WorldWideScience

Sample records for center microquasar 1e

  1. Microquasars

    Science.gov (United States)

    Castro-Tirado, Alberto J.; Greiner, Jochen; Paredes, Josep M.

    2001-06-01

    The study of microquasars, sources in our Galaxy displaying powerful relativistic jets, is a rapidly advancing field in astrophysics. New instrumentation on the ground (MERLIN, SCUBA, VLA, and VLT) and aboard satellites (ASCA, BSAX, ISO, IXAE and RXTE) has provided important results, and much more is expected to come from Chandra and XMM-Newton. In the future, powerful instrumentation will come online in sub-mm (ALMA) and gamma rays (INTEGRAL), extending our coverage to important regions for the study of microquasars. Energy transport via relativistic jets is one of the most important physical mechanisms taking place in compact objects, either in binary systems or in the nuclei of active galaxies. Large efforts have been devoted to proper understanding of the disk-jet connection, and even the effects of rotation or magnetic fields. Several important advances have been made recently, both from the point of view of the theoretical treatment of jets and the different new observational tests. All of them are reflected in this book, the first one devoted to the study of these enigmatic objects. Link: http://www.wkap.nl/book.htm/0-7923-6923-8

  2. A Deep XMM-Newton Observation of the Enigmatic Microquasar 1E 1740.7-2942

    Science.gov (United States)

    Miller, Jon

    1E 1740.7-2942 is a microquasar residing in the Galactic center. It is persistently bright at X-ray energies and has been shown to power large scale bi-polar jets, thus making it an ideal source to probe the jet generation/launching mechanism in accreting black holes. Analysis of archival data hinted at the presence of a relativistically broadened iron line, providing a means to constrain the spin of the black hole in this system for the first time. In AO-10 we were awarded a 130 ks XMM-Newton category B target of oppurtunity (ToO) observation, with the aim of observing this system in the low-hard state. This observation was triggered in April 2012 and the data have been obtained, where a preliminary analysis reveals the expected broad iron line. Modeling this iron line will allow us to constrain the spin of the black hole and probe its relation to the presence of large scale jets in this system. We request a total of $63.7k funding to support the analysis of this deep XMM-Newton observation, including the primary target (1E 1740.7-2942) and the serendipitous sources in the field of view (destiny of the universe, and the nature of black holes, dark energy, dark matter, and gravity. and 2.4.2: Improve understanding of the many phenomena and processes associated with galaxy, stellar, and planetary system formation and evolution from the earliest epochs to today.

  3. The proton microquasar

    OpenAIRE

    Vila, Gabriela S.; Romero, Gustavo E.

    2008-01-01

    We present a model for high-energy emission in microquasars where the energy content of the jets is dominated by relativistic protons. We also include a primary leptonic component. Particles are accelerated up to relativistic energies in a compact region located near the base of the jet, where most of the emission is produced. We calculate the production spectrum due to proton and electron synchrotron radiation and photohadronic interactions. The target field for proton-photon collisions is p...

  4. Correlations of Active Galactic Nuclei with Microquasars

    Institute of Scientific and Technical Information of China (English)

    YE Yong-Chun; ZUO Xue-Qin; WANG Ding-Xiong

    2006-01-01

    Correlations of active galactic nuclei (AGNs) with microquasars are discussed based on the coexistence of the Blandford-Znajek (BZ) and magnetic coupling (MC) processes (CEBZMC) in black hole (BH) accretion disk.The proportions of several quantities of BH systems for both AGNs and microquasars are derived by combining the observational data with CEBZMC. It is shown that the square of the magnetic field at the BH horizon is inversely proportional to the BH mass, while the accretion rate of the disk is proportional to the BH mass. In addition, the very steep emissivity indexes from the recent XMM-Newton observations of the nearby bright Seyfert 1 galaxy MCG-6-30-15 and the microquasars XTE J1650-500 are well fitted by considering the MC effects on the disk radiation. These results suggest strongly the correlations of A GNs with microquasars.

  5. Microquasar models for 3EG J1828+0142 and 3EG J1735-1500

    CERN Document Server

    Bosch-Ramon, V; Romero, G E; Torres, D F

    2004-01-01

    Microquasars are promising candidates to emit high-energy gamma-rays. Moreover, statistical studies show that variable EGRET sources at low galactic latitudes could be associated with the inner spiral arms. The variable nature and the location in the Galaxy of the high-mass microquasars, concentrated in the galactic plane and within 55 degrees from the galactic center, give to these objects the status of likely counterparts of the variable low-latitude EGRET sources. We consider in this work the two most variable EGRET sources at low-latitudes: 3EG J1828+0142 and 3EG J1735-1500, proposing a microquasar model to explain the EGRET data in consistency with the observations at lower energies (from radio frequencies to soft gamma-rays) within the EGRET error box.

  6. Internal shock model for Microquasars

    CERN Document Server

    Kaiser, C R; Spruit, H C; Kaiser, Christian R.; Sunyaev, Rashid; Spruit, Henk C.

    2000-01-01

    We present a model for the radio outbursts of microquasars based on the assumption of quasi-continuous jet ejection. The jets are `lit up' by shock fronts traveling along the jets during outbursts. The observed comparatively flat decay light curves combined with gradually steepening spectral slopes are explained by a superposition of the radiation of the aging relativistic particle population left behind by the shocks. This scenario is the low energy, time-resolved equivalent to the internal shock model for GRBs. We show that this model predicts energy contents of the radiating plasma similar to the plasmon model. At the same time, the jet model relaxes the severe requirements on the central source in terms of the rate at which this energy must be supplied to the jet. Observations of `mini-bursts' with flat spectral slopes and of infrared emission far from the source centre suggest two different states of jet ejections: (i) A `mini-burst' mode with relatively stable jet production and weak radio emission with...

  7. Jets in high-mass microquasars

    CERN Document Server

    Perucho, Manel

    2011-01-01

    The morphologies of detected jets in X-ray binaries are almost as diverse as their number. This is due to different jet properties and ambient media that these jets encounter. It is important to understand the physics of these objects and to obtain information about possible sites suitable for particle acceleration in order to explain the observations at very high energies. Here I present the results obtained from the first relativistic hydrodynamical simulations of jets in high-mass microquasars. Our results allow us to make estimates for the emission originated in different sites of the whole structure generated by the jets. These works represent a first step in trying to obtain a deeper understanding of the physics and emission processes related with jets in high-mass microquasars.

  8. The precessing jets of 1E 1740.7-2942

    CERN Document Server

    Luque-Escamilla, Pedro L; Martinez-Aroza, Josee

    2015-01-01

    Context. 1E 1740.7-2942 is believed to be one of the two prototypical microquasars towards the Galactic center region whose X-ray states strongly resemble those of Cygnus X-1. Yet, the bipolar radio jets of 1E 1740.7-2942 are very reminiscent of a radio galaxy. The true nature of the object has thus remained an open question for nearly a quarter of a century. Aims. Our main goal here is to confirm the Galactic membership of 1E 1740.7-2942 by searching for morphological changes of its extended radio jets in human timescales. This work was triggered as a result of recent positive detection of fast structural changes in the large-scale jets of its 'twin' GRS 1758-258. Methods. We carried out an in-depth exploration of the VLA public archives and fully recalibrated all 1E 1740.7-2942 extended data sets in the C configuration of the array. We obtained and analyzed matching beam radio maps for five epochs, covering years 1992, 1993, 1994, 1997 and 2000, with an angular resolution of a few arcseconds. Results. We cl...

  9. The precessing jets of 1E 1740.7-2942

    Science.gov (United States)

    Luque-Escamilla, Pedro L.; Martí, Josep; Martínez-Aroza, José

    2015-12-01

    Context. The source 1E 1740.7-2942 is believed to be one of the two prototypical microquasars towards the Galactic center region whose X-ray states strongly resemble those of Cygnus X-1. Yet, the bipolar radio jets of 1E 1740.7-2942 are very reminiscent of a radio galaxy. The true nature of the object has thus remained an open question for nearly a quarter of a century. Aims: Our main goal here is to confirm the Galactic membership of 1E 1740.7-2942 by searching for morphological changes of its extended radio jets in human timescales. This work was triggered as a result of recent positive detection of fast structural changes in the large-scale jets of the very similar source GRS 1758-258. Methods: We carried out an in-depth exploration of the Very Large Array public archives and fully recalibrated all 1E 1740.7-2942 extended data sets in the C configuration of the array. We obtained and analyzed matching beam radio maps for five epochs, covering years 1992, 1993, 1994, 1997 and 2000, with an angular resolution of a few arcseconds. Results: We clearly detected structural changes in the arc-minute jets of 1E 1740.7-2942 on timescales of roughly a year, which set a firm distance upper limit of 12 kpc. Moreover, a simple precessing twin-jet model was simultaneously fitted to the five observing epochs available. The observed changes in the jet flow are strongly suggestive of a precession period of ~1.3 yr. Conclusions: The fitting of the precession model to the data yields a distance of ~5 kpc. This value, and the observed changes, rule out any remaining doubts about the 1E 1740.7-2942 Galactic nature. To our knowledge, this microquasar is the second whose jet precession ephemeris become available after SS433. This kind of information is relevant to the physics of compact objects, since the genesis of the precession phenomenon occurs very close to the interplay region between the accretion disk and the compact object in the system. Appendix A and a movie associated to

  10. Microquasar Jet Irradiation of the Proto-Solar Nebula?

    CERN Document Server

    Butt, Y; Butt, Yousaf; Prantzos, Nikos

    2006-01-01

    We explore the possibility that a now-extinct microquasar may have irradiated the proto-solar neighborhood, causing the 'anomalously' high local 11B/10B isotopic ratio, and comment on some observational tests of the scenario.

  11. Jet-Induced Nucleosynthesis in Misaligned Microquasars

    CERN Document Server

    Butt, Y M; Prantzos, N; Butt, Yousaf M.; Maccarone, Thomas J.; Prantzos, Nikos

    2002-01-01

    The jet axes and the orbital planes of microquasar systems are usually assumed to be approximately perpendicular, eventhough this is not currently an observational requirement. On the contrary, in one of the few systems where the relative orientations are well-constrained, V4641Sgr, the jet axis is known to lie not more than ~35 degrees from the binary plane. Such a jet, lying close to the binary plane, and traveling at a significant fraction of the speed of light may periodically impact the secondary star initiating nuclear reactions on its surface. The integrated yield of such nuclear reactions over the age of the binary system (less the radiative mass loss) will detectably alter the elemental abundances of the companion star. This scenario may explain the anomalously high Li enhancements (roughly ~20-200 times the sun's photospheric value; or, equivalently, 0.1-1 times the average solar system value) seen in the companions of some black-hole X-ray binary systems. (Such enhancements are puzzling since Li nu...

  12. Understanding the Very High-Energy Emission from Microquasars

    CERN Document Server

    Bosch-Ramon, Valenti

    2008-01-01

    Microquasars are X-ray binaries with relativistic jets. These jets are powerful energy carriers, thought to be fed by accretion, which produce non-thermal emission at different energy bands. To date, several Galactic sources showing extended radio emission, among them at least one confirmed microquasar, Cygnus X-1, have been detected in the TeV range. All of them show complex patterns of spectral and temporal behavior. In this work, we discuss the physics behind the very high-energy emission in microquasars. In concrete, we focus on the microquasar Cygnus X-1, and also in the other two TeV binaries with detected extended outflows, LS 5039 and LS I +61 303, pointing out relevant aspects of the complex phenomena occurring in them. We conclude that the TeV emission is likely of leptonic origin, although hadrons cannot be discarded. In addition, efficient electromagnetic cascades can hardly develop since even relatively low magnetic fields suppress them. Also, the modeling of the radiation from some of the detect...

  13. Multifrequency Behavior of Microquasars in the GeV--TeV era: A review

    CERN Document Server

    Bosch-Ramon, V

    2011-01-01

    Microquasars are X-ray binaries that present non-thermal radio jets. Efficient particle acceleration can take place in different regions of the jets of microquasars. The accelerated particles can emit gamma-rays via leptonic or hadronic processes, with a complex spectral and temporal behavior. The jet termination region can be also an efficient non-thermal emitter, as well as, in high-mass microquasars, the region of the binary system outside the jet. In this work, I briefly describe the physics behind the non-thermal emission observed in microquasars at different scales, focusing in the GeV and TeV bands.

  14. Extreme particle acceleration in the microquasar Cygnus X-3.

    Science.gov (United States)

    Tavani, M; Bulgarelli, A; Piano, G; Sabatini, S; Striani, E; Evangelista, Y; Trois, A; Pooley, G; Trushkin, S; Nizhelskij, N A; McCollough, M; Koljonen, K I I; Pucella, G; Giuliani, A; Chen, A W; Costa, E; Vittorini, V; Trifoglio, M; Gianotti, F; Argan, A; Barbiellini, G; Caraveo, P; Cattaneo, P W; Cocco, V; Contessi, T; D'Ammando, F; Del Monte, E; De Paris, G; Di Cocco, G; Di Persio, G; Donnarumma, I; Feroci, M; Ferrari, A; Fuschino, F; Galli, M; Labanti, C; Lapshov, I; Lazzarotto, F; Lipari, P; Longo, F; Mattaini, E; Marisaldi, M; Mastropietro, M; Mauri, A; Mereghetti, S; Morelli, E; Morselli, A; Pacciani, L; Pellizzoni, A; Perotti, F; Picozza, P; Pilia, M; Prest, M; Rapisarda, M; Rappoldi, A; Rossi, E; Rubini, A; Scalise, E; Soffitta, P; Vallazza, E; Vercellone, S; Zambra, A; Zanello, D; Pittori, C; Verrecchia, F; Giommi, P; Colafrancesco, S; Santolamazza, P; Antonelli, A; Salotti, L

    2009-12-01

    Super-massive black holes in active galaxies can accelerate particles to relativistic energies, producing jets with associated gamma-ray emission. Galactic 'microquasars', which are binary systems consisting of a neutron star or stellar-mass black hole accreting gas from a companion star, also produce relativistic jets, generally together with radio flares. Apart from an isolated event detected in Cygnus X-1, there has hitherto been no systematic evidence for the acceleration of particles to gigaelectronvolt or higher energies in a microquasar, with the consequence that we are as yet unsure about the mechanism of jet energization. Here we report four gamma-ray flares with energies above 100 MeV from the microquasar Cygnus X-3 (an exceptional X-ray binary that sporadically produces radio jets). There is a clear pattern of temporal correlations between the gamma-ray flares and transitional spectral states of the radio-frequency and X-ray emission. Particle acceleration occurred a few days before radio-jet ejections for two of the four flares, meaning that the process of jet formation implies the production of very energetic particles. In Cygnus X-3, particle energies during the flares can be thousands of times higher than during quiescent states. PMID:19935645

  15. NuSTAR and INTEGRAL observations of a low/hard state of 1E1740.7-2942

    DEFF Research Database (Denmark)

    Natalucci, Lorenzo; Tomsick, John A.; Bazzano, Angela;

    2014-01-01

    The microquasar 1E1740.7-2942, also known as the "Great Annihilator", was observed by NuSTAR in the Summer of 2012. We have analyzed in detail two observations taken ~2 weeks apart, for which we measure hard and smooth spectra typical of the low/hard state. A few weeks later the source flux decli...

  16. VLBA "Movie" Gives Scientists New Insights On Workings of Mysterious Microquasars

    Science.gov (United States)

    2004-01-01

    433 wobbles like a child's top, causing its jets to move in a circle every 164 days. By imaging SS 433 daily, the astronomers were able to trace individual ejections of material in these jets as they moved outward from the center. In addition, they could track the jets' precession, the movement caused by the disk's wobble. In other microquasars, blobs of material shot from the core become fainter, as seen with radio telescopes, as they move outward. However, in SS 433, blobs routinely brighten at specific distances from the core. From earlier studies, researchers had concluded that such brightening always occurs at one specific distance. The VLBA movie shows, instead, that there are multiple brightening regions and not all blobs brighten at all the regions. "We think the ejected material brightens because it's slamming into something," Rupen said. "However, whatever it's hitting has to be replenished somehow so that the brightening can occur again when the jet sweeps through that area the next time," he added. "It also appears that it isn't always replenished, because the brightening doesn't always happen," Mioduszewski pointed out. The VLBA movie revealed vital new information about another part of SS 433 -- material moving outward from the core, but not part of the superfast jets. This material moves outward in a direction not quite perpendicular to the direction of the jets. Discovered with the VLBA in 2000, this material had been seen only in one-time snapshots before, but the movie shows the steady evolution of its movement for the first time. That motion was the key to a possible answer to two riddles -- the source of the slower-moving material itself and the source of whatever the jet blobs are hitting when they brighten. "What seems most plausible to us is that the accretion disk is putting out a broad wind," Rupen explained. That broad wind from the disk hits a denser wind coming from the "normal" companion star to generate the radio waves seen coming from

  17. Sensitivity of an underwater Cerenkov km3 telescope to TeV neutrinos from Galactic Microquasars

    CERN Document Server

    Distefano, C; Ambriola, M; Ameli, F; Amore, I; Anghinolfi, M; Anzalone, A; Barbarino, G C; Barbarito, E; Battaglieri, M; Bellotti, R; Beverini, N; Bonori, M; Bouhadef, B; Brescia, M; Cacopardo, G; Cafagna, F; Capone, A; Caponetto, L; Castorina, E; Ceres, A; Chiarusi, T; Circella, M; Cocimano, R; Coniglione, R; Cordelli, M; Costa, M; Cuneo, S; D'Amico, A; De Bonis, G; De Marzo, C; De Rosa, G; De Vita, R; Falchini, E; Fiorello, C; Flaminio, V; Fratini, K; Gabrielli, A; Galeotti, S; Gandolfi, E; Giacomelli, G; Giorgi, F; Grimaldi, A; Habel, R; Leonora, E; Lonardo, A; Longo, G; Lo Presti, D; Lucarelli, F; Maccioni, E; Margiotta, A; Martini, A; Masullo, R; Megna, R; Migneco, E; Mongelli, M; Montaruli, T; Morganti, M; Musumeci, M; Nicolau, C A; Orlando, A; Osipenko, M; Osteria, G; Papaleo, R; Pappalardo, V; Petta, C; Piattelli, P; Raia, G; Randazzo, N; Reito, S; Ricco, G; Riccobene, G; Ripani, M; Rovelli, A; Ruppi, M; Russo, G V; Russo, S; Sapienza, P; Sedita, M; Shirokov, E; Simeone, F; Sipala, V; Spurio, M; Taiuti, M; Terreni, G; Trasatti, L; Urso, S; Valente, V; Vicini, P

    2006-01-01

    In this paper are presented the results of Monte Carlo simulations on the capability of the proposed NEMO-km$^3$ telescope to detect TeV muon neutrinos from Galactic microquasars. For each known microquasar we compute the number of detectable events, together with the atmospheric neutrino and muon background events. We also discuss the detector sensitivity to neutrino fluxes expected from known microquasars, optimizing the event selection also to reject the background; the number of events surviving the event selection are given.

