mo, Kun; Oaks, Aaron; Wolf, Dieter; Stubbins, James F.


    Cerium dioxide, a non-radioactive surrogate of uranium dioxide, is useful for simulating the radiation responses of uranium dioxide and mixed oxide fuel (MOX). Controlled additions of lanthanum can also be used to form various levels of lattice oxide or anion vacancies. In previous transmission electron microscopy (TEM) experimental studies, the growth rate of dislocation loops in irradiated lanthanum doped ceria was reported to vary with lanthanum concentration. This work reports findings of the evolution mechanisms of the dislocation loops in cerium oxide with and without lanthanum dopants based on a combination of molecular statics and molecular dynamics simulations. These dislocation loops are found to be b = 1 / 3 interstitial type Frank loops. Calculations of the defect energy profiles of the dislocation loops with different structural configurations and radii reveal the basis for preference of nucleation as well as the driving force of growth. Frenkel pair evolution simulations and displacement cascade overlaps simulations were conducted for a variety of lanthanum doping conditions. The nucleation and growth processes of the Frank loop were found to be controlled by the mobility of cation interstitials, which is significantly influenced by the lanthanum doping concentration. Competition mechanisms coupled with the mobility of cation point defects were discovered, and can be used to explain the lanthanum effects observed in experiments.

  16. FT-IR Studies of Cerium Oxide Nanoparticles and Natural Zeolite Materials

    Directory of Open Access Journals (Sweden)

    Oana Lelia Pop


    Full Text Available An emerging topic of our days is nanoscience and nanotechnology successfully applied in the food industry. Characteristics such as size, surface area and morphology can modify the basic properties and the chemical reactivity of the nanomaterials. The breakthrough of innovative materials, processes, and phenomena at the nanoscale, as well as the progress of new experimental and theoretical techniques for research, supply novel opportunities for the expansion of original nanosystems and nanostructured materials. These study examine two types of nanoparticles, namely cerium oxide nanoparticles (CeO2 NP and natural zeolites. In view of the importance of CeO2 NP in various biological applications, the primary objective of this study is to characterise four samples of CeO2 NP in order to understand the role of the synthesis process in the final product. Nanocrystalline natural zeolites are materials with interesting properties which allows them to be used as adjuvant in many therapies. The characterisation of CeO2 NP and two types of natural zeolites using Fourier Transform Infrared (FT-IR spectroscopy is described. Therefore, this study examined two types of nanomaterials, namely cerium oxide nanoparticles and zeolites, for further applications on microorganisms and living cells.

  17. Elasticity of cerium up to 4.4 GPa by sound velocity measurements under hydrostatic pressure

    International Nuclear Information System (INIS)

    We report here the longitudinal and shear sound velocities on polycrystalline cerium under hydrostatic pressure across the iso-structural γ-α phase transition up to 4.4 GPa. Comparing with previous methods, the pressure-density relation of Ce has been calculated by integrating with the initial travel time and pressure without any fitting. The pressure correction of the Grüneisen parameter and linear expansion coefficient are taken into account during the integration process. The sound velocities, bulk modulus, shear modulus, Debye temperature, and vibrational entropy are achieved and have been compared with previous results. The bulk modulus of cerium in α phase agrees with the previous results determined by neutron and x-ray diffraction. The Debye temperature above and below the phase transition are θDγ=130.9 K and θDα=151.9 K, respectively. The difference of the Debye temperature from respective experiment is found and has been expounded. We consider that the vibrational entropy change per atom of 0.44 k B as the Kondo collapse of 17% volume change, and 0.70 k B as the total change from γ phase to complete α phase. (papers)

  18. Dielectric properties and electronic transitions of porous and nanostructured cerium oxide films

    International Nuclear Information System (INIS)

    Cerium dioxide (CeO2) exhibits exceptional electronic properties such as optical transparency and high refractive index (n) and high dc dielectric constant (k). Therefore, it is an attractive material for ultra-thin gate oxide in CMOS technology, where high-k dielectrics are required. We study the electronic properties of nanostructured and porous cerium oxide (CeOx) films, 110-500 nm thick, grown on Si by electron beam evaporation (EBE) and ion beam assisted deposition (IBAD). The film microstructure and morphology (grain size, porosity, defect concentration, surface and interface roughness) are controlled by varying the process parameters appropriately. They have been studied by high-resolution and transmission electron microscopy (HRTEM). The optical properties have been studied by spectroscopic ellipsometry (SE) and k was determined by capacitance measurements. We have found that the values of k and n (1.6-2.5 depending on porosity) are affected by the electronic transitions, which are strongly correlated with the microstructure and morphology of the films. We investigate how the microstructure and morphology variations affect the absolute values of the dc dielectric constant and of the dielectric function at the UV-Vis and IR spectral regions. In addition, we investigate the very important role of the defects, which have the form of grain boundaries, trivalent Ce3+ and O vacancies. As a result we were able to tailor n and k of CeOx films controlling their porosity and defect density

  19. Cerium relieving the inhibition of photosynthesis and growth of spinach caused by lead

    Institute of Scientific and Technical Information of China (English)

    ZHOU Min; ZE Yuguan; LI Na; DUAN Yanmei; CHEN Ting; LIU Chao; HONG Fashui


    Chloroplasts were isolated from spinach cultured in lead chloride-present, Ce~(3+)-administered, cerium chloride-administered lead chloride-present Hoagland's media or that of Hoagland's media. The experimental study demonstrated the effects of cerium (Ce) on distribu-tion of light energy and photochemical activities of spinach chloroplast grown in lead (Pb)-present media. It was observed that Pb~(2+) signifi-cantly inhibited photosynthesis in spinach, including light absorption, energy transfer from LHCII to photosystem II, excitation energy dis-tribution from photosystem I to photosystem II, and transformation from light energy to electron energy and oxygen evolution of chloroplasts,and decreased spinach growth. However, Ce~(3+) treatment to pb~(2+)-present chloroplasts could obviously improve light absorption and excitation energy distribution in both photosystems and increase activity of photochemical reaction and oxygen evolution of chloroplasts. The results suggested that Ce~(3+) under Pb~(2+) stress could maintain the stability of chloroplast membrane, and improve photosynthesis of spinach chloro-plast, thus promote spinach growth.

  20. Cerium relieving the inhibition of photosynthesis and growth of spinach caused by lead

    Institute of Scientific and Technical Information of China (English)

    ZHOU; Min


    Chloroplasts were isolated from spinach cultured in lead chloride-present, Ce3+-administered, cerium chloride-administered lead chloride-present Hoagland's media or that of Hoagland's media. The experimental study demonstrated the effects of cerium (Ce) on distribu-tion of light energy and photochemical activities of spinach chloroplast grown in lead (Pb)-present media. It was observed that Pb2+ signifi-cantly inhibited photosynthesis in spinach, including light absorption, energy transfer from LHCII to photosystem II, excitation energy dis-tribution from photosystem I to photosystem II, and transformation from light energy to electron energy and oxygen evolution of chloroplasts,and decreased spinach growth. However, Ce3+ treatment to pb2+-present chloroplasts could obviously improve light absorption and excitation energy distribution in both photosystems and increase activity of photochemical reaction and oxygen evolution of chloroplasts. The results suggested that Ce3+ under Pb2+ stress could maintain the stability of chloroplast membrane, and improve photosynthesis of spinach chloro-plast, thus promote spinach growth.

  1. Complete Oxidation of Methane over Palladium Supported on Alumina Modified with Calcium, Lanthanum, and Cerium Ions

    Institute of Scientific and Technical Information of China (English)

    Beata Stasinska; Wojciech Gac; Theophilos Ioannides; Andrzej Machocki


    The activity and thermal stability of Pd/Al2O3 and Pd/(Al2O3+MOx) (M=Ca, La, Ce) palladium catalysts in the reaction of complete oxidation of methane are presented in this study. The catalyst supports were prepared by sol-gel method and they were dried either conventionally or with supercritical carbon dioxide. Then they were impregnated with palladium nitrate solution. The catalysts with unmodified alumina had a high surface area. The activity and thermal stability of the alumina-supported catalyst was also very high. The introduction of calcium, lanthanum, or cerium oxide into alumina support caused a decrease of the surface area in the way dependent on the support precursor drying method. These modifiers decreased the activity of palladium catalysts, and they required higher temperatures for the complete oxidation of methane than unmodified Pd/Al2O3. The improvement of the palladium activity by lanthanum and cerium support modifier was observed only at low temperatures of the reaction.

  2. Growth of monodisperse nanocrystals of cerium oxide during synthesis and annealing

    Energy Technology Data Exchange (ETDEWEB)

    Ghosh, Swapankumar, E-mail:; Divya, Damodaran [National Institute for Interdisciplinary Science and Technology (NIIST), Council of Scientific and Industrial Research (CSIR) (India); Remani, Kottayilpadi C. [Sree Neelakanda Government Sanskrit College, Department of Chemistry (India); Sreeremya, Thadathil S. [National Institute for Interdisciplinary Science and Technology (NIIST), Council of Scientific and Industrial Research (CSIR) (India)


    Monodisperse cerium oxide nanocrystals have been successfully synthesised using simple ammonia precipitation technique from cerium(III) nitrate solution at different temperatures in the range 35-80 {sup o}C. The activation energy for growth of CeO{sub 2} nanocrystals during the precipitation is calculated as 11.54 kJ/mol using Arrhenius plot. Average crystal diameter was obtained from XRD analysis, HR-TEM and light scattering (PCS). The analysis of size data from HR-TEM images and PCS clearly indicated the formation of highly crystalline CeO{sub 2} particles in narrow size range. CeO{sub 2} nanocrystals precipitated at 35 {sup o}C were further annealed at temperatures in the range 300-700 {sup o}C. The activation energy for crystal growth during annealing is also calculated and is close to the reported values. An effort is made to predict the mechanism of crystal growth during the precipitation and annealing.

  3. Lanthanum, cerium, praseodymium, and neodymium metals and their interaction with oxygen studied by photoelectron spectroscopy

    International Nuclear Information System (INIS)

    Clean films of La, Ce, Pr, and Nd, prepared by in situ evaporation have been investigated by photoelectron spectroscopy. Different light sources He I (hv = 21.2 eV), He II (hv = 40.8 eV) and Mg Kα (hv = 1253.6 eV) have been used for the electron excitation in order to characterize the metals. Measurements have been performed after exposing the clean metals to various amounts of oxygen. From the vanishing of the emission from the sd conduction band upon exposure the conclusion is drawn that an oxide layer thicker than the probing depth (20 A) is formed on all four metals and that the oxide (at room temperature) has the form: Me2O3, Me=La, Ce, Pr, Nd. The tetravalent cerium oxide is obtained when the film is heated to about 6000C during oxygen exposure. The interaction with oxygen is also characterized by recording the oxygen 1s level and some metal core levels (Me 3d, 4d and 4p). The results from the pure metals and from the metal oxides give further experimental evidence for a 4f level binding energy of 1.9 eV in γ-cerium. (Auth.)

  4. Visible Light Induced Photocatalysis of Cerium Ion Modified Titania Sol and Nanocrystallites

    Institute of Scientific and Technical Information of China (English)

    Yibing XIE; Chunwei YUAN


    The cerium ion(Ce4+) doped titania sol and nanocrystallites were prepared by chemical coprecipitation-peptization and hydrothermal synthesis methods, respectively. The X-ray diffraction pattern shows that Ce4+-TiO2 xerogel powder has semicrystalline structure and thermal sintering sample has crystalline structure. Ce4+-TiO2 nanocrystallites are composed of the major anatase phase titania (88.82 wt pct) and a small amount of crystalline cerium titanate.AFM micrograph shows that primary particle size of well-dispersed ultrafine sol particles is below 15 nm in diameter.The particle sizes are 30 nm for xerogel sample and 70 nm for nanocrystallites sample, which is different from the estimated values (2.41 nm and 4.53 nm) by XRD Scherrer's formula. The difference is mainly due to aggregation of nanocrystallites. The experimental results exhibit that photocatalysts of Ce4+-TiO2 sol and nanocrystallites have the ability to photodegrade reactive brilliant red dye (X-3B) under visible light irradiation with the ion-TiO2/VIS/dye system. Moreover, Ce4+ doped titania sol has shown higher efficiency than the nanocrystallites sample in respect of potocatalytic activity. Meanwhile, dye photodegradation mechanisms are proposed to different photocatalytic reaction systems, which are dye photosensitization, ion-dye photosensitization and interband photocatalysis & dye photosensitization with respect to TiO2 nanocrystallites, Ce4+-TiO2 sol and Ce4+-TiO2 nanocrystallites system.

  5. Effects of different valences of cerium ion on conformation of Horseradish Peroxidase

    Institute of Scientific and Technical Information of China (English)

    XIANG Li; GE Zhiqiang


    Our previous studies demonstrated that Ce4+ could induce reactive oxygen species (ROS) burst as a signal to promote pacilitaxel biosynthesis in suspension cultured Taxus cuspidate cells. To further understand the mechanism of cerium ions inducing ROS burst, circular dichroism (CD), synchronous fluorescence, and electron paramagnetic resonance (EPR) were used to detect them inducing conforma-tional change of horseradish peroxidase (HRF). Horseradish peroxidase activity was reduced by 78% by 0.1 mmol/L Ce4+, whereas it was only reduced by 28% by 0.1 mmol/L Ce3+. Circular dichroism spectra showed that the percentage of transition from helical content and other structure to βstrands andβturns was 23.1 when induced by Ce4+, whereas it was only 13.2 when induced by Ce3+. In synchronous fluorescence spectra, Ce4+ led to red shift and intensity-elevation of tryptophan fluorescence emission maximum, whereas in the case of Ce3+, the results were a contrast to the above. Furthermore, g factor (gx and gy) in electron paramagnetic resonance (EPR) induced by Ce4+ and Ce3+ was significantly different. These results indicated that the different valence of cerium ion induced various conformations of HRP, and Ce4+ was more effective than Ce3+. This suggested that Ce4+ affected the burst of ROS through changing the conformation of oxidoreductase.

  6. Cerium-zinc redox flow battery: Positive half-cell electrolyte studies

    Institute of Scientific and Technical Information of China (English)

    XIE Zhipeng; ZHOU Debi; XIONG Fengjiao; ZHANG Shimin; HUANG Kelong


    Experimental work was performed to evaluate the Ce3+/Ce4+ redox couple in methane sulfonic acid (MSA) electrolyte for use in redox flow battery (RFB) technology. The electrochemical behaviour of the Ce3+/Ce4+ in MSA media was investigated using cyclic voltammetry, linear sweep voltammetry, chronoamperometry and rotating disc electrode. The standard rate constant of the Ce3+/Ce4+ redox reaction on graphite electrode in MSA was 4.06x10-4 cm/s. The diffusion coefficient of Ce3+ in MSA was 5.87-6.15x10-6 cm2/s, and was 2.56-2.68x 10-6 cm2/s for Ce4+. The energy efficiency of a cerium-zinc test cell was 74.8%. The high stability of cerium salts in MSA media and relatively fast redox kinetics of the Ce3+/Ce4+ redox reaction at graphite ectrode indicated that the Ce3+/Ce4+ might be well suited for use in RFB technology.

  7. Direct liquid injection chemical vapor deposition of platinum doped cerium oxide thin films

    International Nuclear Information System (INIS)

    Thin films of Pt-doped CeO2 were grown by direct liquid injection chemical vapor deposition on silicon wafer covered by native oxide at 400 °C using Ce(IV) alkoxide and organoplatinum(IV) as precursors. X-ray photoelectron spectra evidenced that the platinum oxidation state is linked to the deposition way. For platinum deposited on top of cerium oxide thin films previously grown, metallic platinum particles were obtained. Cerium and platinum codeposition allowed obtaining a Pt0 and Pt2+ mixture with the Pt2+ to Pt ratio strongly dependent on the platinum flow rate during the deposition. Indeed, the lower the platinum precursor flow rate is, the higher the Pt2+ to Pt ratio is. Moreover, surface and cross-sectional morphologies obtained by scanning electron microscopy evidenced porous layers in any case. - Highlights: • Pt-doped ceria were synthesized. • Films were obtained by direct liquid injection chemical vapor deposition. • Simultaneous deposition of Pt and Ce was used to obtain homogeneous films. • Pt2+ was revealed through X-ray photoelectron spectroscopy. • Different routes were used to exalt Pt2+/Pt ratio

  8. Magnetic studies of GaN nanoceramics doped with 1% of cerium

    Institute of Scientific and Technical Information of China (English)

    K. Oganisian; P. Gluchowski; W. Strek


    The magnetization measurements of gallium intride nanoceramics doped with 1% of cerium and sintered under various pressures were reported.It was found that GaN nanoceramics doped with cerium showed paramagnetic behavior in the wide temperature range.Nanoceramics of GaN with 1% of Ce (as undoped GaN) was diamagnetic one,but under certain temperature the paramagnetic properties started to dominate.This crossover temperature was nonlinearly dependent on the pressure applied during the sintering.The fitting of molar magnetic susceptibility allowed to estimate the Curie temperature,Curie constant and diamagnetic part of susceptibility.As it was found,all the samples showed the antiferromagnetic ordering with θp≈-1 K.Also,the effective magnetic moment was estimated for all of the samples.As a result,magnetic moments in terms of Ce ion were notably larger in comparison with those obtained within the Russell-Saunders coupling model.We suggested that it was the strong influence of amorphous shell which was rising with the pressure applied during the sintering.Finally,we presented dependences of magnetization as a function of applied field.All the samples manifested weak ferromagnetism at high temperatures and paramagnetic behavior in low temperature region.

  9. [XPS study on the influence of calcination conditions to cerium ion valence]. (United States)

    Mei, Yan; Yan, Jian-ping; Nie, Zuo-ren


    For the system of Ce(NO3)2.6H2O and urea solution during homogeneous precipitation method, X-ray diffraction (XRD), infrared spectrum (IR) and especially X-ray photoelectron spectroscopy (XPS) were used to study and characterize the product structure, variety of cerium ion valence, compound surface character and kernel electronic configurations. The results of XRD and IR showed that calcination temperature had a great effect on the cerium ion valence. The products are orthorhombic Ce2 O(CO3)2.H2O with valence III by using homogeneous precipitation method directly. When heated from the temperature 200 degrees C to 250 degrees C, the product of CeO(CO3)2.H2O with valence VI was finally changed into stable CeO2 with valence IV. XPS was used to study the surface character and kernel electronic configurations of the three different compounds through fine scanning of O(1s), Ce(3d) and Ce(4d) apices, and the results approved that the compounds with different valences are caused by the different valence electronic configurations of the products.

  10. Cerium oxide nanoparticles stimulate proliferation of primary mouse embryonic fibroblasts in vitro. (United States)

    Popov, Anton L; Popova, Nelly R; Selezneva, Irina I; Akkizov, Azamat Y; Ivanov, Vladimir K


    The increasing application of cell therapy technologies in the treatment of various diseases requires the development of new effective methods for culturing primary cells. The major limitation for the efficient use of autologous cell material is the low rate of cell proliferation. Successful cell therapy requires sufficient amounts of cell material over a short period of time with the preservation of their differentiation and proliferative potential. In this regard, the development of novel, highly efficient stimulators of proliferative activity in stem cells is a truly urgent task. In this paper we have demonstrated that citrate-stabilized cerium oxide nanoparticles (nanoceria) enhance the proliferative activity of primary mouse embryonic fibroblasts in vitro. Cerium oxide nanoparticles stimulate cell proliferation in a wide range of concentrations (10(-3)М-10(-9)M) through reduction of intracellular levels of reactive oxygen species (ROS) during the lag phase of cell growth and by modulating the expression level of the major antioxidant enzymes. We found the optimal concentration of nanoceria, which provides the greatest acceleration of cell proliferation in vitro, while maintaining the levels of intracellular ROS and mRNA of antioxidant enzymes in the physiological range. Our results confirm that nanocrystalline ceria can be considered as a basis for effective and inexpensive supplements in cell culturing. PMID:27524035

  11. Direct liquid injection chemical vapor deposition of platinum doped cerium oxide thin films

    Energy Technology Data Exchange (ETDEWEB)

    Zanfoni, N.; Avril, L.; Imhoff, L.; Domenichini, B., E-mail:; Bourgeois, S.


    Thin films of Pt-doped CeO{sub 2} were grown by direct liquid injection chemical vapor deposition on silicon wafer covered by native oxide at 400 °C using Ce(IV) alkoxide and organoplatinum(IV) as precursors. X-ray photoelectron spectra evidenced that the platinum oxidation state is linked to the deposition way. For platinum deposited on top of cerium oxide thin films previously grown, metallic platinum particles were obtained. Cerium and platinum codeposition allowed obtaining a Pt{sup 0} and Pt{sup 2+} mixture with the Pt{sup 2+} to Pt ratio strongly dependent on the platinum flow rate during the deposition. Indeed, the lower the platinum precursor flow rate is, the higher the Pt{sup 2+} to Pt ratio is. Moreover, surface and cross-sectional morphologies obtained by scanning electron microscopy evidenced porous layers in any case. - Highlights: • Pt-doped ceria were synthesized. • Films were obtained by direct liquid injection chemical vapor deposition. • Simultaneous deposition of Pt and Ce was used to obtain homogeneous films. • Pt{sup 2+} was revealed through X-ray photoelectron spectroscopy. • Different routes were used to exalt Pt{sup 2+}/Pt ratio.

  12. Kinetics of Cerium(IV) Extraction from H(2)SO(4)-HF Medium with Cyanex 923. (United States)

    Liao, Wuping; Yu, Guihong; Yue, Shantang; Li, Deqian


    Studies of the extraction kinetics of cerium(IV) from H(2)SO(4)-HF solutions with Cyanex 923 in n-heptane have been carried out using a constant interfacial area cell with laminar flow. The experimental hydrodynamic conditions were chosen so that the contribution of diffusion to the measured rate of reaction was minimized. The data were analyzed in terms of pseudo-first order constants. The results were compared with those of the system without HF. It was concluded that the addition of HF reduces the activation energy for the forward rate from 46.2 to 36.5 kJ mol(-1) while it has an opposite effect on the activation energy for the reverse process(the activation energy increased from 23.3 to 90.8 kJ mol(-1)). Thus, HF can accelerate the rate of cerium(IV) extraction. At the same time, the extraction rate is controlled by a mixed chemical reaction-diffusion rather than by a chemical reaction alone. A rate equation has also been obtained.

  13. Custom cerium oxide nanoparticles protect against a free radical mediated autoimmune degenerative disease in the brain. (United States)

    Heckman, Karin L; DeCoteau, William; Estevez, Ana; Reed, Kenneth J; Costanzo, Wendi; Sanford, David; Leiter, James C; Clauss, Jennifer; Knapp, Kylie; Gomez, Carlos; Mullen, Patrick; Rathbun, Elle; Prime, Kelly; Marini, Jessica; Patchefsky, Jamie; Patchefsky, Arthur S; Hailstone, Richard K; Erlichman, Joseph S


    Cerium oxide nanoparticles are potent antioxidants, based on their ability to either donate or receive electrons as they alternate between the +3 and +4 valence states. The dual oxidation state of ceria has made it an ideal catalyst in industrial applications, and more recently, nanoceria's efficacy in neutralizing biologically generated free radicals has been explored in biological applications. Here, we report the in vivo characteristics of custom-synthesized cerium oxide nanoparticles (CeNPs) in an animal model of immunological and free-radical mediated oxidative injury leading to neurodegenerative disease. The CeNPs are 2.9 nm in diameter, monodispersed and have a -23.5 mV zeta potential when stabilized with citrate/EDTA. This stabilizer coating resists being 'washed' off in physiological salt solutions, and the CeNPs remain monodispersed for long durations in high ionic strength saline. The plasma half-life of the CeNPs is ∼4.0 h, far longer than previously described, stabilized ceria nanoparticles. When administered intravenously to mice, the CeNPs were well tolerated and taken up by the liver and spleen much less than previous nanoceria formulations. The CeNPs were also able to penetrate the brain, reduce reactive oxygen species levels, and alleviate clinical symptoms and motor deficits in mice with a murine model of multiple sclerosis. Thus, CeNPs may be useful in mitigating tissue damage arising from free radical accumulation in biological systems.

  14. Self-healing Performance of Composite Coatings Prepared by Phosphating and Cerium Nitrate Post-sealing

    Institute of Scientific and Technical Information of China (English)

    LIN Bilan; LU Jintang


    The phosphated and cerium nitrate post-sealed galvanized steel was ifrstly scratched to expose zinc layer and then placed in neutral salt spray (NSS) chamber for different durations. The microstructure and compositions of the scratches were investigated using SEM and EDS. The phases of the corrosion products were examined through XRD. The self-healing mechanism of the composite coatings was discussed. The experimental results show that the composite coatings have an excellent corrosion resistance. The corrosion products increase with corrosion time and ifnally cover the whole scratch. They contain phosphorous, cerium, oxygen, chloride and zinc, and are ifne needle and exceedingly compact. The composite coatings are favorable self-healing. During corrosion, the self-healing ions such as Ce3+, Ce4+, PO43-, Zn2+ in the composite coatings were dissolved, migrated, recombined, and covered the exposed zinc, impeding zinc corrosion. The self-healing process of the scratches on the composite coatings can be divided into three stages, about 2 h, 4 h, and 24 h, respectively.

  15. MicroRNA-148b enhances the radiosensitivity of non-Hodgkin's lymphoma cells by promoting radiation-induced apoptosis

    International Nuclear Information System (INIS)

    Growing evidence has demonstrated that microRNAs (miRNAs) play an important role in regulating cellular radiosensitivity. This study aimed to explore the role of miRNAs in non-Hodgkin's lymphoma (NHL) radiosensitivity. Microarray was employed to compare the miRNA expression profiles in B cell lymphoma cell line Raji before and after a 2-Gy dose of radiation. A total of 20 differentially expressed miRNAs were identified including 10 up-regulated and 10 down-regulated (defined as P <0.05). Among the differentially expressed miRNAs, miR-148b was up-regulated 1.53-fold in response to radiation treatment. A quantitative real-time polymerase chain reaction (PCR) assay confirmed the up-regulation of miR-148b after radiation. Transient transfection experiments showed that miR-148b was up-regulated by miR-148b mimic and down-regulated by miR-148b inhibitor in the Raji cells. A proliferation assay showed that miR-148b could inhibit the proliferation of Raji cells before and after radiation. A clonogenic assay demonstrated that miR-148b sensitized Raji cells to radiotherapy. MiR-148b did not affect the cell cycle profile of post-radiation Raji cells compared with controls. An apoptosis assay showed that miR-148b enhanced apoptosis of Raji cells after irradiation. Taken together, these results demonstrate that miR-148b increased the radiosensitivity of NHL cells probably by promoting radiation-induced apoptosis, which suggests that miR-148b plays an important role in the response of NHL to ionizing radiation. (author)

  16. 26 CFR 1.148-5A - Yield and valuation of investments. (United States)


    ... Section 1.148-5A Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Regulations Applicable to Certain Bonds Sold Prior to July 8... value requirement for transferred proceeds allocations, universal cap allocations, and commingled...

  17. 42 CFR 84.148 - Type C supplied-air respirator, continuous flow class; minimum requirements. (United States)


    ... 42 Public Health 1 2010-10-01 2010-10-01 false Type C supplied-air respirator, continuous flow... RESPIRATORY PROTECTIVE DEVICES Supplied-Air Respirators § 84.148 Type C supplied-air respirator, continuous flow class; minimum requirements. (a) Respirators tested under this section shall be approved only...

  18. Stellar neutron capture rates of sup(148,149,150)Sm

    International Nuclear Information System (INIS)

    We have measured to a precision of proportional 4.5% the neutron capture cross sections of sup(148,149,150)Sm over the neutron energy range 4147Nd and sup(147,148)Pm, are used to establish a set of Maxwellian-averaged cross section useful for investigation of the element synthesis in the s-process around Aproportional150. The ratio of the values of the s-process current anti sigmasub(γ)Nsub(s) (Maxwellian-averaged neutron cross section times s-process abundance) for the s-only isotopes sup(148,150)Sm is 0.91+-0.03, rather than unity as predicted by the local approximation. We interpret this result as due to an s-process branching which partly bypasses 148Sm. Since the beta decay rates at the branching points are expected to be almost independent of temperature, we are able to obtain an estimate of the s-process neutron density of nsub(n)=(1.0+-0.4)x108 cm-3. The new results have also served to considerably improve the anti sigmasub(γ)Nsub(s)-systematics in the mass region 145< A<150. (orig.)

  19. 19 CFR 148.32 - Vehicles, aircraft, boats, teams and saddle horses taken abroad. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Vehicles, aircraft, boats, teams and saddle horses... for Returning Residents § 148.32 Vehicles, aircraft, boats, teams and saddle horses taken abroad. (a) Admission free of duty. Automobiles and other vehicles, aircraft, boats, teams and saddle horses,...

  20. 26 CFR 1.148-6 - General allocation and accounting rules. (United States)


    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false General allocation and accounting rules. 1.148-6...-6 General allocation and accounting rules. (a) In general—(1) Reasonable accounting methods required... expenditures—(1) Expenditures in general—(i) General rule. Reasonable accounting methods for allocating...

  1. 21 CFR 146.148 - Reduced acid frozen concentrated orange juice. (United States)


    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Reduced acid frozen concentrated orange juice. 146... Canned Fruit Juices and Beverages § 146.148 Reduced acid frozen concentrated orange juice. (a) Reduced acid frozen concentrated orange juice is the food that complies with the requirements for...

  2. 19 CFR 148.89 - Property of public international organizations and foreign governments. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Property of public international organizations and... Personnel of Foreign Governments and International Organizations and Special Treatment for Returning Individuals § 148.89 Property of public international organizations and foreign governments. (a)...

  3. 7 CFR 457.148 - Fresh market pepper crop insurance provisions. (United States)


    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Fresh market pepper crop insurance provisions. 457.148... pepper crop insurance provisions. The fresh market pepper crop insurance provisions for the 1999 and... Fresh Market Pepper Crop Provisions If a conflict exists among the policy provisions, the order...

  4. 19 CFR 148.87 - Officers and employees of, and representatives to public international organizations. (United States)


    .... International Union for Conservation of Nature and Natural Resources—Limited privileges 12986 Jan. 18, 1996..., 1975. World Meteorological Organization 10676 Sept. 1, 1956. World Tourism Organization 12508 Mar. 22... affecting § 148.87, see the List of CFR Sections Affected, which appears in the Finding Aids section of...

  5. 26 CFR 1.148-5 - Yield and valuation of investments. (United States)


    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Yield and valuation of investments. 1.148-5...-5 Yield and valuation of investments. (a) In general. This section provides rules for computing the... to an issue is computed under the economic accrual method, using the same compounding interval...

  6. Corrosion behaviour of sol-gel coatings doped with cerium salts on 2024-T3 aluminum alloy

    Energy Technology Data Exchange (ETDEWEB)

    Shi Hongwei; Liu Fuchun [State Key Laboratory for Corrosion and Protection, Institute of Metal Research, Chinese Academy of Sciences, Shenyang 110016 (China); Han Enhou, E-mail: [State Key Laboratory for Corrosion and Protection, Institute of Metal Research, Chinese Academy of Sciences, Shenyang 110016 (China)


    The corrosion behaviour of the sol-gel coatings doped with cerium chloride or cerium nitrate on 2024-T3 aluminum alloy was investigated by using electrochemical impedance spectroscopy (EIS) and immersion tests. The sol-gel matrix was obtained through hydrolysis, condensation of 3-glycidoxypropyltrimethoxysilane (GPTMS) and tetramethoxysilane (TMOS), using diethylentriamine as curing agent. The results indicated that cerium nitrate with concentration of 1 x 10{sup -3} mol L{sup -1} in the silane solution was excellent on self-healing for the sol-gel coating, while cerium chloride had no obvious effect. This result suggested that the introduction of Cl{sup -} promoted the under-film pitting of 2024-T3 substrate. It was found that Ce(OH){sub 3} and Ce(OH){sub 2}{sup 2+} simultaneously existed in the silane solution by X-ray diffraction (XRD) analysis. Ce(OH){sub 2}{sup 2+} transformed to CeO{sub 2} due to high-temperature curing of sol-gel matrix demonstrated by X-ray photoelectron spectroscopy (XPS) analysis. Therefore, it can be considered that Ce(OH){sub 3} and CeO{sub 2} played inhibition roles in the corrosion process of the sol-gel coatings.

  7. Effect of cerium ion implantation on the oxidation behavior of zircaloy-4 at 500 degree sign C

    CERN Document Server

    Chen, X W; Yu, H R; Zhou, Q G; Chen, B S


    In order to investigate the oxidation behavior changes of zircaloy-4 induced by cerium ion implantation using a MEVVA source at an energy of 40 keV with a dose range from 1x10 sup 1 sup 6 to 1x10 sup 1 sup 7 ions/cm sup 2 at the maximum temperature of 130 degree sign C, weight gain curves of the different specimens including as-received zircaloy-4 and cerium-implanted zircaloy-4 were measured after oxidation in air at 500 degree sign C for 100 min. It was obviously found that a significant improvement was achieved in the oxidation behavior of cerium ion implanted zircaloy-4 compared with that of the as-received zircaloy-4. The depth profile of the element composition in the surface region of the samples was obtained by Auger electron spectroscopy, and the valence of the oxides in the scale was analyzed by X-ray photoemission spectroscopy. Glancing angle X-ray diffraction employed to examine the phase transformation in the oxide films showed that the addition of cerium transformed the phase from monoclinic zir...

  8. Influence of hydroxyl content of binders on rheological properties of cerium-gadolinium oxide (CGO) screen printing inks

    DEFF Research Database (Denmark)

    Marani, Debora; Gadea, Christophe; Hjelm, Johan;


    vinyl resins) were selected and characterized in solution via viscosimetry method. A high degree of hyper-entanglement was observed for ethyl cellulose polymers, whereas a mitigated effect characterized the two vinyl resins. Cerium-gadolinium oxides (CGO)-based inks, prepared using the selected binders...

  9. Research Development of Cerium-Zinc Flow Battery%铈锌液流电池的研究进展

    Institute of Scientific and Technical Information of China (English)

    金荣荣; 马立群; 尹东明; 王立民


    Cerium-Zinc redox flow battery has a significant high voltage compared with other redox flow batteries.The potential utilization of cerium-zinc redox flow battery is most likely to occur in energy storage system due to the abundant resources of raw materials and cost-efficient products.This review summarized the recent research and development of cerium-zinc flow batteries,especially for electrolytes of batteries,and analyzes further development prospective of cerium-zinc flow batteries.%铈锌氧化还原液流电池与其它液流电池相比,具有电压高、原材料资源丰富和价格便宜等优点,在储能方面具有很大的应用发展潜力.本文总结了铈锌液流电池的研究进展,特别是对电解液的发展进行了重点总结,并指出了今后铈锌液流电池研究的发展方向.

  10. Germination and early plant development of ten plant species exposed to titanium dioxide and cerium oxide nanoparticles (United States)

    Ten agronomic plant species were exposed to different concentrations of nano titanium dioxide (nTiO2) or nano cerium oxide (nCeO2) (0, 250, 500 and 1000 mg/L) to examine potential effects on germination and early seedling development. We modified a standard test protocol develop...

  11. A mixed acid based vanadium-cerium redox flow battery with a zero-gap serpentine architecture (United States)

    Leung, P. K.; Mohamed, M. R.; Shah, A. A.; Xu, Q.; Conde-Duran, M. B.


    This paper presents the performance of a vanadium-cerium redox flow battery using conventional and zero-gap serpentine architectures. Mixed-acid solutions based on methanesulfonate-sulfate anions (molar ratio 3:1) are used to enhance the solubilities of the vanadium (>2.0 mol dm-3) and cerium species (>0.8 mol dm-3), thus achieving an energy density (c.a. 28 Wh dm-3) comparable to that of conventional all-vanadium redox flow batteries (20-30 Wh dm-3). Electrochemical studies, including cyclic voltammetry and galvanostatic cycling, show that both vanadium and cerium active species are suitable for energy storage applications in these electrolytes. To take advantage of the high open-circuit voltage (1.78 V), improved mass transport and reduced internal resistance are facilitated by the use of zero-gap flow field architecture, which yields a power density output of the battery of up to 370 mW cm-2 at a state-of-charge of 50%. In a charge-discharge cycle at 200 mA cm-2, the vanadium-cerium redox flow battery with the zero-gap architecture is observed to discharge at a cell voltage of c.a. 1.35 V with a coulombic efficiency of up to 78%.

  12. Effect of rare element cerium on the morphology and corrosion resistance of electro-less Ni-P coatings

    Directory of Open Access Journals (Sweden)

    Fu Chuan-qi


    Full Text Available This paper reports an experimental study on the microstructure and corrosion resistance of electro-less Ni-P coatings with increasing content of the rare element cerium (Ce. Surface morphology and the composition of the electro-less Ni-P coatings were studied by scanning electron microscope (SEM, X-ray energy dispersed analysis (EDS and X-ray diffraction analysis (XRD. Hardness and Adhesive force are researched by a HX-200 Vickers diamond indenter micro-hardness tester. Furthermore, we study the adhesive force by using the Revetest scratch tester. We get the possession of Ce amorphous Ni-P coatings which has excellent properties in anti-corrosion. The effect of the rare element cerium concentration on corrosion resistance of the coatings was evaluated in the groundwater immersion test and porosity test, respectively. The results indicated that added little the rare element cerium into the plating bath increased the phosphorus content of the coatings, decreased the corrosion rates, it also decreases the porosity of the amorphous Ni-P coatings. The lowest corrosion rates of the amorphous Ni-P coatings in groundwater immersion test is 4.1 um · h-1, at the rare element cerium concentration of 0.12g · L-1.

  13. 19 CFR 148.88 - Certain representatives to and officers of the United Nations and the Organization of American... (United States)


    ... United Nations and the Organization of American States. 148.88 Section 148.88 Customs Duties U.S. CUSTOMS... members of the staff of the United Nations and the Organization of American States, and their personal... United Nations member nation as the principal resident representative to the United Nations of...

  14. GPER mediated estradiol reduces miR-148a to promote HLA-G expression in breast cancer

    Energy Technology Data Exchange (ETDEWEB)

    Tao, Sifeng, E-mail:; He, Haifei; Chen, Qiang; Yue, Wenjie


    Highlights: • E2 induces the level of miR-148a in MCF-7 and MDA-MB-231 cells. • GPER mediates the E2-induced increase of miR-148a in MCF-7 and MDA-MB-231 cells. • E2-GPER regulates the expression of HLA-G by miR-148a. - Abstract: Breast cancer is the most common malignant diseases in women. miR-148a plays an important role in regulation of cancer cell proliferation and cancer invasion and down-regulation of miR-148a has been reported in both estrogen receptor (ER) positive and triple-negative (TN) breast cancer. However, the regulation mechanism of miR-148a is unclear. The role of estrogen signaling, a signaling pathway is important in development and progression of breast cancer. Therefore, we speculated that E2 may regulate miR-148a through G-protein-coupled estrogen receptor-1 (GPER). To test our hypothesis, we checked the effects of E2 on miR-148a expression in ER positive breast cancer cell MCF-7 and TN cancer cell MDA-MB-231. Then we used GPER inhibitor G15 to investigate whether GPER is involved in regulation of E2 on miR-148a. Furthermore, we analyzed whether E2 affects the expression of HLA-G, which is a miR-148a target gene through GPER. The results showed that E2 induces the level of miR-148a in MCF-7 and MDA-MB-231 cells, GPER mediates the E2-induced increase in miR-148a expression in MCF-7 and MDA-MB-231 cells and E2-GPER regulates the expression of HLA-G by miR-148a. In conclusion, our findings offer important new insights into the ability of estrogenic GPER signaling to trigger HLA-G expression through inhibiting miR-148a that supports immune evasion in breast cancer.

  15. Computational and Experimental Study of the Thermodynamics of Uranium-Cerium Mixed Oxides (United States)

    Hanken, Benjamin Edward

    The thermophysical properties of mixed oxide (MOX) fuels, and how they are influenced by the incorporation of fission products and other actinides, must be well understood for their safe use in an advanced fuel cycle. Cerium is a common plutonium surrogate in experimental studies of MOX, as it closely matches plutonium's ionic radii in the 3+ and 4+ oxidation states, and is soluble in fluorite-structured UO2. As a fission product, cerium's effects on properties of MOX are also of practical interest. To provide additional insights on structure-dependent behavior, urania solid solutions can be studied via density functional theory (DFT), although approaches beyond standard DFT are needed to properly account for the localized nature of the ƒ-electrons. In this work, DFT with Hubbard-U corrections (DFT+U) was employed to study the energetics of fluorite-structured U1-yCe yO2 mixtures. The employed computational approach makes use of a procedure which facilitates convergence of the calculations to multiple self-consistent DFT+U solutions for a given cation arrangement, corresponding to different charge states for the U and Ce ions in several prototypical cation arrangements. Results indicate a significant dependence of the structural and energetic properties of U1-yCeyO2 on the nature of both charge and cation ordering. With the effective Hubbard-U parameters that reproduce well the measured oxidation-reduction energies for urania and ceria, it was found that charge transfer between U4+ and Ce4+ ions, leading to the formation of U5+ and Ce3+, gives rise to an increase in the mixing energy in the range of 4-14 kJ/mol of the formula unit, depending on the nature of the cation ordering. In conjunction with the computational approach, high-temperature oxide-melt drop-solution calorimetry experiments were performed on eight samples spanning compositions of y = 0.119 to y = 0.815. Room temperature mixing enthalpies of U1-yCeyO2 determined from these experiments show near

  16. Cerium doped lanthanum halides: fast scintillators for medical imaging; Halogenures de lanthane dopes cerium des scintillateurs rapides pour l'imagerie medicale

    Energy Technology Data Exchange (ETDEWEB)

    Selles, O


    This work is dedicated to two recently discovered scintillating crystals: cerium doped lanthanum halides (LaCl{sub 3}:Ce{sup 3+} and LaBr{sub 3}:Ce{sup 3+}).These scintillators exhibit interesting properties for gamma detection, more particularly in the field of medical imaging: a short decay time, a high light yield and an excellent energy resolution. The strong hygroscopicity of these materials requires adapting the usual experimental methods for determining physico-chemical properties. Once determined, these can be used for the development of the industrial manufacturing process of the crystals. A proper comprehension of the scintillation mechanism and of the effect of defects within the material lead to new possible ways for optimizing the scintillator performance. Therefore, different techniques are used (EPR, radioluminescence, laser excitation, thermally stimulated luminescence). Alongside Ce{sup 3+} ions, self-trapped excitons are involved in the scintillation mechanism. Their nature and their role are detailed. The knowledge of the different processes involved in the scintillation mechanism leads to the prediction of the effect of temperature and doping level on the performance of the scintillator. A mechanism is proposed to explain the thermally stimulated luminescence processes that cause slow components in the light emission and a loss of light yield. Eventually the study of afterglow reveals a charge transfer to deep traps involved in the high temperature thermally stimulated luminescence. (author)

  17. Effect of Rare Earth Element Cerium on Mechanical Properties and Morphology of TiN Coating Prepared by Arc Ion Plating

    Institute of Scientific and Technical Information of China (English)

    黄拿灿; 胡社军; 谢光荣; 曾鹏; 汝强


    TiN coatings were deposited on polished substrates of W18Cr4V high speed steel by means of vacuum arc ion plating. The effect of cerium on adhesion between TiN coating and substrate was studied. The microstructures and composition of TiN coatings were also investigated by means of scanning electron microscope (SEM), Auger electron spectroscopy (AES), and X-ray diffraction (XRD) technique. It was found that cerium is an effective modifying agent and the addition of suitable amount of cerium to TiN coatings can produce relatively excellent properties such as micro-hardness, wear resistance, oxidation resistance and porosity. The experimental results show that the added cerium in TiN coatings makes a contribution to form the preferred direction along with a (111) or (222) close packed face, which may be one of the reasons that improves some properties mentioned above.

  18. Effects of acetic acid on microstructure and electrochemical properties of nano cerium oxide films coated on AA7020-T6 aluminum alloy

    Institute of Scientific and Technical Information of China (English)

    H. Hasannejad; T. Shahrabi; M. Aliofkhazraei


    Nano cerium oxide films were applied on AA7020-T6 aluminum alloy and the effects of acetic acid concentration on the microstructure and electrochemical properties of the coated samples were investigated by using scanning electron microscopy (SEM), X-ray diffraction (XRD), crack-flee films with well-developed grains were obtained and grain sizes of the films decreased. Elimination of cracks and decreasing grain size of the nano cerium oxide films caused corrosion resistance to increase.

  19. Effect of cerium and lanthanum additives on plasma electrolytic oxidation of AZ31 magnesium alloy

    Institute of Scientific and Technical Information of China (English)

    沈德久; 马豪杰; 郭长虹; 蔡景瑞; 李国龙; 何东磊; 杨庆祥


    Plasma electrolytic oxidation (PEO) coatings on AZ31 magnesium (Mg) alloy were developed using the aqueous solution with alkaline silicate and sodium hydroxide as a base electrolyte system. The effects of cerium (Ce) nitrate and lanthanum (La) nitrate additives on the voltage response, microstructure, compositions and corrosion resistance of PEO coatings were investigated by scan-ning electron microscopy (SEM), energy-dispersive spectrum (EDS), X-ray diffraction (XRD) and potentiodynamic polarization tests, etc. The results showed that Ce and La additives increased the stable voltage and compactness of the PEO coatings, while, those did not change the compositions of the PEO coatings. The corrosion resistance of the PEO coating obtained in solutions with La nitrate of 0.1 g/L was the best, followed by that with Ce nitrate of 0.1 g/L and that without additives.

  20. Aqueous systems of ethanolamine hydrochlorides and of chlorides of cerium, terbium, dysprosium, erbium

    International Nuclear Information System (INIS)

    The isothermal method of cross sections has been used to study the solubility at 25 and 50 deg C in ternary water-salt systems consisting of cerium chloride and mono-(1), di-(2) and triethanolamine (3) hydrochlorides as well as diethanolamine hydrochloride and terbium, dysprosium and erbium chlorides. Solubility isotherms testify to the formation in the system (1) of a congruently dissolved compound of the CeCl3x2(C2H4OHNN2HCl)x2H2O composition. Individual peculiarities of a new solid phase are proved by the DTA method by means of derivatograph ODL-106, while the composition is confirmed by chemical analysis. The rest of the systems - are of simple eutonic type

  1. Boric Acid as an Accelerator of Cerium Surface Treatment on Aluminum

    Directory of Open Access Journals (Sweden)

    K. Cruz-Hernández


    Full Text Available Aluminum pieces are often used in various industrial processes like automotive and aerospace manufacturing, as well as in ornamental applications, so it is necessary to develop processes to protect these materials, processes that can be industrialized to protect the aluminum as well or better than chromate treatments. The purpose of this research is to evaluate boric acid as an accelerator by optimizing its concentration in cerium conversion coatings (CeCC with 10-minute immersion time with a concentration of 0.1 g L−1 over aluminum to protect it. The evaluation will be carried out by measuring anticorrosion properties with electrochemical techniques (polarization resistance, Rp, polarization curves, PC, and electrochemical impedance spectroscopy, EIS in NaCl 3.5% wt. aqueous solution and surface characterization with scanning electron microscopy (SEM.

  2. Effect of cerium on ignition point of AZ91D magnesium alloy

    Directory of Open Access Journals (Sweden)

    Zhao Hongjin


    Full Text Available The surface and interior temperature-time curves of blocky cerium modified AZ91D magnesium alloy were measured during a non-protective heating and melting process. Two inflection points with rapid increase in temperature were found on both curves, which corresponded to the formation of “auliflower”oxide on the surface and the occurrence of flame during melting. These two temperatures are therefore defined as oxidation point and ignition point, respectively. The interior temperature-time curve is similar to that measured on the surface except for a comparable time delay. The oxidation and ignition temperatures increase with Ce content, an average increase of 33=and 61= was found when Ce addition was about 1.0 wt %. However, the increasing rate of the oxidation and ignition temperature decreases with increasing Ce content. An addition of 0.6wt% Ce is recommended for ignition-resistant AZ91 magnesium alloy.

  3. Effect of cerium on ignition point of AZ91D magnesium alloy

    Institute of Scientific and Technical Information of China (English)

    Zhao Hongjin; Zhang Yinghui; Kang Yonglin


    The surface and interior temperature-time curves of blocky cerium modified AZ91D magnesium alloy were measured during a non-protective heating and melting process. Two inflection points with rapid increase in temperature were found on both curves, which corresponded to the formation of "auliflower" oxide on the surface and the occurrence of flame during melting. These two temperatures are therefore defined as oxidation point and ignition point, respectively.The interior temperature-time curve is similar to that measured on the surface except for a comparable time delay. The oxidation and ignition temperatures increase with Ce content, an average increase of 33℃ and 61℃ was found when Ce addition was about 1.0 wt %. However, the increasing rate of the oxidation and ignition temperature decreases with increasing Ce content. An addition of 0.6wt% Ce is recommended for ignition-resistant AZ91 magnesium alloy.

  4. Domain Structure in Calcium-Cerium Fluorocarbonate Minerals, Mianning County, Sichuan Province, China

    Institute of Scientific and Technical Information of China (English)


    The domain structures in calcium-cerium fluorocarbonate mineral series from a rare earth mineral deposit within an aegirine alkali granite massif in Mianning County, Sichuan Province, China, were studied by means of transmission electron microscopy. Many categories of domain structures in this mineral series were observed and investigated, including the microtwin domains of parisite-6R2 and B2S-6R, the antiphase domains of B2S-2H. The results show that the antiphase domains which are faults along crystal plane (0001) are formed by the displacement of crystal lattice in c* direction and the displacement is 0.471 nm. A new polytype (B4S2-3R) of regular mixed-layer structure with B4S2 type is found in the domain region of mixed-layer structure.

  5. Synthesis and properties of solid complexes of lanthanum, cerium. neodymium and erbium with N-phosphonomethylglicyne

    International Nuclear Information System (INIS)

    Water soluble complexes of lanthanum(III), cerium(III), neodymium(III) and erbium(III) with N-phosphonomethylglycine (glyphosate, NMPG) of the general formulae: LaC3H5NO5P·H2O, CeC3H5NO5P·H2O, NdC3H5NO5P·1.5H2O, ErC3H5NO5P·2H2O were synthesized. The solubility in water was determined. Thermal, diffractometric and IR spectrophotometric analyses were carried out. It was found that the lanthanide ions are bonded to N-phosphonmethylglycine through the oxygen atoms of the carboxylic and phosphonate groups and the nitrogen atom of the amine group. The final products of thermal decomposition at 900 oC were determined. (author)

  6. Electrospun cerium nitrate/polymer composite fibres:synthesis, characterization and fibre-division model

    Institute of Scientific and Technical Information of China (English)

    Li Meng-Meng; Long Yun-Ze; Yin Hong-Xing; Zhang Zhi-Ming


    Cerium (III)nitrate/poly(vinylpyrrolidone)(Ce(NO3)3/PVP)composite fibres have been prepared by electrospinning. After calcining the composite fibres in air at 500℃, CeO2 nanowires were obtained. The characterizations of the as-spun composite fibres and resultant nanowires have been carried out by a scanning electron microscope (SEM),an infrared spectrometer, an x-ray diffractometer and a fluorescence spectrophotometer. Interestingly, some unusual ribbon-like or twin fibres were observed besides the common fibres with circular or elliptic cross sections. We developed a fibre-division model resulting from Coulomb repulsion and solvent vaporization to interpret the formation of the ribbona or twin fibres, which has been confirmed by the SEM studies. Our results also indicate that the formation of the ribbons or twin fibres is less dependent on operation voltage and work distance.

  7. Optical Evidence of Itinerant-Localized Crossover of 4f Electrons in Cerium Compounds (United States)

    Kimura, Shin-ichi; Kwon, Yong Seung; Matsumoto, Yuji; Aoki, Haruyoshi; Sakai, Osamu


    Cerium (Ce)-based heavy-fermion materials have a characteristic double-peak structure (mid-IR peak) in the optical conductivity [σ(ω)] spectra originating from the strong conduction (c)-f electron hybridization. To clarify the behavior of the mid-IR peak at a low c-f hybridization strength, we compared the σ(ω) spectra of the isostructural antiferromagnetic and heavy-fermion Ce compounds with the calculated unoccupied density of states and the spectra obtained from the impurity Anderson model. With decreasing c-f hybridization intensity, the mid-IR peak shifts to the low-energy side owing to the renormalization of the unoccupied 4f state, but suddenly shifts to the high-energy side owing to the f-f on-site Coulomb interaction at a slight localized side from the quantum critical point (QCP). This finding gives us information on the change in the electronic structure across QCP.

  8. Diffusion of Barium, Strontium and Cerium in Various Grades of Reactor Graphite

    International Nuclear Information System (INIS)

    Experiments designed to study the diffusion of barium, strontium and cerium in various grades of graphite of interest to the Dragon reactor project will be described. In these experiments specimens of the graphite are immersed in the vapour of the fission product metal under controlled conditions of temperature and pressure for known periods of time. After appropriate grinding and polishing, the distribution of the solute metal in the specimen is determined by means of an electron microprobe. The electron microprobe recordings are then interpreted to obtain apparent values of the diffusion coefficients and their dependence upon temperature. The results indicate that migration occurs primarily via defects in the graphite structure, with only a negligible contribution from in-grain diffusion. The significance of the results is discussed, with particular reference to the differences in behaviour encountered between various grades of graphite. (author)

  9. Study on Electrochemical Characteristics of Electroless Co-Ni-B Alloy with Cerium

    Institute of Scientific and Technical Information of China (English)


    The effects of rare earth element cerium on composition and electrochemical characteristics of electroless Co-Ni-B alloy were studied in this paper. The alloy component was analyzed using Inductively Coupled Plasma (ICP). The plating rate is was determined by electronic balance. The cathode polarization curves and cyclic voltammogram during the electroless deposition were tested by LK998Ⅱmodel electrochemical analytical system. The results show that rare earth element Ce can co-deposit with cobalt-based alloy, and with mass increase of Ce added in aqueous solution, the contents of Co, Ni, Ce in alloy increase and the content of B decreases. Ce can increase deposition rate of alloy in some range. The rare earth makes deposition potential move to positive direction and makes polarizability decrease.

  10. Valence Control of Ce Ions in Cerium-substituted Yttrium Iron Garnet

    Institute of Scientific and Technical Information of China (English)

    SONG Fengbing; LI Qiang; ZHONG Zhifeng


    Cerium-substituted yttrium iron garnet(CexY3-xFe5O12, Ce∶YIG) was prepared via coprecipitation. The structure, morphology, valence state and constituent of Ce ions were investigated respectively. X-ray powder diffraction(XRD) analysis shows that Ce∶YIG was of single cubic YIG phase. The result of X-ray photoelectron spectroscopy(XPS) indicates the Ce ions in Ce∶YIG were in the state of trivalence. Scanning electron microscope(SEM) demonstrates the conglobation of Ce∶YIG particles about 0.2μm scale.The magnetic properties were studied by a vibrating sample magnetometer(VSM) and the result exhibits that substitution of Ce3+ changes the magnetic parameters of YIG. The effects of doping content of Ce ions and synthesis temperature on valence control were discussed in detail.

  11. Stability and morphology of cerium oxide surfaces in an oxidizing environment: A first-principles investigation (United States)

    Fronzi, Marco; Soon, Aloysius; Delley, Bernard; Traversa, Enrico; Stampfl, Catherine


    We present density functional theory investigations of the bulk properties of cerium oxides (CeO2 and Ce2O3) and the three low index surfaces of CeO2, namely, (100), (110), and (111). For the surfaces, we consider various terminations including surface defects. Using the approach of "ab initio atomistic thermodynamics," we find that the most stable surface structure considered is the stoichiometric (111) surface under "oxygen-rich" conditions, while for a more reducing environment, the same (111) surface, but with subsurface oxygen vacancies, is found to be the most stable one, and for a highly reducing environment, the (111) Ce-terminated surface becomes energetically favored. Interestingly, this latter surface exhibits a significant reconstruction in that it becomes oxygen terminated and the upper layers resemble the Ce2O3(0001) surface. This structure could represent a precursor to the phase transition of CeO2 to Ce2O3.