  18. Positron annihilation signatures associated with the outburst of the microquasar V404 Cygni

    CERN Document Server

    Siegert, Thomas; Greiner, Jochen; Krause, Martin G H; Beloborodov, Andrei M; Bel, Marion Cadolle; Guglielmetti, Fabrizia; Rodriguez, Jerome; Strong, Andrew W; Zhang, Xiaoling

    2016-01-01

    Microquasars are stellar-mass black holes accreting matter from a companion star and ejecting plasma jets at almost the speed of light. They are analogues of quasars that contain supermassive black holes of $10^6$ to $10^{10}$ solar masses. Accretion in microquasars varies on much shorter timescales than in quasars and occasionally produces exceptionally bright X-ray flares. How the flares are produced is unclear, as is the mechanism for launching the relativistic jets and their composition. An emission line near 511 kiloelectronvolts has long been sought in the emission spectrum of microquasars as evidence for the expected electron-positron plasma. Transient high-energy spectral features have been reported in two objects, but their positron interpretation remains contentious. Here we report observations of $\\gamma$-ray emission from the microquasar V404 Cygni during a recent period of strong flaring activity. The emission spectrum around 511 kiloelectronvolts shows clear signatures of variable positron annih...

  19. NuSTAR and integral observations of a low/hard state of 1E1740.7-2942

    Energy Technology Data Exchange (ETDEWEB)

    Natalucci, Lorenzo; Bazzano, Angela; Fiocchi, Mariateresa; Ubertini, Pietro [Istituto di Astrofisica e Planetologia Spaziali, INAF, via del Fosso del Cavaliere, I-00133 Roma (Italy); Tomsick, John A.; Boggs, Steven E.; Craig, William W.; Krivonos, Roman [Space Sciences Laboratory, 7 Gauss Way, University of California, Berkeley, CA 94720-7450 (United States); Smith, David M. [Physics Department and Santa Cruz Institute for Particle Physics, University of California, Santa Cruz, CA 95064 (United States); Bachetti, Matteo; Barret, Didier [Université de Toulouse, UPS-OMP, IRAP, Toulouse (France); Christensen, Finn E. [DTU Space, National Space Institute, Technical University of Denmark, Elektrovej 327, DK-2800 Lyngby (Denmark); Fürst, Felix; Grefenstette, Brian W.; Harrison, Fiona A. [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Hailey, Charles J. [Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Kuulkers, Erik [European Space Astronomy Centre (ESA/ESAC), Science Operations Department, E-28691 Villanueva de la Cañada (Madrid) (Spain); Miller, Jon M. [Department of Astronomy, University of Michigan, 500 Church Street, Ann Arbor, MI 48109 (United States); Pottschmidt, Katja [CRESST and NASA Goddard Space Flight Center, Astrophysics Science Division, Code 661, Greenbelt, MD 20771 (United States); Stern, Daniel, E-mail: lorenzo.natalucci@iaps.inaf.it [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); and others

    2014-01-01

    The microquasar 1E1740.7-2942, also known as the 'Great Annihilator,' was observed by NuSTAR in the summer of 2012. We have analyzed in detail two observations taken ∼2 weeks apart, for which we measure hard and smooth spectra typical of the low/hard state. A few weeks later the source flux declined significantly. Nearly simultaneous coverage by INTEGRAL is available from its Galactic Center monitoring campaign lasting ∼2.5 months. These data probe the hard state spectrum from 1E1740.7-2942 before the flux decline. We find good agreement between the spectra taken with IBIS/ISGRI and NuSTAR, with the measurements being compatible with a change in flux with no spectral variability. We present a detailed analysis of the NuSTAR spectral and timing data and upper limits for reflection of the high energy emission. We show that the high energy spectrum of this X-ray binary is well described by thermal Comptonization.

  20. NuSTAR and integral observations of a low/hard state of 1E1740.7-2942

    International Nuclear Information System (INIS)

    The microquasar 1E1740.7-2942, also known as the 'Great Annihilator,' was observed by NuSTAR in the summer of 2012. We have analyzed in detail two observations taken ∼2 weeks apart, for which we measure hard and smooth spectra typical of the low/hard state. A few weeks later the source flux declined significantly. Nearly simultaneous coverage by INTEGRAL is available from its Galactic Center monitoring campaign lasting ∼2.5 months. These data probe the hard state spectrum from 1E1740.7-2942 before the flux decline. We find good agreement between the spectra taken with IBIS/ISGRI and NuSTAR, with the measurements being compatible with a change in flux with no spectral variability. We present a detailed analysis of the NuSTAR spectral and timing data and upper limits for reflection of the high energy emission. We show that the high energy spectrum of this X-ray binary is well described by thermal Comptonization.

  1. Variable Very High Energy Gamma-ray Emission from the Microquasar LS I +61 303

    OpenAIRE

    MAGIC Collaboration; Albert, J

    2006-01-01

    Microquasars are binary star systems with relativistic radio-emitting jets. They are potential sources of cosmic rays and laboratories for elucidating the physics of relativistic jets. Here we report the detection of variable gamma-ray emission above 100 gigaelectron volts from the microquasar LS I +61 303. Six orbital cycles were recorded. Several detections occur at a similar orbital phase, suggesting the emission is periodic. The strongest gamma-ray emission is not observed when the two st...

  2. Variable Very-High-Energy Gamma-Ray Emission from the Microquasar LS I +61 303

    OpenAIRE

    Antoranz Canales, Pedro; Barrio Uña, Juan Abel; Contreras González, José Luis; Fonseca González, Mª Victoria; López Moya, Marcos; Miranda Pantoja, José Miguel

    2006-01-01

    Microquasars are binary star systems with relativistic radio-emitting jets. They are potential sources of cosmic rays and can be used to elucidate the physics of relativistic jets. We report the detection of variable gamma-ray emission above 100 gigaelectron volts from the microquasar LS I 61 + 303. Six orbital cycles were recorded. Several detections occur at a similar orbital phase, which suggests that the emission is periodic. The strongest gamma-ray emission is not observed when the two s...

  3. GMRT radio observations of microquasar GRS 1915+105

    CERN Document Server

    Yadav, J S; Rao, A P; Pooley, G G

    2002-01-01

    We have observed microquasar GRS 1915+105 at 1.28 GHz for 8 days from June 18 to July 1, 2001 using Giant Metrewave Radio Telescope (GMRT). We have seen several isolated radio baby flares of varying intensity and duration. We have also observed broad composite flares with rise and decay times of few hours on June 28-29, 2001 few days prior to when source went to the ``plateau radio state'' on 3rd July, 2001. These broad radio flares consist of several overlapping baby radio flares. The source was in the low-hard X-ray state during this period. We compare these results with 15 GHz radio data from the Ryle telescope.

  4. VERITAS Observations of the Microquasar Cygnus X-3

    CERN Document Server

    Archambault, S; Benbow, W; Berger, K; Bird, R; Bouvier, A; Buckley, J H; Bugaev, V; Byrum, K; Cerruti, M; Chen, X; Ciupik, L; Connolly, M P; Cui, W; Duke, C; Dumm, J; Errando, M; Falcone, A; Federici, S; Feng, Q; Finley, J P; Fortson, L; Furniss, A; Galante, N; Gillanders, G H; Griffin, S; Griffiths, S T; Grube, J; Gyuk, G; Hanna, D; Holder, J; Hughes, G; Humensky, T B; Kaaret, P; Kertzman, M; Khassen, Y; Kieda, D; Krawczynski, H; Lang, M J; Madhavan, A S; Maier, G; Majumdar, P; McArthur, S; McCann, A; Moriarty, P; Mukherjee, R; Nieto, D; de Bhróithe, A O'Faoláin; Ong, R A; Otte, A N; Pandel, D; Park, N; Perkins, J S; Pohl, M; Popkow, A; Prokoph, H; Quinn, J; Ragan, K; Rajotte, J; Reyes, L C; Reynolds, P T; Richards, G T; Roache, E; Sembroski, G H; Sheidaei, F; Smith, A W; Staszak, D; Telezhinsky, I; Theiling, M; Tucci, J V; Tyler, J; Varlotta, A; Vincent, S; Wakely, S P; Weekes, T C; Weinstein, A; Williams, D A; Zitzer, B; McCollough, M L

    2013-01-01

    We report results from TeV gamma-ray observations of the microquasar Cygnus X-3. The observations were made with the Very Energetic Radiation Imaging Telescope Array System (VERITAS) over a time period from 2007 June 11 to 2011 November 28. VERITAS is most sensitive to gamma rays at energies between 85 GeV to 30 TeV. The effective exposure time amounts to a total of about 44 hours, with the observations covering six distinct radio/X-ray states of the object. No significant TeV gamma-ray emission was detected in any of the states, nor with all observations combined. The lack of a positive signal, especially in the states where GeV gamma rays were detected, places constraints on TeV gamma-ray production in Cygnus X-3. We discuss the implications of the results.

  5. RXTE Observations of the Microquasar GRS 1915+105

    CERN Document Server

    Rodríguez, J; Tagger, M

    2001-01-01

    We analyse a set of three RXTE Target of Opportunity observations of the Galactic microquasar GRS 1915+105, observed in April 2000. We concentrate on the timing properties of the source, and examine the properties of a low frequency QPO, with its harmonic, in several energy ranges. The source was found in two different states of the spectro/temporal classification of Belloni et al. (2000), and exhibited in the three observations a strong, low frequency QPO together with a strong harmonic. We discuss the properties of the QPO, of its harmonic and of their spectral behaviour in the framework of the Accretion Ejection Instability (AEI) (Tagger & Pellat, 1999; Varni\\`ere, Rodriguez & Tagger, 2001; Rodriguez et al., 2001).

  6. Relativistic superluminal radio jets in microquasars in our galaxy

    CERN Document Server

    Yadav, J S

    2006-01-01

    We discuss the origin of superluminal radio jets in Black hole X-ray binaries with relativistic radio jets in our Galaxy popularly known as microquasars. We classify the relativistic superluminal jet according to the radio emission in black hole X-ray binaries (transient or persistent) rather than the mass of the companion. The black hole X-ray binaries with transient radio emission (mostly LMXBs) produce superluminal jets with $\\beta_{app} >$ 1 when the accretion rate, $\\dot{m}_{accr}$ is high and the bolometric luminosity L$_{bol}$ approaches the Eddington Luminosity, L$_{Edd}$. On the other hand, the black hole X-ray binaries with persistent radio emission (mostly HMXBs) produce superluminal jets with $\\beta_{app} <$ 1 at relatively low $\\dot{m}_{accr}$. We specially discuss the case of V4641 Sgr, a HMXB with transient radio emission which produces superluminal radio jets like in LMXBs.

  7. Alignment Timescale of the Microquasar GRO J1655-40

    CERN Document Server

    Martin, Rebecca G; Pringle, J E

    2008-01-01

    The microquasar GRO J1655-40 has a black hole with spin angular momentum apparently misaligned to the orbital plane of its companion star. We analytically model the system with a steady state disc warped by Lense-Thirring precession and find the timescale for the alignment of the black hole with the binary orbit. We make detailed stellar evolution models so as to estimate the accretion rate and the lifetime of the system in this state. The secondary can be evolving at the end of the main sequence or across the Hertzsprung gap. The mass-transfer rate is typically fifty times higher in the latter case but we find that, in both cases, the lifetime of the mass transfer state is at most a few times the alignment timescale. The fact that the black hole has not yet aligned with the orbital plane is therefore consistent with either model. We conclude that the system may or may not have been counter-aligned after its supernova kick but that it is most likely to be close to alignment rather than counteralignment now.

  8. Jet-induced star formation by a microquasar

    CERN Document Server

    Mirabel, I F; Rodriguez, L F; Sauvage, M

    2014-01-01

    Theoretical and observational work show that jets from AGN can trigger star formation. However, in the Milky Way the first -and so far- only clear case of relativistic jets inducing star formation has been found in the surroundings of the microquasar GRS 1915+105. Here we summarize the multiwavelength observations of two compact star formation IRAS sources axisymmetrically located and aligned with the position angle of the sub-arcsec relativistic jets from the stellar black hole binary GRS 1915+105 (Mirabel & Rodriguez 1994). The observations of these two star forming regions at centimeter (Rodriguez & Mirabel 1998), millimeter and infrared (Chaty et al. 2001) wavelengths had suggested -despite the large uncertainties in the distances a decade ago- that the jets from GRS 1915+105 are triggering along the radio jet axis the formation of massive stars in a radio lobe of bow shock structure. Recently, Reid et al.(2014) found that the jet source and the IRAS sources are at the same distance, enhancing the...

  9. Sensitivity of an underwater Čerenkov km 3 telescope to TeV neutrinos from Galactic microquasars

    Science.gov (United States)

    Aiello, S.; Ambriola, M.; Ameli, F.; Amore, I.; Anghinolfi, M.; Anzalone, A.; Barbarino, G.; Barbarito, E.; Battaglieri, M.; Bellotti, R.; Beverini, N.; Bonori, M.; Bouhadef, B.; Brescia, M.; Cacopardo, G.; Cafagna, F.; Capone, A.; Caponetto, L.; Castorina, E.; Ceres, A.; Chiarusi, T.; Circella, M.; Cocimano, R.; Coniglione, R.; Cordelli, M.; Costa, M.; Cuneo, S.; D'Amico, A.; De Bonis, G.; De Marzo, C.; De Rosa, G.; De Vita, R.; Distefano, C.; Falchini, E.; Fiorello, C.; Flaminio, V.; Fratini, K.; Gabrielli, A.; Galeotti, S.; Gandolfi, E.; Giacomelli, G.; Giorgi, F.; Grimaldi, A.; Habel, R.; Leonora, E.; Lonardo, A.; Longo, G.; Lo Presti, D.; Lucarelli, F.; Maccioni, E.; Margiotta, A.; Martini, A.; Masullo, R.; Megna, R.; Migneco, E.; Mongelli, M.; Montaruli, T.; Morganti, M.; Musumeci, M.; Nicolau, C. A.; Orlando, A.; Osipenko, M.; Osteria, G.; Papaleo, R.; Pappalardo, V.; Petta, C.; Piattelli, P.; Raia, G.; Randazzo, N.; Reito, S.; Ricco, G.; Riccobene, G.; Ripani, M.; Rovelli, A.; Ruppi, M.; Russo, G. V.; Russo, S.; Sapienza, P.; Sedita, M.; Shirokov, E.; Simeone, F.; Sipala, V.; Spurio, M.; Taiuti, M.; Terreni, G.; Trasatti, L.; Urso, S.; Valente, V.; Vicini, P.

    2007-09-01

    In this paper are presented the results of Monte Carlo simulations on the capability of the proposed NEMO-km 3 telescope to detect TeV muon neutrinos from Galactic microquasars. For each known microquasar we compute the number of detectable events, together with the atmospheric neutrino and muon background events. We also discuss the detector sensitivity to neutrino fluxes expected from known microquasars, optimizing the event selection also to reject the background; the number of events surviving the event selection are given. The best candidates are the steady microquasars SS433 and GX339-4 for which we estimate a sensitivity of about 5 × 10 -11 erg/cm 2 s; the predicted fluxes are expected to be well above this sensitivity. For bursting microquasars the most interesting candidates are Cygnus X-3, GRO J1655-40 and XTE J1118+480: their analyses are more complicated because of the stochastic nature of the bursts.

  10. Variable very-high-energy gamma-ray emission from the microquasar LS I +61 303.

    Science.gov (United States)

    Albert, J; Aliu, E; Anderhub, H; Antoranz, P; Armada, A; Asensio, M; Baixeras, C; Barrio, J A; Bartelt, M; Bartko, H; Bastieri, D; Bavikadi, S R; Bednarek, W; Berger, K; Bigongiari, C; Biland, A; Bisesi, E; Bock, R K; Bordas, P; Bosch-Ramon, V; Bretz, T; Britvitch, I; Camara, M; Carmona, E; Chilingarian, A; Ciprini, S; Coarasa, J A; Commichau, S; Contreras, J L; Cortina, J; Curtef, V; Danielyan, V; Dazzi, F; De Angelis, A; de Los Reyes, R; De Lotto, B; Domingo-Santamaría, E; Dorner, D; Doro, M; Errando, M; Fagiolini, M; Ferenc, D; Fernández, E; Firpo, R; Flix, J; Fonseca, M V; Font, L; Fuchs, M; Galante, N; Garczarczyk, M; Gaug, M; Giller, M; Goebel, F; Hakobyan, D; Hayashida, M; Hengstebeck, T; Höhne, D; Hose, J; Hsu, C C; Isar, P G; Jacon, P; Kalekin, O; Kosyra, R; Kranich, D; Laatiaoui, M; Laille, A; Lenisa, T; Liebing, P; Lindfors, E; Lombardi, S; Longo, F; López, J; López, M; Lorenz, E; Lucarelli, F; Majumdar, P; Maneva, G; Mannheim, K; Mansutti, O; Mariotti, M; Martínez, M; Mase, K; Mazin, D; Merck, C; Meucci, M; Meyer, M; Miranda, J M; Mirzoyan, R; Mizobuchi, S; Moralejo, A; Nilsson, K; Oña-Wilhelmi, E; Orduña, R; Otte, N; Oya, I; Paneque, D; Paoletti, R; Paredes, J M; Pasanen, M; Pascoli, D; Pauss, F; Pavel, N; Pegna, R; Persic, M; Peruzzo, L; Piccioli, A; Poller, M; Pooley, G; Prandini, E; Raymers, A; Rhode, W; Ribó, M; Rico, J; Riegel, B; Rissi, M; Robert, A; Romero, G E; Rügamer, S; Saggion, A; Sánchez, A; Sartori, P; Scalzotto, V; Scapin, V; Schmitt, R; Schweizer, T; Shayduk, M; Shinozaki, K; Shore, S N; Sidro, N; Sillanpää, A; Sobczynska, D; Stamerra, A; Stark, L S; Takalo, L; Temnikov, P; Tescaro, D; Teshima, M; Tonello, N; Torres, A; Torres, D F; Turini, N; Vankov, H; Vitale, V; Wagner, R M; Wibig, T; Wittek, W; Zanin, R; Zapatero, J

    2006-06-23

    Microquasars are binary star systems with relativistic radio-emitting jets. They are potential sources of cosmic rays and can be used to elucidate the physics of relativistic jets. We report the detection of variable gamma-ray emission above 100 gigaelectron volts from the microquasar LS I 61 + 303. Six orbital cycles were recorded. Several detections occur at a similar orbital phase, which suggests that the emission is periodic. The strongest gamma-ray emission is not observed when the two stars are closest to one another, implying a strong orbital modulation of the emission or absorption processes. PMID:16709745

  11. Probability 1/e

    Science.gov (United States)

    Koo, Reginald; Jones, Martin L.

    2011-01-01

    Quite a number of interesting problems in probability feature an event with probability equal to 1/e. This article discusses three such problems and attempts to explain why this probability occurs with such frequency.

  12. Main: 1E1E [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1E トウモロコシ Corn Zea mays L. Beta-Glucosidase, Chloroplast Precursor Name=Glu1; Zea...TDDAYASQEVNGPDGKPIGPPMGNPWIYMYPEGLKDLLMIMKNKYGNPPIYITENGIGDVDTKETPLPMEAALNDYKRLDYIQRHIATLKESIDLGSNVQGYFAWSLLDNFEWFAGFTERYGIVYVDRNNNCTRYMKESAKWLKEFNTAKKPSKKILTPA corn_1E1E.jpg ...