  12. Cerium-based binary and ternary oxides in the transesterification of dimethylcarbonate with phenol. (United States)

    Dibenedetto, Angela; Angelini, Antonella; di Bitonto, Luigi; De Giglio, Elvira; Cometa, Stefania; Aresta, Michele


    Diphenyl carbonate (DPC) plays a key role in phosgene-free carbonylation processes. It can be produced by transesterification of dimethyl carbonate (DMC) with phenol in the presence of catalysts. Methyl phenyl carbonate (MPC) is first produced that is then converted into DPC by either disproportionation or further transesterification with phenol. Cerium-based bimetallic oxides (with the heterometal being niobium, iron, palladium, or aluminum) are used as catalysts in the transesterification of DMC to synthesize MPC. The catalytic activity is affected by the type and concentration of the heterometal. XPS, IR and elementary analyses are employed to characterize the new catalysts. Differently from pure oxides, the mixed oxides produce a significant increase of the conversion and selectivity towards MPC. PMID:24616260

  13. Cerium-activated sol–gel silica glasses for radiation dosimetry in harsh environment (United States)

    El Hamzaoui, Hicham; Capoen, Bruno; Helou, Nissrine Al; Bouwmans, Géraud; Ouerdane, Youcef; Boukenter, Aziz; Girard, Sylvain; Marcandella, Claude; Duhamel, Olivier; Chadeyron, Geneviève; Mahiou, Rachid; Bouazaoui, Mohamed


    Cerium-doped silica glass has been prepared for ionizing radiation dosimetry applications, using the sol–gel route and densification under different atmospheres. In comparison with the glass densified under air atmosphere, the one obtained after sintering the xerogel under helium gas presents improved optical properties, with an enhancement of the photoluminescence quantum yield up to 33%, which is attributed to a higher Ce3+ ions concentration. Such a glassy rod has been jacketed in a quartz tube and then drawn at high temperature to a cane, which has been used as active material in a fibered remote x-ray radiation dosimeter. The sample exhibited a reversible linear radioluminescence intensity response versus the dose rate up to 30 Gy s‑1. These results confirm the potentialities of this material for in vivo or high rate dose remote dosimetry measurements.

  14. Dielectric studies on cerium doped BaLa2Ti3O10

    Directory of Open Access Journals (Sweden)

    Parshuram B. Abhange


    Full Text Available The BaLa2-xCexTi3O10 samples (with x = 0.2, 0.4, 0.6 and 0.8 were prepared by hydroxide co-precipitation method and finally sintered at 1150 °C. The structure of the prepared samples was characterized by XRD and SEM. The single phase material was confirmed only for the BaLa1.8Ce0.2Ti3O10 ceramics. However, at higher cerium concentration secondary phase was observed. The characteristic plate-like structure, having grains with submicrometer thickness and high aspect ratio, was clearly observed by SEM. The results of dielectric measurement suggest that the appropriate adjustment of doping (with x between 0.2 and 0.8 will give sufficient high dielectric constant at very low loss. The resistivity of samples decreases with increase in temperature indicating the normal semiconducting electrical behaviour.

  15. Extraction of Uranium and Cerium mixture with liquid membrane emulsion process using Tributylphosphate extractant

    International Nuclear Information System (INIS)

    As a membrane a mixture of surfactant (span-80), Tributylphosphate in kerosene and sodium carbonate was used. The feeder was a mixture of uranium and cerium solution with 418.88 ppm U and 101.81 ppm Ce concentration in nitrate acid. The variables investigated were % surfactant (1-8 %) percentage, rotary speed for membrane making (2,500-10,000 rpm) and the acidity of feeder (0.5-3 M). The experiment result were that the optimal concentration of surfactant 5 %, rotary speed 7,500 rpm and efficiency extraction (efeks-U = 23.65 %, efeks-Ce = 7.09 %) at 0.5 M nitric acid and the efficiency stripping (efstripp-U = 5.06 %, efstripp-Ce = 99.91 %) at 0.5 M nitric acid

  16. Redox-active cerium oxide nanoparticles protect human dermal fibroblasts from PQ-induced damage

    Directory of Open Access Journals (Sweden)

    Claudia von Montfort


    Full Text Available Recently, it has been published that cerium (Ce oxide nanoparticles (CNP; nanoceria are able to downregulate tumor invasion in cancer cell lines. Redox-active CNP exhibit both selective pro-oxidative and antioxidative properties, the first being responsible for impairment of tumor growth and invasion. A non-toxic and even protective effect of CNP in human dermal fibroblasts (HDF has already been observed. However, the effect on important parameters such as cell death, proliferation and redox state of the cells needs further clarification. Here, we present that nanoceria prevent HDF from reactive oxygen species (ROS-induced cell death and stimulate proliferation due to the antioxidative property of these particles.

  17. Photochemical reduction and oxidation of cerium(IV) porphyrin sandwich complexes

    Energy Technology Data Exchange (ETDEWEB)

    Radzki, S. [Department of Chemistry, M. Curie-Sklodowska University, Lublin (Poland); Giannotti, Ch. [Institut de Chimie des Substances Naturelles, CNRS, Gif-sur-Yvette (France)


    Irradiation of cerium(IV) complex of octaethyl bisporphyrin Ce[OEP(-2)]{sub 2} with visible light, in the presence of CCl{sub 4} as an electron acceptor, leads to their photooxidation and {pi} cation formation. The process was followed using electron absorption and magnetic circular dichroism spectroscopy. Electronic configuration in neutral mono- and bisporphyrin (sandwich) complexes were compared to the one of neutral species. Photoirradiation of sandwich octaethyl- and tetraphenyl bisporphyrins, in the presence of an electron donor (triethylamine) results in their photoreduction on different pathways. Formation of the [Ce(III)(TPP)(-2)TPP(-2)]{sup -} and [Ce(III)(OEP)(-1)(OEP)(-2)] complexes was followed by absorption and electron spin resonance spectroscopy. (author) 31 refs, 4 figs

  18. Effect of Cerium on the Viscosity of Liquid Fe-C Alloy of Eutectic Content

    Institute of Scientific and Technical Information of China (English)

    滕新营; 叶以富; 刘含莲; 王焕荣; 石志强; 耿浩然


    The viscosities of liquid Fe-4.30C and Fe-4.30C-Ce alloys were measured by oscillating crucible viscometer. The results show that viscosity of Fe-4.30C alloy changes from 5.50 to 8.30 MPa*s when the liquid is cooled from 1425 ℃ to the melting point. The abnormity of viscosity of Fe-4.30C alloy near the melting point is reasonable due to the formation of graphite. The addition of cerium especially with content higher than 0.21% causes an evidently decrease in viscosity for eutectic alloy resulting from increase of free volume and size decrease of atom cluster in the liquids. It can be concended that the existence of C-Ce compound contributes to the discontinuous of viscosity at 1340~1370 ℃ for the Fe-4.30C-Ce alloy by experinments with differential scanning calorimeter.

  19. Impact of electrolyte composition on the performance of the zinc-cerium redox flow battery system (United States)

    Nikiforidis, Georgios; Berlouis, Léonard; Hall, David; Hodgson, David


    The zinc-cerium redox flow battery has the highest open circuit cell voltage (Ecell = 2.4 V) of all the common redox flow battery (RFB) systems being investigated. In this paper, carbon polymer composite materials based on polyvinyl ester and polyvinylidene difluoride are investigated as the negative electrode for this RFB system. Electrolyte composition, particularly on the negative side, is found to play a key role in maintaining high (˜90%) coulombic efficiencies for the different charge durations, from 10 min to 4 h, examined. Energy efficiencies >60% are obtained for temperatures in the range 45 °C-55 °C when the zinc ion concentration in the methanesulfonic acid electrolyte is 2.5 mol dm-3. No dependence of the energy efficiency on the flow velocity is found, over the range 7.5 cm s-1-13.5 cm-1.

  20. Nanoscale Hybrid Langmuir-Blodgett Films Based on Cerium-Substituted Heteropolymolybdate and Polyquinoline

    Institute of Scientific and Technical Information of China (English)

    王峥; 柳士忠; 杜祖亮; 胡振纲; 张洪杰


    Nanoscale hybrid organic/inorganic Langmuir-Blodgett films of cerium-substituted heteropolymolybdates(Ce-HPMo) and π-conjugated macromolecule poly(1,2-dihydro-2,2,4-trimethyl)quinoline(PQ) were obtained with auxiliary film-forming material stearic acid(SA) or octadecylamine(ODA). The surface pressure-area isotherms illuminate the formation of the hybrid LB films of PQ/ODA/Ce-HPMo and P Q/SA/Ce-HPMo. The different film-forming mechanism was discussed when the different auxiliary film-forming materials were used in the system. The absorption spectra indicate that the molecules of PQ and Ce-HPMo are incorporated into the LB films. Tapping-mode AFM image reveals a granular surface texture of nanosized Ce-substituted heteropolymolybdate. STM image shows that the conductivity is greatly improved after Ce-substituted heteropolymolybdates are incorporated in the films.

  1. Adsorption of Magnesium Sulfate from Desulfurization Industrial Wastewater by Nano-Cerium Loaded Recycled Aggregates. (United States)

    Yoon, Hyung-Sun; Bak, Somi; Seo, Seong-Gyu; Choi, Jeongdong; Kim, Eun-Sik


    In this research, the recycled aggregates (RAs) from blast furnace were solidified with nano-cerium (Ce), and applied to reduce the ionic species (e.g., magnesium sulfate) in the desulfurization industrial wastewater. Static batch experiments were performed based on different loading of recycled aggregates. Sulfate sorption isotherm studies were performed by Langmuir adsorption model. The physical morphologies were determined using scanning electron microscope. The results presented that the partial ions were captured with the different loading of the recycled aggregates during the batch tests. It was observed that 8 hr batch reaction equilibrated the electrical conductivity reduction, and 13% mass loading was estimated an optimal dosage of adsorbent. This study showed the nano-Ce loaded RAs could reduce ionic species in wastewater, and expected to be an economical adsorbent for wastewater treatment process. PMID:27433701

  2. Equiatomic cerium intermetallics CeXX' with two p elements

    Energy Technology Data Exchange (ETDEWEB)

    Poettgen, Rainer [Muenster Univ. (Germany). Inst. fuer Anorganische und Analytische Chemie; Chevalier, Bernard [Bordeaux Univ., Pessac (France). Institut de Chimie de la Matiere Condensee de Bordeaux


    The equiatomic CeXX' phases (X and X' = elements of the 3{sup rd}, 4{sup th}, or 5{sup th} main group) extend the large series of CeTX intermetallics (T = electron-rich transition metal). These phases crystallize with simple structure types, i.e. ZrNiAl, TiNiSi, CeScSi, α-ThSi{sub 2}, AlB{sub 2}, and GdSi{sub 2}. In contrast to the CeTX intermetallics one observes pronounced solid solutions for the CeXX' phases. The main influence on the magnetic ground states results from the absence of d electrons. All known CeXX' phases show exclusively trivalent cerium and antiferro- or ferromagnetic ordering at low temperatures. The crystal chemical details and some structure-property relationships are reviewed.

  3. Distribution of Cerium Ion in Cordierite Ceramics and Its Effect on Structure of Cordierite Crystal

    Institute of Scientific and Technical Information of China (English)

    Shi Zhiming


    Cerium addition plays an important role in sintering, transformation and phasicochemical properties of cordierite ceramics. The present work aims at studying the distribution of Ce4+ in cordierite ceramics and its effect on the structure of cordierite crystal by means of differential thermal analysis (DTA), X-ray diffraction (XRD) and scanning electronic microscope (SEM) so as to clarify the behavior of Ce4+. Results show that Ce4+ can exist in two forms of CeO2 particles and solid solution in Ce4+ -modified cordierite ceramics by the sol-gel method. The CeO2 particles separately distribute in the cordierite matrix. Ce4+ dissolves little into cordierite crystal, resulting in a decrease of lattice constants ofthe crystal. This kind of distribution behavior of Ce4+ makes us to easily tailor the properties of the cordieritc ceramics.

  4. Structural Characteristics of Cerium Oxide Nanocrystals Prepared by the Microemulsion Method

    Institute of Scientific and Technical Information of China (English)

    J.Zhang; X.Ju; Z.Y.Wu; T.Liu; T.D.Hu; Y.N.Xie


    The aim of this work is to investigate the microstructure development of erium oxide nanocrystal,prepared by the microemulsion process,as a function of annealing temperature in air.Combined with the HRTEM and the thermogravimetric-differential thermal analysis in air.Combined withthe HRTEm and the thremogravimetric-differential thermal analysis(TG-DTA),the XRD patterns reveal that the sample annealed at 623 K is amorphous,and the formation of cerium oxide nanocrystal occurs above 773 K.The local structural and electronic properties in the nanocrystallization process are probed by X-ray absorption spectra (XAS) at the Ce L3 edge.It is found that the phase structure changes from triclinic to cubic (CeO2),and the electroic structure changes from Ce3 to Ce4 upon increasing the annealing temperature.

  5. Potential of using cerium oxide nanoparticles for protecting healthy tissue during accelerated partial breast irradiation (APBI). (United States)

    Ouyang, Zi; Mainali, Madan Kumar; Sinha, Neeharika; Strack, Guinevere; Altundal, Yucel; Hao, Yao; Winningham, Thomas Andrew; Sajo, Erno; Celli, Jonathan; Ngwa, Wilfred


    The purpose of this study is to investigate the feasibility of using cerium oxide nanoparticles (CONPs) as radical scavengers during accelerated partial breast irradiation (APBI) to protect normal tissue. We hypothesize that CONPs can be slowly released from the routinely used APBI balloon applicators-via a degradable coating-and protect the normal tissue on the border of the lumpectomy cavity over the duration of APBI. To assess the feasibility of this approach, we analytically calculated the initial concentration of CONPs required to protect normal breast tissue from reactive oxygen species (ROS) and the time required for the particles to diffuse to various distances from the lumpectomy wall. Given that cerium has a high atomic number, we took into account the possible inadvertent dose enhancement that could occur due to the photoelectric interactions with radiotherapy photons. To protect against a typical MammoSite treatment fraction of 3.4Gy, 5ng·g(-1) of CONPs is required to scavenge hydroxyl radicals and hydrogen peroxide. Using 2nm sized NPs, with an initial concentration of 1mg·g(-1), we found that 2-10days of diffusion is required to obtain desired concentrations of CONPs in regions 1-2cm away from the lumpectomy wall. The resultant dose enhancement factor (DEF) is less than 1.01 under such conditions. Our results predict that CONPs can be employed for radioprotection during APBI using a new design in which balloon applicators are coated with the NPs for sustained/controlled in-situ release from within the lumpectomy cavity. PMID:27053452

  6. Decomposition processes and structural transformations of cerium propionate into nanocrystalline ceria at different oxygen partial pressures

    International Nuclear Information System (INIS)

    The structural transformations that occur when thermal treatments turn cerium propionate into nanocrystalline ceria have been analysed with thermoanalytical techniques (TG, DTA and MS) and with structural and magnetic characterization (HRTEM, SQUID and XRD) of the final and intermediate products. Attention has been paid to what occurs during the decomposition of propionate and how the process is affected by the furnace atmosphere (oxidizing or inert). In an oxidizing atmosphere, the decomposition of cerium propionate is triggered by the oxidation of Ce3+ to Ce4+. This reaction entails the loss of large unoxidized propionate fragments of the propionate ligands. As decomposition proceeds, the carbonaceous residue makes the oxygen transport inside the material more difficult and decomposition becomes diffusion limited. At this point, extensive oxidation of the residue begins until it is completely removed. Crystallization of CeO2 occurs simultaneously with decomposition. In these conditions, crystalline nanoparticles (diameter of 3–5 nm) can be obtained at a temperature as low as 300 °C. In an inert atmosphere, decomposition occurs in three steps. During the first step, one of the three propionate ligands is lost, with little oxidation of Ce3+, and is substituted by a hydroxyl group. The second step entails the loss of the remaining ligands with a substantial oxidation of Ce3+ to Ce4+. After this step, the intermediate product is, proposed as, a mixture of amorphous Ce(OH)3 and Ce(OH)4. Finally, the third step leads to conversion of the Ce hydroxide into crystalline CeO2. In an inert atmosphere, the process is less reproducible than in air and a carbonaceous residue remains in the product.

  7. Air, aqueous and thermal stabilities of Ce3+ ions in cerium oxide nanoparticle layers with substrates

    KAUST Repository

    Naganuma, Tamaki


    Abundant oxygen vacancies coexisting with Ce3+ ions in fluorite cerium oxide nanoparticles (CNPs) have the potential to enhance catalytic ability, but the ratio of unstable Ce3+ ions in CNPs is typically low. Our recent work, however, demonstrated that the abundant Ce3+ ions created in cerium oxide nanoparticle layers (CNPLs) by Ar ion irradiation were stable in air at room temperature. Ce valence states in CNPs correlate with the catalytic ability that involves redox reactions between Ce3+ and Ce4+ ions in given application environments (e.g. high temperature in carbon monoxide gas conversion and immersion conditions in biomedical applications). To better understand the mechanism by which Ce3+ ions achieve stability in CNPLs, we examined (i) extra-long air-stability, (ii) thermal stability up to 500 °C, and (iii) aqueous stability of Ce 3+ ions in water, buffer solution and cell culture medium. It is noteworthy that air-stability of Ce3+ ions in CNPLs persisted for more than 1 year. Thermal stability results showed that oxidation of Ce 3+ to Ce4+ occurred at 350 °C in air. Highly concentrated Ce3+ ions in ultra-thin CNPLs slowly oxidized in water within 1 day, but stability was improved in the cell culture medium. Ce 3+ stability of CNPLs immersed in the medium was associated with phosphorus adsorption on the Ce3+ sites. This study also illuminates the potential interaction mechanisms of stable Ce3+ ions in CNPLs. These findings could be utilized to understand catalytic mechanisms of CNPs with abundant oxygen vacancies in their application environments. © The Royal Society of Chemistry 2014.

  8. Structural and electronic properties of cerium from LDA+U calculations

    Directory of Open Access Journals (Sweden)

    F. Kheradmand


    Full Text Available  In this work structural, electronic and magnetic properties of alpha and gamma phases of cerium crystal have been calculated by means of the LDA and LDA+U methods. The equilibrium volume and magnetic moment obtained from the GGA approximation in agreement with the experiment are equal to 27.64 Å3 and 0.00018 µB, respectively. This agreement shows that the 4f electrons in alpha phase are itinerant due to the use of the GGA, where no strong correlations have been yet thaken into account. We have observed that even after applying the GGA+U method with U = 6.1 eV, the density of states of f orbital remains still at Fermi surface. Therefore, in complete accord with the experiment, our results show that the 4f electrons in the alpha phase are not localized. This is the case where the LDA and the GGA approximations could not describe the gamma phase properly. Indeed, physical properties of the gamma phase is consistent with the experiment and could only be reproduced after applying LDA+U method with U = 4.4 eV. In this way, the value of equilibrium volume and magnetic moment calculated for the gamma phase were found to be 34.33 Å3 and 1.15 µB, respectively. After including correlations among 4f electrons the γ-Ce DOS is positioned at its more reasonable place lower than Fermi level compared with the DOS obtained from GGA calculations. Our results, then, show that the 4f electrons in the gamma phase, as opposed to the alpha phase, are localized which is indicative of the fact that gamma cerium is a strongly correlated system. The volume of 11 kbar has been obtained for the pressure of the alpha-gamma phase transition .

  9. Cerium oxide nanoparticles inhibit the migration and proliferation of gastric cancer by increasing DHX15 expression

    Directory of Open Access Journals (Sweden)

    Xiao YF


    Full Text Available Yu-Feng Xiao,1 Jian-Mei Li,2 Su-Min Wang,1 Xin Yong,1 Bo Tang,1 Meng-Meng Jie,1 Hui Dong,1 Xiao-Chao Yang,2 Shi-Ming Yang1 1Department of Gastroenterology, Xinqiao Hospital, Third Military Medical University, Chongqing, People’s Republic of China; 2School of Biomedical Engineering, Third Military Medical University, Chongqing, People’s Republic of China Abstract: Gastric cancer is one of the leading causes of tumor-related deaths in the world. Current treatment options do not satisfy doctors and patients, and new therapies are therefore needed. Cerium oxide nanoparticles (CNPs have been studied as a potential therapeutic approach for treating many diseases. However, their effects on human gastric cancer are currently unknown. Therefore, in this study, we aimed to characterize the effects of CNPs on human gastric cancer cell lines (MKN28 and BGC823. Gastric cancer cells were cocultured with different concentrations of CNPs, and proliferation and migration were measured both in vitro and in vivo. We found that CNPs inhibited the migration of gastric cancer cells when applied at different concentrations, but only a relatively high concentration (10 µg/mL of CNPs suppressed proliferation. Furthermore, we found that CNPs increased the expression of DHX15 and its downstream signaling pathways. We therefore provide evidence showing that CNPs may be a promising approach to suppress malignant activity of gastric cancer by increasing the expression of DHX15. Keywords: cerium oxide nanoparticles, gastric cancer, DHX15, p38

  10. A sequence variation (I148M) in PNPLA3 associated with nonalcoholic fatty liver disease disrupts triglyceride hydrolysis. (United States)

    He, Shaoqing; McPhaul, Christopher; Li, John Zhong; Garuti, Rita; Kinch, Lisa; Grishin, Nick V; Cohen, Jonathan C; Hobbs, Helen H


    Obesity and insulin resistance are associated with deposition of triglycerides in tissues other than adipose tissue. Previously, we showed that a missense mutation (I148M) in PNPLA3 (patatin-like phospholipase domain-containing 3 protein) is associated with increased hepatic triglyceride content in humans. Here we examined the effect of the I148M substitution on the enzymatic activity and cellular location of PNPLA3. Structural modeling predicted that the substitution of methionine for isoleucine at residue 148 would restrict access of substrate to the catalytic serine at residue 47. In vitro assays using recombinant PNPLA3 partially purified from Sf9 cells confirmed that the wild type enzyme hydrolyzes emulsified triglyceride and that the I148M substitution abolishes this activity. Expression of PNPLA3-I148M, but not wild type PNPLA3, in cultured hepatocytes or in the livers of mice increased cellular triglyceride content. Cell fractionation studies revealed that approximately 90% of wild type PNPLA3 partitioned between membranes and lipid droplets; substitution of isoleucine for methionine at position 148 did not alter the subcellular distribution of the protein. These data are consistent with PNPLA3-I148M promoting triglyceride accumulation by limiting triglyceride hydrolysis.

  11. Effect of calcination temperature on the crystallite growth of cerium oxide nano-powders prepared by the co-precipitation process

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Jian-Chih [Department of Orthopaedics, Kaohsiung Medical University Hospital, Kaohsiung 807, Taiwan (China); Chen, Wen-Cheng [School of Dentistry, College of Dental Medicine, Kaohsiung Medical University, Kaohsiung 807, Taiwan (China); Tien, Yin-Chun [Department of Orthopaedics, Kaohsiung Medical University Hospital, Kaohsiung 807, Taiwan (China); Shih, Chi-Jen, E-mail: [Department of Fragrance and Cosmetics Science, Kaohsiung Medical University, 100 Shi-Chuan1st Road, Kaohsiung 80708, Taiwan (China)


    Cerium oxide nanocrystallites were synthesized by a co-precipitation process at a relatively low temperature, using cerium (III) nitrate as the starting material in a water solution with pH in the range of 8-9. The effect of calcination temperature on the crystallite growth of cerium oxide nano-powders was investigated by X-ray diffraction, transmission electron microscopy and electron diffraction. The crystallization temperature of the cerium oxide powders was estimated to be about 273 K, by XRD analysis. When calcined at temperatures from 473 to 1273 K, face-centered cubic phase crystallization was observed by XRD. The crystallite size of the cerium oxide increased from 12.0 to 48 nm as the calcining temperature increased from 473 to 1273 K, in the pH range 8-9. The activation energy for the growth of cerium oxide nanoparticles was found to have very low values of 17.5 kJ/mol for pH = 8 and 16.0 kJ/mol for pH = 9.

  12. Effect of calcination temperature on the crystallite growth of cerium oxide nano-powders prepared by the co-precipitation process

    International Nuclear Information System (INIS)

    Cerium oxide nanocrystallites were synthesized by a co-precipitation process at a relatively low temperature, using cerium (III) nitrate as the starting material in a water solution with pH in the range of 8-9. The effect of calcination temperature on the crystallite growth of cerium oxide nano-powders was investigated by X-ray diffraction, transmission electron microscopy and electron diffraction. The crystallization temperature of the cerium oxide powders was estimated to be about 273 K, by XRD analysis. When calcined at temperatures from 473 to 1273 K, face-centered cubic phase crystallization was observed by XRD. The crystallite size of the cerium oxide increased from 12.0 to 48 nm as the calcining temperature increased from 473 to 1273 K, in the pH range 8-9. The activation energy for the growth of cerium oxide nanoparticles was found to have very low values of 17.5 kJ/mol for pH = 8 and 16.0 kJ/mol for pH = 9.

  13. 46 CFR 148.04-17 - Petroleum coke, calcined, at 130 °F or above. (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false Petroleum coke, calcined, at 130 °F or above. 148.04-17...-17 Petroleum coke, calcined, at 130 °F or above. (a) The requirements of this part do not apply to bulk shipments of petroleum coke, calcined, on any vessel when the material is less than 130 °F....

  14. Pairing phase transition and thermodynamical quantities in 148,149Sm (United States)

    Razavi, R.; Behkami, A. N.; Dehghani, V.


    The nuclear level densities and entropies in 148,149Sm have been calculated in the framework of the superconducting theory that includes modified nuclear pairing gap. For modified pairing gap parameter the smooth transition from the BCS to the Fermi type distributions is used. By applying modified pairing gap, the extracted S-shaped heat capacity as a function of nuclear temperature exhibits a physical and smoother behavior instead of the singular behavior predicted by the BCS equations at critical temperature.

  15. Pairing phase transition and thermodynamical quantities in {sup 148,149}Sm

    Energy Technology Data Exchange (ETDEWEB)

    Razavi, R., E-mail: [Department of Physics, Faculty of Science, Imam Hossein Comprehensive University, Tehran (Iran, Islamic Republic of); Behkami, A.N. [Fars Science and Research Center, Islamic Azad University, Shiraz (Iran, Islamic Republic of); Dehghani, V. [Physics Department, Faculty of Science, University of Sistan and Baluchestan, Zahedan (Iran, Islamic Republic of)


    The nuclear level densities and entropies in {sup 148,149}Sm have been calculated in the framework of the superconducting theory that includes modified nuclear pairing gap. For modified pairing gap parameter the smooth transition from the BCS to the Fermi type distributions is used. By applying modified pairing gap, the extracted S-shaped heat capacity as a function of nuclear temperature exhibits a physical and smoother behavior instead of the singular behavior predicted by the BCS equations at critical temperature.

  16. 第一艘Mangusta148’ Oceano到达维亚焦雷

    Institute of Scientific and Technical Information of China (English)



  17. Experimental Quantum Key Distribution over 14.8 km in a Special Optical Fibre

    Institute of Scientific and Technical Information of China (English)

    桂有珍; 韩正甫; 莫小范; 郭光灿


    We present an experimental set-up for quantum key distribution in a special optical fibre at the wavelength of850nm. The system employs the BB84 protocol to establish a secret key between Alice and Bob over 14.8km.The key is encoded in the phase of very weak laser of average photon number 0.11 per pulse. The measured error rate is lower than 10%.

  18. Octupole correlations in the odd-[ital Z] nuclei [sup 148-151]Eu

    Energy Technology Data Exchange (ETDEWEB)

    Jongman, J.R.; Bacelar, J.C.S.; Urban, W.; Noorman, R.F.; van Pol, J.; Steenbergen, T.; de Voigt, M.J.A. (Kernfysisch Versneller Instituut, 9747 AA Groningen (Netherlands)); Nyberg, J.; Sletten, G. (Neils Bohr Institute, Riso, 4000 Roskilde (Denmark)); Dionisio, J.; Vieu, C. (Centre de Spectrometrie Nucleaire et Spectrometrie de Masse, 91405 Orsay (France))


    The effects of octupole correlations in the [ital Z]=63 nuclei [sup 148[minus]151]Eu are studied. The persistency of octupole instability through the transitional region of near-spherical ([ital N][le]85) towards prolate nuclei ([ital N][ge]88) is established and discussed. Intrinsic dipole moments, which are experimentally inferred from the measured electric dipole transition rates observed between parity doublets, are used to characterize the strength of the octupole correlations.

  19. Atacama Cosmology Telescope: Extragalactic Sources at 148 GHz in the 2008 Survey

    CERN Document Server

    Marriage, T A; Lin, Y -T; Marsden, D; Nolta, M R; Partridge, B; Ade, P A R; Aguirre, P; Amiri, M; Appel, J W; Barrientos, L F; Battistelli, E S; Bond, J R; Brown, B; Burger, B; Chervenak, J; Das, S; Devlin, M J; Dicker, S R; Doriese, W B; Dunkley, J; Dunner, R; Essinger-Hileman, T; Fisher, R P; Fowler, J W; Hajian, A; Halpern, M; Hasselfield, M; Hernandez-Monteagudo, C; Hilton, G C; Hilton, M; Hincks, A D; Hlozek, R; Huffenberger, K M; Hughes, D H; Hughes, J P; Infante, L; Irwin, K D; Kaul, M; Klein, J; Kosowsky, A; Lau, J M; Limon, M; Lupton, R H; Martocci, K; Mauskopf, P; Menanteau, F; Moodley, K; Moseley, H; Netterfield, C B; Niemack, M D; Page, L A; Parker, L; Quintana, H; Reid, B; Sehgal, N; Sherwin, B D; Sievers, J; Spergel, D N; Staggs, S T; Swetz, D S; Switzer, E R; Thornton, R; Trac, H; Tucker, C; Warne, R; Wilson, G; Wollack, E; Zhao, Y


    We report on extragalactic sources detected in a 455 square-degree map of the southern sky made with data at a frequency of 148 GHz from the Atacama Cosmology Telescope 2008 observing season. We provide a catalog of 157 sources with flux densities spanning two orders of magnitude: from 15 to 1500 mJy. Comparison to other catalogs shows that 98% of the ACT detections correspond to sources detected at lower radio frequencies. Three of the sources appear to be associated with the brightest cluster galaxies of low redshift X-ray selected galaxy clusters. Estimates of the radio to mm-wave spectral indices and differential counts of the sources further bolster the hypothesis that they are nearly all radio sources, and that their emission is not dominated by re-emission from warm dust. In a bright (>50 mJy) 148 GHz-selected sample with complete cross-identifications from the Australia Telescope 20 GHz survey, we observe an average steepening of the spectra between 5, 20, and 148 GHz with median spectral indices of $...

  20. Panthenol-stabilized cerium dioxide nanoparticles for cosmeceutic formulations against ROS-induced and UV-induced damage. (United States)

    Zholobak, N M; Shcherbakov, A B; Bogorad-Kobelska, A S; Ivanova, O S; Baranchikov, A Ye; Spivak, N Ya; Ivanov, V K


    A method of panthenol-stabilized cerium dioxide nanoparticles synthesis was developed and their effect on the survival rate of human epidermoid cancer cells HEp-2 and diploid epithelial swine testicular cell line (ST-cells) under oxidative stress conditions induced by hydrogen peroxide introduction and UV irradiation was studied. The results obtained indicate that the use of panthenol as a stabilizer supposedly provides a substantial increase in the efficiency of protection. The degree of protection is determined by panthenol-to-ceria molar ratio. The combination of panthenol and nano-ceria protects biological objects under study from reactive oxygen species (ROS) and UV-irradiation more effectively than individual panthenol or ceria. The protective action of panthenol-stabilized cerium dioxide nanoparticles depends strongly on their composition and the means of their application. PMID:24300997

  1. Real-time observation of dynamic process of oxygen vacancy migration in cerium oxides under electric field

    International Nuclear Information System (INIS)

    The dynamic process of oxygen vacancy migration driven by the external electric field is directly observed at atomic scale in the cerium oxides (CeO2) thin film by in-situ transmission electron microscopy method. When a bias voltage of a proper value is applied across the CeO2 film, the oxygen vacancies are formed near the interface of CeO2/anode, followed by their migration along the direction of the external electric field. The structural modulation occurs in the [110] zone axis due to the ordering of oxygen vacancies. The migration of oxygen vacancies results in the reversible structural transformation, i.e., releasing and storing oxygen processes in CeO2, which is of great significance for the ionic and electronic applications of the cerium oxides materials, such as oxygen pump, gas sensor, resistive random access memory, etc

  2. Synthesis of ordered cerium-doped cubic mesoporous silica using long-chain ionic liquid as template

    Institute of Scientific and Technical Information of China (English)


    The long-chain ionic liquid 1-hexadecyl-3-methylimidazolium chloride (C16mimCl) was used as a template to prepare cerium-doped MCM-48 materials in basic medium by a hydrothermal synthesis procedure.The effect of the amount of Ce salt and C16mimCl/Si on the synthesis were discussed in detail.This mesoporous material exhibits a pore architecture which is cubic Ia3d gyroid and possesses a large surface area and a narrow pore distribution.Cerium in calcined porous framework exists in the form of well-dispersed tetrahedral coordination.The C16mimCl shows a high tendency toward selfaggregation that allows the formation of the ceriumdoped gyroid mesostructure by using the appropriate amount of Ce salt.

  3. Structure phase transformation and equation of state of cerium metal under pressures up to 51 GPa (United States)

    Ce, Ma; Zuo-Yong, Dou; Hong-Yang, Zhu; Guang-Yan, Fu; Xiao, Tan; Bin, Bai; Peng-Cheng, Zhang; Qi-Liang, Cui


    This study presents high pressure phase transitions and equation of states of cerium under pressures up to 51 GPa at room temperature. The angle-dispersive x-ray diffraction experiments are carried out using a high energy synchrotron x-ray source. The bulk moduli of high pressure phases of cerium are calculated using the Birch–Murnaghan equation. We discuss and correct several previous controversial conclusions, which are caused by the measurement accuracy or personal explanation. The c/a axial ratio of ε-Ce has a maximum value at about 29 GPa, i.e., c/a ≈ 1.690. Project supported by the National Natural Science Foundation of China (Grant No. NSAF.U1330115) and the National Major Scientific Instrument and Equipment Development Project of China (Grant No. 2012YQ130234).

  4. Preparation and properties of a cerium-containing hydroxyapatite coating on commercially pure titanium by micro-arc oxidation

    Institute of Scientific and Technical Information of China (English)

    HUANG Yong; WANG Yingjun; NING Chengyun; NAN Kaihui; HAN Yong


    A porous cerium-containing hydroxyapatite coating on commercially pure titanium was prepared by micro-arc oxidation (MAO) in an electrolytic solution containing calcium acetate, β-glycerol phosphate disodium salt pentahydrate (β-GP), and cerium nitrate. The thickness, phase, composition morphology, and biocompatibility of the oxide coating were characterized by X-ray diffraction (XRD), electron probe microanalysis (EPMA), scanning electron microscopy (SEM) with energy dispersive X-ray spectrometer (EDS), and cell culture. The thickness of the MAO film is about 15-25μm, and the coating is porous and uneven, without any apparent interface to the titanium substrates. The results of XRD and EDS show that the porous coating is made up of hydroxyapatite (HA) film containing Ce. The favorable osteoblast cell affinity makes the Ce-HA film have a good biocompatibility. The Ce-HA film is expected to have significant medical applications as dental implants and artificial bone joints.

  5. Real-time observation of dynamic process of oxygen vacancy migration in cerium oxides under electric field

    Energy Technology Data Exchange (ETDEWEB)

    Li, Xiaomin; Qi, Kuo; Sun, Muhua; Huang, Qianming; Xu, Zhi, E-mail:, E-mail:; Wang, Wenlong [Beijing National Laboratory for Condensed Matter Physics and Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China); Bai, Xuedong, E-mail:, E-mail: [Beijing National Laboratory for Condensed Matter Physics and Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China); Collaborative Innovation Center of Quantum Matter, Beijing 100871 (China)


    The dynamic process of oxygen vacancy migration driven by the external electric field is directly observed at atomic scale in the cerium oxides (CeO{sub 2}) thin film by in-situ transmission electron microscopy method. When a bias voltage of a proper value is applied across the CeO{sub 2} film, the oxygen vacancies are formed near the interface of CeO{sub 2}/anode, followed by their migration along the direction of the external electric field. The structural modulation occurs in the [110] zone axis due to the ordering of oxygen vacancies. The migration of oxygen vacancies results in the reversible structural transformation, i.e., releasing and storing oxygen processes in CeO{sub 2}, which is of great significance for the ionic and electronic applications of the cerium oxides materials, such as oxygen pump, gas sensor, resistive random access memory, etc.

  6. Development of electrolytic process in molten salt media for light rare-earth metals production. The metallic cerium electrodeposition

    International Nuclear Information System (INIS)

    The development of molten salt process and the respective equipment aiming rare-earth metals recovery was described. In the present case, the liquid cerium metal electrodeposition in a molten electrolytes of cerium chloride and an equimolar mixture of sodium and potassium chlorides in temperatures near 800C was studied. Due the high chemical reactivity of the rare-earth metals in the liquid state and their molten halides, an electrolytic cell was constructed with controlled atmosphere, graphite crucibles and anodes and a tungsten cathode. The electrolytic process variables and characteristics were evaluated upon the current efficiency and metallic product purity. Based on this evaluations, were suggested some alterations on the electrolytic reactor design and upon the process parameters. (author). 90 refs, 37 figs, 20 tabs

  7. The biological effects of subacute inhalation of diesel exhaust following addition of cerium oxide nanoparticles in atherosclerosis-prone mice

    Energy Technology Data Exchange (ETDEWEB)

    Cassee, Flemming R., E-mail: [National Institute for Public Health and the Environment, PO box 1, 3720 BA Bilthoven (Netherlands); Campbell, Arezoo, E-mail: [Western University of Health Sciences, Pomona, CA (United States); Boere, A. John F., E-mail: [National Institute for Public Health and the Environment, PO box 1, 3720 BA Bilthoven (Netherlands); McLean, Steven G., E-mail: [BHF/University Centre for Cardiovascular Sciences, University of Edinburgh, Edinburgh (United Kingdom); Duffin, Rodger, E-mail: [MRC Centre for Inflammation Research, University of Edinburgh, Edinburgh (United Kingdom); Krystek, Petra, E-mail: [Philips Innovation Services, Eindhoven (Netherlands); Gosens, Ilse, E-mail: [National Institute for Public Health and the Environment, PO box 1, 3720 BA Bilthoven (Netherlands); Miller, Mark R., E-mail: [BHF/University Centre for Cardiovascular Sciences, University of Edinburgh, Edinburgh (United Kingdom)


    Background: Cerium oxide (CeO{sub 2}) nanoparticles improve the burning efficiency of fuel, however, little is known about health impacts of altered emissions from the vehicles. Methods: Atherosclerosis-prone apolipoprotein E knockout (ApoE{sup -/-}) mice were exposed by inhalation to diluted exhaust (1.7 mg/m{sup 3}, 20, 60 or 180 min, 5 day/week, for 4 weeks), from an engine using standard diesel fuel (DE) or the same diesel fuel containing 9 ppm cerium oxide nanoparticles (DCeE). Changes in hematological indices, clinical chemistry, atherosclerotic burden, tissue levels of inflammatory cytokines and pathology of the major organs were assessed. Results: Addition of CeO{sub 2} to fuel resulted in a reduction of the number (30%) and surface area (10%) of the particles in the exhaust, whereas the gaseous co-pollutants were increased (6-8%). There was, however, a trend towards an increased size and complexity of the atherosclerotic plaques following DE exposure, which was not evident in the DCeE group. There were no clear signs of altered hematological or pathological changes induced by either treatment. However, levels of proinflammatory cytokines were modulated in a brain region and liver following DCeE exposure. Conclusions: These results imply that addition of CeO{sub 2} nanoparticles to fuel decreases the number of particles in exhaust and may reduce atherosclerotic burden associated with exposure to standard diesel fuel. From the extensive assessment of biological parameters performed, the only concerning effect of cerium addition was a slightly raised level of cytokines in a region of the central nervous system. Overall, the use of cerium as a fuel additive may be a potentially useful way to limit the health effects of vehicle exhaust. However, further testing is required to ensure that such an approach is not associated with a chronic inflammatory response which may eventually cause long-term health effects.

  8. Cerium(Ⅳ) ammonium nitrate catalysed facile and efficient synthesis of polyhydroquinoline derivatives through Hantzsch multicomponent condensation

    Institute of Scientific and Technical Information of China (English)

    Cherkupally Sanjeeva Reddy; Mekala Raghu


    A general and convenient practical approach for the synthesis of polyhydroquinoline derivatives has been achieved via one-pot four-component Hantzsch condensation of aromatic aldehydes,dimedone,ethyl acetoacetate and ammonium acetate in the presence of a catalytic amount of cerium(Ⅳ) ammonium nitrate (CAN),in ethanol solvent at ambient temperature.Simple work-up,mild reaction conditions,inexpensive and non-toxic catalyst,and excellent product yields are the advantageous features of this method.

  9. Study on corrosion resistance of the BTESPT silane cooperating with rare earth cerium on the surface of aluminum-tube

    Institute of Scientific and Technical Information of China (English)

    肖围; 满瑞林; 缪畅; 彭天兰


    Bis-3-(triethoxysilyl)propyltetrasulfide(BTESPT) silane-rare earth cerium composite coatings on aluminum-tube were prepared at 60 °C by immersion method.The performance of composite coatings to protect the aluminum-tube against corrosion was investigated with potentiodynamic polarization curves,electrochemical impedance spectroscopy(EIS),and salt spray test(SST).The results of potentiodynamic polarization curves and EIS indicated that the self-corrosion current decreased by two orders of magnitude and the i...

  10. Correlation between the energy level structure of cerium-doped yttrium aluminum garnet and luminescent behavior at varying temperatures (United States)

    Song, Zhen; Liu, Xiaolang; He, Lizhu; Liu, Q. L.


    Luminescent spectra of cerium-doped yttrium aluminum garnet are measured at varying temperatures. It is found that the two excitation peaks demonstrate a reverse trend as the temperature rises, and the breadth of the high-energy emission peak experiences an abrupt widening. These effects could be directly linked to the energy level scheme of Ce3+ under the crystal field of local symmetry. Moreover, an alternative fitting function is provided which could effectively resolve the emission curve.

  11. The biological effects of subacute inhalation of diesel exhaust following addition of cerium oxide nanoparticles in atherosclerosis-prone mice

    International Nuclear Information System (INIS)

    Background: Cerium oxide (CeO2) nanoparticles improve the burning efficiency of fuel, however, little is known about health impacts of altered emissions from the vehicles. Methods: Atherosclerosis-prone apolipoprotein E knockout (ApoE−/−) mice were exposed by inhalation to diluted exhaust (1.7 mg/m3, 20, 60 or 180 min, 5 day/week, for 4 weeks), from an engine using standard diesel fuel (DE) or the same diesel fuel containing 9 ppm cerium oxide nanoparticles (DCeE). Changes in hematological indices, clinical chemistry, atherosclerotic burden, tissue levels of inflammatory cytokines and pathology of the major organs were assessed. Results: Addition of CeO2 to fuel resulted in a reduction of the number (30%) and surface area (10%) of the particles in the exhaust, whereas the gaseous co-pollutants were increased (6–8%). There was, however, a trend towards an increased size and complexity of the atherosclerotic plaques following DE exposure, which was not evident in the DCeE group. There were no clear signs of altered hematological or pathological changes induced by either treatment. However, levels of proinflammatory cytokines were modulated in a brain region and liver following DCeE exposure. Conclusions: These results imply that addition of CeO2 nanoparticles to fuel decreases the number of particles in exhaust and may reduce atherosclerotic burden associated with exposure to standard diesel fuel. From the extensive assessment of biological parameters performed, the only concerning effect of cerium addition was a slightly raised level of cytokines in a region of the central nervous system. Overall, the use of cerium as a fuel additive may be a potentially useful way to limit the health effects of vehicle exhaust. However, further testing is required to ensure that such an approach is not associated with a chronic inflammatory response which may eventually cause long-term health effects.

  12. The effects of cerium doping concentration on the properties and photocatalytic activity of bimetallic Mo/Ce catalyst (United States)

    Allaedini, Ghazaleh; Tasirin, Siti Masrinda; Aminayi, Payam


    In this study, the characterization and photocatalytic activity of MoO3 nanoparticles doped with various doping concentrations of cerium have been investigated. The Fourier transform infrared (FT-IR) spectra of the prepared catalysts confirmed that MoO3 particles have been successfully doped by cerium. Field emission scanning electron microscopy (FESEM) was performed to visualize the surface morphology of the obtained catalysts. The XRD patterns suggested that the crystallinity of the sample with the lowest doping concentration of 15 mol % was higher in comparison with samples of higher doping concentrations. The volume-averaged crystal sizes of the obtained catalysts were calculated to be 25, 28, and 32 nm for 15, 35, and 60 mol % samples, respectively. The photocatalytic activity along with the reaction kinetics of Ce-doped MoO3 nanoparticles have also been investigated through the dye degradation of methyl orange. The synthesized Ce-doped MoO3 particles with the lowest dopant concentration of 15 mol % exhibited the highest photocatalytic activity for methyl orange dye degradation. It was observed that photo-degradation activity decreased with an increase in the doping concentration of cerium. The predicted rate constants for samples with 15, 35, and 60 mol % doping concentrations were found to be 0.0432, 0.035, and 0.029 min-1, respectively.

  13. Study of cerium-promoted rhodium alumina catalyst as a steam reforming catalyst for treatment of spent solvents

    Institute of Scientific and Technical Information of China (English)

    Hee-Chul Yang; Min-Woo Lee; Ho-Sang Hwang; Jei-Kwon Moon; Dong-Yong Chung


    This study attempted to develop an appropriate catalyst used for the steam reforming of gasified spent solvents. Rh2O3/ CeO2-Al2O3 catalysts with various CeO2 loadings were prepared and heated at different temperatures of 500 and 800 ºC, and their surface properties were studied using X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS), transmission electron mi-croscopy (TEM), temperature programmed reduction (TPR) and Brumauer-Emmett-Teller (BET) analyses. Rhodium existed in the form of Rh2O3, regardless of the sample composition as well as the heating temperature. In the tested range of cerium addition (up to 12 times the rhodium mass), no significant changes in BET surface areas and binding energy corresponding to Rh 3d5/2were observed. Instead, the addition of cerium led to a greatly enhanced dispersion of rhodium nanoparticles, and no agglomeration of rhodium was observed for samples heated even at 800 ºC. Honeycomb monolith rhodium catalysts promoted with cerium were fabricated and tested for the steam reforming of a gasified spent solvent, mainly consisting of butylene (C4H8). The test results suggested that a ce-rium-promoted rhodium catalyst could be used as an appropriate reforming catalyst for treating low-quality non-methane hydrocar-bons without the formation of coke at high temperatures of up to 900 ºC.

  14. Study on cerium-doped nano-TiO2 coatings for corrosion protection of 316 L stainless steel (United States)

    Li, Suning; Wang, Qian; Chen, Tao; Zhou, Zhihua; Wang, Ying; Fu, Jiajun


    Many methods have been reported on improving the photogenerated cathodic protection of nano-TiO2 coatings for metals. In this work, nano-TiO2 coatings doped with cerium nitrate have been developed by sol-gel method for corrosion protection of 316 L stainless steel. Surface morphology, structure, and properties of the prepared coatings were investigated by X-ray diffraction, X-ray photoelectron spectroscopy, scanning electron microscopy and energy dispersive X-ray spectroscopy. The corrosion protection performance of the prepared coatings was evaluated in 3 wt% NaCl solution by using electrochemical techniques in the presence and absence of simulated sunlight illumination. The results indicated that the 1.2% Ce-TiO2 coating with three layers exhibited an excellent photogenerated cathodic protection under illumination attributed to the higher separation efficiency of electron-hole pairs and higher photoelectric conversion efficiency. The results also showed that after doping with an appropriate concentration of cerium nitrate, the anti-corrosion performance of the TiO2 coating was improved even without irradiation due to the self-healing property of cerium ions.

  15. Ternary Plutonium-Cerium-Nickel Alloys as a Possible Fuel for Fast Reactors with Liquid Metal Cores

    International Nuclear Information System (INIS)

    The authors present results of a study of ternary plutonium-cerium-nickel alloys. From metallographic. thermal and X-ray analyses of these ternary alloys they obtained the projection of the liquidus curve onto the concentration triangle and the contours of the phase regions of the phase diagram over the isothermal cross-section for 400°C. The existence is established of a continuous series of solid solutions between the intermetallic compounds CeNi and PuNi, The maximum solubility of plutonium in the compound Ce7Ni3 is approximately 47.0 at. %. In the plutonium-cerium-nickel system there is a ternary eutectic with its melting point at 480°C. The composition of this eutectic is as follows: 45 at. % plutonium, 30 at. % cerium and 25 at.% nickel. The authors assume the existence of a peritectic point, the composition of which is not accurately established. The alloys, which lie along the valley line connecting the binary eutectics in the CeNi, PuNi system have a melting point not higher than 470°C. These alloys have a promising future as a fuel for fast reactors with liquid metal cores. (author)

  16. A Sequence Variation (I148M) in PNPLA3 Associated with Nonalcoholic Fatty Liver Disease Disrupts Triglyceride Hydrolysis*


    He, Shaoqing; McPhaul, Christopher; Li, John Zhong; Garuti, Rita; Kinch, Lisa; Nick V Grishin; Cohen, Jonathan C.; Hobbs, Helen H.


    Obesity and insulin resistance are associated with deposition of triglycerides in tissues other than adipose tissue. Previously, we showed that a missense mutation (I148M) in PNPLA3 (patatin-like phospholipase domain-containing 3 protein) is associated with increased hepatic triglyceride content in humans. Here we examined the effect of the I148M substitution on the enzymatic activity and cellular location of PNPLA3. Structural modeling predicted that the substitution of methionine for isoleu...

  17. Q148N, a Novel Integrase Inhibitor Resistance Mutation Associated with Low-Level Reduction in Elvitegravir Susceptibility. (United States)

    Varghese, Vici; Pinsky, Benjamin A; Smith, Darvin S; Klein, Daniel; Shafer, Robert W


    The integrase strand transfer inhibitor (INSTI)-resistance mutations Q148H/K/R are arguably the most important INSTI-resistance mutations as they represented the first step to high-level dolutegravir cross-resistance. We describe an individual with transmitted four-class drug resistance whose virus sequence had the previously uncharacterized mutation Q148N. Infectious molecular HIV-1 clones containing Q148N alone and in combination with G140S demonstrated ∼2.4-4.5 reduced elvitegravir susceptibility depending on the virus's genetic context but retained susceptibility to raltegravir and dolutegravir. This level of reduced elvitegravir susceptibility is lower than that observed with Q148H/K/R and in fact the infected individual responded to an initial treatment regimen containing tenofovir/emtricitabine/elvitegravir/cobicistat. Q148N was associated with a higher replication capacity than Q148H, suggesting that this mutation may be more fit in the absence of selective INSTI therapy. PMID:27009474

  18. Freshwater dispersion stability of PAA-stabilised cerium oxide nanoparticles and toxicity towards Pseudokirchneriella subcapitata

    Energy Technology Data Exchange (ETDEWEB)

    Booth, Andy, E-mail: [SINTEF Materials and Chemistry, Trondheim N-7465 (Norway); Størseth, Trond [SINTEF Materials and Chemistry, Trondheim N-7465 (Norway); Altin, Dag [BioTrix, Trondheim N-7022 (Norway); Fornara, Andrea; Ahniyaz, Anwar [German Federal Institute for Risk Assessment (BfR), Department of Product Safety, Berlin (Germany); Jungnickel, Harald; Laux, Peter; Luch, Andreas [SP Chemistry, Materials and Surfaces, Drottning Kristinas vag 45, SE-11686 Stockholm (Sweden); Sørensen, Lisbet [SINTEF Materials and Chemistry, Trondheim N-7465 (Norway)


    An aqueous dispersion of poly (acrylic acid)-stabilised cerium oxide (CeO{sub 2}) nanoparticles (PAA-CeO{sub 2}) was evaluated for its stability in a range of freshwater ecotoxicity media (MHRW, TG 201 and M7), with and without natural organic matter (NOM). In a 15 day dispersion stability study, PAA-CeO{sub 2} did not undergo significant aggregation in any media type. Zeta potential varied between media types and was influenced by PAA-CeO{sub 2} concentration, but remained constant over 15 days. NOM had no influence on PAA-CeO{sub 2} aggregation or zeta potential. The ecotoxicity of the PAA-CeO{sub 2} dispersion was investigated in 72 h algal growth inhibition tests using the freshwater microalgae Pseudokirchneriella subcapitata. PAA-CeO{sub 2} EC{sub 50} values for growth inhibition (GI; 0.024 mg/L) were 2–3 orders of magnitude lower than pristine CeO{sub 2} EC{sub 50} values reported in the literature. The concentration of dissolved cerium (Ce{sup 3+}/Ce{sup 4+}) in PAA-CeO{sub 2} exposure suspensions was very low, ranging between 0.5 and 5.6 μg/L. Free PAA concentration in the exposure solutions (0.0096–0.0384 mg/L) was significantly lower than the EC{sub 10} growth inhibition (47.7 mg/L) value of pure PAA, indicating that free PAA did not contribute to the observed toxicity. Elemental analysis indicated that up to 38% of the total Cerium becomes directly associated with the algal cells during the 72 h exposure. TOF-SIMS analysis of algal cell wall compounds indicated three different modes of action, including a significant oxidative stress response to PAA-CeO{sub 2} exposure. In contrast to pristine CeO{sub 2} nanoparticles, which rapidly aggregate in standard ecotoxicity media, PAA-stabilised CeO{sub 2} nanoparticles remain dispersed and available to water column species. Interaction of PAA with cell wall components, which could be responsible for the observed biomarker alterations, could not be excluded. This study indicates that the increased

  19. Cytotoxicity and antibacterial activity of gold-supported cerium oxide nanoparticles

    Directory of Open Access Journals (Sweden)

    Suresh Babu K


    Full Text Available K Suresh Babu,1,† M Anandkumar,1,† TY Tsai,2 TH Kao,2 B Stephen Inbaraj,2 BH Chen2,31Centre for Nano Sciences and Technology, Madanjeet School of Green Energy Technologies, Pondicherry University, Kalapet, India; 2Department of Food Science, 3Graduate Institute of Medicine, Fu Jen University, Taipei, Taiwan†These authors contributed equally to this workBackground: Cerium oxide nanoparticles (CeO2 have been shown to be a novel therapeutic in many biomedical applications. Gold (Au nanoparticles have also attracted widespread interest due to their chemical stability and unique optical properties. Thus, decorating Au on CeO2 nanoparticles would have potential for exploitation in the biomedical field. Methods: In the present work, CeO2 nanoparticles synthesized by a chemical combustion method were supported with 3.5% Au (Au/CeO2 by a deposition-precipitation method. The as-synthesized Au, CeO2, and Au/CeO2 nanoparticles were evaluated for antibacterial activity and cytotoxicity in RAW 264.7 normal cells and A549 lung cancer cells. Results: The as-synthesized nanoparticles were characterized by X-ray diffraction, scanning and transmission electron microscopy, and ultraviolet-visible measurements. The X-ray diffraction study confirmed the formation of cubic fluorite-structured CeO2 nanoparticles with a size of 10 nm. All synthesized nanoparticles were nontoxic towards RAW 264.7 cells at doses of 0–1,000 µM except for Au at >100 µM. For A549 cancer cells, Au/CeO2 had the highest inhibitory effect, followed by both Au and CeO2 which showed a similar effect at 500 and 1,000 µM. Initial binding of nanoparticles occurred through localized positively charged sites in A549 cells as shown by a shift in zeta potential from positive to negative after 24 hours of incubation. A dose-dependent elevation in reactive oxygen species indicated that the pro-oxidant activity of the nanoparticles was responsible for their cytotoxicity towards A549 cells. In

  20. Steric and electronic effects of 1,3-disubstituted cyclopentadienyl ligands on metallocene derivatives of Cerium, Titanium, Manganese, and Iron

    Energy Technology Data Exchange (ETDEWEB)

    Sofield, C.D.