  13. A time dependent search for neutrino emission from micro-quasars with the ANTARES telescope

    International Nuclear Information System (INIS)

    The ANTARES collaboration has successfully built, deployed and is currently operating an underwater Cherenkov detector dedicated to high energy neutrino astronomy. The primary aim of the experiment is to detect cosmic sources of neutrinos in order to reveal the production sites of cosmic rays. Among the sources likely to be significant sources of neutrinos are those accelerating relativistic jets, like gamma ray bursts, active galactic nuclei and micro-quasars. Micro-quasars are binary systems formed by a compact object accreting mass from a companion star. The mass transfer causes the emission of X-rays, whereas the onset of magnetic forces in the accreting plasma can cause the acceleration of relativistic jets, which are observed by radio telescopes via their non-thermal synchrotron emission. In some systems, a correlation between X-ray and radio light curves indicates an interplay between accretion and ejection respectively. Some micro-quasars are also high energy and very high energy gamma ray emitters. In this thesis, a time dependent search for neutrino emission from micro-quasars was performed with a multi-messenger approach (photon/neutrino). The data from the X-ray monitors RXTE/ASM and SWIFT/BAT, and the gamma-ray telescope FERMI/LAT were used to select transient events in which the source was supposed to accelerate relativistic jets. The restriction of the analysis to the ejection periods allows a drastic reduction of atmospheric muon and neutrino background, and thus to increase the chances of a discovery. The search was performed with the ANTARES data taken between 2007 and 2010. Statistical analysis was carried out using an un-binned likelihood method based on a likelihood ratio test. The cuts for the event selection were optimized in order to maximize the chance of a discovery. As no neutrino signal was observed in correlation with these micro-quasars, upper limits on the neutrino fluxes of the micro-quasars under study were calculated and compared

  14. Modulated high-energy gamma-ray emission from the microquasar Cygnus X-3.

    Science.gov (United States)

    Abdo, A A; Ackermann, M; Ajello, M; Axelsson, M; Baldini, L; Ballet, J; Barbiellini, G; Bastieri, D; Baughman, B M; Bechtol, K; Bellazzini, R; Berenji, B; Blandford, R D; Bloom, E D; Bonamente, E; Borgland, A W; Brez, A; Brigida, M; Bruel, P; Burnett, T H; Buson, S; Caliandro, G A; Cameron, R A; Caraveo, P A; Casandjian, J M; Cecchi, C; Celik, O; Chaty, S; Cheung, C C; Chiang, J; Ciprini, S; Claus, R; Cohen-Tanugi, J; Cominsky, L R; Conrad, J; Corbel, S; Corbet, R; Dermer, C D; de Palma, F; Digel, S W; do Couto e Silva, E; Drell, P S; Dubois, R; Dubus, G; Dumora, D; Farnier, C; Favuzzi, C; Fegan, S J; Focke, W B; Fortin, P; Frailis, M; Fusco, P; Gargano, F; Gehrels, N; Germani, S; Giavitto, G; Giebels, B; Giglietto, N; Giordano, F; Glanzman, T; Godfrey, G; Grenier, I A; Grondin, M-H; Grove, J E; Guillemot, L; Guiriec, S; Hanabata, Y; Harding, A K; Hayashida, M; Hays, E; Hill, A B; Hjalmarsdotter, L; Horan, D; Hughes, R E; Jackson, M S; Jóhannesson, G; Johnson, A S; Johnson, T J; Johnson, W N; Kamae, T; Katagiri, H; Kawai, N; Kerr, M; Knödlseder, J; Kocian, M L; Koerding, E; Kuss, M; Lande, J; Latronico, L; Lemoine-Goumard, M; Longo, F; Loparco, F; Lott, B; Lovellette, M N; Lubrano, P; Madejski, G M; Makeev, A; Marchand, L; Marelli, M; Max-Moerbeck, W; Mazziotta, M N; McColl, N; McEnery, J E; Meurer, C; Michelson, P F; Migliari, S; Mitthumsiri, W; Mizuno, T; Monte, C; Monzani, M E; Morselli, A; Moskalenko, I V; Murgia, S; Nolan, P L; Norris, J P; Nuss, E; Ohsugi, T; Omodei, N; Ong, R A; Ormes, J F; Paneque, D; Parent, D; Pelassa, V; Pepe, M; Pesce-Rollins, M; Piron, F; Pooley, G; Porter, T A; Pottschmidt, K; Rainò, S; Rando, R; Ray, P S; Razzano, M; Rea, N; Readhead, A; Reimer, A; Reimer, O; Richards, J L; Rochester, L S; Rodriguez, J; Rodriguez, A Y; Romani, R W; Ryde, F; Sadrozinski, H F-W; Sander, A; Saz Parkinson, P M; Sgrò, C; Siskind, E J; Smith, D A; Smith, P D; Spinelli, P; Starck, J-L; Stevenson, M; Strickman, M S; Suson, D J; Takahashi, H; Tanaka, T; Thayer, J B; Thompson, D J; Tibaldo, L; Tomsick, J A; Torres, D F; Tosti, G; Tramacere, A; Uchiyama, Y; Usher, T L; Vasileiou, V; Vilchez, N; Vitale, V; Waite, A P; Wang, P; Wilms, J; Winer, B L; Wood, K S; Ylinen, T; Ziegler, M

    2009-12-11

    Microquasars are accreting black holes or neutron stars in binary systems with associated relativistic jets. Despite their frequent outburst activity, they have never been unambiguously detected emitting high-energy gamma rays. The Fermi Large Area Telescope (LAT) has detected a variable high-energy source coinciding with the position of the x-ray binary and microquasar Cygnus X-3. Its identification with Cygnus X-3 is secured by the detection of its orbital period in gamma rays, as well as the correlation of the LAT flux with radio emission from the relativistic jets of Cygnus X-3. The gamma-ray emission probably originates from within the binary system, opening new areas in which to study the formation of relativistic jets. PMID:19965378

  15. Non-linear variability in microquasars in relation with the winds from their accretion disks

    CERN Document Server

    Janiuk, Agnieszka; Sukova, Petra; Capitanio, Fiamma; Bianchi, Stefano; Kowalski, Wojtek

    2016-01-01

    The microquasar IGR J17091, which is the recently discovered analogue of the well known source GRS 1915+105, exhibits quasi-periodic outbursts, with a period of 5-70 seconds, and regular amplitudes, referred to as "heartbeat state". We argue that these states are plausibly explained by accretion disk instability, driven by the dominant radiation pressure. Using our GLobal Accretion DIsk Simulation hydrodynamical code, we model these outbursts quantitatively. We also find a correlation between the presence of massive outflows launched from the accretion disk and the stabilization of its oscillations. We verify the theoretical predictions with the available timing and spectral observations. Furthermore, we postulate that the underlying non-linear differential equations that govern the evolution of an accretion disk are responsible for the variability pattern of several other microquasars, including XTE J1550-564, GX 339-4, and GRO J1655-40. This is based on the signatures of deterministic chaos in the observed ...

  16. Modulated High-Energy Gamma-Ray Emission from the Micro-quasar Cygnus X-3

    International Nuclear Information System (INIS)

    Micro-quasars are accreting black holes or neutron stars in binary systems with associated relativistic jets. Despite their frequent outburst activity, they have never been unambiguously detected emitting high-energy gamma rays. The Fermi Large Area Telescope (LAT) has detected a variable high-energy source coinciding with the position of the x-ray binary and micro-quasar Cygnus X-3. Its identification with Cygnus X-3 is secured by the detection of its orbital period in gamma rays, as well as the correlation of the LAT flux with radio emission from the relativistic jets of Cygnus X-3. The gamma-ray emission probably originates from within the binary system, opening new areas in which to study the formation of relativistic jets. (authors)

  17. A Search for Time Dependent Neutrino Emission from Microquasars with the ANTARES Telescope

    CERN Document Server

    Adrián-Martínez, S; André, M; Anghinolfi, M; Anton, G; Ardid, M; Astraatmadja, T; Aubert, J -J; Baret, B; Barrios, J; Basa, S; Bertin, V; Biagi, S; Bigongiari, C; Bogazzi, C; Bouhou, B; Bouwhuis, M C; Brunner, J; Busto, J; Capone, A; Caramete, L; Cârloganu, C; Carr, J; Cecchini, S; Charif, Z; Charvis, P; Chiarusi, T; Circella, M; Coniglione, R; Core, L; Costantini, H; Coyle, P; Creusot, A; De Rosa, G; Dekeyser, I; Deschamps, A; De Bonis, G; Distefano, C; Donzaud, C; Dornic, D; Dorosti, Q; Drouhin, D; Dumas, A; Eberl, T; Elsässer, D; Emanuele, U; Enzenhöfer, A; Ernenwein, J -P; Escoffier, S; Fehn, K; Felis, I; Fermani, P; Folger, F; Fusco, L A; Galatà, S; Gay, P; Geißelsöder, S; Geyer, K; Giordano, V; Gleixner, A; Gómez-González, J P; Graf, K; Guillard, G; van Haren, H; Heijboer, A J; Hello, Y; Hernández-Rey, J J; Herold, B; Hößl, J; Hofestädt, J; James, C W; de Jong, M; Kadler, M; Kalekin, O; Kappes, A; Katz, U; Kooijman, P; Kouchner, A; Kreykenbohm, I; Kulikovskiy, V; Lahmann, R; Lambard, E; Lambard, G; Larosa, G; Lattuada, D; Lefèvre, D; Leonora, E; Loehner, H; Loucatos, S; Mangano, S; Marcelin, M; Margiotta, A; Martínez-Mora, J A; Martini, S; Mathieu, A; Michael, T; Migliozzi, P; Montaruli, T; Müller, C; Neff, M; Nezri, E; Palioselitis, D; Păvălaş, G E; Perrina, C; Piattelli, P; Popa, V; Pradier, T; Racca, C; Riccobene, G; Richter, R; Rivière, C; Robert, A; Roensch, K; Rostovtsev, A; Salda\; Samtleben, D F E; Sánchez-Losa, A; Sanguineti, M; Sapienza, P; Schmid, J; Schnabel, J; Schulte, S; Schüssler, F; Seitz, T; Sieger, C; Spies, A; Spurio, M; Steijger, J J M; Stolarczyk, T; Taiuti, M; Tamburini, C; Tayalati, Y; Trovato, A; Vallage, B; Vallée, C; Van Elewyck, V; Vernin, P; Visser, E; Vivolo, D; Wagner, S; Wilms, J; de Wolf, E; Yatkin, K; Yepes, H; Zornoza, J D; Zúñiga, J

    2014-01-01

    Results are presented on a search for neutrino emission from a sample of six microquasars, based on the data collected by the ANTARES neutrino telescope between 2007 and 2010. By means of appropriate time cuts, the neutrino search has been restricted to the periods when the acceleration of relativistic jets was taking place at the microquasars under study. The time cuts have been chosen using the information from the X-ray telescopes RXTE/ASM and Swift/BAT, and, in one case, the gamma-ray telescope Fermi/LAT. Since none of the searches has produced a statistically significant signal, upper limits on the neutrino fluences are derived and compared to the predictions from theoretical models.

  18. Accretion disk winds as the jet suppression mechanism in the microquasar GRS 1915+105.

    Science.gov (United States)

    Neilsen, Joseph; Lee, Julia C

    2009-03-26

    Stellar-mass black holes with relativistic jets, also known as microquasars, mimic the behaviour of quasars and active galactic nuclei. Because timescales around stellar-mass black holes are orders of magnitude smaller than those around more distant supermassive black holes, microquasars are ideal nearby 'laboratories' for studying the evolution of accretion disks and jet formation in black-hole systems. Whereas studies of black holes have revealed a complex array of accretion activity, the mechanisms that trigger and suppress jet formation remain a mystery. Here we report the presence of a broad emission line in the faint, hard states and narrow absorption lines in the bright, soft states of the microquasar GRS 1915+105. ('Hard' and 'soft' denote the character of the emitted X-rays.) Because the hard states exhibit prominent radio jets, we argue that the broad emission line arises when the jet illuminates the inner accretion disk. The jet is weak or absent during the soft states, and we show that the absorption lines originate when the powerful radiation field around the black hole drives a hot wind off the accretion disk. Our analysis shows that this wind carries enough mass away from the disk to halt the flow of matter into the radio jet. PMID:19325629

  19. The role of fast magnetic reconnection in acceleration zones of microquasars and AGNs

    CERN Document Server

    Kadowaki, L H S

    2013-01-01

    Fast magnetic reconnection events can be a very powerful mechanism operating at the jet launching region of microquasars and AGNs. We have recently found that the power released by reconnection between the magnetic field lines of the coronal inner disk region and the lines anchored into the black hole is able to accelerate relativistic particles through a first-order Fermi process and produce the observed radio luminosity from both microquasars and low luminous AGNs (LLAGNs). We also found that the observed correlation between the radio luminosity and the mass of these sources, spanning 10^9 orders of magnitude in mass, is naturally explained by this process. In this work, assuming that the gamma-ray emission is probably originated in the same acceleration zones that produce the radio emission, we have applied the scenario above to investigate the origin of the high energy outcomes from an extensive number of sources including high (HLAGNs) and LLAGNs, microquasars and GRBs. We find correlation of our model w...

  20. New evidence on the origin of the microquasar GRO J1655-40

    CERN Document Server

    Combi, J A; Mirabel, I F

    2007-01-01

    Aims. Motivated by the new determination of the distance to the microquasar GRO J1655-40 by Foellmi et al. (2006), we conduct a detailed study of the distribution of the atomic and molecular gas, and dust around the open cluster NGC 6242, the possible birth place of the microquasar. The proximity and relative height of the cluster on the galactic disk provides a unique opportunity to study SNR evolution and its possible physical link with microquasar formation. Methods. We search in the interstellar atomic and molecular gas around NGC 6242 for traces that may have been left from a supernova explosion associated to the formation of the black hole in GRO J1655-40. Furthermore, the 60/100 mu IR color is used as a tracer of shocked-heated dust. Results. At the kinematical distance of the cluster the observations have revealed the existence of a HI hole of 1.5*1.5 degrees in diameter and compressed CO material acumulated along the south-eastern internal border of the HI cavity. In this same area, we found extended...

  1. Time-Dependent Synchrotron and Compton Spectra from Jets of Microquasars

    CERN Document Server

    Gupta, S; Dermer, C D; Boettcher, Markus; Dermer, Charles D.; Gupta, Swati

    2006-01-01

    Jet models for the high-energy emission of Galactic X-ray binary sources have regained significant interest with detailed spectral and timing studies of the X-ray emission from microquasars, the recent detection by the HESS collaboration of very-high-energy gamma-rays from the microquasar LS~5039, and the earlier suggestion of jet models for ultraluminous X-ray sources observed in many nearby galaxies. Here we study the synchrotron and Compton signatures of time-dependent electron injection and acceleration, adiabatic and radiative cooling, and different jet geometries in the jets of Galactic microquasars. Synchrotron, synchrotron-self-Compton, and external-Compton radiation processes with soft photons provided by the companion star and the accretion disk are treated. An analytical solution is presented to the electron kinetic equation for general power-law geometries of the jets for Compton scattering in the Thomson regime. We pay particular attention to predictions concerning the rapid flux and spectral var...

  2. An unusual timing and spectral state of a black hole microquasar XTE J1550-564

    Institute of Scientific and Technical Information of China (English)

    Ying-Kang Jin; Shuang-Nan Zhang; Ti-Pei Li

    2009-01-01

    An unusual timing and spectral state of a black hole microquasar XTE J1550-564 observed with RXTE is analyzed. Millisecond variabilities are found, which are significantly shorter than the minimum possible time scale in the light curves of black hole binaries, as suggested by Sunyaev & Revnivtsev (2000). The X-ray spectral fitting result indicates that there is an unusual soft component in the spectrum, which may be responsible for the millisecond variabilities. The millisecond variabilities as well as the unusual soft spectral component should be produced from some small, but independent active regions in the accretion disk.

  3. Chandra-ASCA-RXTE observations of the micro-quasar GRS 1915+105

    CERN Document Server

    Lee, J C; Reynolds, C S; Fabian, A C; Blackman, E G

    2000-01-01

    A Chandra AO1 30ks HETGS observation of the X-ray transient micro-quasar GRS 1915+105 reveals absorption edges and faint line emission over the HETG energy range. We find from a preliminary analysis evidence for prominent neutral K edges associated with iron, silicon, magnesium, and tentatively sulphur. The column densities assuming solar abundances are consistent with ~ few x $10^{22} cm^{-2}$ in excess of the Galactic value, and may point to surrounding cold material associated with GRS 1915+105. Neutral Fe K$\\alpha$ emission, and ionized absorption from Fe XXV and Fe XXVI are resolved. We limit our discussion to the Chandra results.

  4. An unified model for superluminal motion and state transition on microquasars and quasars

    CERN Document Server

    Gong, B

    2006-01-01

    Superluminal motion has been interpreted as relativistically moving out flow. The increasing observations of such sources provide chance to investigate their mechanism in detail. This paper proposes that superluminal motion may be jet precession induced blob motion. This model can interpret a number of observational phenomena which are not well understood under the scenario of bulk motion, such as the absence of the receding blob after the outburst and the receding blob becomes brighter than the approaching one in XTE J1550-564 . Moreover the compton scattering of photos from a warped accretion disk may form a structured jet. And the precession of the structured jet may lead to the complicated state transitions observed in microquasars like GRS 1915+105. Applying to AGNs, the model may explain the scales of length and time of the phenomena proportioning to the mass of the black hole. The new model can be tested easily on microquasars, i.e., XTE J1550-564, on which the previous receding blob should move toward...

  5. Leptonic/hadronic models for electromagnetic emission in microquasars: the case of GX 339-4

    CERN Document Server

    Vila, Gabriela S

    2010-01-01

    We present a general self-consistent lepto/hadronic jet model for the non-thermal electromagnetic emission of microquasars. The model is applied to the low-mass microquasar (LMMQ) GX 339-4 and predicts its high-energy features. We assume that both leptons and hadrons are accelerated up to relativistic energies by diffusive shock acceleration, and calculate their contribution to the electromagnetic spectrum through all main radiative processes. The radiative contribution of secondary particles (pions, muons and electron-positron pairs) is included. We use a set of simultaneous observations in radio and X-rays to constrain the model parameters and find the best fit to the data. We obtain different spectral energy distributions that can explain the observations, and make predictions for the high-energy emission. Observations with gamma-ray instruments like Fermi can be used to test the model and determine the proton content of the jets. Finally, we estimate the positron injection in the surrounding medium. Our f...

  6. Modelling Oscillations in the Jet Emission from Microquasar GRS 1915+105

    CERN Document Server

    Collins, R S; Cox, S J; Collins, Ross S.; Kaiser, Christian R.; Cox, Simon J.

    2003-01-01

    The variability in the infrared to millimetre emission from microquasar GRS 1915+105 is believed to be dominated by the system's relativistic jet. In this paper we develop a time-dependent version of the Blandford & Konigl (1979) jet emission model and apply it to the oscillations in the infrared and millimetre emission from GRS 1915+105 observed by Fender & Pooley (2000). The resulting model provides a reasonable description of the observed flux oscillations from GRS 1915+105. From a fit of the observed time lag between the flux peaks in the infrared and millimetre emission together with the flux normalisation we were able to determine the model parameters for the GRS 1915+105 jet. We find that to achieve the observed flux levels with the model requires an unphysically large electron density within the jet. We therefore conclude that the Blandford & Konigl (1979) model cannot explain these observations, either because it does not provide the correct description of the emission from microquasar je...