    Sterically demanding 1,3-disubstituted cyclopentadienyl ligands were used to modify the physical properties of the corresponding metallocenes. Sterically demanding ligands provided kinetic stabilization for trivalent cerium compounds. Tris(di-t-butylcyclopentadienyl)cerium was prepared and anion competition between halides and cyclopentadienyl groups which had complicated synthesis of the tris(cyclopentadienyl)compound was qualitatively examined. Bis(di-t-butylcyclopentadienyl)cerium methyl was prepared and its rate of decomposition, by ligand redistribution, to tris(di-t-butylcyclopentadienyl)cerium was shown to be slower than the corresponding rate for less sterically demanding ligands. Asymmetrically substituted ligands provided a symmetry label for examination of chemical exchange processes. Tris[trimethylsilyl(t-butyl)cyclopentadienyl]cerium was prepared and the rate of interconversion between the C1 and C3 isomers was examined. The enthalpy difference between the two distereomers is 7.0 kJ/mol. The sterically demanding cyclopentadienyl ligands ansa-di-t-butylcyclopentadiene (Me2Si[(Me3C)2C5H3]2), ansa-bis(trimethylsilyl)cyclopentadiene (Me2Si[(Me3Si)2C5H3]2) and tetra-t-butylfulvalene and metallocene derivatives of the ligands were prepared and their structures were examined by single crystal X-ray crystallography. The effect that substituents on the cyclopentadienyl ring have on the pi-electron system of the ligand was examined through interaction between ligand and metal orbitals. A series of 1,3-disubstituted manganocenes was prepared and their electronic states were determined by solid-state magnetic susceptibility, electron paramagnetic resonance, X-ray crystallography, and variable temperature UV-vis spectroscopy. Spin-equilibria in [(Me3C)2C5H3]2Mn and [(Me3C)(Me3Si)C5H3]2Mn were examined and indicate an enthalpy difference of 15 kJ/mol between the high-spin and low-spin forms. Cyclopentadienyl groups resistant to intramolecular oxidative addition

  1. miRNA-148a 在膀胱癌组织中的表达及生物信息学分析%Expression of miRNA-148a in Bladder Carcinoma Tissues and Its Bioinformatics Analysis

    Institute of Scientific and Technical Information of China (English)

    谢小娟; 朱娜; 潘晶晶; 魏力强; 陈葳


    Objective To explore the role of miRNA-148a in bladder tumorous development and progression.Methods Ex-pression of miRNA-148a was assessed in 35 bladder carcinoma tissues and 16 non-carcinoma tissues by fluorescence quanti-tative real time PCR,and correlation with clinical features was evaluated.Target genes and transcription factors of miRNA-148a were predicted using bioinformatic analysis,then TF-miRNA-148a-target genes network diagram was built and the tar-get genes was analyzed of gene ontology enrichment and KEGG pathway.Results Expression of miRNA-148a was lower in bladder carcinoma tissues than in non-carcinoma tissues(0.000 8±0.000 2 vs 0.002 1±0.000 5)(t=2.46,P 0.05).268 target genes of miRNA-148a were predicted by three softwares at the same time,60 transcription factors were predicted and the binding sites with combination scroes above 80 was 657.The target genes of miRNA-148a was enriched in many biological processes,such as neuron differentiation,generation of neurons,neuron projec-tion development,cytoplasmic mRNA processing body,cytoplasm(P <0.001).They also participated in p53 signaling path-way,proteoglycans in cancer-homo sapiens,pathways in cancer,prostate cancer,protein processing in endoplasmic reticulum, focal adhesion and so on(P <0.05).According to TF-miRNA-148a-target genes network diagram,miRNA-148a was regula-ted by SP1,ESR1,AP1,MYC and BRCA1,genes of IGF1,P27kip1 ,NCOA1,PTEN,SERPINE1 might be regulated by miR-NA-148a.Conclusion miRNA-148a which was significantly down-regulation in bladder carcinoma tissues may be participate in bladder tumorous development and progression,bioinformatics analysis provides some ideas for further research.%目的:探索 miRNA-148a 在膀胱癌发生发展中的作用。方法收集35例膀胱癌组织和16例非癌组织,采用荧光定量 PCR 方法检测 miRNA-148a 的相对表达量,并分析其与临床特征的相关性;采用生物信息学分析,预测 miRNA-148a的靶基

  2. Cerium Substitution in Yttrium Iron Garnet: Valence State, Structure, and Energetics

    Energy Technology Data Exchange (ETDEWEB)

    Guo, Xiaofeng; Tavakoli, Amir H.; Sutton, Steve; Kukkadapu, Ravi K.; Qi, Liang; Lanzirotti, Anthony; Newville, Mathew; Asta, Mark D.; Navrotsky, Alexandra


    The garnet structure is a promising nuclear waste form because it can accommodate various actinide elements. Y3Fe5O12 (YIG) is a model composition for such substitutions. Since cerium (Ce) can be considered an analogue of actinide elements such as thorium (Th), plutonium (Pu), and uranium (U), studying the local structure and thermodynamic stability of Ce-substituted YIG (Ce:YIG) can provide insights into the structural and energetic aspects of large ion substitution in garnets. Single phases of yttrium iron garnet with Ce substitution up to 20 mol % (Y3-xCexFe5O12 with 0 ≤ x ≤ 0.2) were synthesized through a citrate-nitrate combustion method. The oxidation state of cerium was examined by X-ray absorption near edge structure spectroscopy (XANES); the oxidation state and site occupancy of Fe as a function of Ce loading also was monitored by 57Fe-Mössbauer spectroscopy. These measurements establish that Ce is predominantly in the trivalent state at low substitution levels, while a mixture of trivalent and tetravalent states are observed at higher concentrations. Fe was predominately trivalent and exists in multiple environments. High temperature oxide melt solution calorimetry was used to determine the enthalpy of formation of these Ce-substituted YIG garnets. The thermodynamic analysis demonstrated that, although there is an entropic driving force for the substitution of Ce for Y, the substitution reaction is enthalpically unfavorable. The experimental results are complemented by electronic structure calculations performed within the framework of density functional theory (DFT) with Hubbard-U corrections, which reproduce the observed increase in the tendency for tetravalent Ce to be present with higher loading of Ce. The DFT+U results suggest that the energetics underlying the formation of tetravalent Ce involves a competition between an unfavorable energy to oxidize Ce and reduce Fe, and a favorable contribution due to strain-energy reduction. The structural

  3. Effects of amorphous silica coating on cerium oxide nanoparticles induced pulmonary responses (United States)

    Ma, Jane; Mercer, Robert R.; Barger, Mark; Schwegler-Berry, Diane; Cohen, Joel M.; Demokritou, Philip; Castranova, Vincent


    Recently cerium compounds have been used in a variety of consumer products, including diesel fuel additives, to increase fuel combustion efficiency and decrease diesel soot emissions. However, cerium oxide (CeO2) nanoparticles have been detected in the exhaust, which raises a health concern. Previous studies have shown that exposure of rats to nanoscale CeO2 by intratracheal instillation (IT) induces sustained pulmonary inflammation and fibrosis. In the present study, male Sprague–Dawley rats were exposed to CeO2 or CeO2 coated with a nano layer of amorphous SiO2 (aSiO2/CeO2) by a single IT and sacrificed at various times post-exposure to assess potential protective effects of the aSiO2 coating. The first acellular bronchoalveolar lavage (BAL) fluid and BAL cells were collected and analyzed from all exposed animals. At the low dose (0.15 mg/kg), CeO2 but not aSiO2/CeO2 exposure induced inflammation. However, at the higher doses, both particles induced a dose-related inflammation, cytotoxicity, inflammatory cytokines, matrix metalloproteinase (MMP)-9, and tissue inhibitor of MMP at 1 day post-exposure. Morphological analysis of lung showed an increased inflammation, surfactant and collagen fibers after CeO2 (high dose at 3.5 mg/kg) treatment at 28 days post-exposure. aSiO2 coating significantly reduced CeO2-induced inflammatory responses in the airspace and appeared to attenuate phospholipidosis and fibrosis. Energy dispersive X-ray spectroscopy analysis showed Ce and phosphorous (P) in all particle-exposed lungs, whereas Si was only detected in aSiO2/CeO2-exposed lungs up to 3 days after exposure, suggesting that aSiO2 dissolved off the CeO2 core, and some of the CeO2 was transformed to CePO4 with time. These results demonstrate that aSiO2 coating reduce CeO2-induced inflammation, phospholipidosis and fibrosis. PMID:26210349

  4. Interactive effects of cerium oxide and diesel exhaust nanoparticles on inducing pulmonary fibrosis

    Energy Technology Data Exchange (ETDEWEB)

    Ma, Jane Y.C., E-mail: [Health Effects Laboratory Division, National Institute for Occupational Safety and Health, Morgantown, WV 26505 (United States); Young, Shih-Houng; Mercer, Robert R.; Barger, Mark; Schwegler-Berry, Diane [Health Effects Laboratory Division, National Institute for Occupational Safety and Health, Morgantown, WV 26505 (United States); Ma, Joseph K. [School of Pharmacy, West Virginia University, Morgantown, WV 26506 (United States); Castranova, Vincent [Health Effects Laboratory Division, National Institute for Occupational Safety and Health, Morgantown, WV 26505 (United States)


    Cerium compounds have been used as a fuel-borne catalyst to lower the generation of diesel exhaust particles (DEPs), but are emitted as cerium oxide nanoparticles (CeO{sub 2}) along with DEP in the diesel exhaust. The present study investigates the effects of the combined exposure to DEP and CeO{sub 2} on the pulmonary system in a rat model. Specific pathogen-free male Sprague–Dawley rats were exposed to CeO{sub 2} and/or DEP via a single intratracheal instillation and were sacrificed at various time points post-exposure. This investigation demonstrated that CeO{sub 2} induces a sustained inflammatory response, whereas DEP elicits a switch of the pulmonary immune response from Th1 to Th2. Both CeO{sub 2} and DEP activated AM and lymphocyte secretion of the proinflammatory cytokines IL-12 and IFN-γ, respectively. However, only DEP enhanced the anti-inflammatory cytokine IL-10 production in response to ex vivo LPS or Concanavalin A challenge that was not affected by the presence of CeO{sub 2}, suggesting that DEP suppresses host defense capability by inducing the Th2 immunity. The micrographs of lymph nodes show that the particle clumps in DEP + CeO{sub 2} were significantly larger than CeO{sub 2} or DEP, exhibiting dense clumps continuous throughout the lymph nodes. Morphometric analysis demonstrates that the localization of collagen in the lung tissue after DEP + CeO{sub 2} reflects the combination of DEP-exposure plus CeO{sub 2}-exposure. At 4 weeks post-exposure, the histological features demonstrated that CeO{sub 2} induced lung phospholipidosis and fibrosis. DEP induced lung granulomas that were not significantly affected by the presence of CeO{sub 2} in the combined exposure. Using CeO{sub 2} as diesel fuel catalyst may cause health concerns. - Highlights: • DEP induced acute lung inflammation and switched immune response from Th1 to Th2. • DEP induced lung granulomas were not affected by the presence of CeO{sub 2}. • CeO{sub 2} induced sustained lung

  5. Retraction. I148M PNPLA3 variant and progressive liver disease: A new paradigm in hepatology. (United States)


    Retraction: The following editorial from HEPATOLOGY, "I148M PNPLA3 variant and progressive liver disease: A new paradigm in hepatology", by Luca Valenti, Anna Alisi and Valerio Nobili, posted online on 2 December 2011 as an Accepted Article in Wiley Online Library (, has been retracted by agreement between the authors, the AASLD, the journal Editor in Chief, Michael H. Nathanson, and Wiley Periodicals, Inc. The retraction has been agreed due to the fact that an incorrect version was posted online. The correct version of the Editorial has been issued under a separate DOI, 10.1002/hep.25617.

  6. Patatin-like phospholipase domain containing-3 gene I148M polymorphism, steatosis, and liver damage in hereditary hemochromatosis

    Institute of Scientific and Technical Information of China (English)

    Luca Valenti; Paolo Maggioni; Alberto Piperno; Raffaela Rametta; Sara Pelucchi; Raffaella Mariani; Paola Dongiovanni; Anna Ludovica Fracanzani; Silvia Fargion


    AIM:To investigate whether the patatin-/ike phospho/ipase domain containing-3 gene (PNPLA3) I148M polymorphism is associated with steatosis,fibrosis stage,and cirrhosis in hereditary hemochromatosis (HH).METHODS:We studied 174 consecutive unrelated homozygous for the C282Y HFE mutation of HH (C282Y+/+ HH) patients from Northern Italy,for whom the presence of cirrhosis could be determined based on histological or clinical criteria,without excessive alcohol intake (< 30/20 g/d in males or females) or hepatitis B virus and hepatitis C virus viral hepatitis.Steatosis was evaluated in 123 patients by histology (n =100) or ultrasound (n =23).The PNPLA3 rs738409 single nucleotide polymorphism,encoding for the p.148M protein variant,was genotyped by a Taqman assay (assay on demand,Applied Biosystems).The association of the PNPLA3 I148M protein variant (p.I148M) with steatosis,fibrosis stage,and cirrhosis was evaluated by logistic regression analysis.RESULTS:PNPLA3 genotype was not associated with metabolic parameters,including body mass index (BMI),the presence of diabetes,and lipid levels,but the presence of the p.148M variant at risk was independently associated with steatosis [odds ratio (OR) 1.84 per p.148M allele,95% confidence interval (CI):1.05-3.31;P =0.037],independently of BMI and alanine aminotransaminase (ALT) levels.The p.148M variant was also associated with higher aspartate aminotransferase (P =0.0014) and ALT levels (P =0.017) at diagnosis,independently of BMI and the severity of iron overload.In patients with liver biopsy,the 148M variant was independently associated with the severity (stage) of fibrosis (estimated coefficient 0.56 ± 0.27,P =0.041).In the overall series of patients,the p.148M variant was associated with cirrhosis in lean (P =0.049),but not in overweight patients (P =not significant).At logistic regression analysis,cirrhosis was associated with BMI ≥ 25 (OR 1.82,95% CI:1.02-3.55),ferritin > 1000 ng/mL at diagnosis (OR 19.3,95

  7. Mechanism of trace cerium in ultra-clean IF steel%微量稀土铈在超洁净IF钢中的作用

    Institute of Scientific and Technical Information of China (English)

    杨吉春; 栗宏伟; 周莉; 张剑; 刘南


    The existence forms of cerium in ultra-IF steel,in which the contents of oxygen and sulphur were both less than 0.000 6%,were studied by chemical analysis,thermodynamic calculation,micro-examination and hardness mea-surement. And the effects of cerium on Al2O3 inclusions,microstructure and hardness were discussed. The results show that,when the cerium content was between 0.006 1%and 0.009 3%,the solid solubility of cerium range from 0.004 1%to 0.006 7%. About seventy percent of cerium is in the form of solid solution,the rest of cerium is in the form of inclu-sions,and there is no Ce-Fe intermetallic compound in the steel. By adding cerium,Al2O3 inclusions are modified into smaller globular CeAlO3 inclusions. Cerium played a role in modifying inclusions in the steel. Cerium has the effect of re-fining the microstructures of the steel. The greater the amount of solid solution of cerium was,the finer the crystalline grains were. When the content of cerium are 0.006 1%and 0.009 3%,Rockwell hardness increases by 7.6%and 12.7%re-spectively compared with IF steel without cerium.%采用化学成分分析、热力学计算、显微观察、硬度测定的方法,研究了稀土铈在氧和硫质量分数均小于0.0006%的超洁净IF钢中的存在状态,以及铈对钢的Al2O3夹杂物、显微组织和硬度的影响机理。结果表明,当铈质量分数为0.0061%~0.0093%时,铈的固溶量为0.0041%~0.0067%,约70%的铈以固溶形态存在,其余的铈以夹杂物形态存在,钢中不存在铈铁金属间化合物。铈能够将Al2O3夹杂物转化为尺寸较小的球状CeAlO3夹杂物,具有变质夹杂物的作用。铈具有改善IF钢的显微组织的作用,钢中铈的固溶量越大,晶粒越细。与不含铈的IF钢相比,当钢中铈质量分数为0.0061%和0.0093%时,钢的洛氏硬度分别提高了7.6%和12.7%。

  8. Clinical study of androgenic alopecia in 148 patients%男性型脱发148例临床分析

    Institute of Scientific and Technical Information of China (English)

    谭凤明; 侯显曾; 张滨岳; 姚海峰; 程喜平


    目的 探讨男性型脱发的临床特征.方法 收集148例男性型脱发病例的临床资料,并对患者的发病年龄、家族史、临床分级、疗效、血清双氢睾酮(DHT)、轻拉试验进行分析.结果 发病年龄以 15~25岁占比例最大,家族史与发病年龄相关,家族史与临床分级相关,血清DHT水平升高占80.41%,非那雄胺治疗总有效率为88.98%,轻拉试验阳性占22.97%.结论 男性型脱发发病年龄偏早,发病与职业、精神神经因素有关,有家族史患者的发病年龄比无家族史患者的发病年龄更早,有家族史患者出现重型男性型脱发的可能性更大,疗效与疗程呈正相关,疗效与家族史无关,部分患者出现轻拉试验阳性.%Objective To investigate the clinical characteristics of androgenic alopecia. Methods The clinical information of 148 cases of androgenic alopecia during the last three years was collected. The age of onset, family history, clinical classification, therapeutic efficacy, plasma dihydrotestosterone ( DHT ), light hair - pull test of the patients were analyzed. Results Most diseases got onset at the age between 15 and 25. Significant correlations were revealed between the family history and onset age or clinical classification ( P <0. 05 ). Elevated DHT was also revealed in 80. 41% patients. The overall effective rate of fiansteride treatment and positive light hair-pull rates were 88. 98% and 22. 97% , respectively. Conclusion The onset age of androgenic alopecia is young. And it is correlated with occupational and psychiatric factors. Patients with family history suffer earlier onset age and higher probability of severe androgenic alopecia. However, the efficacy of treatment is correlated with the course of therapy but not with family history.

  9. Clinical and cytogenetic analysis of 148 patients with Turner syndrome%148例Turner综合征患者临床与细胞遗传学研究

    Institute of Scientific and Technical Information of China (English)

    李川; 范歆; 罗静思; 钱家乐; 欧珊; 陈少科



  10. Prediction of yttrium, lanthanum, cerium, and neodymium leaching recovery from apatite concentrate using artificial neural networks

    Institute of Scientific and Technical Information of China (English)

    E. Jorjani; A.H. Bagherieh; Sh. Mesroghli; S. Chehreh Chelgani


    The assay and recovery of rare earth elements (REEs) in the leaching process is being determined using expensive analytical methods: inductively coupled plasma atomic emission spectroscopy (ICP-AES) and inductively coupled plasma mass spectroscopy (ICP-MS). A neural network model to predict the effects of operational variables on the lanthanum, cerium, yttrium, and neodymium recovery in the leaching of apatite concentrate is presented in this article. The effects of leaching time (10 to 40 min),pulp densities (30% to 50%), acid concentrations (20% to 60%), and agitation rates (100 to 200 r/min), were investigated and optimized on the recovery of REEs in the laboratory at a leaching temperature of 60οC. The obtained data in the laboratory optimization process were used for training and testing the neural network. The feed-forward artificial neural network with a 4-5-5-1 arrangement was capable of estimating the leaching recovery of REEs. The neural network predicted values were in good agreement with the experimental results. The correlations of R=1 in training stages, and R=0.971, 0.952, 0.985, and 0.98 in testing stages were a result of Ce, Nd, La, and Y recovery prediction respectively, and these values were usually acceptable. It was shown that the proposed neural network model accurately reproduced all the effects of the operation variables, and could be used in the simulation of a leaching plant for REEs.

  11. Preparation of Nano-TiO2 Doped with Cerium and Its Photocatalytic Activity

    Institute of Scientific and Technical Information of China (English)


    Cerium-doped titanium dioxide nano-powders were prepared through the sol-gel method and the compound samples were characterized by X-ray diffraction (XRD), transmission electron microscopy (TEM), and UV/Vis diffuse reflectance spectra (DRS). The photocatalytic activity was evaluated by photocatalytic degradation of phenol in water. The results of XRD, TEM, and DRS show that pure TiO2 and Ce-doped TiO2 powder crystallines are a mixture of anatase and rutile;the doping can retard the development of the grain size of TiO2 and decrease the diameter of TiO2 from more than 20nm of pure TiO2 to about 10 nm;the doped TiO2 can improve the light absorption of TiO2 and suitable doping content tends to move the DRS spectrum of TiO2 towards visible light, but too much doping is not good for the light absorption ability.The results of the photocatalytic experiments show that doping with Ce content of 0.08 % ~ 0.4 % can increase the photocatalytic activity of TiO2;however, doping with Ce content of 0.5 % ~ 2.5 % can significantly decrease the photocatalytic activity of TiO2. The favorite doping content is 0.4 % in the range of our experiments.

  12. Effects of cerium oxide nanoparticles on soil enzymatic activities and wheat grass nutrients uptake (United States)

    Li, Biting; Chen, Yirui; Bai, Lingyun; Jacobson, Astrid; Darnault, Christophe


    The US National Science Foundation estimated that the use of nanomaterials and nanotechnology would reach a global market value of 1 million this year. Concomitant with the wide applications of nanoparticles is an increasing risk of adverse effects to the environment and human health. As a common nanomaterial used as a fuel catalyst and polish material, cerium (IV) oxide nanoparticles (CeO2 NP) were tested for their potential impact on soil health and plant growth. Through exposure by air, water, and solid deposition, nanoparticles may accumulate in soils and impact agricultural systems. The objectives of this research were to determine whether CeO2 NPs affect the growth of wheat grass and selected soil enzyme activities chose as indicators of soil health. Wheat grass was grown in plant boxes containing CeO2 NPs mixed with agricultural soil at different concentrations. Two control groups were included: one consisting of soil with plants but no CeO2 NPs, and one containing only soil, i.e., no NP or wheat plants added. The plants were grown for 10 weeks and harvested every two weeks in a laboratory under sodium growth lights. At the end of the each growing period, two weeks, soils were assayed for phosphatase, β-glucosidase, and urease activities, and NPK values. Spectrophotometer analyses were used to assess enzyme activities, and NPK values were tested by Clemson Agricultural Center. Wheat yields were estimated by shoot and root lengths and weights.

  13. Biodiesel production over thermal activated cerium modified Mg-Al hydrotalcites

    International Nuclear Information System (INIS)

    Heterogeneous basic catalysts can be used for biodiesel production. The performances of several types of such materials are described in the literature but small attention is given to its deactivation in reaction medium. This paper put in evidence that catalysts are not static identities in the reaction medium, and relates the physical characteristics of fresh and post reaction samples with deactivation mechanisms. Catalysts, tested during the methanolysis of soybean oil, were prepared by thermal activation of Ce modified Mg-Al hydrotalcites (Mg/Al = 3, Ce/Mg 0.03 (atomic ratio) presented FAME yields higher than 90%. Thermogravimetry analysis of post reaction catalysts evidenced that cerium influences the reaction mechanism. The post reaction catalysts evidenced that surface restructuring occurs during reaction with sizeable change of the elements distribution which as beneficial effect on the catalytic performances. -- Highlights: ► Basic heterogeneous catalysts have been tested during the methanolysis of soybean oil to produces biodiesel (FAME). ► Catalysts were prepared by thermal activation of Ce modified Mg-Al hydrotalcites. ► Samples prepared with Ce/Mg < 0.05 (molar ratio) showed hydrotalcite XRD patterns even after calcination. ► Ce promotes fast rehydration/restructuration of the hydrotalcite having a beneficial effect on the catalytic performances.

  14. Synthesis, characterization and thermal expansion measurements on uranium-cerium mixed oxides (United States)

    Venkata Krishnan, R.; Panneerselvam, G.; Singh, Brij Mohan; Kothandaraman, B.; Jogeswararao, G.; Antony, M. P.; Nagarajan, K.


    Uranium-cerium mixed oxides (U 1-yCe y)O 2 ( y = 0.2, 0.4, 0.6, 0.8) were prepared by combustion synthesis using citric acid as the fuel. Sintering of the solid solutions was carried out at 1873 K under reduced atmosphere. From the room temperature XRD patterns of the sintered samples it was found that the solid solutions form single phase fluorite structure. The room temperature lattice parameters of (U 1-yCe y)O 2 ( y = 0.2, 0.4, 0.6, 0.8) are 0.5458, 0.5446, 0.5434 and 0.5422 nm respectively. Thermal expansion of (U 1-yCe y)O 2 ( y = 0.2, 0.4, 0.6, 0.8) in the temperature range 298-1973 K was measured by high temperature X-ray diffraction (HTXRD). The coefficients of thermal expansion increase with increase in CeO 2 content in the sample and the measured data in the temperature range 298-1973 K, for (U 1-yCe y)O 2 ( y = 0.2, 0.4, 0.6, 0.8) are 18.23, 19.91, 21.59, 23.29 × 10 -6 K -1, respectively.

  15. The low-aluminium cast iron of reduced silicon content treated with cerium mischmetal

    Directory of Open Access Journals (Sweden)

    M. S. Soiński


    Full Text Available The work presents the effect of cerium mischmetal used in quantities of 0.1 and 0.2 wt-% and ferrosilicon used in quantities from 0.5% to 1.5% on the alloy matrix and the shape of graphite precipitates in the low-aluminium cast iron from seven heats, basing on the examination of its structure. The hypereutectic cast iron of the relatively high carbon content (4.0÷4.2% at the prior-to-treatment silicon and manganese content equal to ca. 0.6% and ca. 0.04%, respectively, has been examined.It has been found that the performed treatment leads to the change in the alloy matrix from the nearly almost pearlitic to the ferritic-pearlitic one accompanied by changes in the shape of graphite precipitates. Due to applying both of the mentioned substances in the above stated amounts the graphite precipitates in cast iron have taken the shape of nodular and vermicular ones, and no presence of flake graphite has been revealed. A quantitative analysis of the performed treatment i.e. determining the fractions of graphite precipitates of different shapes has been possible by means of a computer image analyser.

  16. Preparation and evaluation of cerium oxide-bovine hydroxyapatite composites for biomedical engineering applications. (United States)

    Gunduz, O; Gode, C; Ahmad, Z; Gökçe, H; Yetmez, M; Kalkandelen, C; Sahin, Y M; Oktar, F N


    The fabrication and characterization of bovine hydroxyapatite (BHA) and cerium oxide (CeO2) composites are presented. CeO2 (at varying concentrations 1, 5 and 10wt%) were added to calcinated BHA powder. The resulting mixtures were shaped into green cylindrical samples by powder pressing (350MPa) followed by sintering in air (1000-1300°C for 4h). Density, Vickers microhardness (HV), compression strength, scanning electron microscopy (SEM) and X-ray diffraction (XRD) studies were performed on the products. The sintering behavior, microstructural characteristics and mechanical properties were evaluated. Differences in the sintering temperature (for 1wt% CeO2 composites) between 1200 and 1300°C, show a 3.3% increase in the microhardness (564 and 582.75HV, respectively). Composites prepared at 1300°C demonstrate the greatest compression strength with comparable results for 5 and 10wt% CeO2 content (106 and 107MPa) which are significantly better than those for 1wt% and those that do not include any CeO2 (90 and below 60MPa, respectively). The results obtained suggest optimal parameters to be used in preparation of BHA and CeO2 composites, while also highlighting the potential of such materials in several biomedical engineering applications.