  7. MASTER optical polarization variability detection in the Microquasar V404 Cyg/GS2023+33

    CERN Document Server

    Lipunov, Vladimir M; Kornilov, V; Krushinskiy, V; Vlasenko, D; Tiurina, N; Balanutsa, P; Kuznetsov, A; Budnev, N; Gress, O; Tlatov, A; Lopez, R Rebolo; Serra-Ricart, M; Buckley, D A H; Israelian, G; Lodieu, N; Ivanov, K; Yazev, S; Sergienko, Yu; Gabovich, A; Yurkov, V; Levato, H; Saffe, C; Podesta, R; Mallamaci, C; Lopez, C

    2016-01-01

    On 2015 June 15 the Swift space observatory discovered that the Galactic black hole candidate V404 Cyg was undergoing another active X-ray phase, after 25 years of inactivity (Barthelmy et al. 2015). Twelve telescopes of the MASTER Global Robotic Net located at six sites across four continents were the first ground based observatories to start optical monitoring of the microquasar after its gamma-ray wakeup at 18h 34m 09s U.T. on 2015 June 15 (Lipunov et al. 2015). In this paper we report, for the first time, the discovery of variable optical linear polarization, changing by 4-6% over a timescale of approximately 1 h, on two different epochs. We can conclude that the additional variable polarization arisies from the relativistic jet generated by the black hole in V404Cyg. The polarization variability correlates with optical brightness changes, increasing when the flux decreases.

  8. IR spectra of the microquasar GRS 1915+105 during a low state

    CERN Document Server

    Harlaftis, E T; Castro-Tirado, A J

    2001-01-01

    There is controversy regarding the nature of the suspected donor star to the microquasar GRS 1915+105, and hence whether GRS 1915+105 is a high mass X-ray binary (HMXB) or a low-mass X-ray binary (LMXB). In order to clarify this issue, we obtained an infrared (J, H and K) spectrum of GRS 1915+105 in its low state which shows a steeper continuum than the prototype X-ray binary Sco X-1. We did not detect any HeII emission at 2.189 microns from GRS 1915+105 in our quiescent spectrum, indicating that the line is transient and is only observed during episodes of high X-ray activity. For our instrument configuration, there is no detection of the 12CO lines which are characteristic of late-type stars either in GRS1915+105 or Sco X-1.

  9. Jet propulsion of wind ejecta from a major flare in the black hole microquasar SS433

    CERN Document Server

    Blundell, Katherine

    2011-01-01

    We present direct evidence, from Adaptive-Optics near-infra-red imaging, of the jets in the Galactic microquasar SS433 interacting with enhanced wind-outflow off the accretion disc that surrounds the black hole in this system. Radiant quantities of gas are transported significant distances away from the black hole approximately perpendicular to the accretion disc from which the wind emanates. We suggest that the material that comprised the resulting "bow-tie" structure is associated with a major flare that the system exhibited ten months prior to the observations. During this flare, excess matter was expelled by the accretion disc as an enhanced wind, which in turn is "snow-ploughed", or propelled, out by the much faster jets that move at approximately a quarter of the speed of light. Successive instances of such bow-ties may be responsible for the large-scale X-ray cones observed across the W50 nebula by ROSAT.

  10. Unveiling the high energy tail of 1E 1740.7-2942 with INTEGRAL

    CERN Document Server

    Bouchet, L; Jourdain, E; Roques, J P; Bazzano, A; De Cesare, G

    2008-01-01

    The microquasar 1E 1740.7-2942 is observed with Integral since Spring 2003. Here, we report on the source high energy behaviour by using the first three years of data collected with SPI and IBIS telescopes, taking advantage of the instruments complementarity. Light curves analysis showed two main states for 1E 1740.7-2942: the canonical low/hard state of black-hole candidates and a ``dim'' state, characterised by a ~ 20 times fainter emission, detected only below 50 keV and when summing more than 1Ms of data. For the first time the continuum of the low/hard state has been measured up to ~ 600 keV with a spectrum that is well represented by a thermal Comptonization plus an additional component necessary to fit the data above 200 keV. This high energy component could be related to non-thermal processes as already observed in other black-hole candidates. Alternatively, we show that a model composed by two thermal Comptonizations provides an equally representative description of the data: the temperature of the f...

  11. A Resonantly-Excited Disk-Oscillation Model of High-Frequency QPOs of Microquasars

    CERN Document Server

    Kato, Shoji

    2012-01-01

    A possible model of twin high-frequency QPOs (HF QPOs) of microquasars is examined. The disk is assumed to have global magnetic fields and to be deformed with a two-armed pattern. In this deformed disk, set of a two-armed ($m=2$) vertical p-mode oscillation and an axisymmetric ($m=0$) g-mode oscillation are considered. They resonantly interact through the disk deformation when their frequencies are the same. This resonant interaction amplifies the set of the above oscillations in the case where these two oscillations have wave energies of opposite signs. These oscillations are assumed to be excited most efficiently in the case where the radial group velocities of these two waves vanish at the same place. The above set of oscillations is not unique, depending on the node number, $n$, of oscillations in the vertical direction. We consider that the basic two sets of oscillations correspond to the twin QPOs. The frequencies of these oscillations depend on disk parameters such as strength of magnetic fields. For o...

  12. THE VARIABLE NEAR-INFRARED COUNTERPART OF THE MICROQUASAR GRS 1758–258

    Energy Technology Data Exchange (ETDEWEB)

    Luque-Escamilla, Pedro L. [Departamento de Ingeniería Mecánica y Minera, EPSJ, Universidad de Jaén, Campus Las Lagunillas s/n, A3-008, 23071 Jaén (Spain); Martí, Josep [Departamento de Física, EPSJ, Universidad de Jaén, Campus Las Lagunillas s/n, A3-420, 23071 Jaén (Spain); Muñoz-Arjonilla, Álvaro J., E-mail: peter@ujaen.es, E-mail: jmarti@ujaen.es, E-mail: ajmunoz@ujaen.es [Grupo de Investigación FQM-322, Universidad de Jaén, Campus Las Lagunillas s/n, A3-065, 23071 Jaén (Spain)

    2014-12-10

    We present a new study of the microquasar system GRS 1758–258 in the near-infrared domain based on archival observations with the Hubble Space Telescope and the NICMOS camera. In addition to confirming the near-infrared counterpart pointed out by Muñoz-Arjonilla et al., we show that this object displays significant photometric variability. From its average magnitudes, we also find that GRS 1758–258 fits well within the correlation between the optical/near-infrared and X-ray luminosity known to exist for low-mass, black-hole candidate X-ray binaries in a hard state. Moreover, the spectral energy distribution built using all radio, near-infrared, and X-ray data available closest in time to the NICMOS observations can be reasonably interpreted in terms of a self-absorbed radio jet and an irradiated accretion disk model around a stellar-mass black hole. All these facts match the expected behavior of a compact binary system and strengthen our confidence in the counterpart identification.

  13. Disk-Jet Connection in the Microquasar GRS 1915+105 and IR and Radio Emission

    CERN Document Server

    Yadav, J S

    2001-01-01

    We present evidence of a direct accretion disk-jet connection in the Galactic microquasar GRS 1915+105 based on our analysis of RXTE/PCA data with a ``spike'' in X-ray light curves. We find that the radio emission increases as the hardness ratio increases during the low hard state. We suggest that the ``spike'' which separates the dips with hard and soft spectra marks the beginning of the burst phase when the luminosity of the soft X-rays (5-15 keV) increases by a large factor (~ 10). This produces a major ejection episode of the synchrotron - emitting plasma termed as ``baby jets'' which are associated with infrared (IR) and radio flares of about half an hour period widely reported in the literature. Subsequent short but frequent soft dips produce overlapping faint flares which result in an enhanced level of quasi-steady emission. We discuss the dissipation of accretion energy in the inner part of the disk in terms of a comptonising cloud and the escaping mass which produces synchrotron radiation. We discuss...

  14. When Microquasar Jets and Supernova Collide: Hydrodynamically Simulating the SS433-W50 Interaction

    CERN Document Server

    Goodall, Paul T; Blundell, Katherine M

    2011-01-01

    We present investigations of the interaction between the relativistic, precessing jets of the microquasar SS433 with the surrounding, expanding Supernova Remnant (SNR) shell W50, and the consequent evolution in the inhomogeneous Interstellar Medium (ISM). We model their evolution using the hydrodynamic FLASH code, which uses adaptive mesh refinement. We show that the peculiar morphology of the entire nebula can be reproduced to a good approximation, due to the combined effects of: (i) the evolution of the SNR shell from the free-expansion phase through the Sedov blast wave in an exponential density profile from the Milky Way disc, and (ii) the subsequent interaction of the relativistic, precessing jets of SS 433. Our simulations reveal: (1) Independent measurement of the Galaxy scale-height and density local to SS433 (as n_0 = 0.2 cm^{-3}, Z_d = 40 pc), with this scale-height being in excellent agreement with the work of Dehnen & Binney. (2) A new mechanism for hydrodynamic refocusing of conical jets. (3)...

  15. High-mass microquasars and low-latitude gamma-ray sources

    CERN Document Server

    Bosch-Ramon, V; Paredes, J M

    2004-01-01

    Population studies of unidentified EGRET sources suggest that there exist at least three different populations of galactic gamma-ray sources. One of these populations is formed by young objects distributed along the galactic plane with a strong concentration toward the inner spiral arms of the Galaxy. Variability, spectral and correlation analysis indicate that this population is not homogeneous. In particular, there is a subgroup of sources that display clear variability in their gamma-ray fluxes on timescales from days to months. Following the proposal by Kaufman Bernad\\'o et al. (2002), we suggest that this group of sources might be high-mass microquasars, i.e. accreting black holes or neutron stars with relativistic jets and early-type stellar companions. We present detailed inhomogeneous models for the gamma-ray emission of these systems that include both external and synchrotron self-Compton interactions. We have included effects of interactions between the jet and all external photon fields to which it...

  16. Multifrequency Observations of the Galactic Microquasars GRS1915+105 and GROJ1655-40

    CERN Document Server

    Remillard, R A; McClintock, J E; Bailyn, C D; Orosz, J A; Greiner, J; Remillard, Ronald A.; Morgan, Edward H.; Clintock, Jeffrey E. Mc; Bailyn, Charles D.; Orosz, Jerome A.; Greiner, Jochen

    1998-01-01

    The two galactic `microquasars' with superluminal radio jets have been quite active during 1996, generatinga variety of studies involving both NASA and ground-based observatories. GRS~1915+105 has displayed dramatic accretion instability in observations with RXTE, revealing X-ray light curves and emission states unlike anything previously seen. Variable QPOs in the range of 0.07--10 Hz have been monitored with the capability to track the individual oscillations. The QPO amplitude is as high as 40% of the mean flux, while both amplitude and phase lag increase with photon energy. The results imply a direct link between the QPO mechanism and the origin of the energetic electrons believed to radiate the X-ray power-law component. GRS1915+105 also displays a transient yet stationary QPO at 67 Hz. The other source, GRO J1655-40, is an optically established black hole binary. Recent optical reports include an excellent model for the binary inclination and masses, while an optical precursor to the April 1996 X-ray ou...

  17. Non-Markov statistical effects of X-ray emission intensity of the microquasar GRS 1915+105

    CERN Document Server

    Yulmetyev, R M; Khusnutdinov, R M; Panischev, O Y; Hänggi, P

    2006-01-01

    In this paper we develop the new approach in time series analysis with a variable time step and present the results of quantitative and qualitative estimation of randomness and regularity, and the study of non-Markovian effects of the X-ray emission intensity of the microquasar GRS 1915+105. Our estimation is based on the application of the theory of discrete non-Markovian stochastic processes and gives a wide set of quantitative characteristics and parameters of the studied system with a variable time step. This set reflects the change of the effects of randomness and regularity, the alternation of Markovian and non-Markovian processes in the initial time signals. Initially these characteristics were determined for the simple model systems constructed by means of a molecular dynamics method. Further the calculation of these parameters was executed for the X-ray emission intensity of the microquasar GRS 1915+105. We have developed a theoretical scheme for the detailed analysis of the time series with a variab...

  18. The effects of the stellar wind and orbital motion on the jets of high-mass microquasars

    Science.gov (United States)

    Bosch-Ramon, V.; Barkov, M. V.

    2016-05-01

    Context. High-mass microquasar jets propagate under the effect of the wind from the companion star, and the orbital motion of the binary system. The stellar wind and the orbit may be dominant factors determining the jet properties beyond the binary scales. Aims: This is an analytical study, performed to characterise the effects of the stellar wind and the orbital motion on the jet properties. Methods: Accounting for the wind thrust transferred to the jet, we derive analytical estimates to characterise the jet evolution under the impact of the stellar wind. We include the Coriolis force effect, induced by orbital motion and enhanced by the wind's presence. Large-scale evolution of the jet is sketched, accounting for wind-to-jet thrust transfer, total energy conservation, and wind-jet flow mixing. Results: If the angle of the wind-induced jet bending is larger than its half-opening angle, the following is expected: (i) a strong recollimation shock; (ii) bending against orbital motion, caused by Coriolis forces and enhanced by the wind presence; and (iii) non-ballistic helical propagation further away. Even if disrupted, the jet can re-accelerate due to ambient pressure gradients, but wind entrainment can weaken this acceleration. On large scales, the opening angle of the helical structure is determined by the wind-jet thrust relation, and the wind-loaded jet flow can be rather slow. Conclusions: The impact of stellar winds on high-mass microquasar jets can yield non-ballistic helical jet trajectories, jet partial disruption and wind mixing, shocks, and possibly non-thermal emission. Among other observational diagnostics, such as radiation variability at any band, the radio morphology on milliarcsecond scales can be informative on the wind-jet interaction.

  19. The role of fast magnetic reconnection on the radio and gamma-ray emission from the nuclear regions of microquasars and low luminosity AGNs

    CERN Document Server

    Kadowaki, L H S; Singh, Chandra B

    2014-01-01

    Fast magnetic reconnection events can be a very powerful mechanism operating in the core region, near the jet launching area, of microquasars and AGNs. In earlier work, it has been suggested that the power released by fast reconnection events between the magnetic field lines lifting from the inner accretion disk region and the lines anchored into the central black hole could accelerate relativistic particles and produce the observed radio emission from microquasars and low luminosity AGNs (LLAGNs). Moreover, it has been proposed that the observed correlation between the radio emission and the mass of these sources, spanning $10^{10}$ orders of magnitude in mass, might be related to this process. In the present work, we revisit this model comparing different fast magnetic reconnection mechanisms, and apply the scenario above to a much larger sample of sources (including also blazars, and gamma-ray bursts - GRBs). We find that LLAGNs and microquasars confirm the trend above, i.e., their radio emission could be ...

  20. A search for very high-energy flares from the microquasars GRS 1915+105, Circinus X-1, and V4641 Sgr using contemporaneous H.E.S.S. and \\textit{RXTE} observations

    CERN Document Server

    Abdalla, H; Aharonian, F; Benkhali, F Ait; Akhperjanian, A G; Angüner, E O; Arrieta, M; Aubert, P; Backes, M; Balzer, A; Barnard, M; Becherini, Y; Tjus, J Becker; Berge, D; Bernhard, S; Bernlöhr, K; Birsin, E; Blackwell, R; Böttcher, M; Boisson, C; Bolmont, J; Bordas, P; Bregeon, J; Brun, F; Brun, P; Bryan, M; Bulik, T; Capasso, M; Carr, J; Casanova, S; Chadwick, P M; Chakraborty, N; Chalme-Calvet, R; Chaves, R C G; Chen, A; Chevalier, J; Chrétien, M; Colafrancesco, S; Cologna, G; Condon, B; Conrad, J; Couturier, C; Cui, Y; Davids, I D; Degrange, B; Deil, C; deWilt, P; Dickinson, H J; Djannati-Ataï, A; Domainko, W; Donath, A; Drury, L O'C; Dubus, G; Dutson, K; Dyks, J; Dyrda, M; Edwards, T; Egberts, K; Eger, P; Ernenwein, J -P; Eschbach, S; Farnier, C; Fegan, S; Fernandes, M V; Fiasson, A; Fontaine, G; Förster, A; Funk, S; Füßling, M; Gabici, S; Gajdus, M; Gallant, Y A; Garrigoux, T; Giavitto, G; Giebels, B; Glicenstein, J F; Gottschall, D; Goyal, A; Grondin, M -H; Grudzińska, M; Hadasch, D; Hahn, J; Hawkes, J; Heinzelmann, G; Henri, G; Hermann, G; Hervet, O; Hillert, A; Hinton, J A; Hofmann, W; Hoischen, C; Holler, M; Horns, D; Ivascenko, A; Jacholkowska, A; Jamrozy, M; Janiak, M; Jankowsky, D; Jankowsky, F; Jingo, M; Jogler, T; Jouvin, L; Jung-Richardt, I; Kastendieck, M A; Katarzyński, K; Katz, U; Kerszberg, D; Khélifi, B; Kieffer, M; King, J; Klepser, S; Klochkov, D; Kluźniak, W; Kolitzus, D; Komin, Nu; Kosack, K; Krakau, S; Kraus, M; Krayzel, F; Krüger, P P; Laffon, H; Lamanna, G; Lau, J; -P., J; Lefaucheur, J; Lefranc, V; Lemière, A; Lemoine-Goumard, M; Lenain, J -P; Leser, E; Lohse, T; Lorentz, M; Liu, R; Lypova, I; Marandon, V; Marcowith, A; Mariaud, C; Marx, R; Maurin, G; Maxted, N; Mayer, M; Meintjes, P J; Menzler, U; Meyer, M; Mitchell, A M W; Moderski, R; Mohamed, M; Morå, K; Moulin, E; Murach, T; de Naurois, M; Niederwanger, F; Niemiec, J; Oakes, L; Odaka, H; Öttl, S; Ohm, S; Ostrowski, M; Oya, I; Padovani, M; Panter, M; Parsons, R D; Arribas, M Paz; Pekeur, N W; Pelletier, G; Petrucci, P -O; Peyaud, B; Pita, S; Poon, H; Prokhorov, D; Prokoph, H; Pühlhofer, G; Punch, M; Quirrenbach, A; Raab, S; Reimer, A; Reimer, O; Renaud, M; Reyes, R de los; Rieger, F; Romoli, C; Rosier-Lees, S; Rowell, G; Rudak, B; Rulten, C B; Sahakian, V; Salek, D; Sanchez, D A; Santangelo, A; Sasaki, M; Schlickeiser, R; Schüssler, F; Schulz, A; Schwanke, U; Schwemmer, S; Seyffert, A S; Shafi, N; Shilon, I; Simoni, R; Sol, H; Spanier, F; Spengler, G; Spies, F; Stawarz, Ł; Steenkamp, R; Stegmann, C; Stinzing, F; Stycz, K; Sushch, I; Tavernet, J -P; Tavernier, T; Taylor, A M; Terrier, R; Tluczykont, M; Trichard, C; Tuffs, R; van der Walt, J; van Eldik, C; van Soelen, B; Vasileiadis, G; Veh, J; Venter, C; Viana, A; Vincent, P; Vink, J; Voisin, F; Völk, H J; Vuillaume, T; Wadiasingh, Z; Wagner, S J; Wagner, P; Wagner, R M; White, R; Wierzcholska, A; Willmann, P; Wörnlein, A; Wouters, D; Yang, R; Zabalza, V; Zaborov, D; Zacharias, M; Zdziarski, A A; Zech, A; Zefi, F; Ziegler, A; Żywucka, N

    2016-01-01

    Microquasars are potential $\\gamma$-ray emitters. Indications of transient episodes of $\\gamma$-ray emission were recently reported in at least two systems: Cyg X-1 and Cyg X-3. The identification of additional $\\gamma$-ray-emitting microquasars is required to better understand how $\\gamma$-ray emission can be produced in these systems. Theoretical models have predicted very high-energy (VHE) $\\gamma$-ray emission from microquasars during periods of transient outburst. Observations reported herein were undertaken with the objective of observing a broadband flaring event in the $\\gamma$-ray and X-ray bands. Contemporaneous observations of three microquasars, GRS 1915+105, Circinus X-1, and V4641 Sgr, were obtained using the High Energy Spectroscopic System (H.E.S.S.) telescope array and the Rossi X-ray Timing Explorer (RXTE) satellite. X-ray analyses for each microquasar were performed and VHE $\\gamma$-ray upper limits from contemporaneous H.E.S.S. observations were derived. No significant $\\gamma$-ray signal ...

  1. The effects of the stellar wind and orbital motion on the jets of high-mass microquasars

    CERN Document Server

    Bosch-Ramon, V

    2016-01-01

    High-mass microquasar jets propagate under the effect of the wind from the companion star, and the orbital motion of the binary system. The stellar wind and the orbit may be dominant factors determining the jet properties beyond the binary scales.} An analytical study is performed to characterize the effects of the stellar wind and the orbital motion on the jet properties. Accounting for the wind thrust transferred to the jet, we derive analytical estimates to characterize the jet evolution under the impact of the stellar wind. We include the Coriolis force effect, induced by orbital motion and enhanced by the wind presence. Large-scale evolution of the jet is sketched accounting for wind-to-jet thrust transfer, total energy conservation, and wind-jet flow mixing. If the angle of the wind-induced jet bending is larger than its half-opening angle, the following is expected: (i) a strong recollimation shock; (ii) bending against orbital motion, caused by Coriolis forces and enhanced by the wind presence; and (i...

  2. Different Types of X-ray Variability Observed in Micro-Quasar GRS 1915+105 with the IXAE

    CERN Document Server

    Naik, S; Paul, B; Rao, A R; Yadav, J S; Seetha, S

    2001-01-01

    The galactic micro-quasar source GRS 1915+105 has been observed with the Indian X-ray Astronomy Experiment (IXAE) several times over a period extending from 1996 to 2000. The source has been observed in different luminosity states and exhibits a rich variety of random and regular X-ray variability over a wide range of time scales. It also shows a unique variability characteristic namely the occurrence of quasi-regular X-ray bursts with period ranging from 20 s to about 100 s which have slow rise and fast decay. The X-ray spectrum of these bursts is hardest near the end of decay. In the low-hard state and bright-soft state with rapid variability, the source exhibits quasi-periodic oscillations (QPOs) with variable frequency which is luminosity dependent. Regular X-ray intensity dips have been detected coincident with the occurrence of a giant radio outburst. The source made a transition from a low-state to a high-state in 1999 in less than a day and from a soft-bright state to a hard-low state in 2000 in less ...

  3. Infrared study of H1743-322 in outburst: a radio-quiet and NIR-dim microquasar

    CERN Document Server

    Chaty, S; Dubus, G

    2015-01-01

    The X-ray binary, black hole candidate, and microquasar H1743-322 exhibited a series of X-ray outbursts between 2003 and 2008. We took optical/infrared (OIR) observations with the ESO/NTT telescope during 3 of these outbursts (2003, 2004, and 2008), to study its spectral energy distribution (SED). We detect rapid flares of duration ~5 mn in the high time-resolution IR lightcurve. We identify H and He emission lines in the IR spectra, coming from the accretion disk. The IR SED exhibits the spectral index typically associated with the X-ray high, soft state in our observations taken during the 2003 and 2004 outbursts, while the index changes to one that is typical of the X-ray low, hard state during the 2008 outburst. During this last outburst, we detected a change of slope in the NIR spectrum between the J and Ks bands, where the JH part is characteristic of an optically thick disk emission, while the HKs part is typical of optically thin synchrotron emission. Furthermore, the comparison of our IR data with ra...

  4. GAMMA-RAY OBSERVATIONS OF THE MICROQUASARS CYGNUS X-1, CYGNUS X-3, GRS 1915+105, AND GX 339–4 WITH THE FERMI LARGE AREA TELESCOPE

    Energy Technology Data Exchange (ETDEWEB)

    Bodaghee, Arash; Tomsick, John A. [Space Sciences Laboratory, 7 Gauss Way, University of California, Berkeley, CA 94720 (United States); Pottschmidt, Katja [CRESST and NASA Goddard Space Flight Center, Astrophysics Science Division, Code 661, Greenbelt, MD 20771 (United States); Rodriguez, Jérôme [Laboratoire AIM, CEA/IRFU, Université Paris Diderot, CNRS/INSU, CEA DSM/IRFU/SAp, Centre de Saclay, F-91191 Gif-sur-Yvette (France); Wilms, Jörn [Dr. Karl Remeis-Sternwarte and Erlangen Centre for Astroparticle Physics, Friedrich-Alexander-Universität Erlangen-Nürnberg, Sternwartstrasse 7, D-96049 Bamberg (Germany); Pooley, Guy G., E-mail: bodaghee@ssl.berkeley.edu [Mullard Radio Astronomy Observatory, Cavendish Laboratory, The University of Cambridge, J. J. Thomson Avenue, Cambridge CB3 0HE (United Kingdom)

    2013-10-01

    Detecting gamma-rays from microquasars is a challenging but worthwhile endeavor for understanding particle acceleration and the jet mechanism and for constraining leptonic/hadronic emission models. We present results from a likelihood analysis on timescales of 1 day and 10 days of ∼4 yr worth of gamma-ray observations (0.1-10 GeV) by Fermi-LAT of Cyg X-1, Cyg X-3, GRS 1915+105, and GX 339–4. Our analysis reproduced all but one of the previous gamma-ray outbursts of Cyg X-3 as reported with Fermi or AGILE, plus five new days on which Cyg X-3 is detected at a significance of ∼5σ that are not reported in the literature. In addition, Cyg X-3 is significantly detected on 10 day timescales outside of known gamma-ray flaring epochs, which suggests that persistent gamma-ray emission from Cyg X-3 has been detected for the first time. For Cyg X-1 we find three low-significance excesses (∼3-4σ) on daily timescales that are contemporaneous with gamma-ray flares reported (also at low significance) by AGILE. Two other microquasars, GRS 1915+105 and GX 339–4, are not detected, and we derive 3σ upper limits of 2.3 × 10{sup –8} photons cm{sup –2} s{sup –1} and 1.6 × 10{sup –8} photons cm{sup –2} s{sup –1}, respectively, on the persistent flux in the 0.1-10 GeV range. These results enable us to define a list of the general conditions that are necessary for the detection of gamma-rays from microquasars.

  5. GAMMA-RAY OBSERVATIONS OF THE MICROQUASARS CYGNUS X-1, CYGNUS X-3, GRS 1915+105, AND GX 339–4 WITH THE FERMI LARGE AREA TELESCOPE

    International Nuclear Information System (INIS)

    Detecting gamma-rays from microquasars is a challenging but worthwhile endeavor for understanding particle acceleration and the jet mechanism and for constraining leptonic/hadronic emission models. We present results from a likelihood analysis on timescales of 1 day and 10 days of ∼4 yr worth of gamma-ray observations (0.1-10 GeV) by Fermi-LAT of Cyg X-1, Cyg X-3, GRS 1915+105, and GX 339–4. Our analysis reproduced all but one of the previous gamma-ray outbursts of Cyg X-3 as reported with Fermi or AGILE, plus five new days on which Cyg X-3 is detected at a significance of ∼5σ that are not reported in the literature. In addition, Cyg X-3 is significantly detected on 10 day timescales outside of known gamma-ray flaring epochs, which suggests that persistent gamma-ray emission from Cyg X-3 has been detected for the first time. For Cyg X-1 we find three low-significance excesses (∼3-4σ) on daily timescales that are contemporaneous with gamma-ray flares reported (also at low significance) by AGILE. Two other microquasars, GRS 1915+105 and GX 339–4, are not detected, and we derive 3σ upper limits of 2.3 × 10–8 photons cm–2 s–1 and 1.6 × 10–8 photons cm–2 s–1, respectively, on the persistent flux in the 0.1-10 GeV range. These results enable us to define a list of the general conditions that are necessary for the detection of gamma-rays from microquasars

  6. Joint H-alpha and X-Ray Observations of Massive X-Ray Binaries. II. The Be X-ray Binary and Microquasar LS I +61 303

    OpenAIRE

    Grundstrom, E. D.; Caballero-Nieves, S. M.; Gies, D. R.; Huang, W.; McSwain, M. V.; Rafter, S. E.; Riddle, R. L.; Williams, S. J.; Wingert, D. W.

    2006-01-01

    We present the results of an H-alpha monitoring campaign on the BeXRB and microquasar system LS I +61 303. We use radial velocity measurements of HeI lines in our spectra to re-evaluate the orbital elements and to better establish the time of periastron. We list equivalent widths and other parameters for the H-alpha emission line and discuss the orbital phase related variations observed. We call attention to a dramatic episode of emission weakening that occurred in less than a day that probab...

  7. A parallax distance to the microquasar GRS 1915+105 and a revised estimate of its black hole mass

    Energy Technology Data Exchange (ETDEWEB)

    Reid, M. J.; McClintock, J. E.; Steiner, J. F.; Narayan, R. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Steeghs, D. [Department of Physics, The University of Warwick, Coventry CV4 7AL (United Kingdom); Remillard, R. A. [MIT Kavli Institute for Astrophysics and Space Research, MIT, 70 Vassar Street, Cambridge, MA 02139 (United States); Dhawan, V., E-mail: mreid@cfa.harvard.edu [National Radio Astronomy Observatory, P.O. Box 0, Socorro, NM 87801 (United States)

    2014-11-20

    Using the Very Long Baseline Array, we have measured a trigonometric parallax for the microquasar GRS 1915+105, which contains a black hole and a K-giant companion. This yields a direct distance estimate of 8.6{sub −1.6}{sup +2.0} kpc and a revised estimate for the mass of the black hole of 12.4{sub −1.8}{sup +2.0} M {sub ☉}. GRS 1915+105 is at about the same distance as some H II regions and water masers associated with high-mass star formation in the Sagittarius spiral arm of the Galaxy. The absolute proper motion of GRS 1915+105 is –3.19 ± 0.03 mas yr{sup –1} and –6.24 ± 0.05 mas yr{sup –1} toward the east and north, respectively, which corresponds to a modest peculiar speed of 22 ± 24 km s{sup –1} at the parallax distance, suggesting that the binary did not receive a large velocity kick when the black hole formed. On one observational epoch, GRS 1915+105 displayed superluminal motion along the direction of its approaching jet. Considering previous observations of jet motions, the jet in GRS 1915+105 can be modeled with a jet inclination to the line of sight of 60° ± 5° and a variable flow speed between 0.65c and 0.81c, which possibly indicates deceleration of the jet at distances from the black hole ≳ 2000 AU. Finally, using our measurements of distance and estimates of black hole mass and inclination, we provisionally confirm our earlier result that the black hole is spinning very rapidly.

  8. Testing modified gravity and no-hair relations for the Kerr-Newman metric through quasi-periodic oscillations of galactic microquasars

    CERN Document Server

    Suvorov, Arthur George

    2016-01-01

    We construct multipole moments for stationary, asymptotically flat, spacetime solutions to higher-order curvature theories of gravity. The moments are defined using $3+1$ techniques involving timelike Killing vector constructions as in the classic papers by Geroch and Hansen. Using the fact that the Kerr-Newman metric is a vacuum solution to a particular class of $f(R)$ theories of gravity, we compute all its moments, and find that they admit recurrence relations similar to those for the Kerr solution in general relativity. It has been proposed previously that modelling the measured frequencies of quasi-periodic oscillations from galactic microquasars enables experimental tests of the no-hair theorem. We explore the possibility that, even if the no-hair relation is found to break down in the context of general relativity, there may be an $f(R)$ counterpart that is preserved. We apply the results to the microquasars GRS $1915$+$105$ and GRO J$1655$-$40$ using the diskoseismology and kinematic resonance models,...

  9. Class 1E digital systems studies

    International Nuclear Information System (INIS)

    This document is furnished as part of the effort to develop NRC Class 1E Digital Computer Systems Guidelines which is Task 8 of USAF Rome Laboratories Contract F30602-89-D-0100. The report addresses four major topics, namely, computer programming languages, software design and development, software testing and fault tolerance and fault avoidance. The topics are intended as stepping stones leading to a Draft Regulatory Guide document. As part of this task a small scale survey of software fault avoidance and fault tolerance practices was conducted among vendors of nuclear safety related systems and among agencies that develop software for other applications demanding very high reliability. The findings of the present report are in part based on the survey and in part on review of software literature relating to nuclear and other critical installations, as well as on the authors' experience in these areas

  10. Chandra Discovers the X-ray Signature of a Powerful Wind from a Galactic Microquasar

    Science.gov (United States)

    2000-11-01

    Wide Web, along with other information about the discovery, at http://www.astro.psu.edu/users/niel/cirx1/cirx1.html. A binary-star system 20,000 light years from Earth in the constellation of Circinus. Animation showing the strong variability over time of one of the P Cygni spectral lines seen by Chandra from Circinus X-1 (Click Image to View Animation) Credit: Niel Brandt and Norbert Schulz (Note: This animation is the same as the one referred to in the above paragraph) Atoms irradiated with energetic X-rays can emit as well as absorb them at specific wavelengths. Whether astronomers observe emission or absorption depends on the state and environment of the irradiated atoms, so these processes carry vital information about the emitting and absorbing material. Regarding the time-lapse movie, Schulz commented "You can see this profile flipping up and down between a strong emission line on the red side and a strong absorption line on the blue side. We don't yet fully understand what this means, but it does indicate the dynamic nature of this system. We see indications that sometimes either the emitting or the absorbing region gets obscured by matter so thick that not even X rays can penetrate it." The researchers say one reason their discovery that Circinus X-1 has a high-velocity wind is important is that this small two-star system now has striking similarities with a type of luminous active galaxy known as a broad-absorption-line quasar. Broad-absorption-line quasars are galaxies containing a violent centers powered by supermassive black holes. "This type of galaxy has an accretion disk circling its black hole plus very powerful winds created when radiation pushes material off of the disk and out into space," Brandt says. "The disk winds from broad-absorption-line quasars create P Cygni lines in the spectra of these objects. Circinus X-1, with the newly detected X-ray P Cygni profiles, appears in many ways to be a microscopic version of a broad-absorption-line quasar

  11. Discovery of an unusual new radio source in the star-forming galaxy M82: Faint supernova, supermassive blackhole, or an extra-galactic microquasar?

    CERN Document Server

    Muxlow, T W B; Garrington, S T; Pedlar, A; Fenech, D M; Argo, M K; van Eymeren, J; Ward, M; Zezas, A; Brunthaler, A

    2010-01-01

    A faint new radio source has been detected in the nuclear region of the starburst galaxy M82 using MERLIN radio observations designed to monitor the flux density evolution of the recent bright supernova SN2008iz. This new source was initially identified in observations made between 1-5th May 2009 but had not been present in observations made one week earlier, or in any previous observations of M82. In this paper we report the discovery of this new source and monitoring of its evolution over its first 9 months of existence. The true nature of this new source remains unclear, and we discuss whether this source may be an unusual and faint supernova, a supermassive blackhole associated with the nucleus of M82, or intriguingly the first detection of radio emission from an extragalactic microquasar.

  12. Main: 1E4N [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E4N トウモロコシ Corn Zea mays L. Beta-Glucosidase, Chloroplast Precursor Name=Glu1; Zea...EVNGPDGKPIGPPMGNPWIYMYPEGLKDLLMIMKNKYGNPPIYITENGIGDVDTKETPLPMEAALNDYKRLDYIQRHIATLKESIDLGSNVQGYFAWSLLDNFEWFAGFTERYGIVYVDRNNNCTRYMKESAKWLKEFNTAKKPSKKILTPA corn_1E4N.jpg ...

  13. Main: 1E4L [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E4L トウモロコシ Corn Zea mays L. Beta-Glucosidase, Chloroplast Precursor Name=Glu1; Zea...MKNKYGNPPIYITENGIGDVDTKETPLPMEAALNDYKRLDYIQRHIATLKESIDLGSNVQGYFAWSLLDNFEWFAGFTERYGIVYVDRNNNCTRYMKESAKWLKEFNTAKKPSKKILTPA corn_1E4L.jpg ...

  14. Main: 1E1F [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1F トウモロコシ Corn Zea mays L. Beta-Glucosidase, Chloroplast Precursor Name=Glu1; Zea...QRHIATLKESIDLGSNVQGYFAWSLLDNFEWFAGFTERYGIVYVDRNNNCTRYMKESAKWLKEFNTAKKPSKKILTPA corn_1E1F.jpg ...

  15. Gamma-ray observations of the microquasars Cygnus X-1, Cygnus X-3, GRS 1915+105, and GX 339-4 with the Fermi Large Area Telescope

    CERN Document Server

    Bodaghee, Arash; Pottschmidt, Katja; Rodriguez, Jerome; Wilms, Joern; Pooley, Guy G

    2013-01-01

    Detecting gamma-rays from microquasars is a challenging but worthwhile endeavor for understanding particle acceleration, the jet mechanism, and for constraining leptonic/hadronic emission models. We present results from a likelihood analysis on timescales of 1 d and 10 d of ~4 years worth of gamma-ray observations (0.1-10 GeV) by Fermi-LAT of Cyg X-1, Cyg X-3, GRS 1915+105, and GX 339-4. Our analysis reproduced all but one of the previous gamma-ray outbursts of Cyg X-3 as reported with Fermi or AGILE, plus 5 new days on which Cyg X-3 is detected at a significance of ~5-sigma that are not reported in the literature. In addition, Cyg X-3 is significantly detected on 10-d timescales outside of known gamma-ray flaring epochs which suggests that persistent gamma-ray emission from Cyg X-3 has been detected for the first time. For Cyg X-1, we find three low significance excesses (~3-4-sigma) on daily timescales that are contemporaneous with gamma-ray flares reported (also at low significance) by AGILE. Two other mic...