  17. Effect of cerium on photosynthetic characteristics of soybean seedling exposed to supplementary ultraviolet-B radiation

    Institute of Scientific and Technical Information of China (English)

    LIANG Chan-juan; HUANG Xiao-hua; ZHOU Qing


    Effects of cerium (Ce3+) on photosynthetic characteristics were investigated by hydroponics under laboratory conditions when soybean seedlings were exposed to two levels of supplementary UV-B radiation. UV-B radiation badly inhibited the photosynthesis in soybean seedling, leading to a reduction in net photosynthetic rate (Ph), Hill reaction activity, light saturated photosynthetic rate (Ps) and apparent quanta yield (AQY), as well as the CO2 and light saturated photosynthetic rate (Pm) and carboxulation efficiency (CE). On the contrary, Ce obviously promoted the photosynthesis of plants by increasing Hill reaction activity, accelerating electron transport and photophosphorylation, and enhancing carboxylation efficiency. For Ce+UV-B treatments,the values of photosynthetic parameters were still lower than those of the control, but obviously higher than those of UV-B treatment.The results indicated that Ce alleviated the inhibition of UV-B radiation on the photosynthesis in soybean seedling to a certain extent.In correlating of Pn with Hill activity, AQY and CE, we found that the changes of photosynthetic rate were mainly influenced by the regulating effect of Ce on Hill activity and AQY at low level (0.15 W/m2) of UV-B radiation, but were dominated by the regulating effect of Ce on CE at high level (0.45 W/m2). Thus, Ce could regulate many aspects in photosynthesis of soybean seedling under UV-B stress. The regulating mechanism was close related with the dosage of UV-B radiation.

  18. Cerium oxide nanoparticles inhibit the migration and proliferation of gastric cancer by increasing DHX15 expression (United States)

    Xiao, Yu-Feng; Li, Jian-Mei; Wang, Su-Min; Yong, Xin; Tang, Bo; Jie, Meng-Meng; Dong, Hui; Yang, Xiao-Chao; Yang, Shi-Ming


    Gastric cancer is one of the leading causes of tumor-related deaths in the world. Current treatment options do not satisfy doctors and patients, and new therapies are therefore needed. Cerium oxide nanoparticles (CNPs) have been studied as a potential therapeutic approach for treating many diseases. However, their effects on human gastric cancer are currently unknown. Therefore, in this study, we aimed to characterize the effects of CNPs on human gastric cancer cell lines (MKN28 and BGC823). Gastric cancer cells were cocultured with different concentrations of CNPs, and proliferation and migration were measured both in vitro and in vivo. We found that CNPs inhibited the migration of gastric cancer cells when applied at different concentrations, but only a relatively high concentration (10 µg/mL) of CNPs suppressed proliferation. Furthermore, we found that CNPs increased the expression of DHX15 and its downstream signaling pathways. We therefore provide evidence showing that CNPs may be a promising approach to suppress malignant activity of gastric cancer by increasing the expression of DHX15. PMID:27486320

  19. Role of cerium, lanthanum, and strontium additions in an Al-Si-Mg (A356) alloy

    Energy Technology Data Exchange (ETDEWEB)

    Nabawy, Ahmed M.; Samuel, Agnes M.; Samuel, Fawzy H. [Universite du Quebec, Chicoutimi (Canada). Dept. des Sciences Appliquees; Alkahtani, Saleh A.; Abuhasel, Khaled A. [Salman Bin Abdulaziz Univ., Riyadh (Saudi Arabia). Mechanical Engineering Dept.


    The effects of individual and combined additions of cerium (Ce), lanthanum (La), and strontium (Sr) on the eutectic modification and solidification characteristics of an Al-Si-Mg (A356) aluminum alloy were investigated using optical microscopy and thermal analysis techniques. Addition of Ce, La, and Sr resulted in different depression levels of the eutectic nucleation temperature and eutectic growth undercooling, generating modified eutectic structures exhibiting different levels of modification. Microstructural results showed that the best modification levels using individual additions were achieved by Sr which produced a fine fibrous eutectic structure, followed by La, which produced a refined lamellar structure, with Ce providing the lowest level of modification. On the other hand, a combined addition of Ce and Sr provided the highest modification level, with the production of a very fine fibrous eutectic silicon structure. In general, the addition of Sr helped to further increase the refinement obtained in the alloys containing La or Ce + La additions. In the latter alloy, the main intermetallic phases observed were La(Al,Si){sub 2} and Al{sub 20}(La,Ce)Ti{sub 2}Si. The improved modification levels were found to be proportional to the depression in the eutectic nucleation temperature and the eutectic growth undercooling. A high cooling rate also improved the modification level by at least one level.

  20. A nanostructured cerium oxide film-based immunosensor for mycotoxin detection

    International Nuclear Information System (INIS)

    Rabbit-immunoglobulin antibodies (r-IgGs) and bovine serum albumin (BSA) have been immobilized onto sol-gel-derived nanostructured cerium oxide (nanoCeO2) film fabricated onto an indium-tin-oxide (ITO) coated glass plate to detect ochratoxin-A (OTA). Broad reflection planes obtained in x-ray diffraction (XRD) patterns reveal the formation of CeO2 nanostructures. Electrochemical studies reveal that nanoCeO2 particles provide an increased electroactive surface area for loading of r-IgGs with desired orientation, resulting in enhanced electron communication between r-IgGs and electrode. BSA/r-IgGs/nano CeO2/ITO immunoelectrode exhibits improved characteristics such as linear range (0.5-6 ng dl-1), low detection limit (0.25 ng dl-1), fast response time (30 s) and high sensitivity (1.27 μA ng-1 dl-1 cm-2). The high value of the association constant (Ka, 0.9 x 1011 l mol-1) indicates the high affinity of the BSA/r-IgGs/nanoCeO2/ITO immunoelectrode to OTA.

  1. Enhanced hydrogen desorption property of MgH{sub 2} with the addition of cerium fluorides

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Huai-Jun, E-mail: [School of Materials Science and Engineering, South China University of Technology, Guangzhou 510640 (China); Department of Mechanical Engineering, Faculty of Engineering, Kyushu University, Fukuoka 819-0395 (Japan); Matsuda, Junko [International Institute for Carbon-Neutral Energy Research (WPI-I2CNER), Kyushu University, Fukuoka 819-0395 (Japan); Li, Hai-Wen [International Institute for Carbon-Neutral Energy Research (WPI-I2CNER), Kyushu University, Fukuoka 819-0395 (Japan); International Research Center for Hydrogen Energy, Kyushu University, Fukuoka 819-0395 (Japan); Zhu, Min [School of Materials Science and Engineering, South China University of Technology, Guangzhou 510640 (China); China–Australia Joint Laboratory for Energy & Environmental Materials, South China University of Technology, Guangzhou 510640 (China); Akiba, Etsuo [Department of Mechanical Engineering, Faculty of Engineering, Kyushu University, Fukuoka 819-0395 (Japan); International Institute for Carbon-Neutral Energy Research (WPI-I2CNER), Kyushu University, Fukuoka 819-0395 (Japan); International Research Center for Hydrogen Energy, Kyushu University, Fukuoka 819-0395 (Japan)


    Highlights: • Activation energy of MgH{sub 2} desorption is remarkably reduced with the dopant of CeF{sub 4}. • The improvement might be attributed to new Ce–F–Mg species at the CeF{sub 4}/MgH{sub 2} interface. • Easy electron transfer induced from the high valence Ce-cation benefits MgH{sub 2} desorption. - Abstract: Hydrogen desorption property of MgH{sub 2} doped with cerium fluorides with different valences prepared using ball milling has been studied. CeF{sub 4} is catalytically active for hydrogen desorption of MgH{sub 2}. Hydrogen desorption temperature and apparent activation energy of MgH{sub 2} are significantly reduced with dopant of 2 mol% of CeF{sub 4}, which might be attributed to the formation of a new Ce–F–Mg specie at the CeF{sub 4}/MgH{sub 2} interface and the easy electron transfer induced from the high valence Ce-cation. The apparent activation energy of hydrogen desorption of MgH{sub 2} is reduced from ∼160 kJ/mol to ∼110 kJ/mol with the dopant of CeF{sub 4}.

  2. Preparation and investigation of structural, magnetic and microwave absorption properties of cerium doped barium hexaferrite

    Directory of Open Access Journals (Sweden)

    P Kameli


    Full Text Available In this study the structure, magnetic and microwave absorption properties of cerium (Ce doped barium hexaferrite with general formulae BaCexFe12-xO19 (x=0.0, 0.05, 0.1, 0.15, 0.2 have been investigated. These samples have been prepared by sol- gel method. Influence of replacing Fe+3 ion by rare- earth Ce+3 ion on the structural, magnetic and microwave absorption properties have been investigated by X- ray diffraction (XRD, Fourier transform infrared (FT-IR, Vibrating sample magnetometer (VSM and vector network analyzer (VNA. X-ray diffraction analysis indicated that the samples are of single phase with space group p63/mmc. The magnetic properties of samples indicated that with the Ce doping the saturation magnetization show no regular behavior. Moreover, coercivity (Hc first decreased and reached to the minimum value for x=0.1 sample and then increased with Ce content increasing. Also, measurement of electromagnetic wave absorption in X and Ku frequency bands indicated that the maximum of reflection loss obtained for x=0.15 sample. Moreover, result indicated that absorption peak shifted toward a lower frequency when thickness was increased.

  3. A spectrophotometric study of cerium IV and chromium VI species in nuclear fuel reprocessing process streams (United States)

    Nickson, I. D.; Boxall, C.; Jackson, A.; Whillock, G. O. H.


    Nuclear fuel reprocessing schemes such as PUREX and UREX utilise HNO3 media. An understanding of the corrosion of process engineering materials such as stainless steel in such media is a major concern for the nuclear industry. Two key species are cerium and chromium which, as Ce(IV), Cr(VI), may act as corrosion accelerants. An on-line analytical technique for these quantities would be useful for determining the relationship between corrosion rate and [Ce(IV)] and [Cr(VI)]. Consequently, a strategy for simultaneous quantification of Ce(IV), Cr(VI) and Cr(III) in the presence of other ions found in average burn-up Magnox / PWR fuel reprocessing stream (Fe, Mg, Nd, Al) is being developed. This involves simultaneous UV-vis absorbance measurement at 620, 540, 450 nm, wavelengths where Ce and Cr absorb but other ions do not. Mixed solutions of Cr(VI) and Ce(IV) are found to present higher absorbance values at 540 nm than those predicted from absorbances recorded from single component solutions of those ions. This is attributed to the formation of a 3:1 Cr(VI)-Ce(IV) complex and we report on the complexation and UV-visible spectrophotometric characteristics of this species. To the best of our knowledge this is the first experimental study of this complex in aqueous nitric acid solution systems.

  4. Shifts in oxidation states of cerium oxide nanoparticles detected inside intact hydrated cells and organelles

    Energy Technology Data Exchange (ETDEWEB)

    Szymanski, Craig J.; Munusamy, Prabhakaran; Mihai, Cosmin; Xie, Yumei; Hu, Dehong; Gilles, Marry K.; Tyliszczak, T.; Thevuthasan, Suntharampillai; Baer, Donald R.; Orr, Galya


    Cerium oxide nanoparticles (CNPs) have been shown to induce diverse biological effects, ranging from toxic to beneficial. The beneficial effects have been attributed to the potential antioxidant activity of CNPs via certain redox reactions, depending on their oxidation state or Ce3+/Ce4+ ratio. However, this ratio is strongly dependent on the environment and age of the nanoparticles and it is unclear whether and how the complex intracellular environment impacts this ratio and the possible redox reactions of CNPs. To identify any changes in the oxidation state of CNPs in the intracellular environment and better understand their intracellular reactions, we directly quantified the oxidation states of CNPs outside and inside intact hydrated cells and organelles using correlated scanning transmission x-ray and super resolution fluorescence microscopies. By analyzing hundreds of small CNP aggregates, we detected a shift to a higher Ce3+/Ce4+ ratio in CNPs inside versus outside the cells, indicating a net reduction of CNPs in the intracellular environment. We further found a similar ratio in the cytoplasm and in the lysosomes, indicating that the net reduction occurs earlier in the internalization pathway. Together with oxidative stress and toxicity measurements, our observations identify a net reduction of CNPs in the intracellular environment, which is consistent with their involvement in potentially beneficial oxidation reactions, but also point to interactions that can negatively impact the health of cells.

  5. Characterization of the alumina film with cerium doped on the iron-aluminide diffusion coating

    Energy Technology Data Exchange (ETDEWEB)

    Zhan, Q., E-mail:; Yang, H.G.; Zhao, W.W.; Yuan, X.M.; Hu, Y.


    An iron-aluminide layer with a thin alumina film on the top as a composite tritium permeation barrier (TPB) coating was characterized under different oxidation conditions. The TPB coating was prepared initially on a China Low Activation Ferritic-Martensitic (CLAM) steel by a pack cementation aluminizing process and then an alumina film was formed on the surface of this iron-aluminide diffusion layer by an oxidizing process. To modify the properties of the FeAl/Al{sub 2}O{sub 3} composite TPB coatings, the rare earth element (cerium) was introduced as a dopant while oxidizing. Characterization showed that a continuous oxide scale with a thickness of about 300–400 nm was formed on the FeAl diffusion layer. The film was mainly composed of Al{sub 2}O{sub 3} doped with a little CeO{sub 2}. In addition, the concentration of α-Al{sub 2}O{sub 3} increased with elevated temperature while oxidizing. The phase transformation behavior of alumina scale on the surface of an iron-aluminide layer was studied in this paper.

  6. Catalytic performance of cerium iron complex oxides for partial oxidation of methane to synthesis gas

    Institute of Scientific and Technical Information of China (English)

    LI Kongzhai; WANG Hua; WEI Yonggang; LIU Mingchun


    The cerium iron complex oxides oxygen carder was prepared by the co-precipitation method. The reactions between methane and lattice oxygen from the complex oxides were investigated in a fixed micro-reactor system. The reduced oxygen carrier could be re-oxidized by air and its initial state could be restored. The characterizations of the oxygen carriers were studied using XRD, O2-TPD, and H2-TPR. The results showed that the bulk lattice oxygen of CeO2-Fe2O3 was found to be suitable for the partial oxidation of methane to synthesis gas. There were two kinds of oxygen species on the oxygen carder: the stronger oxygen species that was responsible for the complete oxidation of methane, and the weaker oxygen species (bulk lattice oxygen) that was responsible for the selective oxidation of methane to CO and H2 at a higher temperature. Then, the lost bulk lattice oxygen could be selectively supplemented by air re-oxidation at an appropriate reaction con-dition. CeFeO3 appeared on the oxygen carrier after 10 successive redox cycles, however, it was not bad for the selectivity of CO and H2.


    Institute of Scientific and Technical Information of China (English)

    SuZhengquan; FengHuixia


    The tetravalent metal salts of monoalkyl phosphates[M(R-OPO3)2] are a new kind of stationary phases of chromatography-homogeneous bonded phases.The studies on preparation,structure and gas chromatographic efficiency of cerium bis (octylphosphate) (COPP) are reported in this paper. By using chemical analysis,infrared spectra,x-ray diffraction analysis ,the strong evidence that COPP has a layered structure of the α-zirconium phosphate type was demonstrated,the repetitive unit is C8H17OPO3CeO3POC8H17 and there is a little bending or interpenetration of the alkyl chains within the layers.The thermogravimetic analysis of the COPP indicated that it has much more thermalstability than silica-based packings.The thermodynamic parameters ΔH and molecular connectivity indexes x′ for the adsorption of several dozen compounds on the COPP have also been determined by gas chromatographic method,and the fine linearity between them was shown.

  8. RM1 Semiempirical Quantum Chemistry: Parameters for Trivalent Lanthanum, Cerium and Praseodymium.

    Directory of Open Access Journals (Sweden)

    José Diogo L Dutra

    Full Text Available The RM1 model for the lanthanides is parameterized for complexes of the trications of lanthanum, cerium, and praseodymium. The semiempirical quantum chemical model core stands for the [Xe]4fn electronic configuration, with n =0,1,2 for La(III, Ce(III, and Pr(III, respectively. In addition, the valence shell is described by three electrons in a set of 5d, 6s, and 6p orbitals. Results indicate that the present model is more accurate than the previous sparkle models, although these are still very good methods provided the ligands only possess oxygen or nitrogen atoms directly coordinated to the lanthanide ion. For all other different types of coordination, the present RM1 model for the lanthanides is much superior and must definitely be used. Overall, the accuracy of the model is of the order of 0.07Å for La(III and Pr(III, and 0.08Å for Ce(III for lanthanide-ligand atom distances which lie mostly around the 2.3Å to 2.6Å interval, implying an error around 3% only.

  9. Toxic Effects of Lanthanum, Cerium, Chromium and Zinc on Potamogeton Malaianus

    Institute of Scientific and Technical Information of China (English)

    Wang Xue; Shi Guoxin; Xu Qinsong; Wang Chuntao


    The toxic effects of rare earth elements such as lanthanum, cerium and heavy metal elements such as chromium, zinc on Potamogeton malaianus Miq. were studied. The results show that the contents of chlorophyll and soluble protein increase to a certain degree and then decrease under La3+, Ce3+, Zn2+ stress, while there is a constantly dropping tendency under Cr6+ stress. The four ions have different effects on protective enzyme systems of Potamogeton malaianus. They can induce rises of the activities of catalase (CAT) and peroxides (POD) at lower concentration, however, with the increase of ions concentration, the activities decline. The change of SOD activity is exactly opposite to that of CAT and POD activity. It falls at first and rises later. An increasing tendency of MDA content appears with the increasing concentration. The toxicities of La3+, Zn2+, Ce3+ and Cr6+ become more serious in the order. The lethal concentration of Cr6+ to Potamogeton malaianus ranges from 0.5 to 1 mg·L-1, that of Ce3+ and Zn2+ ranges from 3 to 5 mg·L-1, and that of La3+ ranges from 7 to 10 mg·L-1. The toxic mechanism of La3+ and Ce3+ is similar to that of Cr6+ and Zn2+.

  10. CO responses of sensors based on cerium oxide thick films prepared from clustered spherical nanoparticles. (United States)

    Izu, Noriya; Matsubara, Ichiro; Itoh, Toshio; Akamatsu, Takafumi; Shin, Woosuck


    Various types of CO sensors based on cerium oxide (ceria) have been reported recently. It has also been reported that the response speed of CO sensors fabricated from porous ceria thick films comprising nanoparticles is extremely high. However, the response value of such sensors is not suitably high. In this study, we investigated methods of improving the response values of CO sensors based on ceria and prepared gas sensors from core-shell ceria polymer hybrid nanoparticles. These hybrid nanoparticles have been reported to have a unique structure: The core consists of a cluster of ceria crystallites several nanometers in size. We compared the characteristics of the sensors based on thick films prepared from core-shell nanoparticles with those of sensors based on thick films prepared from conventionally used precipitated nanoparticles. The sensors prepared from the core-shell nanoparticles exhibited a resistance that was ten times greater than that of the sensors prepared from the precipitated nanoparticles. The response values of the gas sensors based on the core-shell nanoparticles also was higher than that of the sensors based on the precipitated nanoparticles. Finally, improvements in sensor response were also noticed after the addition of Au nanoparticles to the thick films used to fabricate the two types of sensors.

  11. Destruction of commercial pesticides by cerium redox couple mediated electrochemical oxidation process in continuous feed mode

    International Nuclear Information System (INIS)

    Mediated electrochemical oxidation was carried out for the destruction of commercial pesticide formulations using cerium(IV) in nitric acid as the mediator electrolyte solution in a bench scale set up. The mediator oxidant was regenerated in situ using an electrochemical cell. The real application of this sustainable process for toxic organic pollutant destruction lies in its ability for long term continuous operation with continuous organic feeding and oxidant regeneration with feed water removal. In this report we present the results of fully integrated MEO system. The task of operating the continuous feed MEO system for a long time was made possible by continuously removing the feed water using an evaporator set up. The rate of Ce(IV) regeneration in the electrochemical cell and the consumption for the pesticide destruction was matched based on carbon content of the pesticides. It was found that under the optimized experimental conditions for Ce(III) oxidation, organic addition and water removal destruction efficiency of ca. 99% was obtained for all pesticides studied. It was observed that the Ce(IV) concentration was maintained nearly the same throughout the experiment. The stable operation for 6 h proved that the process can be used for real applications and for possible scale up for the destruction of larger volumes of toxic organic wastes.

  12. Physical properties of new cerium palladium phosphide with C6Cr23-type structure

    Directory of Open Access Journals (Sweden)

    T. Abe


    Full Text Available We have found that a cerium palladium phosphide crystallizes into a C6Cr23-type structure with atomic disorder. Prepared polycrystalline samples show a homogeneity range in the ternary Ce–Pd–P phase diagram. The physical properties of the highest-quality sample of Ce2.4Pd20.7P5.9 were investigated by measuring the magnetization, electrical resistivity and specific heat. No pronounced phase transition was observed down to 0.5 K. The Kondo screening of localized 4f electrons in metallic Ce2.4Pd20.7P5.9 appears to be weaker than that in the isostructural compounds of Ce3Pd20Si6 and Ce3Pd20Ge6. By a comparative study of Ce2.4Pd20.7P5.9 and Ce3Pd20X6 (X = Si, Ge, the competition between the Kondo temperature and ordering temperatures including the quadrupolar ordering temperature is briefly discussed.

  13. Untangling the biological effects of cerium oxide nanoparticles: the role of surface valence states (United States)

    Pulido-Reyes, Gerardo; Rodea-Palomares, Ismael; Das, Soumen; Sakthivel, Tamil Selvan; Leganes, Francisco; Rosal, Roberto; Seal, Sudipta; Fernández-Piñas, Francisca


    Cerium oxide nanoparticles (nanoceria; CNPs) have been found to have both pro-oxidant and anti-oxidant effects on different cell systems or organisms. In order to untangle the mechanisms which underlie the biological activity of nanoceria, we have studied the effect of five different CNPs on a model relevant aquatic microorganism. Neither shape, concentration, synthesis method, surface charge (ζ-potential), nor nominal size had any influence in the observed biological activity. The main driver of toxicity was found to be the percentage of surface content of Ce3+ sites: CNP1 (58%) and CNP5 (40%) were found to be toxic whereas CNP2 (28%), CNP3 (36%) and CNP4 (26%) were found to be non-toxic. The colloidal stability and redox chemistry of the most and least toxic CNPs, CNP1 and CNP2, respectively, were modified by incubation with iron and phosphate buffers. Blocking surface Ce3+ sites of the most toxic CNP, CNP1, with phosphate treatment reverted toxicity and stimulated growth. Colloidal destabilization with Fe treatment only increased toxicity of CNP1. The results of this study are relevant in the understanding of the main drivers of biological activity of nanoceria and to define global descriptors of engineered nanoparticles (ENPs) bioactivity which may be useful in safer-by-design strategies of nanomaterials.

  14. Role of phosphate on stability and catalase mimetic activity of cerium oxide nanoparticles. (United States)

    Singh, Ragini; Singh, Sanjay


    Cerium oxide nanoparticles (CeNPs) have been recently shown to scavenge reactive oxygen and nitrogen species (ROS and RNS) in different experimental model systems. CeNPs (3+) and CeNPs (4+) have been shown to exhibit superoxide dismutase (SOD) and catalase mimetic activity, respectively. Due to their nanoscale dimension, CeNPs are expected to interact with the components of biologically relevant buffers and medium, which could alter their catalytic properties. We have demonstrated earlier that CeNPs (3+) interact with phosphate and lose the SOD activity. However, very little is known about the interaction of CeNPs (4+) with the phosphate and other anions, predominantly present in biological buffers and their effects on the catalase mimetic-activity of these nanoparticles. In this study, we report that catalase mimetic-activity of CeNPs (4+) is resistant to the phosphate anions, pH changes and composition of cell culture media. Given the abundance of phosphate anions in the biological system, it is likely that internalized CeNPs would be influenced by cytoplasmic and nucleoplasmic concentration of phosphate.

  15. Enhanced corrosion resistance of magnesium alloy AM60 by cerium(III) in chloride solution

    Energy Technology Data Exchange (ETDEWEB)

    Heakal, F. El-Taib, E-mail: [Chemistry Department, Faculty of Science, Cairo University, Giza 12613 (Egypt); Shehata, O.S. [Physical Chemistry Department, National Research Centre, Dokki, Giza (Egypt); Tantawy, N.S. [Girl' s College of Arts, Science and Education, Ain Shams University, Asma Fahmi Street, Cairo (Egypt)


    Highlights: Black-Right-Pointing-Pointer Corrosion rate of AM60 in Cl{sup -} solution decreases with increasing [Ce{sup 3+}] up to 1 mM. Black-Right-Pointing-Pointer Beyond that level the corrosion rate increases and then stabilizes. Black-Right-Pointing-Pointer The spontaneously formed film characterises by increasing resistance with time. Black-Right-Pointing-Pointer The converted film after 10 d immersion exhibits self-healing in plain Cl{sup -} solution. Black-Right-Pointing-Pointer Ce(III) should be present in the corrodent to form a more compact surface coating. - Abstract: Cerium(III) was utilised to enhance the corrosion resistance of AM60 in NaCl solution. Ce{sup 3+} can suppress corrosion deterioration up to 1.0 mM. Beyond that level corrosion rate increases till a steady value. Surface film resistance increases with time evolution until 24 h, then decreases and stabilizes. The converted film after 240 h immersion exhibits self-healing and thickening when re-exposed to plain chloride solution. SEM and EDX confirmed that when Ce is present as additive in solution, more compact coating is formed better than its presence as a post coating on the alloy surface before being immersed in the corrosive environment.

  16. Copper-cerium oxides supported on carbon nanomaterial for preferential oxidation of carbon monoxide

    Institute of Scientific and Technical Information of China (English)

    高美怡; 江楠; 赵宇宏; 徐长进; 苏海全; 曾尚红


    The CuxO-CeO2/Fe@CNSs, CuxO-CeO2/MWCNTs-Co and CuxO-CeO2/MWCNTs-Ni catalysts were prepared by the im-pregnation method and characterized by transmission electron microscopy, scanning electron microscopy, X-ray powder diffrac-tion, H2-temperature programmed reduction and N2 adsorption-desorption techniques. It was found that the Fe nanoparticles were encapsulated into the multi-layered carbon nanospheres (CNSs). However, the multi-wall carbon nanotubes (MWCNTS) were generated on the Co/Al2O3 and Ni/Al2O3 precursor. The addition of carbon nanomaterial as supports could improve structural properties and low-temperature activity of the CuO-CeO2 catalyst, and save the used amount of metal catalysts in the temperature range with high selectivity for CO oxidation. The copper-cerium oxides supported on carbon nanomaterial had good resistence to H2O and CO2.

  17. Gold-supported cerium-doped NiOx catalysts for water oxidation (United States)

    Ng, Jia Wei Desmond; García-Melchor, Max; Bajdich, Michal; Chakthranont, Pongkarn; Kirk, Charlotte; Vojvodic, Aleksandra; Jaramillo, Thomas F.


    The development of high-performance catalysts for the oxygen-evolution reaction (OER) is paramount for cost-effective conversion of renewable electricity to fuels and chemicals. Here we report the significant enhancement of the OER activity of electrodeposited NiOx films resulting from the combined effects of using cerium as a dopant and gold as a metal support. This NiCeOx-Au catalyst delivers high OER activity in alkaline media, and is among the most active OER electrocatalysts yet reported. On the basis of experimental observations and theoretical modelling, we ascribe the activity to a combination of electronic, geometric and support effects, where highly active under-coordinated sites at the oxide support interface are modified by the local chemical binding environment and by doping the host Ni oxide with Ce. The NiCeOx-Au catalyst is further demonstrated in a device context by pairing it with a nickel-molybdenum hydrogen evolution catalyst in a water electrolyser, which delivers 50 mA consistently at 1.5 V over 24 h of continuous operation.

  18. Effect of Cerium Doping on Superconducting Properties of YBCO Film Prepared by TFA-MOD Method

    International Nuclear Information System (INIS)

    The effects of Ba and Ce addition has been investigated in YBCO prepared by trifluoroacetate(TFA) metalorganic deposition(MOD) method. Precursor solutions with cation ratios of Y:Ba:Cu:Ce=1:2+x:3:x(x=0, 0.05, 0.1 and 1.5) have been prepared by adding an excess amount of cerium and barium. Coated film was calcined at lower temperature under a moisture-containing oxygen atmosphere. Superconducting YBCO films have been obtained by performing conversion heat treatment at temperature of 780-810 degrees C under a moisture-containing Ar(1,000 ppm oxygen) atmosphere. It has been shown that the critical current(Ic) of YBCO film was degraded by doping of Ba and Ce atoms. But Ic was increased as the amount of doped Ba and Ce content increased from 5% to 15 %. It was observed that there was little increase of a flux pinning force with Ba and Ce addition in YBCO film prepared by TFA-MOD process.