  16. A Relativistic Fe K-alpha Emission Line in the Intermediate Luminosity BeppoSAX Spectrum of the Galactic Microquasar V4641 Sgr

    CERN Document Server

    Miller, J M; in 't Zand, J J M; Reynolds, C S; Wijnands, R; Nowak, M A; Lewin, W H G

    2002-01-01

    Broad Fe K-alpha emission lines have recently been reported in a number of Galactic black holes. Such lines are useful accretion flow diagnostics because they may be produced at the inner accretion disk and shaped by relativistic effects, but in general they have only been observed at luminosities of L_X = 10^(37-38) erg/s in soft X-rays. The Galactic microquasar V4641 Sgr -- widely known for its 12.2 Crab (1.5-12 keV) outburst in 1999 September -- displayed low-level activity in 1999 March. BeppoSAX observed the source in this state and Fe K-alpha line emission was found (in 't Zand et al. 2000). In re-analyzing these data, we find strong evidence that the Fe K-alpha line profile is broadened. For the most likely values of the source distance and black hole mass measured by Orosz et al. (2001), our fits to the total spectrum indicate that the source was observed at a luminosity of L_X = 1.9 (+1.0, -0.8) * 10^(36) erg/s (2-10 keV), or L_(2-10)/L_(Eddington) = 1.8 (+0.9, -0.8) * 10^(-3). Advection-dominated ac...

  17. Purification and Structural Analysis of Plectin and BPAG1e.

    Science.gov (United States)

    Manso, José A; García Rubio, Inés; Gómez-Hernández, María; Ortega, Esther; Buey, Rubén M; Carballido, Ana M; Carabias, Arturo; Alonso-García, Noelia; de Pereda, José M

    2016-01-01

    Plectin and BPAG1e belong to the plakin family of high-molecular-weight proteins that interconnect the cytoskeletal systems and anchor them to junctional complexes. Plectin and BPAG1e are prototypical plakins with a similar tripartite modular structure. The N- and C-terminal regions are built of multiple discrete structural domains, while the central rod domain mediates dimerization by coiled-coil interactions. Owing to the mosaic organization of plakins, the structure of their constituent individual domains or small multi-domain segments can be analyzed isolated. Yet, understanding the integrated function of large regions, oligomers, and heterocomplexes of plakins is difficult due to the large and segmented structure. Here, we describe methods for the production of plectin and BPAG1e samples suitable for structural and biophysical analysis. In addition, we discuss the combination of hybrid methods that yield information at several resolution levels to study the complex, multi-domain, and flexible structure of plakins.

  18. Nieuwe grondstoffen voor biobrandstoffen : alternatieve 1e generatie energiegewassen

    NARCIS (Netherlands)

    Elbersen, H.W.; Oyen, L.P.A.; Bakker, R.R.C.; Blaauw, R.

    2009-01-01

    Bioenergie en dan vooral biobrandstoffen (voor transport) staan in de belangstelling. Hierbij gaat het vooral om de huidige zogenaamde 1e generatie biobrandstoffen. Deze zijn gebaseerd op suikers en zetmeel voor de productie van bioethanol als benzinevervanging of oliën en vetten voor de productie v

  19. Data of evolutionary structure change: 1E4XH-1JGUH [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E4XH-1JGUH 1E4X 1JGU H H QVQLQQPGAELVKPGASVKLSCKASGFTFTNYWMHWVKQ...EE EEE EEE EEEEEEEEEEE EEEEEEE EEEEEE --- 0... 1E4X H 1E4XHPHE CA 185 ARG CA 224 ILE CA 296 1E4X... H 1E4XH IGEILPSNGRT

  20. Data of evolutionary structure change: 1E4XI-1CF8H [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E4XI-1CF8H 1E4X 1CF8 I H QVQLQQPGAELVKPGPSVKLSCKASGFTFT-NYWMHWVK...EEE EEEEEEEEEE EEEEEEE EEEEEE - 0 1E4X... I 1E4XI...A 262 ASP CA 228 THR CA 300 ARG CA 287 1E4X... I 1E4XI

  1. Data of evolutionary structure change: 1E4XI-1LO3H [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E4XI-1LO3H 1E4X 1LO3 I H QVQLQQPGAELVKPGPSVKLSCKASGFTFTNYWMHWVKQ...EEEEEEEEEEHHHH EEEEEEE EEEEE - 0 1E4X... I 1E4XI ...6 LEU CA 230 ILE CA 298 TYR CA 288 1E4X... I 1E4XI GEILPSNGRTN

  2. The strange accretion state in the microquasar M81 ULS1%奇异吸积态的微类星体--M81 ULS1

    Institute of Scientific and Technical Information of China (English)

    白宇; 王松; 刘继峰

    2016-01-01

    Microquasars share the same phenomenon of the relativistic jets to their cousins of quasars, showing redshifted and blueshifted emission lines in their spectra, if the jets are domi-nated by baryonic matter. Such relativistic jets are not expected from sources with supersoft X-ray spectra, based on previous observations and classical theory. We report the discovery of blueshifted broad Hαemission lines, with the projected velocities~17 percent of the speed of light, in optical spectra of an ultraluminous supersoft X-ray source (ULS) in the nearby galaxy M81 (M81 ULS-1), which is the strong evidence of jets with relativistic speeds. The relativistic jets are not expected to be launched from white dwarfs, which is hard to reconcile with its constant soft X-rays, but the rel-ativistic jets in a ULS may possibly be explained by a long speculated super-critically accreting black hole.%微类星体拥有与类星体相似的相对论喷流现象,如果喷流的物质为重子,则在光谱中表现为红移和蓝移的发射线。经典的理论和以往的观测表明,对于辐射出超软X射线的天体,相对论喷流是无法产生的。文章作者在M81旋涡星系超软极亮X射线源(M81 ULS1)的光谱中,发现了蓝移的宽Hα发射线,其速度约为0.17倍的光速,这是相对论喷流的有力证据,也证认了M81 ULS1是一个微类星体。然而,它的相对论喷流不可能起源于白矮星,这与M81 ULS1的超软X射线光谱相矛盾。作者还发现超软极亮X射线源中的相对论喷流,可以被最新的处于超爱丁顿吸积的黑洞模型所解释。

  3. Security 1E10 anti-idiotypic vaccine in patients with tumors of different locations

    Directory of Open Access Journals (Sweden)

    Carmen Viada

    2016-02-01

    Full Text Available Cancer is a leading cause of death in Cuba and the world. Lung cancer is the leading cause of death, breast cancer is the second leading cause of death and colorectal cancer is the third leading cause of death. The 1E10 anti-idiotype vaccine is a new immunotherapeutic agent, registered for lung cancer by the Center for Molecular Immunology (CIM. You want to evaluate the safety of this vaccine in the treatment of various cancer sites. To determine the safety adverse events occurred in six clinical trials (one stage I lung, 3 phase II in breast, colon and lung, 1 phase II-III and program expanded use, both in lung were evaluated. 656 patients were studied. Demographic variables, the characteristics of the disease and adverse events were measured. The studies were balanced with respect to baseline characteristics. The most common adverse events were local reactions associated with 1E10 anti-idiotype vaccine and systemic reactions of mild or moderate intensity that were not related to the administration of the vaccine under study. The 1E10 anti-idiotype vaccine is safe for the low frequency and intensity of adverse events reported.

  4. Proper Motion and Timing of Two Unusual Pulsars: Calvera and 1E 1207.4-5209

    CERN Document Server

    Halpern, J P

    2015-01-01

    Using pairs of images from the Chandra High-Resolution Camera we examine the proper motion of the central compact object (CCO) 1E 1207.4-5209 in the supernova remnant (SNR) PKS 1209-51/52, and the unusual pulsar Calvera that is possibly a CCO descendant. For 1E 1207.4-5209, an insignificant proper motion of 15+/-7 mas/yr is measured, corresponding to a corrected tangential velocity of <180 km/s at the distance of 2 kpc. This proves that the previously noted large offset of the pulsar from the apparent geometric center of the SNR is not due to high proper motion; evidently the symmetry of the remnant does not indicate its center of expansion. Calvera has a marginally significant proper motion of 69+/-26 mas/yr, corresponding to 86+/-33 km/s for a hypothetical distance of 0.3 kpc. Notably, its vector is away from the Galactic plane, although its high Galactic latitude of b = +37 deg may be more a consequence of its proximity than its velocity. We also provide updated timing solutions for each pulsar. Spannin...

  5. X-1E on Lakebed with Collapsed Nose Gear

    Science.gov (United States)

    1956-01-01

    This photo was taken June 18, 1956 on Rogers Dry Lakebed after Flight 7 of the Bell Aircraft Corporation X-1E with NACA High-Speed Flight Station test pilot Joseph `Joe' Walker at the controls. The first generation X-1s were well known for nose gear failures and the X-1E was no exception. The hard pitch down on landing usually resulted in a collapsed nose gear. The damage rarely was serious but required several days of down-time for repair. The X-1E was the only one to have a true tail skid to protect the empennage from over-rotation during landing. There were four versions of the Bell X-1 rocket-powered research aircraft that flew at the NACA High-Speed Flight Research Station, Edwards, California. The bullet-shaped X-1 aircraft were built by Bell Aircraft Corporation, Buffalo, N.Y. for the U.S. Army Air Forces (after 1947, U.S. Air Force) and the National Advisory Committee for Aeronautics (NACA). The X-1 Program was originally designated the XS-1 for EXperimental Supersonic. The X-1's mission was to investigate the transonic speed range (speeds from just below to just above the speed of sound) and, if possible, to break the 'sound barrier.' Three different X-1s were built and designated: X-1-1, X-1-2 (later modified to become the X-1E), and X-1-3. The basic X-1 aircraft were flown by a large number of different pilots from 1946 to 1951. The X-1 Program not only proved that humans could go beyond the speed of sound, it reinforced the understanding that technological barriers could be overcome. The X-1s pioneered many structural and aerodynamic advances including extremely thin, yet extremely strong wing sections; supersonic fuselage configurations; control system requirements; powerplant compatibility; and cockpit environments. The X-1 aircraft were the first transonic-capable aircraft to use an all-moving stabilizer. The flights of the X-1s opened up a new era in aviation. The first X-1 was air-launched unpowered from a Boeing B-29 Superfortress on January 25

  6. Aging evaluation of class 1E batteries: Seismic testing

    Energy Technology Data Exchange (ETDEWEB)

    Edson, J.L. (EG and G Idaho, Inc., Idaho Falls, ID (USA))

    1990-08-01

    This report presents the results of a seismic testing program on naturally aged class 1E batteries obtained from a nuclear plant. The testing program is a Phase 2 activity resulting from a Phase 1 aging evaluation of class 1E batteries in safety systems of nuclear power plants, performed previously as a part of the US Nuclear Regulatory Commission's Nuclear Plant Aging Research Program and reported in NUREG/CR-4457. The primary purpose of the program was to evaluate the seismic ruggedness of naturally aged batteries to determine if aged batteries could have adequate electrical capacity, as determined by tests recommended by IEEE Standards, and yet have inadequate seismic ruggedness to provide needed electrical power during and after a safe shutdown earthquake (SSE) event. A secondary purpose of the program was to evaluate selected advanced surveillance methods to determine if they were likely to be more sensitive to the aging degradation that reduces seismic ruggedness. The program used twelve batteries naturally aged to about 14 years of age in a nuclear facility and tested them at four different seismic levels representative of the levels of possible earthquakes specified for nuclear plants in the United States. Seismic testing of the batteries did not cause any loss of electrical capacity. 19 refs., 29 figs., 7 tabs.

  7. Aging evaluation of class 1E batteries: Seismic testing

    International Nuclear Information System (INIS)

    This report presents the results of a seismic testing program on naturally aged class 1E batteries obtained from a nuclear plant. The testing program is a Phase 2 activity resulting from a Phase 1 aging evaluation of class 1E batteries in safety systems of nuclear power plants, performed previously as a part of the US Nuclear Regulatory Commission's Nuclear Plant Aging Research Program and reported in NUREG/CR-4457. The primary purpose of the program was to evaluate the seismic ruggedness of naturally aged batteries to determine if aged batteries could have adequate electrical capacity, as determined by tests recommended by IEEE Standards, and yet have inadequate seismic ruggedness to provide needed electrical power during and after a safe shutdown earthquake (SSE) event. A secondary purpose of the program was to evaluate selected advanced surveillance methods to determine if they were likely to be more sensitive to the aging degradation that reduces seismic ruggedness. The program used twelve batteries naturally aged to about 14 years of age in a nuclear facility and tested them at four different seismic levels representative of the levels of possible earthquakes specified for nuclear plants in the United States. Seismic testing of the batteries did not cause any loss of electrical capacity. 19 refs., 29 figs., 7 tabs

  8. BEST sensitivity to O(1) eV sterile neutrino

    CERN Document Server

    Barinov, Vladislav; Gorbunov, Dmitry; Ibragimova, Tatiana

    2016-01-01

    Numerous anomalous results in neutrino oscillation experiments can be attributed to interference of ~1 eV sterile neutrino. The specially designed to fully explore the Gallium anomaly Baksan Experiment on Sterile Transitions (BEST) starts next year. We investigate the sensitivity of BEST in searches for sterile neutrino mixed with electron neutrino. Then, performing the combined analysis of all the Gallium experiments (SAGE, GALLEX, BEST) we find the regions in model parameter space (sterile neutrino mass and mixing angle), which will be excluded if BEST agrees with no sterile neutrino hypothesis. For the opposite case, if BEST observes the signal as it follows from the sterile neutrino explanation of the Gallium (SAGE and GALLEX) anomaly, we show how BEST will improve upon the present estimates of the model parameters.

  9. Data of evolutionary structure change: 1E1QC-2HLDA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1QC-2HLDA 1E1Q 2HLD C A ADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSS...ELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKIT...RPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQS--DLDASTKQTLVRGERLTQLLKQNQYSPLATEEQV...> 0 2HLD A 2HLDA AFAQS--DLDA...ain> 1E1Q C 1E1QC AFAQFGSDLDA

  10. X-1E launch from B-50 mothership

    Science.gov (United States)

    1950-01-01

    it was to be launched on its second flight. It had to be jettisoned to the Muroc desert. Shop experiments soon determined that the deadly explosive culprit for the X-1D, the X-1 #3, and the X-1A was the ulmer leather gasket material used in contact with the liquid oxygen. The loss of the X-1 #3 and the X-1D led the NACA to rebuild the X-1 #2 into a new aircraft. By December 1955, the redesignated X-1E was ready. It featured a new, very thin 4-percent wing along with the existing 8-percent tail, with an efficient low-pressure turbo-pump for the engine. It also contained an ejection seat for the pilot, unlike the original X-1. On October 8, 1957, the aircraft with NACA pilot Joseph A. Walker achieved a speed of Mach 2.24 (1,478 mph). During its second flight career, the new X-1E allowed NACA to gather significant data on high Mach flight and stability questions and to demonstrate improved engine and production technology for incorporation into new USAF aircraft. The X-1E was also used to obtain in-flight data on the improvements achieved with the high-speed wing. These wings, made by Stanley Aircraft, wereonly 3 - 3/8-in. thick at the thickest point and had 343 gauges installed in them for measurement of structural loads and aerodynamic heating. Like the original X-1 it was air launched. This movie clip running about 10 seconds shows a drop from the B-50 mothership, accelerating away under rocket power and at speed making a high altitude contrail.

  11. Data of evolutionary structure change: 1E0UC-3G2GD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E0UC-3G2GD 1E0U 3G2G C D ----------------------------MKKTKIVCTIG...PKTESEEMLAKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKT------GKTAAILLDTKGPEIRTMKLEGGNDVSLKAGQTFTFTTDKSVI--GNSEMVAVTYE...GFTTDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVLNNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVIEIREHLKAHGGENIHIIS...KIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRALKVVITATMMLDSMIKNPRPTRAEAGDVAN...TAHQLVLSKGVVPQLV--KEITSTDDFYR----LGKELALQSGLAHKGDVVVMVSGALVPSGTTNTASVHVL- QTQQLHAAMADTFLEHMCRLD

  12. Data of evolutionary structure change: 1E1RC-2HLDA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1RC-2HLDA 1E1R 2HLD C A ADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSS...ELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKIT...RPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQS--DLDASTKQTLVRGERLTQLLKQNQYSPLATEEQV...fEVID> 0 2HLD A 2HLDA AFAQS--DLDAS GGG -- HH

  13. Hastings Center

    Science.gov (United States)

    ... Public Events October 19, Hastings Center Seminar, Garrison : Human Genetic Engineering: Wh at Can We Do? What Should We ... Public Events October 19, Hastings Center Seminar, Garrison : Human Genetic Engineering: Wh at Can We Do? What Should We ...

  14. Excel Center

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Citigroup,one of the World top 500 companies,has now settled in Excel Center,Financial Street. The opening ceremony of Excel Center and the entry ceremony of Citigroup in the center were held on March 31.Government leaders of Xicheng District,the Excel CEO and the heads of Asia-Pacific Region leaders of Citibank all participated in the ceremony.

  15. Job center

    Science.gov (United States)

    To better meet the needs of AGU members, a program has been started to increase the effectiveness of the Job Center activity at the Spring and Fall Meetings. As a result, participation in the Job Center at the 1988 AGU Spring Meeting in Baltimore increased substantially compared to previous Spring Meetings. The number of employers, applicants, and interviews scheduled more than doubled compared to the 1987 Spring Job Center.In order to make the meeting Job Centers even better, a survey is being conducted of employers and applicants who participated in the 1988 Spring Job Center. Evaluation of this survey will be useful in continuing increased participation in and the effectiveness of the Job Center at the 1988 Fall Meeting. Past participants and those interested in the future of the Job Center are encouraged to forward comments and suggestions to AGU, Member Programs Division, 2000 Florida Ave., N.W., Washington, DC 20009.

  16. Functional Centering

    CERN Document Server

    Hahn, M

    1996-01-01

    Based on empirical evidence from a free word order language (German) we propose a fundamental revision of the principles guiding the ordering of discourse entities in the forward-looking centers within the centering model. We claim that grammatical role criteria should be replaced by indicators of the functional information structure of the utterances, i.e., the distinction between context-bound and unbound discourse elements. This claim is backed up by an empirical evaluation of functional centering.

  17. Distribution center

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    Distribution center is a logistics link fulfill physical distribution as its main functionGenerally speaking, it's a large and hiahly automated center destined to receive goods from various plants and suppliers,take orders,fill them efficiently,and deliver goods to customers as quickly as possible.

  18. "5M1E"监督管理初探

    Institute of Scientific and Technical Information of China (English)

    王卫东

    2008-01-01

    @@ 一、影响安全生产的基本因素--"5M1E" "5M1E"是指对安全生产起主要影响作用的人(Man)、机(Machine)、科(Material)、法(Methods)、测(Measurement)、环(Environment)6大因素,简称"5M1E"因素.

  19. The Mysterious Galactic Center Radio Source N3

    Science.gov (United States)

    Ludovici, Dominic; Lang, Cornelia C.; Morris, Mark; Lucien Mutel, Robert; Mills, Elisabeth A. C.; Toomey, James E.; Ott, Juergen

    2016-06-01

    Here we report on new, multi-wavelength radio observations of the mysterious point source "N3" that appears to be located in the vicinity of the Galactic Center. VLA observations between 2 and 50 GHz reveal that N3 is a compact and bright non-thermal source (56 mJy at 10 GHz) which is superimposed upon the non-thermal radio filaments (NTFs) of the Radio Arc. Our highest frequency observations place a strict upper limit of 65x28 milli-arcseconds on the size of this source. We compare our observations to those of Yusef-Zadeh (1987) and Lang (1997) and conclude that N3 is variable over long time scales. Additionally, we present the detection of a compact molecular cloud located adjacent to N3 in projection. CH3CN, CH3OH, CS, HC3N, HNCO, SiO, SO, and NH3 are detected in the cloud and most transitions have FWHM line widths of ~20 km s-1. The rotational temperature determined from the metastable NH3 transitions ranges from 79 K to 183 K depending on the transitions used and the location in the cloud. We present evidence that this molecular cloud is interacting with N3. After exploring the relationship between the NTFs, molecular cloud, and N3, we conclude that N3 likely lies within the Galactic Center. While we are able to rule out many possible physical counterparts, including an active star, HII region, young supernova, AGN, and microquasar, further observations will be required to determine the true nature of this mysterious source.