  19. Recent advances of cerium oxide nanoparticles in synthesis, luminescence and biomedical studies:a review

    Institute of Scientific and Technical Information of China (English)

    何立莹; 苏玉民; 蒋兰宏; 石士考


    Nanostructured cerium oxide (CeO2) commonly known as nanoceria is a rare earth metal oxide, which plays a technologi-cally important role due to its versatile applications as automobile exhaust catalysts, oxide ion conductors in solid oxide fuel cells, electrode materials for gas sensors, ultraviolet absorbents and glass-polishing materials. However, nanoceria has little or weak lumi-nescence, and therefore its uses in high-performance luminescent devices and biomedical areas are limited. In this review, we present the recent advances of nanoceria in the aspects of synthesis, luminescence and biomedical studies. The CeO2 nanoparticles can be synthesized by solution-based methods including co-precipitation, hydrothermal, microemulsion process, sol-gel techniques, combus-tion reaction and so on. Achieving controlled morphologies and enhanced luminescence efficiency of nanoceria particles are quite es-sential for its potential energy- and environment-related applications. Additionally, a new frontier for nanoceria particles in biomedi-cal research has also been opened, which involves low toxicity, retinopathy, biosensors and cancer therapy aspects. Finally, the sum-mary and outlook on the challenges and perspectives of the nanoceria particles are proposed.

  20. A nanostructured cerium oxide film-based immunosensor for mycotoxin detection (United States)

    Kaushik, Ajeet; Rathee Solanki, Pratima; Ansari, Anees Ahmad; Ahmad, Sharif; Dhar Malhotra, Bansi


    Rabbit-immunoglobulin antibodies (r-IgGs) and bovine serum albumin (BSA) have been immobilized onto sol-gel-derived nanostructured cerium oxide (nanoCeO2) film fabricated onto an indium-tin-oxide (ITO) coated glass plate to detect ochratoxin-A (OTA). Broad reflection planes obtained in x-ray diffraction (XRD) patterns reveal the formation of CeO2 nanostructures. Electrochemical studies reveal that nanoCeO2 particles provide an increased electroactive surface area for loading of r-IgGs with desired orientation, resulting in enhanced electron communication between r-IgGs and electrode. BSA/r-IgGs/nano CeO2/ITO immunoelectrode exhibits improved characteristics such as linear range (0.5-6 ng dl-1), low detection limit (0.25 ng dl-1), fast response time (30 s) and high sensitivity (1.27 µA ng-1 dl-1 cm-2). The high value of the association constant (Ka, 0.9 × 1011 l mol-1) indicates the high affinity of the BSA/r-IgGs/nanoCeO2/ITO immunoelectrode to OTA.

  1. Gold-supported cerium-doped NiOx catalysts for water oxidation (United States)

    Ng, Jia Wei Desmond; García-Melchor, Max; Bajdich, Michal; Chakthranont, Pongkarn; Kirk, Charlotte; Vojvodic, Aleksandra; Jaramillo, Thomas F.


    The development of high-performance catalysts for the oxygen-evolution reaction (OER) is paramount for cost-effective conversion of renewable electricity to fuels and chemicals. Here we report the significant enhancement of the OER activity of electrodeposited NiOx films resulting from the combined effects of using cerium as a dopant and gold as a metal support. This NiCeOx–Au catalyst delivers high OER activity in alkaline media, and is among the most active OER electrocatalysts yet reported. On the basis of experimental observations and theoretical modelling, we ascribe the activity to a combination of electronic, geometric and support effects, where highly active under-coordinated sites at the oxide support interface are modified by the local chemical binding environment and by doping the host Ni oxide with Ce. The NiCeOx–Au catalyst is further demonstrated in a device context by pairing it with a nickel–molybdenum hydrogen evolution catalyst in a water electrolyser, which delivers 50 mA consistently at 1.5 V over 24 h of continuous operation.

  2. Tribological characteristics of monodispersed cerium borate nanospheres in biodegradable rapeseed oil lubricant (United States)

    Boshui, Chen; Kecheng, Gu; Jianhua, Fang; Jiang, Wu; Jiu, Wang; Nan, Zhang


    Stearic acid-capped cerium borate composite nanoparticles, abbreviated as SA/CeBO3, were prepared by hydrothermal method. The morphologies, element compositions, size distributions, crystal and chemical structures, hydrophobic characteristics, of SA/CeBO3 were characterized by scanning electron microscope, energy dispersive X-ray spectrometer, dynamic laser particle size analyzer, X-ray diffraction, and Fourier transform infrared spectrometer, respectively. The friction and wear performances of SA/CeBO3 as a lubricating additive in a rapeseed oil were evaluated on a four-ball tribo-tester. The tribochemical characteristics of the worn surfaces were investigated by X-ray photoelectron spectroscopy. The results showed that the hydrophobic SA/CeBO3 were monodispersed nanospheres with an average diameter of 8 nm, and exhibited excellent dispersing stability in rapeseed oil. Meanwhile, SA/CeBO3 nanospheres were outstanding in enhancing friction-reducing and anti-wear capacities of rapeseed oil. The prominent tribological performances of SA/CeBO3 in rapeseed oil were attributed to the formation of a composite boundary lubrication film mainly composed of lubricous tribochemical species of B2O3, CeO2 and Fe2O3, and the adsorbates of SA/CeBO3 and rapeseed oil, on the tribo-surfaces.

  3. Effects of cerium on growth and physiological characteristics of Anabaena flosaquae

    Institute of Scientific and Technical Information of China (English)

    WANG Yingjun; LI Jia; L(U) Yun; JIN Hangbiao; DENG Shihuai; ZENG Yunmin


    In the present study,the effects of cerium (Ce) on the growth and physiological changes were investigated in the cyanobacterium Anabaenaflosaquae (A.flosaquae) during a 17-day period.The results showed that the content of chlorophyll a (chl-a) and activity of antioxidase (e.g.superoxide dismutase,peroxidase,and catalase) increased with Ce3+ concentration in the range of 0.05 to 0.1 mg/L and the growth of A.flosaquae was stimulated.While at around 5 mg/L,the content of malondiadehyde (MDA) increased significantly but the activity of antioxidase reduced,which resulted in the ruin of antioxidant defense system.Compared to the control (Ce3+-free),the population size of live cells declined significantly.Microcystin-LR (MC-LR),the most common and toxic cyanotoxins produced by A.flosaquae,was detected and the highest content of MC-LR was observed in 10 mg/L Ce3+ treatment.These results implied that the aqueous environment might suffer a more negative ecological impact when exposed to relatively low Ce3+ concentrations (<0.1 mg/L).

  4. Press or pulse exposures determine the environmental fate of cerium nanoparticles in stream mesocosms. (United States)

    Baker, Leanne F; King, Ryan S; Unrine, Jason M; Castellon, Benjamin T; Lowry, Gregory V; Matson, Cole W


    Risk-assessment models indicate that stream ecosystems receiving municipal wastewater effluent may have the greatest potential for exposure to manufactured nanoparticles. The authors determined the fate of cerium oxide (CeO2 ) nanoparticles in outdoor stream mesocosms using 1) 1-time pulse addition of CeO2 nanoparticles, representative of accidental release, and 2) continuous, low-level press addition of CeO2 nanoparticles, representative of exposure via wastewater effluent. The pulse addition led to rapid nanoparticle floc formation, which appeared to preferentially deposit on periphyton in low-energy areas downstream from the location of the input, likely as a result of gravitational sedimentation. Floc formation limited the concentration of suspended nanoparticles in stream water to movement. In contrast, press addition of nanoparticles led to higher suspended nanoparticle concentrations (77% of target) in stream water, possibly as a result of stabilization of suspended nanoparticles through interaction with dissolved organic carbon. Smaller nanoparticle aggregates appeared to preferentially adsorb to stream surfaces in turbulent sections, where Ce concentrations were highest in the press, likely a result of stochastic encounter with the surface. Streams receiving wastewater effluent containing nanoparticles may lead to exposure of aquatic organisms over a greater spatial extent than a similar amount of nanoparticles from an accidental release. Exposure models must take into account these mechanisms controlling transport and depositional processes. PMID:26576038

  5. Hierarchical porous carbon toward effective cathode in advanced zinc-cerium redox flow battery

    Institute of Scientific and Technical Information of China (English)

    谢志鹏; 杨斌; 蔡定建; 杨亮


    Advanced zinc-cerium redox flow battery (ZCRFB) is a large-scale energy storage system which plays a significant role in the application of new energy sources. The requirement of superior cathode with high acitivity and fast ion diffusion is a hierarchical porous structure, which was synthesized in this work by a method in which both hard template and soft template were used. The structure and the performance of the cathode prepared here were characterized and evaluated by a variety of techniques such as scan-ning electron microscopy (SEM), transmission electron microscopy (TEM), X-ray photoelectron spectroscopy (XPS), cyclic voltam-metry (CV), linear sweep voltammetry (LSV), and chronoamperometry (CA). There were mainly three types of pore size within the hierarchical porous carbon:2μm, 80 nm, and 10 nm. The charge capacity of the cell using hierarchical porous carbon (HPC) as posi-tive electrode was obviously larger than that using carbon felt;the former was 665.5 mAh with a coulombic efficiency of 89.0%and an energy efficiency of 79.0%, whereas the latter was 611.1 mAh with a coulombic efficiency of 81.5%and an energy efficiency of 68.6%. In addition, performance of the ZCRFB using HPC as positive electrode showed a good stability over 50 cycles. These results showed that the hierarchical porous carbon was superior over the carbon felt for application in ZCRFB.

  6. China's Rare Earth Supply Chain: Illegal Production, and Response to new Cerium Demand (United States)

    Nguyen, Ruby Thuy; Imholte, D. Devin


    As the demand for personal electronic devices, wind turbines, and electric vehicles increases, the world becomes more dependent on rare earth elements. Given the volatile, Chinese-concentrated supply chain, global attempts have been made to diversify supply of these materials. However, the overall effect of supply diversification on the entire supply chain, including increasing low-value rare earth demand, is not fully understood. This paper is the first attempt to shed some light on China's supply chain from both demand and supply perspectives, taking into account different Chinese policies such as mining quotas, separation quotas, export quotas, and resource taxes. We constructed a simulation model using Powersim Studio that analyzes production (both legal and illegal), production costs, Chinese and rest-of-world demand, and market dynamics. We also simulated new demand of an automotive aluminum-cerium alloy in the US market starting from 2018. Results showed that market share of the illegal sector has grown since 2007-2015, ranging between 22% and 25% of China's rare earth supply, translating into 59-65% illegal heavy rare earths and 14-16% illegal light rare earths. There will be a shortage in certain light and heavy rare earths given three production quota scenarios and constant demand growth rate from 2015 to 2030. The new simulated Ce demand would require supply beyond that produced in China. Finally, we illustrate revenue streams for different ore compositions in China in 2015.

  7. Uniform Cerium-Based Coordination Polymer Microsnheres: Preoaration and Upconversion Emission. (United States)

    Nie, Zhi-Wen; Zeng, Cheng-Hui; Xie, Gang; Zhong, Sheng-Liang


    Homogeneously doped Yb3+ and Er3+ cerium-based coordination polymer (CP) microspheres have been successfully synthesized on a large scale through a simple solvothermal route with 2,5-pyridinedicarboxylic acid (2,5-H2PDC) as the organic linker. CeO2: Yb3+, Er3+ porous microspheres were obtained by annealing the corresponding CP microspheres at 600 °C for 4 h under atmospheric pressure. These as-prepared products were characterized by Powder X-ray diffraction (PXRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), Fourier transform infrared spectroscopy (FTIR), energy-dispersion X-ray (EDX) spectroscopy, Thermogravimetric (TG) and derivative thermogravimetric (DTG) analysis. The room temperature upconversion luminescent spectra of the as-prepared microspheres were carried out by 980 nm NIR light excitation. Interestingly, Yb3+ and Er3+ codoped CP microspheres give a single-band emission centered at 673 nm, while the CeO2: Yb3+, Er3+ microspheres give emission in green and red region, with red being the dominant emission. The emission intensity of the CeO2: Yb3+, Er3+ microspheres were much stronger than that of the Yb3+ and Er3+ codoped CP microspheres. PMID:27451693

  8. Novel cerium doped glass-reinforced hydroxyapatite with antibacterial and osteoconductive properties for bone tissue regeneration. (United States)

    Morais, D S; Fernandes, S; Gomes, P S; Fernandes, M H; Sampaio, P; Ferraz, M P; Santos, J D; Lopes, M A; Sooraj Hussain, N


    The aim of this work was to develop a bioactive bone substitute with an effective antibacterial ability based on a cerium (Ce) doped glass-reinforced hydroxyapatite (GR-HA) composite. Developed composites were physicochemically characterized, using x-ray diffraction (XRD) analysis, SEM, energy dispersive x-ray spectroscopy (EDS), and flexural bending strength (FBS) tests. X-ray photoelectron spectroscopy (XPS) analysis was performed to analyze the oxidation state of Ce in the prepared doped glass. The antimicrobial activity of the composites was evaluated against Staphylococcus aureus, Staphylococcus epidermidis and Pseudomonas aeruginosa; whether the cytocompatibility profile was assayed with human osteoblastic-like cells (Mg-63 cell line). The results revealed that the Ce inclusion in the GR-HA matrix induced the antimicrobial ability of the composite. In addition, Ce-doped materials reported an adequate biological behavior following seeding of osteoblastic populations, by inducing cell adhesion and proliferation. Developed materials were also found to enhance the expression of osteoblastic-related genes. Overall, the developed GR-HA_Ce composite is a prospective candidate to be used within the clinical scenario with a successful performance due to the effective antibacterial properties and capability of enhancing the osteoblastic cell response. PMID:26391473

  9. Cerium Oxide Nanoparticles Decorated Graphene Nanosheets for Selective Detection of Dopamine. (United States)

    Nayak, Pranati; Santhosh, P N; Ramaprabhu, S


    The fabrication of a novel amperometric biosensor based on selective determination of dopamine (DA) using nafion coated cerium oxide nanoparticles (NPs) decorated graphene nanosheets (CeO2-HEG-nafion) as a transducer candidate is reported. Graphene was synthesized by hydrogen exfoliation technique. Decoration of CeO2NPs over graphene nanosheets was done by chemical reduction method. The electrochemical impedance spectroscopy (EIS) study shows the enhanced electron transfer kinetics of the composite compared to HEG modified and bare glassy carbon electrode (GCE). The response of the composite towards dopamine displays a lower oxidation potential of 0.23 V and a high oxidation current. The sensor exhibits linearity from 10 µM to 780 µM with a detection limit of 1 µM. In the presence of nafion, it shows excellent selectivity for coexisting interference species like Ascorbic acid (AA) and Uric acid (UA). The excellent performance of the biosensor can be attributed to large active surface area, enhanced electron transfer kinetics and high catalytic activity of the composite.

  10. Gadolinium-148 And Other Spallation Production Cross Section Measurements For Accelerator Target Facilities

    CERN Document Server

    Kelley, K C


    At the Los Alamos Neutron Science Center accelerator complex, protons are accelerated to 800 MeV and directed to two tungsten targets, Target 4 at the Weapons Neutron Research facility and the 1L target at the Lujan Center. The Department of Energy requires hazard classification analyses to be performed on these targets and places limits on certain radionuclide inventories in the targets to avoid characterizing the facilities as “nuclear facilities.” Gadolinium-148 is a radionuclide created from the spallation of tungsten. Allowed isotopic inventories are particularly low for this isotope because it is an alpha-particle emitter with a 75-year half-life. The activity level of Gadolinium-148 is low, but it encompasses almost two-thirds of the total dose burden for the two tungsten targets based on present yield estimates. From a hazard classification standpoint, this severely limits the lifetime of these tungsten targets. The cross section is not well-established experimentally and this is t...

  11. Zfp148 deficiency causes lung maturation defects and lethality in newborn mice that are rescued by deletion of p53 or antioxidant treatment.

    Directory of Open Access Journals (Sweden)

    Volkan I Sayin

    Full Text Available The transcription factor Zfp148 (Zbp-89, BFCOL, BERF1, htβ interacts physically with the tumor suppressor p53 and is implicated in cell cycle control, but the physiological role of Zfp148 remains unknown. Here we show that Zfp148 deficiency leads to respiratory distress and lethality in newborn mice. Zfp148 deficiency prevented structural maturation of the prenatal lung without affecting type II cell differentiation or surfactant production. BrdU analyses revealed that Zfp148 deficiency caused proliferation arrest of pulmonary cells at E18.5-19.5. Similarly, Zfp148-deficient fibroblasts exhibited proliferative arrest that was dependent on p53, raising the possibility that cell stress is part of the underlying mechanism. Indeed, Zfp148 deficiency lowered the threshold for activation of p53 under oxidative conditions. Moreover, both in vivo and cellular phenotypes were rescued on Trp53(+/- or Trp53(-/- backgrounds and by antioxidant treatment. Thus, Zfp148 prevents respiratory distress and lethality in newborn mice by attenuating oxidative stress-dependent p53-activity during the saccular stage of lung development. Our results establish Zfp148 as a novel player in mammalian lung maturation and demonstrate that Zfp148 is critical for cell cycle progression in vivo.

  12. Interaction between PNPLA3 I148M variant and age at infection in determining fibrosis progression in chronic hepatitis C.

    Directory of Open Access Journals (Sweden)

    Stella De Nicola

    Full Text Available BACKGROUND AND AIMS: The PNPLA3 I148M sequence variant favors hepatic lipid accumulation and confers susceptibility to hepatic fibrosis and hepatocellular carcinoma. The aim of this study was to estimate the effect size of homozygosity for the PNPLA3 I148M variant (148M/M on the fibrosis progression rate (FPR and the interaction with age at infection in chronic hepatitis C (CHC. METHODS: FPR was estimated in a prospective cohort of 247 CHC patients without alcohol intake and diabetes, with careful estimation of age at infection and determination of fibrosis stage by Ishak score. RESULTS: Older age at infection was the strongest determinant of FPR (p<0.0001. PNPLA3 148M/M was associated with faster FPR in individuals infected at older age (above the median, 21 years; -0.64±0.2, n = 8 vs. -0.95±0.3, n = 166 log10 FPR respectively; p = 0.001; confirmed for lower age thresholds, p<0.05, but not in those infected at younger age (p = ns. The negative impact of PNPLA3 148M/M on fibrosis progression was more marked in subjects at risk of altered hepatic lipid metabolism (those with grade 2-3 steatosis, genotype 3, and overweight; p<0.05. At multivariate analysis, PNPLA3 148M/M was associated with FPR (incremental effect 0.08±0.03 log10 fibrosis unit per year; p = 0.022, independently of several confounders, and there was a significant interaction between 148M/M and older age at infection (p = 0.025. The association between 148M/M and FPR remained significant even after adjustment for steatosis severity (p = 0.032. CONCLUSIONS: We observed an interaction between homozygosity for the PNPLA3 I148M variant and age at infection in determining fibrosis progression in CHC patients.

  13. Effect of selected method of technical processing of meat on the level of cerium 144 in the meat and bones of chicken

    International Nuclear Information System (INIS)

    Experiments were carried out for elimination of cerium 144 radioisotope from the meat and bones of chicken receiving this radioisotope intravitally. The basic methods of technical processing of meat were applied: soaking, boiling, corning. The meat and bones were subjected also to the action of 1% solutions of organic acids used in food industry (citric, acetic, lactic acid). The bones were treated additionally with 5% solutions of these acids. It was found that corning was the method providing best decontamination in the case of the meat, while boiling was most effective in removing the radioactivity from the bones. Among the organic acids the lactic acid in a 1% solution eliminated cerium 144 most effectively from the meat and 5% citric acid from the bones. The effectiveness of these methods of cerium removal depended on the degree of meat fragmentation - the only exception was corning. (author)

  14. Improving in-vitro biocorrosion resistance of Mg-Zn-Mn-Ca alloy in Hank’s solution through addition of cerium

    Institute of Scientific and Technical Information of China (English)

    张凡; 马爱斌; 宋丹; 江静华; 卢富敏; 张留艳; 杨东辉; 陈建清


    Two kinds of Mg-Zn-Mn-Ca alloys with and without cerium were designed and fabricated. In-vitro degradation tests and electrochemical evaluations were carried out to compare their biocorrosion behavior in Hank’s solution at 37 ºC. After adding cerium, the continuous network distributed Ca2Mg6Zn3 phases in Mg-2Zn-0.5Mn-1Ca alloy (Alloy I) were separated due to the emerging non-continuously distributed Mg2Ca phase and Mg12CeZn phase. This change led to corrosion acceleration of Mg ma-trix at the initial stage but also sped up the formation of compact corrosion products for Mg-2Zn-0.5Mn-1Ca-1.5Ce alloy (Alloy II), and therefore enhanced its biocorrosion resistance. Cerium containing Alloy II has the potential to be used as future biomate-rials.

  15. 稀土元素铈在不锈钢中的应用及研究进展%Application and Development of Cerium in Stainless Steel

    Institute of Scientific and Technical Information of China (English)

    郑锋; 程挺宇; 张巧云


    The application of cerium in Ferrite stainless steel, austenitic stainless steel and duplex stainless steel is comprehensively described.Performances of stainless steel, such as corrosion resistance, plastic and tensile strength, can be significantly improved by adding cerium.The stainless steel containing cerium has wide application prospects.%阐述稀土元索铈在铁素体不锈钢、奥氏体不锈钢、双相不锈钢中的应用.铈能显著提高不锈钢的耐蚀性、塑性、抗拉强度等各项性能,因而含铈不锈钢具有广阔的应用前景.

  16. 新生儿惊厥148例临床分析%Neonatal Shock Clinical Analysis of 148 Cases of Break Off

    Institute of Scientific and Technical Information of China (English)



      目的探讨新生儿惊厥病因、临床特点及急救方法,减少惊厥及后遗症的发生.方法回顾性分析我院2005年01月-2011年12月共收治的148例惊厥新生儿的临床资料.结果痊愈121例,有症状出院的19例,死亡5例,自动出院3例,20例遗留有不同程度神经系统后遗症.围产期窒息是引起惊厥的首要原因,其次是感染性疾病、糖及电解质紊乱、各类先天性遗传代谢病.发作类型以微小性发作为多见,其次为阵挛性发作.治疗重点在于止痉,首选苯巴比妥,14.9%的患儿足量用药不能控制.结论围产期窒息是导致新生儿惊厥的主要病因;苯巴比妥仍是抗惊厥的首选药物,少数患儿须加用二线药物;发作形式以微小性发作最为多见;EEG 背景波是判断预后的一个良好的指示.%  Objective Investigate the cause of neonatal convulsions、clinical characteristics and first-aid methods,reduce the incidence of seizures and the sequelae.Methods Retrospective analysis of our hospital from Janu-ary 2005 to December 2011 in the total of 148 cases of eclampsia admitted to the clinical data of newborn.Results 121 cases of ful recovery,discharged from hospital with symptoms of 19 cases,the death of five cases, three cases of automatic discharge, there are 20 cases left over from the nervous system sequelae of varying degrees.Caused by perinatal asphyxia is the primary cause of febrile seizures, folowed by infectious diseases, sugar and electrolyte disorders, various types of congenital genetic metabolic diseases. Type of attack made little as often, folowed by clonic seizures. To stop focusing on the reatment of seizures, Phenobarbital prefered ,14.9% of children with a sufficient quantiy of medicines stil con not control.Conclusions Perinatal asphyxia is a major cause of neonatal convulsions;Phenobarbital is stil the first choice anticonvulsant drug, a smal number of children with second-line drugs should be added; The

  17. Potential of a Hydrometallurgical Recycling Process for Catalysts to Cover the Demand for Critical Metals, Like PGMs and Cerium (United States)

    Steinlechner, Stefan; Antrekowitsch, Jürgen


    The metals from the platinum group are used in many different industries, for example dental, jewelry, and chemicals. Nevertheless, the most important use is based on their catalytic properties. Approximately 50% of platinum and palladium are used as automotive and industrial catalysts. In case of rhodium, an even higher percentage (around 80-90%) is used as an alloying element in the active layer of different catalysts. The high required amount of 300-900 kg of treated ore to obtain approximately 1 g of PGM is responsible for the high prices. On average, the contents in the ore of Pt and Pd are 5-10 times higher than Rh and Ru and around 50 times higher than Ir and Os. Additionally, the regional limitation of ore bodies leads to a strong dependence on mainly South Africa and Russia as PGM suppliers. Based on the strong discrepancy in supply and demand of PGM's around the world, recycling of catalysts is mandatory and meaningful from the ecological and economical point of view. Based on the high prices of PGM, the industry is forced to improve the efficiency of catalysts, which is done by improving the wash coat technology. By using rare-earth elements, like cerium oxide, the surface can be increased and the ability to supply oxygen is secured. As a side effect, cerium as an additional critical element is introduced into the recycling circuit of catalytic converters, forming a further valuable component and forming a major challenge for common pyrometallurgical converter recycling. Therefore, this article introduces a hydrometallurgical process, developed together with Railly&Hill Inc., for PGM as well as cerium recovery from catalytic converters.

  18. Fabrication of Al5083 surface composites reinforced by CNTs and cerium oxide nano particles via friction stir processing

    Energy Technology Data Exchange (ETDEWEB)

    Hosseini, S.A. [Department of Materials Science and Engineering, Faculty of Engineering, Shahid Chamran University of Ahvaz (Iran, Islamic Republic of); Ranjbar, Khalil, E-mail: [Department of Materials Science and Engineering, Faculty of Engineering, Shahid Chamran University of Ahvaz (Iran, Islamic Republic of); Dehmolaei, R. [Department of Materials Science and Engineering, Faculty of Engineering, Shahid Chamran University of Ahvaz (Iran, Islamic Republic of); Amirani, A.R. [12th Ghaem Street, Bld. Hashemzadeh, Shahrak Golestan, Tehran (Iran, Islamic Republic of)


    Highlights: • Using friction stir processing, an effect of CNTs and CeO{sub 2} reinforcements on mechanical and corrosion properties of Al5083 alloy is reported. • The strength of Al5083 was increased by 42%, its matrix grain size reduced five times, and hardness was doubled by the incorporation of CNTs-CeO{sub 2} mixture in the volume ratio of 75-25 respectively. • Unlike the CNTs, incorporation of nanosized CeO{sub 2} particles resulted in remarkable increase in pitting resistance of the alloy. - Abstract: In the present investigation, friction stir processing (FSP) was utilized to incorporate Multi Walled Carbon Nano Tubes (MWCNT) and nanosized cerium oxide particles into the matrix of Al5083 alloy to form surface reinforced composites. The effect of these nanosized reinforcements either separately or in the combined form, on microstructural modification, mechanical properties and corrosion resistance of FSPed Al5083 surface composites was studied. A threaded cylindrical hardened steel tool was used with the rotation speeds of 600 and 800 rpm and travel speeds of 35 and 45 mm/min and a tilt angle of 5°. Mechanical properties and corrosion resistance of FSPed samples were evaluated and compared with the base alloy. The maximum tensile strength and hardness value were achieved for the hybrid composite containing a mixture of CNTs and cerium oxide in the volume ratio of 75-25, respectively, whereas a significant increase in pitting resistance of the base alloy was obtained when cerium oxide alone was incorporated. The corrosion behavior of the samples was investigated by potentiodynamic polarization tests and assessed in term of pitting potential and passivation range. Microstructural analysis carried out by using optical and electron microscopes showed that reinforcements are well dispersed inside the nugget zone (NZ), and remarkable grain refinement is gained. The study was aimed to fabricate surface composites with improved mechanical properties and

  19. Hysteresis phenomenon and huge isotope effect in hydrogenation cycles of some cerium-containing LaNi5-type compounds

    International Nuclear Information System (INIS)

    The huge hysteresis effect and the isotope effect, two effects that accompany the hydrogen absorbing process of cerium containing LaHi5-type compound were studied. The hysteresis effect was studied on compounds of the type (Lasub(0.5)Cesub(0.5))Nisub(5-x)Cosuh(x) and their hydrides, for 0 5 compounds display very large hysteresis effect in the course of a hydrogenation cycle. The addition of cobalt markedly affects the absorption pressure plateau which reverts to normal value at x = 1, practically eliminating the hysteresis effect. The results indicate that the relevant absorption pressure plateau and the resulting hysteresis effect are due to the presence of cerium atoms and to the formation of the expanded Hsup(I) LaNi5-type hydride. The formation of this hydride phase favours the reversion of cerium to the trivalent state. The substitution of 20% of the nickel atoms by cobalt atoms suppresses the formation of the Hsup(I) hydride which is replaced by tOe less expanded Hsup(II) hydride. The Hsup(II) hydride does not display anomalous hysteresis effect. Similar results were obtained for MmNisub(5-x)Cosub(x) (Mm = mischmetal). The isotope effect was studied on the compound (Lasub(0.4)Cesub(0.6))Ni5. The pressure-composition isotherms were determined both for hydrogen and deuterium for different working temperatures. A huge temperature-dependent isotope effect with cross-over occurring below room temperature was observed. The enthalpy and entropy differences between the hydride and the deuteride were calculated and found to be more negative in the deuteride both for the absorption and desorption pressures

  20. Influence of the surface pre-treatment of aluminum on the processes of formation of cerium oxides protective films (United States)

    Andreeva, R.; Stoyanova, E.; Tsanev, A.; Stoychev, D.