  20. Senior Centers

    Medline Plus

    Full Text Available ... Karen Albers] We provide a wide variety of activities -- physical, health, mental health programs with Senior Plus, cognitive ... of games. [Narrator] Many senior centers also offer exercise programs. [Karen Albers] We offer aerobics, tai chi, ...

  1. Senior Centers

    Medline Plus

    Full Text Available ... Living independently at home is something many older adults would like to do as long as they can. Senior centers, adult day care, transportation, and meals programs are long- ...

  2. Senior Centers

    Medline Plus

    Full Text Available ... variety of social and recreational activities. [Karen Albers] We provide a wide variety of activities -- physical, health, ... senior centers also offer exercise programs. [Karen Albers] We offer aerobics, tai chi, tap dancing, ballroom dancing, ...

  3. Senior Centers

    Medline Plus

    Full Text Available ... transportation, and meals programs are long-term care services available in the community which make it easier ... about senior centers and other long-term care services available in your community, contact the Eldercare Locator ...

  4. Senior Centers

    Medline Plus

    Full Text Available ... of games. [Narrator] Many senior centers also offer exercise programs. [Karen Albers] We offer aerobics, tai chi, ... chi, tap dancing, ballroom dancing, square dancing, chair exercise, arthritis classes, yoga, and lots of dancing. [Narrator] ...

  5. Data of evolutionary structure change: 1E4WL-1MCEA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E4WL-1MCEA 1E4W 1MCE L A DIQMTQTPSSLSASLGDRVTISCRASQ---DISHYLNWF...DINVKWKIDGSERQNGVLDSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC- PSALTQ-PPSASGSLGQSVTI...ain>A 1MCEA CSSYEGSDNFV EE...263 ALA CA 289 1MCE A 1MCEA...in>A 1MCEA SKQSN-NKYAA -

  6. Data of evolutionary structure change: 1E4XL-1MCEA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E4XL-1MCEA 1E4X 1MCE L A DIQMTQTPSSLSASLGDRVTISCRASQ---DISHYLNWF...DINVKWKIDGSERQNGVLDSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC- PSALTQ-PPSASGSLGQSVTI...hain>A 1MCEA YYCSSYEGSDN E...line> ALA CA 288 1MCE A 1MCEA...onfEVID> 3 1MCE A 1MCEA

  7. Data of evolutionary structure change: 1E6OL-1MCEA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E6OL-1MCEA 1E6O 1MCE L A EIVLTQSPAITAASLGQKVTITCSAS----SSVSYMHWY...DINVKWKIDGSERQNGVLNSWTDQDS-KDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN--- PSALTQ-PPSASGSLGQSVT...82 1MCE A 1MCEA...in> 1MCE A 1MCEA...2 1MCE A 1MCEA

  8. Data of evolutionary structure change: 1CTMA-1E2ZA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CTMA-1E2ZA 1CTM 1E2Z A A YPIFAQQNYENPREATGRIVCANCHLASKPVDIEVPQAV...EEEEEEEE EEEEEEEE - EEEEEEE EEE EEEEEEEEEE 0 1CTM A 1CTMA ILRKE--KGGYE ure>EEEE -- EEEure> ITALSEKKGGFE EEEE EEEure>

  9. Data of evolutionary structure change: 1CTMA-1E2WA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CTMA-1E2WA 1CTM 1E2W A A YPIFAQQNYENPREATGRIVCANCHLASKPVDIEVPQAV...index> 1CTM A 1CTM...A ILRKE--KGGYE ure>EEEE -- EEEure> ITALSEKKGGFE ure>EE EEEure> IEKAN-GEVVV ure>EEE - EEEEure> <

  10. Data of evolutionary structure change: 1CTMA-1E2ZC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available M A 1CTMA IVDASNERQVI ...1CTMA-1E2ZC 1CTM 1E2Z A C YPIFAQQNYENPREATGRIVCANCHLASKPVDIEVPQAV...EEEEEE EEEEEEE - EEEEEEE EEE EEEEEEEEEE 0 1CT...M A 1CTMA KILRK--EKGGY ure>EEEEE-- EEure>

  11. Physicochemical and biological characterization of 1E10 Anti-Idiotype vaccine

    Directory of Open Access Journals (Sweden)

    Machado Yoan J

    2011-11-01

    Full Text Available Abstract Background 1E10 monoclonal antibody is a murine anti-idiotypic antibody that mimics N-glycolyl-GM3 gangliosides. This antibody has been tested as an anti-idiotypic cancer vaccine, adjuvated in Al(OH3, in several clinical trials for melanoma, breast, and lung cancer. During early clinical development this mAb was obtained in vivo from mice ascites fluid. Currently, the production process of 1E10 is being transferred from the in vivo to a bioreactor-based method. Results Here, we present a comprehensive molecular and immunological characterization of 1E10 produced by the two different production processes in order to determine the impact of the manufacturing process in vaccine performance. We observed differences in glycosylation pattern, charge heterogeneity and structural stability between in vivo-produced 1E10 and bioreactor-obtained 1E10. Interestingly, these modifications had no significant impact on the immune responses elicited in two different animal models. Conclusions Changes in 1E10 primary structure like glycosylation; asparagine deamidation and oxidation affected 1E10 structural stability but did not affect the immune response elicited in mice and chickens when compared to 1E10 produced in mice.

  12. Data of evolutionary structure change: 1E43A-2DIEA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E43A-2DIEA 1E43 2DIE A A VNGTLMQYFEWYTPNDGQHWKRLQNDAEHLSDIGITAVW...WTKFDFPGRGNTHSNFKWRWYHFDGTDWDQSRQLQNKIYKFRGTGKAWDWEVDIENGNYDYLMYADIDMDHPEVINELRNWGVWYTNTLNLDGFRIDAVKHIKYSYTR...ine> PHE CA 463 2DIE A 2DIE...613037109375 1 2DIE... A 2DIEA GIPTH---GVPSM

  13. Complete Genome Sequence of a Bovine Viral Diarrhea Virus Subgenotype 1e Strain Isolated in Switzerland

    OpenAIRE

    Stalder, Hanspeter; Schweizer, Matthias; Bachofen, Claudia

    2015-01-01

    We sequenced the complete genome of the bovine viral diarrhea virus (BVDV) strain Carlito. It belongs to the subgenotype 1e that is described in Europe only and represents the second most prevalent subgenotype in Switzerland. This is the first report of a full-length sequence of BVDV-1e.

  14. Broadband X-ray Spectral Investigations of Magnetars, 4U 0142+61, 1E 1841-045, 1E 2259+586, and 1E 1048.1-5937

    CERN Document Server

    Weng, Shan-Shan

    2015-01-01

    We have generated an extended version of rather simplified but physically oriented three-dimensional magnetar emission model, STEMS3D, to allow spectral investigations up to 100 keV. We have then applied it to the broadband spectral spectra of four magnetars: 4U 0142+61, 1E 1841-045, 1E 2259+586 and 1E 1048.1-5937, using data collected with Swift/XRT or XMM-Newton in soft X-rays, and Nuclear Spectroscopic Telescope Array in the hard X-ray band. We found that the hard X-ray emission of 4U 0142+61 was spectrally hard compared to the earlier detections, indicating that the source was likely in a transition to or from a harder state. We find that the surface properties of the four magnetars are consistent with what we have obtained using only the soft X-ray data with STEMS3D, implying that our physically motivated magnetar emission model is a robust tool. Based on our broadband spectral investigations, we conclude that resonant scattering of the surface photons in the magnetosphere alone cannot account for the ha...

  15. Sulfation of fulvestrant by human liver cytosols and recombinant SULT1A1 and SULT1E1

    Directory of Open Access Journals (Sweden)

    Edavana VK

    2011-11-01

    Full Text Available Vineetha Koroth Edavana1, Xinfeng Yu1, Ishwori B Dhakal1, Suzanne Williams1, Baitang Ning2, Ian T Cook3, David Caldwell1, Charles N Falany3, Susan Kadlubar11Division of Medical Genetics, College of Medicine, University of Arkansas for Medical Sciences, Little Rock, AR, USA; 2Division of Personalized Nutrition and Medicine, National Center for Toxicological Research, Food and Drug Administration, Jefferson, AR, USA; 3Department of Pharmacology, University of Alabama, Birmingham, AL, USAAbstract: Fulvestrant (Faslodex™ is a pure antiestrogen that is approved to treat hormone receptor-positive metastatic breast cancer in postmenopausal women. Previous studies have demonstrated that fulvestrant metabolism in humans involves cytochromes P450 and UDP-glucuronosyltransferases (UGTs. To date, fulvestrant sulfation has not been characterized. This study examined fulvestrant sulfation with nine recombinant sulfotransferases and found that only SULT1A1 and SULT1E1 displayed catalytic activity toward this substrate, with Km of 4.2 ± 0.99 and 0.2 ± 0.16 µM, respectively. In vitro assays of 104 human liver cytosols revealed marked individual variability that was highly correlated with β-naphthol sulfation (SULT1A1 diagnostic substrate; r = 0.98, P < 0.0001, but not with 17ß-estradiol sulfation (SULT1E1 diagnostic substrate; r = 0.16, P = 0.10. Fulvestrant sulfation was correlated with both SULT1A1*1/2 genotype (P value = 0.023 and copy number (P < 0.0001. These studies suggest that factors influencing SULT1A1/1E1 tissue expression and/or enzymatic activity could influence the efficacy of fulvestrant therapy.Keywords: fulvestrant, sulfotransferase, genotype, copy number

  16. Senior Centers

    Medline Plus

    Full Text Available ... dancing. [Narrator] These centers can provide entree to new activities and expand a person’s social contacts. [Karen ... meeting all their interests and introducing them to new things; whether it’s an arts and crafts project, ...

  17. Construction of a recombinant adenovirus Vector of human papillomavirus type 16 L1_E7c

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    Human papillomaviruses are closely associated with human cervical cancer, especially HPV types 16 and 18. At present, HPV can not be produced in large quantity; it also has tumorgenicity and these properties of HPV have seriously hampered the development of HPV vaccine. HPV type 16 L1 proteins can assembled into virus-like particles (VLP), which are morphologically identical to the nature virion. In order to develop the recombinant adenovirus vectors of HPV, we constructed a recombinant adenovirus shuttle plasmid pCA14 L1-E7c. Methods: Human papillomavirus type 16 L1 open reading frame without terminator codon (TAA) (5559- 7152) and E7c (682- 855) were amplified using PCR. The L1 and E7c fragments were inserted into pGEM-T easy vectors by T- A strategy, named pTAL1 and pTAE7c. pTAL1 was cut with Hind III and BglII, the pTAE7c with BamHI and ClaI. The L1 DNA fragment, E7c and pBluesscript SK were ligated together using T4 DNA ligase. pBSL1-E7c and pBSL1-E7c was digested with Hind III and Xhol. The L1-E7c fragment was inserted into adenovirus shuttle plasmids pCAl4, named pCAl4L1-E7c. DNA sequence results indicated that The L1-E7c DNA fragment can encode the HPV16L1-E7 fusion protein correctly. Results: The L1 and E7c DNA fragments were amplified by PCR and recombinant plasmid pTAL1, pTAE7c, pBSL1-E7c and pCA14L1-E7c were constructed correctly. The pCAl4L1-E7c can be used in the further research work, cotransfected the 293 cell with the parent adenovirus pBHG10. Conclusion: Our results indicated that we have constructed a HPV16L1-E7 fusion DNA fragments and the adenovirus shuttle plasmids pCALl-E7c for the further research.

  18. The Unusual Galactic Center Radio Source N3

    Science.gov (United States)

    Ludovici, D. A.; Lang, C. C.; Morris, M. R.; Mutel, R.; Mills, E. A. C.; Toomey, J. E., IV; Ott, J.

    2016-08-01

    Here, we report on new multi-wavelength radio observations of the unusual point source “N3” that appears to be located in the vicinity of the Galactic Center (GC). VLA observations between 2 and 50 GHz reveal that N3 is a compact and bright source (56 mJy at 10 GHz) with a non-thermal spectrum superimposed upon the non-thermal radio filaments (NTFs) of the Radio Arc. Our highest frequency observations place a strict upper limit of 65 × 28 mas on the size of N3. We compare our observations to those of Yusef-Zadeh & Morris and Lang et al., and conclude that N3 is variable over long timescales. Additionally, we present the detection of a compact molecular cloud located adjacent to N3 in projection. CH3CN, CH3OH, CS, HC3N, HNCO, SiO, SO, and NH3 are detected in the cloud, and most transitions have FWHM line widths of ˜20 km s‑1. The rotational temperature determined from the metastable NH3 transitions ranges from 79 to 183 k depending on the transitions used. We present evidence that this molecular cloud is interacting with N3. After exploring the relationship between the NTFs, molecular cloud, and N3, we conclude that N3 likely lies within the GC. We are able to rule out the H ii region, young supernova, active star, AGN, and micro-quasar hypotheses for N3. While a micro-blazar may provide a viable explanation for N3, additional observations are needed to determine the physical counterpart of this mysterious source.

  19. IRASM Center

    International Nuclear Information System (INIS)

    IRASM is a national center for radiation processing developed around an industrial Co60 gamma irradiator. Being a department in an R and D national institute, IRASM Center is dealing with radiation treatment, pre/post microbiological control, validation of irradiation sterilization, detection of irradiated foodstuffs. Training is available for operators of new irradiation facilities focused on radiation technologies, dosimetry, sterilization, food treatment, conservation by irradiation of cultural heritage, quality assurance. Expertise on proper choosing the plastics for packaging versus dose is offered to the potential clients. IRASM Center is also involved in interdisciplinary applied research like chitosan treatment, sterile male technique or implementation of irradiation step in production of pharmaceuticals. All important activities: irradiation treatment, dosimetry, microbiology, detection of irradiated food, radioprotection, nuclear safety, physical protection. are performed in accordance with the proper standards in the frame of a certified quality management system. In this way Co60 industrial sources, a byproduct of certain nuclear power plants like Candu type, appear to be the key of a large technical and R and D domain. (authors)

  20. Herschel Observations of a Potential Core Forming Clump: Perseus B1-E

    CERN Document Server

    Sadavoy, S I; Andre, Ph; Pezzuto, S; Bernard, J -P; Bontemps, S; Bressert, E; Chitsazzadeh, S; Fallscheer, C; Hennemann, M; Hill, T; Martin, P; Motte, F; Luong, Q Nguyen; Peretto, N; Reid, M; Schneider, N; Testi, L; White, G J; Wilson, C

    2011-01-01

    We present continuum observations of the Perseus B1-E region from the Herschel Gould Belt Survey. These Herschel data reveal a loose grouping of substructures at 160 - 500 micron not seen in previous submillimetre observations. We measure temperature and column density from these data and select the nine densest and coolest substructures for follow-up spectral line observations with the Green Bank Telescope. We find that the B1-E clump has a mass of ~ 100 solar masses and appears to be gravitationally bound. Furthermore, of the nine substructures examined here, one substructure (B1-E2) appears to be itself bound. The substructures are typically less than a Jeans length from their nearest neighbour and thus, may interact on a timescale of ~ 1 Myr. We propose that B1-E may be forming a first generation of dense cores, which could provide important constraints on the initial conditions of prestellar core formation. Our results suggest that B1-E may be influenced by a strong, localized magnetic field, but further...

  1. Herschel observations of a potential core-forming clump: Perseus B1-E

    Science.gov (United States)

    Sadavoy, S. I.; di Francesco, J.; André, Ph.; Pezzuto, S.; Bernard, J.-P.; Bontemps, S.; Bressert, E.; Chitsazzadeh, S.; Fallscheer, C.; Hennemann, M.; Hill, T.; Martin, P.; Motte, F.; Nguyen Luong, Q.; Peretto, N.; Reid, M.; Schneider, N.; Testi, L.; White, G. J.; Wilson, C.

    2012-04-01

    We present continuum observations of the Perseus B1-E region from the Herschel Gould Belt Survey. These Herschel data reveal a loose grouping of substructures at 160-500 μm not seen in previous submillimetre observations. We measure temperature and column density from these data and select the nine densest and coolest substructures for follow-up spectral line observations with the Green Bank Telescope. We find that the B1-E clump has a mass of ~100 M⊙ and appears to be gravitationally bound. Furthermore, of the nine substructures examined here, one substructure (B1-E2) appears to be itself bound. The substructures are typically less than a Jeans length from their nearest neighbour and thus, may interact on a timescale of ~1 Myr. We propose that B1-E may be forming a first generation of dense cores, which could provide important constraints on the initial conditions of prestellar core formation. Our results suggest that B1-E may be influenced by a strong, localized magnetic field, but further observations are still required.

  2. NuSTAR and XMM-Newton observations of 1e1743.1-2843: indications of a neutron star LMXB nature of the compact object

    DEFF Research Database (Denmark)

    Lotti, Simone; Natalucci, Lorenzo; Mori, Kaya;

    2016-01-01

    We report on the results of NuSTAR and XMM-Newton observations of the persistent X-ray source 1E1743.1-2843, located in the Galactic Center region. The source was observed between 2012 September and October by NuSTAR and XMM-Newton, providing almost simultaneous observations in the hard and soft ...

  3. Exceptional flaring activity of the anomalous X-ray pulsar 1E 1547.0-5408

    CERN Document Server

    Savchenko, V; Beckmann, V; Produit, N; Walter, R

    2009-01-01

    (Abridged) We studied an exceptional period of activity of the anomalous X-ray pulsar 1E 1547.0-5408 in January 2009, during which about 200 bursts were detected by INTEGRAL. The major activity episode happened when the source was outside the field of view of all the INTEGRAL instruments. But we were still able to study the properties of 84 bursts detected simultaneously by the anti-coincidence shield of the spectrometer SPI and by the detector of the imager ISGRI. We find that the luminosity of the 22 January 2009 bursts of 1E 1547.0-5408 was > 1e42 erg/s. This luminosity is comparable to that of the bursts of soft gamma repeaters (SGR) and is at least two orders of magnitude larger than the luminosity of the previously reported bursts from AXPs. Similarly to the SGR bursts, the brightest bursts of 1E 1547.0-5408 consist of a short spike of ~100 ms duration with a hard spectrum, followed by a softer extended tail of 1-10 s duration, which occasionally exhibits pulsations with the source spin period of ~2 s. ...

  4. NuSTAR observations of magnetar 1e 1841-045

    DEFF Research Database (Denmark)

    An, Hongjun; Hascoet, Romain; Kaspi, Victoria M.;

    2013-01-01

    We report new spectral and temporal observations of the magnetar 1E 1841-045 in the Kes 73 supernova remnant obtained with the Nuclear Spectroscopic Telescope Array. Combined with new Swift and archival XMM-Newton and Chandra observations, the phase-averaged spectrum is well characterized by a bl...