    It is known that there is special interest in the contemporary investigations on conversion treatment of aluminum aimed at promoting its corrosion stability, which is focused on electrolytes on the basis of salts of metals belonging to the group of rare-earth elements. Their application is especially attractive, as it enables a successful substitution of the presently applied highly efficient, but at the same time toxic Cr6+-containing electrolytes. The present paper presents a study on the influence of the preliminary alkaline activation and acidic de-oxidation of the aluminum surface on the processes of immersion formation of protective cerium oxides films on Al 1050. The results obtained show that their deposition from simple electrolytes (containing only salts of Ce3+ ions) on the Al surface, treated only in alkaline solution, occurs at a higher rate, which leads to preparing thicker oxide films having a better protective ability. In the cases when the formation of oxide films is realized in a complex electrolyte (containing salts of Ce3+ and Cu2+ ions), better results are obtained with respect to the morphology and protective action of cerium oxides film on samples that have been consecutively activated in alkaline solution and deoxidized in acidic solution. Electrochemical investigations were carried out in a model corrosion medium (0.1 M NaCl); it was shown that the cerium protective films, deposited by immersion, have a cathodic character with regard to the aluminum support and inhibit the occurrence of the depolarizing corrosion process -- the reaction of oxygen reduction.

  1. Steady photo-darkening of thulium alumino-silicate fibers pumped at $1.07~\\mu m$: Quantitative effect of lanthanum, cerium and thulium

    CERN Document Server

    Lupi, Jean-François; Blanc, Wilfried; Mady, Franck; Benabdesselam, Mourad; Dussardier, Bernard; Neuville, Daniel R


    By pumping thulium-doped silica-based fibers at 1.07~\\mu m, rapid generation of absorbing centers leads to photo-induced attenuation (PIA). This detrimental effect prevents exploiting laser emissions in the visible and near infrared. We report on the characterization of the PIA versus the fiber core composition, particularly the concentration of thulium (Tm), lanthanum (La) and cerium (Ce) ions. We show that UV emision induced by Tm-Tm energy transfers is the source of photo-darkening, and that lanthanum and cerium are efficient hardeners against PIA.

  2. Interactive effect of cerium and aluminum on the ignition point and the oxidation resistance of magnesium alloy

    Energy Technology Data Exchange (ETDEWEB)

    Lin Pengyu [Key Laboratory of Automobile Materials of Ministry of Education, School of Materials Science and Engineering, Nanling Campus of Jilin University, Changchun Jilin 130025 (China)], E-mail:; Zhou Hong; Li Wei; Li Wenping; Sun Na [Key Laboratory of Automobile Materials of Ministry of Education, School of Materials Science and Engineering, Nanling Campus of Jilin University, Changchun Jilin 130025 (China); Yang Rong [Public Mathematics Teaching and Research Center, College of Mathematics, Qianwei Campus of Jilin University, Changchun Jilin 130012 (China)


    This paper focused on the interactive effect of cerium (Ce) addition and aluminum (Al) content in magnesium alloy on ignition point and oxidation resistance. Ce content played an important role in improving the oxidation resistance of Mg alloy. Ignition point ascended with increasing Ce content. 0.25 wt% Ce content in Mg alloys could greatly improve tightness of the oxide film of Mg alloys. However, when Ce content in the alloy exceeded its solid solubility, ignition point descended. Furthermore, Al content in the alloy also influenced the ignition point. The higher the Al content was, the lower the ignition point.

  3. Synthesis of β-SiC/SiO_2 core-shell nanowires with the assistance of cerium oxide

    Institute of Scientific and Technical Information of China (English)

    于伟鹏; 郑瑛; 杨娥; 邱健斌; 兰瑞芳


    The β-SiC/SiO2 core-shell nanowires with the "stem-and-node" structure were synthesized in the presence of cerium oxide by the carbothermal reduction of the starch-SiO2 hybrids gel.The samples were characterized by X-ray diffraction(XRD),scanning electron microscopy(SEM),transmission electron microscopy(TEM),high-resolution transmission electron microscopy(HRTEM) and energy-dispersed X-ray(EDX).The results showed that the nanowires consisted of a 20-35 nm diameter crystalline β-SiC core wrapped with a 2-5 n...

  4. Mast cells contribute to altered vascular reactivity and ischemia-reperfusion injury following cerium oxide nanoparticle instillation


    Wingard, Christopher J.; WALTERS, DIANNE M.; Cathey, Brook L.; Hilderbrand, Susana C.; Katwa, Pranita; Lin, Sijie; Ke, Pu Chun; Podila, Ramakrishna; Rao, Apparao; Lust, Robert M.; Brown, Jared M.


    Cerium oxide (CeO2) represents an important nanomaterial with wide ranging applications. However, little is known regarding how CeO2 exposure may influence pulmonary or systemic inflammation. Furthermore, how mast cells would influence inflammatory responses to a nanoparticle exposure is unknown. We thus compared pulmonary and cardiovascular responses between C57BL/6 and B6.Cg-KitW-sh mast cell deficient mice following CeO2 nanoparticle instillation. C57BL/6 mice instilled with CeO2 exhibited...

  5. Analysis of DNA modified by cerium (III, lanthanum (III and gadolinium (III ions by using of raman spectroscopy

    Directory of Open Access Journals (Sweden)

    Veronika Kohoutkova


    Full Text Available Lanthanides are at the present group of heavy metals, which are at the centre of interest, especially because of their ability to interact with DNA and similarity with calcium(III ions, which play crucial role in many cell processes. On basis of DNA interactions, anti–cancerogenic potential is established. In our work, we were focused on interactions of chosen lanthanides – lanthanum, cerium and gadolinium – with DNA. Results of our experiments demonstrate ability of lanthanides to form DNA adducts.

  6. Uptake and Release of Cerium During Fe-Oxide Formation and Transformation in Fe(II) Solutions

    DEFF Research Database (Denmark)

    Nedel, Sorin; Dideriksen, Knud; Christiansen, Bo C.;


    of trace components. Further, Fe(II)-Fe(III) (hydr)oxides are redox active. Cerium, a member of the lanthanide family, can be used as an analogue for the tri- and tetra-valent actinides found in radioactive waste, expected to be stored in subsurface repositories. In experiments with ferrihydrite, Ce...... environments. Our results also suggest that trivalent actinides and lanthanides are released when dissimilatory iron reduction of Fe(III)-oxides leads to GR formation However, under oxidizing conditions, GR may influence radionuclide mobility by catalyzing their transformation to a higher oxidation state....

  7. Oxidation behaviour and electrical properties of cobalt/cerium oxide composite coatings for solid oxide fuel cell interconnects

    DEFF Research Database (Denmark)

    Harthøj, Anders; Holt, Tobias; Møller, Per


    This work evaluates the performance of cobalt/cerium oxide (Co/CeO2) composite coatings and pure Co coatings to be used for solid oxide fuel cell (SOFC) interconnects. The coatings are electroplated on the ferritic stainless steels Crofer 22 APU and Crofer 22H. Coated and uncoated samples....... The ASR of all Crofer 22H samples increased significantly faster than of Crofer 22 APU samples which was likely due to the presence of SiO2 in the oxide/metal interface of Crofer 22H....

  8. The herpesvirus 8-encoded chemokine vMIP-II, but not the poxvirus-encoded chemokine MC148, inhibits the CCR10 receptor

    DEFF Research Database (Denmark)

    Lüttichau, H R; Lewis, I C; Gerstoft, J;


    chemokines are expressed in the skin we suspected MC148 to block CCR10. However, in calcium mobilization assays we found MC148 unable to block CCR10 in micromolar concentrations in contrast to vMIP-II. (125)I-MC148 was only able to bind to CCR8, but not to CCR10, CCR11, CXCR6 / BONZO, APJ, DARC or the orphan...

  9. Synthesis, Structure, and Reactivity ofbis(1,2,4-tri-t-butylcyclopentadienyl) Complexes of Cerium

    Energy Technology Data Exchange (ETDEWEB)

    Werkema, Evan L.


    The sterically demanding 1,2,4-tri-t-butylcyclopentadienylligand (1,2,4-(Me3C)3C5H2, hereafter Cp') has been used to preparemonomeric cerium metallocenes, Cp 2CeX (X = Cl, I, OSO2CF3), which areused to synthesize the benzyl, Cp'2CeCH2C6H5. The benzyl is a usefulstarting material for preparing other complexes in the Cp'2CeZ system (Z= BF4, F, NH2, C6H5, H). X-ray crystal structures of Cp'2CeOSO2CF3,Cp'2CeF, Cp'2CeCH2C6H5, and Cp'2CeH are presented. The benzyl slowlydecomposes in solution to toluene and a metallacycle,[Cp'][(Me3C)2C5H2(CMe2CH2)]Ce. The ring CMe3 groups of both themetallacycle and the hydride, Cp'2CeH, can be fully deuterated byprolonged exposure to C6D6, providing a useful labeling tool inmechanistic studies.The hydride activates C-F and/or C-H bonds influorobenzenes, C6HxF6-x , x = 0-5. The reactions are selective, with theselectivity depending on the presence of two fluorines ortho to thereaction site more than on the type of bond activated. Complexes of thetype Cp'2CeC6HxF5-x , x = 0-4, are formed as intermediates, which slowlydecompose in solution to Cp'2CeF and fluorobenzynes, C6HxF4-x, x = 0-4,which are trapped. The rate at which Cp'2CeC6HxF5-x complexes decomposeincreases as the number of fluorines decreases. Complexes with oneortho-fluorine decompose much faster than those with two ortho-fluorines.The metallacycle activates only C-H bonds in fluorobenzenes, permittingthe synthesis of specific Cp'2CeC6HxF5-x complexes. The crystal structureof Cp'2CeC6F5 is presented. The hydride and the metallacycle react withfluoromethanes, CH4-xFx, x = 1-3, through postulated Cp'2CeCH3-xFxintermediates to generate Cp'2CeF and other products. The other products,CH4, tri-t-butylbenzenes, tri-t-butylfluorobenzenes, and a presumedmetallocene cerium fluoride with one Cp' and one (Me2EtC)(Me3C)2C5H2ligand, suggest a decomposition pathway for Cp'2CeCH3-xFx , x = 1

  10. M148R and M149R are two virulence factors for myxoma virus pathogenesis in the European rabbit. (United States)

    Blanié, Sophie; Mortier, Jérémy; Delverdier, Maxence; Bertagnoli, Stéphane; Camus-Bouclainville, Christelle


    Myxoma virus (MYXV), a member of the Poxviridae family, is the agent responsible for myxomatosis, a fatal disease in the European rabbit (Oryctolagus cuniculus). MYXV has a linear double-stranded DNA genome that encodes several factors important for evasion from the host immune system. Among them, four ankyrin (ANK) repeat proteins were identified: M148R, M149R, M150R and M-T5. To date, only M150R and M-T5 were studied and characterized as critical virulence factors. This article presents the first characterization of M148R and M149R. Green Fluorescent Protein (GFP) fusions allowed us to localize them in a viral context. Whereas M149R is only cytoplasmic, interestingly, M148R is in part located in the nucleolus, a unique feature for an ANK repeat poxviral protein. In order to evaluate their implication in viral pathogenicity, targeted M148R, M149R, or both deletions were constructed in the wild type T1 strain of myxoma virus. In vitro infection of rabbit and primate cultured cells as well as primary rabbit cells allowed us to conclude that M148R and M149R are not likely to be implicated in cell tropism or host range functions. However, in vivo experiments revealed that they are virulence factors since after infection of European rabbits with mutant viruses, a delay in the onset of clinical signs, an increase of survival time and a dramatic decrease in mortality rate were observed. Moreover, histological analysis suggests that M148R plays a role in the subversion of host inflammatory response by MYXV. PMID:19019281

  11. Effect of Cerium on Microstructure and Electrochemical Performance of Ti-V-Cr-Ni Electrode Alloy

    Institute of Scientific and Technical Information of China (English)

    Qiao Yuqing; Zhao Minshou; Zhu Xinjian; Cao Guangyi


    Effect of cerium on the microstructure and electrochemical performance of the Ti0.25V0.35-xCexCr0.1Ni0.3 (x=0, 0.005) electrode alloy was investigated by X-ray diffraction (XRD), field emission scanning electron microscopy/energy dispersive X-ray spectrometry (FESEM-EDS), and electrochemical impedance spectroscopy (EIS) measurements. On the basis of XRD and FESEM-EDS analysis, the alloy was mainly composed of V-based solid solution with body-centered-cubic structure and TiNi-based secondary phase. Ce did not exist in two phases, instead, it existed as Ce-rich small white particles, with irregular edges, distributed near the grain boundaries of the V-based solid solution phase. Discharge capacity, cycle stability, and high-rate discharge ability of the alloy electrode were effectively improved with the addition of Ce at 293 K. It was very surprising that the charge retention was abnormal with larger discharge capacity after standing at the open circuit for 24 h. EIS indicated that addition of Ce improved the dynamic performance, which caused the charge transfer resistance (RT) to decrease and exchange current density (I0) to increase markedly. The exchange current density of the electrochemical reaction on the alloy surface with Ce addition was about 2.07 and 3.10 times larger than that of the alloy without Ce at 303 and 343 K, respectively. The diffusion coefficient of hydrogen (D) in the bulk alloy electrode decreased with addition of Ce, but it did not decrease so much, and the apparent activation energy (△rH) was far higher than that of the AB5 type alloy.

  12. Separation chemistry and clean technique of cerium(IV):A review

    Institute of Scientific and Technical Information of China (English)

    邹丹; 陈继; 李德谦


    The separation method of changeable valence RE element of cerium (Ce) was reviewed in this paper. Solvent extraction is the most effective and efficient method to separate Ce(IV) from RE(III), usually accompanied with fluorine (F) and phosphor (P) from bastnaesite and monazite etc. By roast or wet-air oxidation, Ce(III) of bastnaesite and monazite was oxidized into Ce(IV), and Cyanex923 and [A336][P507] have been investigated to co-extract and recover Ce(IV), F and P from H2SO4 leaching liquor, leading to favorable conditions for the subsequent separation of Th(IV) and RE(III). The interaction of Ce(IV) and F and/or P enhances the roasting, leaching and extraction of Ce(IV) due to increasing of the stability of Ce(IV), and the formation of CeF3 and CePO4 after reductive stripping will benefit the utilization of F and P. For dealing with RE ores of high-content Ce, the clean process of oxidation roasting and Ce(IV)-F separation for Sichuan bastnaesite highlights the advantages of Ce(IV) based clean technique, which firstly demonstrates the comprehensive utilization of Ce(IV), Th(IV), F and RE(III) and prevention of environmental pollution from foun-tainhead. A preliminary flowsheet of two-step oxidation and extraction of Ce(IV) for Bayan Obo mixed ores was further proposed to process the oxidation and extraction of Ce(IV) in presence of both F and P, indicating the possibility of similar effects with clean process of Sichuan bastnaesite. Ce(IV) separation chemistry and clean technique will open up new realms for light RE resources utilization, meeting“Emission Standards of Pollutants from Rare Earths Industry”promulgated by China’s Ministry of Environment Protection (MOP) in 2011.

  13. Pulmonary toxicity of well-dispersed cerium oxide nanoparticles following intratracheal instillation and inhalation

    International Nuclear Information System (INIS)

    We performed inhalation and intratracheal instillation studies of cerium dioxide (CeO2) nanoparticles in order to investigate their pulmonary toxicity, and observed pulmonary inflammation not only in the acute and but also in the chronic phases. In the intratracheal instillation study, F344 rats were exposed to 0.2 mg or 1 mg of CeO2 nanoparticles. Cell analysis and chemokines in bronchoalveolar lavage fluid (BALF) were analyzed from 3 days to 6 months following the instillation. In the inhalation study, rats were exposed to the maximum concentration of inhaled CeO2 nanoparticles (2, 10 mg/m3, respectively) for 4 weeks (6 h/day, 5 days/week). The same endpoints as in the intratracheal instillation study were examined from 3 days to 3 months after the end of the exposure. The intratracheal instillation of CeO2 nanoparticles caused a persistent increase in the total and neutrophil number in BALF and in the concentration of cytokine-induced neutrophil chemoattractant (CINC)-1, CINC-2, chemokine for neutrophil, and heme oxygenase-1 (HO-1), an oxidative stress marker, in BALF during the observation time. The inhalation of CeO2 nanoparticles also induced a persistent influx of neutrophils and expression of CINC-1, CINC-2, and HO-1 in BALF. Pathological features revealed that inflammatory cells, including macrophages and neutrophils, invaded the alveolar space in both studies. Taken together, the CeO2 nanoparticles induced not only acute but also chronic inflammation in the lung, suggesting that CeO2 nanoparticles have a pulmonary toxicity that can lead to irreversible lesions

  14. Reinforcement of natural rubber latex with silica modified by cerium oxide:preparation and properties

    Institute of Scientific and Technical Information of China (English)

    张福全; 廖禄生; 王永周; 汪月琼; 黄红海; 李普旺; 彭政; 曾日中


    Variable masses of nano cerium oxide (CeO2) were added into nano silica (SiO2) to prepare the well-dispersed SiO2-CeO2 suspension (SiO2-CeO2), cetyltrimethyl ammonium bromide (CTAB) was used to adjust the compatibility of SiO2-CeO2 with rubber matrix, then SiO2-CeO2 modified by CTAB and curing formulas were mixed with fresh natural rubber (NR) latex to prepare NR/SiO2-CeO2 nanocomposites that contained 0–10 parts of CeO2 by a new emulsion compounding method. The morphologies, cure characteristics, mechanical properties and thermal-oxidative stability of NR/SiO2-CeO2 nanocomposites were investigated. The re-sults revealed that the presence of CeO2 in NR/SiO2-CeO2nanocomposites was favorable for enhancing the interaction between NR matrix and fillers, helped to get smaller SiO2-CeO2 particles with narrower particle size distribution, further improved the crosslink densities and mechanical properties of NR/SiO2-CeO2 nanocomposites vulcanizates. Meanwhile, the addition of CeO2 increased the active energy at least 4.66%, obviously improved the thermal-oxidative aging-inhibiting properties of NR/SiO2-CeO2 nanocomposites. Additionally, nanocomposites containing CeO2 promotedTg shift to high temperature direction, causing the nanocomposites featured higher tanδ at 0 ºC and lower tanδ at 60 ºC and exhibited comparable wet grip and lower rolling resistance when NR/SiO2-CeO2nano-composites were used in tire tread compound.

  15. Optical spectroscopy of yttrium double phosphates doped by cerium and praseodymium ions

    International Nuclear Information System (INIS)

    This paper reports the spectroscopic properties of cerium- and praseodymium-doped alkali metal yttrium double phosphates, M3Y(PO4)2:Pr3+, Ce3+; M = Na, Rb. These phosphates were obtained by a solid state reaction between lanthanide phosphate hydrates and M3PO4. The absorption, reflection, emission and excitation spectra were measured at room temperature, 77 and 4 K in the IR-vis-ultraviolet (UV) range. For both the Ce3+- and Pr3+-doped double phosphates, the 4fN↔4fN-15d transitions were detected. For the Pr3+-doped double phosphates, the 4f-4f transitions from the 3H4 ground manifold were analyzed. The low temperature 3H4→3P0 absorption spectra were used to characterize the structural modifications between the sodium and rubidium salts. For the Ce3+-doped double phosphate, the strong blue 5d1→4f1 emission band splits into two components due to the 2F5/2-2F7/2 splitting of the 4f1 configuration. Intense emission occurs mainly from the 3P0 level at high dopant concentrations, since the 1D2 emission is strongly quenched but was detected at the 2 mol% doping level. In spite of the forbidden 4f-4f character, the 3P0 transitions have very short decay times, of the order of one μs. Dynamics of the excited states will be discussed based on the decay times and selective excited emission

  16. Pulmonary toxicity of well-dispersed cerium oxide nanoparticles following intratracheal instillation and inhalation

    Energy Technology Data Exchange (ETDEWEB)

    Morimoto, Yasuo, E-mail:; Izumi, Hiroto; Yoshiura, Yukiko; Tomonaga, Taisuke; Oyabu, Takako; Myojo, Toshihiko; Kawai, Kazuaki; Yatera, Kazuhiro [University of Occupational and Environmental Health (Japan); Shimada, Manabu; Kubo, Masaru [Hiroshima University (Japan); Yamamoto, Kazuhiro [National Institute of Advanced Industrial Science and Technology (AIST) (Japan); Kitajima, Shinichi [National Sanatorium Hoshizuka Keiaien (Japan); Kuroda, Etsushi [Osaka University, Laboratory of Vaccine Science, WPI Immunology Frontier Research Center (Japan); Kawaguchi, Kenji; Sasaki, Takeshi [National Institute of Advanced Industrial Science and Technology (AIST) (Japan)


    We performed inhalation and intratracheal instillation studies of cerium dioxide (CeO{sub 2}) nanoparticles in order to investigate their pulmonary toxicity, and observed pulmonary inflammation not only in the acute and but also in the chronic phases. In the intratracheal instillation study, F344 rats were exposed to 0.2 mg or 1 mg of CeO{sub 2} nanoparticles. Cell analysis and chemokines in bronchoalveolar lavage fluid (BALF) were analyzed from 3 days to 6 months following the instillation. In the inhalation study, rats were exposed to the maximum concentration of inhaled CeO{sub 2} nanoparticles (2, 10 mg/m{sup 3}, respectively) for 4 weeks (6 h/day, 5 days/week). The same endpoints as in the intratracheal instillation study were examined from 3 days to 3 months after the end of the exposure. The intratracheal instillation of CeO{sub 2} nanoparticles caused a persistent increase in the total and neutrophil number in BALF and in the concentration of cytokine-induced neutrophil chemoattractant (CINC)-1, CINC-2, chemokine for neutrophil, and heme oxygenase-1 (HO-1), an oxidative stress marker, in BALF during the observation time. The inhalation of CeO{sub 2} nanoparticles also induced a persistent influx of neutrophils and expression of CINC-1, CINC-2, and HO-1 in BALF. Pathological features revealed that inflammatory cells, including macrophages and neutrophils, invaded the alveolar space in both studies. Taken together, the CeO{sub 2} nanoparticles induced not only acute but also chronic inflammation in the lung, suggesting that CeO{sub 2} nanoparticles have a pulmonary toxicity that can lead to irreversible lesions.

  17. Electrodeposition of cerium oxide on porous silicon via anodization and enhancement of photoluminescence (United States)

    Mizuhata, Minoru; Kubo, Yohei; Maki, Hideshi


    A porous Si/cerium oxide composite (PSi/CeO2) was synthesized by electrodeposition of CeO2 via anodic oxidation on PSi. The PSi photoluminescence (PL) was enhanced. The anodically oxidized PSi substrates in HF solution had macropores (diameter 2 μm), mesopores (diameter 15 nm), and micropores (diameter less than 4 nm). Emission at 700 nm from microporous PSi (microPSi) was observed under ultraviolet irradiation. Transmission electron microscopy showed that in microPSi/CeO2, the oxide was infiltrated into microPSi by anodization. The deposited amount of CeO2 depended on the reaction time, applied voltage, temperature, and reaction species concentrations in anodization. Emission by microPSi/CeO2 at 650 nm was observed; the PL intensity was higher (about 10-30 times) than that of PSi because of energy transfer from CeO2 to nanosized Si in porous layers produced by HF etching. The lifetime of the PL of microPSi/CeO2 was longer than that of microPSi. Excitation spectra of microPSi/CeO2 at 650 nm and diffuse-reflectance spectra showed that the excitation peak for microPSi/CeO2 was similar to the absorbance of CeO2, and excitation of microPSi/CeO2 gave two peaks, at 3.7 and 4.4 eV; these peaks originated from the absorptions of CeO2 and Si nanocrystals. The PL of PSi was enhanced in microPSi/CeO2 because of efficient energy transfer from CeO2 to the Si nanocrystal.

  18. Standard test method for atom percent fission in uranium and plutonium fuel (Neodymium-148 Method)

    CERN Document Server

    American Society for Testing and Materials. Philadelphia


    1.1 This test method covers the determination of stable fission product 148Nd in irradiated uranium (U) fuel (with initial plutonium (Pu) content from 0 to 50 %) as a measure of fuel burnup (1-3). 1.2 It is possible to obtain additional information about the uranium and plutonium concentrations and isotopic abundances on the same sample taken for burnup analysis. If this additional information is desired, it can be obtained by precisely measuring the spike and sample volumes and following the instructions in Test Method E267. 1.3 This standard does not purport to address all of the safety concerns, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use.

  19. Effect of variable cerium concentration on photoluminescence behaviour in ZrO2 phosphor synthesized by combustion synthesis method (United States)

    Dubey, Vikas; Kaur, Jagjeet


    Present paper reports synthesis and characterization of trivalent cerium (Ce3+) doped zirconium dioxide (ZrO2) phosphors. Effect of variable concentration of cerium on photoluminescence (PL) is studied. Samples were prepared by combustion synthesis technique which is suitable for less time taking techniques also for large scale production for phosphors. Starting material used for sample preparation are Zr(NO3)3 and Ce(NO3)3 and urea used as a fuel. All prepared phosphor with variable concentration of Ce3+ (0.1 to 2mol%) was studied by photoluminescence analysis it is found that the excitation spectra of prepared phosphor shows broad excitation centred at 390nm. The excitation spectra with variable concentration of Ce3+ show strong peaks at 447nm. Spectrophotometric determinations of peaks are evaluated by Commission Internationale de I'Eclairage technique. Using this phosphor, the desired CIE values including emissions throughout the violet (390 nm) and blue (427 nm) of the spectra were achieved. Efficient blue light emitting diodes were fabricated using Ce3+ doped phosphor based on near ultraviolet (NUV) excited LED lights.

  20. Mechanical properties of cerium and a cerium–5 wt% lanthanum alloy by nanoindentation and ultrasonic velocity measurements

    Energy Technology Data Exchange (ETDEWEB)

    Wheeler, D.W., E-mail: [AWE, Aldermaston, Reading, Berkshire RG7 4PR (United Kingdom); Zekonyte, J.; Wood, R.J.K. [National Centre for Advanced Tribology Southampton (nCATS), University of Southampton, Highfield, Southampton SO17 1BJ (United Kingdom)


    This paper describes a study of the mechanical properties of cerium (Ce) and a cerium–5 wt% lanthanum (Ce–5 wt% La) alloy using nanoindentation and ultrasonic velocity measurements. The materials were also characterised using optical microscopy, energy dispersive spectroscopy, Raman spectroscopy and X-ray diffraction. Despite their propensity to oxidise rapidly in air, both unalloyed Ce and the Ce–5 wt% La alloy have been studied safely in an open laboratory. The hardness and elastic modulus values of the Ce–5 wt% La alloy were slightly higher than those of unalloyed Ce. However, the hardness values of both materials were significantly higher than other values reported in the literature; this was attributed to the presence of cerium oxide inclusions in the microstructure. Reasonable agreement was found between the elastic moduli obtained by nanoindentation and ultrasonic velocity measurements. The mean elastic modulus measured by nanoindentation was, on average, 14% higher than that obtained from the ultrasonic velocity measurements. This work has demonstrated that, with care, Ce can be handled in an open laboratory and meaningful mechanical property data obtained that appear to be free of the influence of the surface oxide layer.