  5. NuSTAR Observations of the Magnetar 1E 2259+586

    DEFF Research Database (Denmark)

    Vogel, Julia K.; Hascoet, Romain; Kaspi, Victoria M.;

    2014-01-01

    We report on new broad band spectral and temporal observations of the magnetar 1E 2259+586, which is located in the supernova remnant CTB 109. Our data were obtained simultaneously with the Nuclear Spectroscopic Telescope Array (NuSTAR) and Swift, and cover the energy range from 0.5-79 keV. We pr...

  6. An application study for the class 1E digital control and monitoring system

    International Nuclear Information System (INIS)

    This paper presents an application study for the Class 1E digital control and monitoring system to the next Japanese plants, especially about MMIS. The system architecture of hardware and software is also introduced, which will explain the strategic plan for the necessary software verification and validation according to the latest requirement from Japanese regulatory guide. (author)

  7. Microquasars and ulxs: fossils of grb sources

    Directory of Open Access Journals (Sweden)

    I. F. Mirabel

    2004-01-01

    Full Text Available Las fuentes de destellos gamma de larga duraci on probablemente resultan del colapso de estrellas masivas en sistemas binarios. Despu es del colapso de la estrella primaria el sistema binario puede permanecer ligado gravitacionalmente dejando como remanente un microcu asar o una fuente Ultraluminosa en rayos X (ULX. En este contexto, los microcu asares y las ULXs son f osiles de las fuentes de destellos gamma y contienen claves sobre la f sica y astrof sica de las fuentes de destellos gamma progenitoras. Aqu muestro que la identi caci on del lugar de nacimiento de los microcu asares acota las propiedades de las estrellas progenitoras de objetos compactos, y que la velocidad con que es disparado el microcu asar puede ser usada para acotar la energ a de la explosi on de las estrellas masivas que son progenitoras de estrellas de neutrones y agujeros negros. Las observaciones muestran que los sistemas binarios con estrellas de neutrones LS 5039, LSI +61 303 y el agujero negro de baja masa en GRO J1655-40 se formaron en explosiones energ eticas, mientras que los agujeros negros de masas mayores (M 10 M en Cygnus X-1 y GRS 1915+105 se formaron por colapso directo en oscuridad completa o en supernovas de baja luminosidad. La asociaci on con c umulos de estrellas masivas de las estrellas de neutrones en LSI +61 303 y de los magnetares SGR 1806-20 and SGR 1900+14, sugiere que estrellas muy masivas (M 50 M pueden bajo ciertas circunstancias, terminar como estrellas de neutrones y no como agujeros negros. Lss fuentes de destellos gamma de larga duraci on contienen los mismos ingredientes b asicos que los microcu asares y las ULXs, objetos compactos con discos de acreci on y chorros relativistas en sistemas binarios, y las analogias fenomenol ogicas encontradas entre los microcu asares y N ucleos Activos de Galaxias podr an ser extendidas a las fuentes de destellos gamma.

  8. STUDYING MICROQUASARS AT HIGH-ENERGIES

    Directory of Open Access Journals (Sweden)

    M. Orellana

    2011-01-01

    Full Text Available El estudio de la radiación gamma en fuentes galácticas ha experimentado un progreso radical durante los últimos años gracias a los resultados obtenidos por los telescopios Cherenkov y los aportes de misiones como Fermi. Entre tales fuentes, los sistemas binarios que se han detectado a energías mayores que 100 GeV albergan potentes aceleradores de partículas inmersos en regiones donde pueden operar múltiples procesos no térmicos de emisión y donde la propagación de los fotones energéticos da lugar al desarrollo de cascadas electromagnéticas. A su vez, desde un punto de vista hidrodinámico, también muestran un comportamiento fascinante, y cuya descripción aún no hemos alcanzado. Este tipo de ambiente, con condiciones regularmente variables, provee un excelente laboratorio de comparación para el desarrollo de modelos teóricos. Como último resultado de la combinación entre la acreción y la eyección de materia sobre un objeto compacto, los microcuasares, binarias de rayos X con radio jets, se manifiestan a lo largo de todo el espectro electromagnético. Esta charla presenta una breve puesta al día sobre nuestro conocimiento de estos sistemas, con énfasis en su emisión a muy altas energías.

  9. SS433: The microquasar link with ulxs?

    Directory of Open Access Journals (Sweden)

    P. A. Charles

    2004-01-01

    Full Text Available SS433 es el microcuasar prototipo de la Galaxia y posiblemente incluso an alogo a las fuentes ULX si se tiene en cuenta la energ a cin etica de los \\jets". Sin embargo y a pesar de 20 a~nos de estudio, nuestras restricciones sobre la naturaleza del sistema binario son extremadamente grandes debido a la di cultad de localizar rasgos espectrales capaces de revelar la naturaleza y el movimiento del donador de la masa. Los espectros azules de alta resoluci on recientemente obtenidos cuando el disco (en precesi on se encuentra de per l, sugieren que la binaria se halla cerca de la fase de envolvente com un, lo cual hace extremadamente dif cil obtener las restricciones cin eticas. Sin embargo, encontramos evidencia de un donador masivo como era de esperar para la muy alta tasa de transferencia de masa inferida y comparamos las propiedades de SS433 con las de Cyg X3.

  10. Observations of microquasars with the MAGIC telescope

    CERN Document Server

    Rico, J; Bordas, P; Bosch-Ramon, V; Cortina, J; Paredes, J M; Ribó, M; Torres, D F; Zanin, R

    2007-01-01

    We report on the results from the observations in very high energy band (VHE, E_gamma > 100GeV) of the black hole X-ray binary (BHXB) Cygnus X-1. The observations were performed with the MAGIC telescope, for a total of 40 hours during 26 nights, spanning the period between June and November 2006. We report on the results of the searches for steady and variable gamma-ray signals, including the first experimental evidence for an intense flare, of duration between 1.5 and 24 hours.

  11. Suzaku Studies of the Supernova Remnant CTB~109 Hosting the Magnetar 1E~2259+586

    CERN Document Server

    Nakano, Toshio; Hiraga, Junoko S; Uchiyama, Hideki; Kaneda, Hidehiro; Enoto, Teruaki

    2015-01-01

    Ages of the magnetar 1E 2259+586 and the associated supernova remnant CTB~109 were studied. Analyzing the Suzaku data of CTB~109, its age was estimated to be $\\sim$14~kyr, which is much shorter than the measured characteristic age of 1E 2259+586, 230 kyr. This reconfirms the previously reported age discrepancy of this magnetar/remnant association, and suggests that the characteristic ages of magnetars are generally over-estimated as compared to their true ages. This discrepancy is thought to arise because the former are calculated without considering decay of the magnetic fields. This novel view is supported independently by much stronger Galactic-plane concentration of magnetars than other pulsars. The process of magnetic field decay in magnetars is mathematically modeled. It is implied that magnetars are much younger objects than previously considered, and can dominate new-born neutron stars.

  12. "5M1E"法在生产管理中的运用

    Institute of Scientific and Technical Information of China (English)

    刘秋香

    2010-01-01

    人(man)、机械(machine)、材料(material)、方法(method)、环境(enviroment)、管理(manage)这几个主要环节实行全面质量管理,称为"5M1E"法.在生产管理中应用该法,可以达到提升人品质、提升产品品质,提高员工士气.

  13. Evidence for the magnetar nature of 1E 161348-5055 in RCW 103

    Science.gov (United States)

    D'Aì, A.; Evans, P. A.; Burrows, D. N.; Kuin, N. P. M.; Kann, D. A.; Campana, S.; Maselli, A.; Romano, P.; Cusumano, G.; La Parola, V.; Barthelmy, S. D.; Beardmore, A. P.; Cenko, S. B.; De Pasquale, M.; Gehrels, N.; Greiner, J.; Kennea, J. A.; Klose, S.; Melandri, A.; Nousek, J. A.; Osborne, J. P.; Palmer, D. M.; Sbarufatti, B.; Schady, P.; Siegel, M. H.; Tagliaferri, G.; Yates, R.; Zane, S.

    2016-08-01

    We report on the detection of a bright, short, structured X-ray burst coming from the supernova remnant RCW 103 on 2016 June 22 caught by the Swift/BAT monitor, and on the follow-up campaign made with Swift/XRT, Swift/UVOT and the optical/NIR GROND detector. The characteristics of this flash, such as duration and spectral shape, are consistent with typical short bursts observed from soft gamma repeaters. The BAT error circle at 68% confidence range encloses the point-like X-ray source at the centre of the nebula, 1E 161348-5055. Its nature has been long debated due to a periodicity of 6.67 hr in X-rays, which could indicate either an extremely slow pulsating neutron star, or the orbital period of a very compact X-ray binary system. We found that 20 minutes before the BAT trigger, the soft X-ray emission of 1E 161348-5055 was a factor of ˜ 100 higher than measured two years earlier, indicating that an outburst had already started. By comparing the spectral and timing characteristics of the source in the two years before the outburst and after the BAT event, we find that, besides a change in luminosity and spectral shape, also the 6.67 hr pulsed profile has significantly changed with a clear phase shift with respect to its low-flux profile. The UV/optical/NIR observations did not reveal any counterpart at the position of 1E 161348-5055. Based on these findings, we associate the BAT burst with 1E 161348-5055, we classify it as a magnetar, and pinpoint the 6.67 hr periodicity as the magnetar spin period.

  14. Phenotypic diversity of toxigenic Vibrio cholerae O1 E1 Tor strains identified in China

    Institute of Scientific and Technical Information of China (English)

    赵璇

    2014-01-01

    Objective To understand the phenotypic diversity of toxigenic Vibrio cholerae O1 E1 Tor strains isolated from different provinces in China during the last 50 years.Methods Traditional biotyping testings including susceptibility to polymyxin B,sensitivity to groupⅣphage,Voges-Proskauer test and haemolysis of sheep erythrocytes were conducted.Results Data from Biotype-specific phenotype analysis revealed that only 133 isolates carried the typical E1 Tor phenotypes while the other 251

  15. Neutronic analysis of the 1D and 1E banks reflux detection system

    Energy Technology Data Exchange (ETDEWEB)

    Blanchard, A.

    1999-12-21

    Two H Canyon neutron monitoring systems for early detection of postulated abnormal reflux conditions in the Second Uranium Cycle 1E and 1D Mixer-Settle Banks have been designed and built. Monte Carlo neutron transport simulations using the general purpose, general geometry, n-particle MCNP code have been performed to model expected response of the monitoring systems to varying conditions.The confirmatory studies documented herein conclude that the 1E and 1D neutron monitoring systems are able to achieve adequate neutron count rates for various neutron source and detector configurations, thereby eliminating excessive integration count time. Neutron count rate sensitivity studies are also performed. Conversely, the transport studies concluded that the neutron count rates are statistically insensitive to nitric acid content in the aqueous region and to the transition region length. These studies conclude that the 1E and 1D neutron monitoring systems are able to predict the postulated reflux conditions for all examined perturbations in the neutron source and detector configurations. In the cases examined, the relative change in the neutron count rates due to postulated transitions from normal {sup 235}U concentration levels to reflux levels remain satisfactory detectable.

  16. PRELIMINARY STUDY OF A NOVEL HUMAN PAPILLOMAVIRUS TYPE 16 L1/E6-E7 CHIMERIC RECOMBINANT DNA VACCINE

    Institute of Scientific and Technical Information of China (English)

    郑瑾; 马军; 张福萍; 杨筱凤; 董小平; 司履生; 王一理

    2004-01-01

    Objective Preparations of HPV16 L1/E6 and L1/E7 prophylactic and therapeutic DNA vaccines. Methods The nucleotides within HPV16 E6 and E7 genes, which are responsible for viral transforming activity, were mutated by mage primer site-directed mutagenesis method. The correctly mutated E6 and E7 fragments were separately cloned into an eukaryotic expression vector pVAX1, together with HPV16 L1 gene, generating chimeric recombinants plasmids 1MpVAX1-L1E6, 2MpVAX1-L1E6, 1MpVAX1-L1E7, 2MpVAX1-L1E7 and 3MpVAX1-L1E7. CHO cells were transiently transfected with the individual DNA vaccines by calcium phosphate method. Target protein expressions in the extracts of the transfected cell lines were measured by ELISA and immunohistochemistry, with HPV16 L1 and E6 specific monoclonal antibodies. Results ELISA assays showed the P/N ratios in the cell extracts transfected with L1E6 and L1E7 plasmids were more than 2.1. Immunohistochemistry revealed brownish precipitant signal in cytoplasm and nuclei of the transfected cells. Conclusion Successful constructions of prophylactic and therapeutic DNA vaccine plasmids lay solid foundation for future animal experiment and clinical trial.

  17. Analysis of trapped gas in 1E34 detonators by gas chromatography

    Energy Technology Data Exchange (ETDEWEB)

    Warner, D.K.; Back, P.S.; Barnhart, B.V.

    1980-05-14

    A method was developed to extract and then analyze gas trapped in thermally aged 1E34 detonators. This gas was extracted into an evacuated volume and injected into a gas chromatograph for separation and quantitative analysis. To effect this gas extraction, a device was designed for puncturing the detonator cup and capturing the effused gas. Limited testing of five detonators in this device shows amounts of gas ranging from about 0.5 X 10 {sup -7} to 12 X 10 {sup - 7} moles.

  18. Pulsed high-energy gamma-radiation from Geminga (1E0630 + 178)

    Science.gov (United States)

    Bertsch, D. L.; Brazier, K. T. S.; Fichtel, C. E.; Hartman, R. C.; Hunter, S. D.; Kanbach, G.; Kniffen, D. A.; Kwok, P. W.; Lin, Y. C.; Mattox, J. R.

    1992-01-01

    The detection of pulsed gamma rays with energy above 50 MeV from the soft X-ray source 1E0630 + 178 is reported, confirming the identification of Geminga with this X-ray source. The period derivative (11.4 +/- 1.7) x 10 exp -15 s/s suggests that Geminga is a nearby isolated rotating neutron star with a magnetic field of 1.6 x 10 exp 12 gauss, a characteristic age of 300,000 yr, and a spin-down energy loss rate of 3.5 x 10 exp 34 erg/s.

  19. Call Center ist nicht gleich Call Center

    OpenAIRE

    Baumgartner, Marc; Udris, Ivars

    2005-01-01

    Untersuchungen in 14 Schweizer Call Centers erbrachten vier Call Center-Typen, die sich hinsichtlich Arbeitstätigkeiten und Kommunikationsrichtung voneinander unterscheiden: (a) Beratungs- und Beschwerdemanagement, (b) Informationsmanagement, (c) Auftragsmanagement und (d) Kunden- und Kampagnenmanagement. Dies hat auch Auswirkungen auf die Personalstruktur, -selektion und -entwicklung der Call Center. Es wird der Frage nachgegangen, welche Kompetenzanforderungen in den unterschiedlichen Call ...

  20. Mutagenic Potential ofBos taurus Papillomavirus Type 1 E6 Recombinant Protein: First Description

    Directory of Open Access Journals (Sweden)

    Rodrigo Pinheiro Araldi

    2015-01-01

    Full Text Available Bovine papillomavirus (BPV is considered a useful model to study HPV oncogenic process. BPV interacts with the host chromatin, resulting in DNA damage, which is attributed to E5, E6, and E7 viral oncoproteins activity. However, the oncogenic mechanisms of BPV E6 oncoprotein per se remain unknown. This study aimed to evaluate the mutagenic potential of Bos taurus papillomavirus type 1 (BPV-1 E6 recombinant oncoprotein by the cytokinesis-block micronucleus assay (CBMNA and comet assay (CA. Peripheral blood samples of five calves were collected. Samples were subjected to molecular diagnosis, which did not reveal presence of BPV sequences. Samples were treated with 1 μg/mL of BPV-1 E6 oncoprotein and 50 μg/mL of cyclophosphamide (positive control. Negative controls were not submitted to any treatment. The samples were submitted to the CBMNA and CA. The results showed that BPV E6 oncoprotein induces clastogenesis per se, which is indicative of genomic instability. These results allowed better understanding the mechanism of cancer promotion associated with the BPV E6 oncoprotein and revealed that this oncoprotein can induce carcinogenesis per se. E6 recombinant oncoprotein has been suggested as a possible vaccine candidate. Results pointed out that BPV E6 recombinant oncoprotein modifications are required to use it as vaccine.

  1. SNR 1E0102.2-7219 after Six Years with Chandra

    Science.gov (United States)

    Rutkowski, M. J.; Schlegel, E. M.; Keohane, J.

    2005-12-01

    We present Chandra X-ray Observatory archived observations of the supernova remnant 1E0102.2-7219 in the Small Magellanic Cloud. Combining 22 ACIS-I observations for 230 ks of total exposure time, we present ACIS images with an unprecedented signal to noise ratio for this remnant. We present three upper limits on the X-ray flux for the remnant's elusive central compact object, which are consistent with current neutron star cooling models, based on a Cas A-like blackbody spectrum. Additionally, we discuss the elliptical structure of the remnant and the relative positions of the blast wave, the reverse shock, and the extent of 1E0102.2-7219's rim. This research was supported by the NSF REU Program at SAO under Eric Schlegel, whose research was supported by contract number NAS8-39073 from NASA to SAO for operation of the Chandra X-Ray Observatory. Jonathan Keohane's research was supported by Chandra award GO3-4070C.

  2. Proposal to Search for Magnetically Charged Particles with Magnetic Charge 1e

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, Michael K. [SLAC National Accelerator Lab., Menlo Park, CA (United States); Fryberger, David [SLAC National Accelerator Lab., Menlo Park, CA (United States)

    2015-11-02

    A model for composite elementary Standard Model (SM) particles based upon magnetically bound vorton pairs, we briefly introduce here, predicts the existence of a complete family of magnetically charged particles, as well as their neutral isotopic partners (all counterparts to the SM elementary particles), in which the lowest mass (charged) particle would be an electrically neutral stable lepton, but which carries a magnetic charge equivalent to 1e. This new particle, which we call a magneticon (a counterpart to the electron) would be pair produced at all e+e- colliders at an Ecm above twice its mass. In addition, PP and PPbar colliders should also be able to produce these new particles through the Drell-Yan process. To our knowledge, no monopole search experiment has been sensitive to such a low-charged magnetic monopole above a particle mass of about 5 GeV/c2. Hence, we propose that a search for such a stable particle of magnetic charge 1e should be undertaken. We have taken the ATLAS detector at the LHC as an example in which this search might be done. To this end, we modeled the magnetic fields and muon trigger chambers of this detector. We show results from a simple Monte Carlo simulation program to indicate how these particles might look in the detector and describe how one might search for these new particles in the ATLAS data stream.

  3. Evidence for the magnetar nature of 1E 161348-5055 in RCW 103

    CERN Document Server

    D'Aì, A; Burrows, D N; Lien, A Y; Kann, D A; Campana, S; Maselli, A; Romano, P; Cusumano, G; La Parola, V; Beardmore, A P; Cenko, B; De Pasquale, M; Gehrels, N; Greiner, J; Kennea, J A; Klose, S; Melandri, A; Nousek, J A; Osborne, J P; Sbarufatti, B; Siegel, M H; Schady, P; Tagliaferri, G; Yates, R; Zane, S

    2016-01-01

    We report on the detection of a bright, short, hard X-ray burst coming from the supernova remnant RCW 103 on 2016 June 22 caught by the \\emph{Swift}/BAT monitor, and on a follow-up campaign made with \\emph{Swift}/XRT and the optical/NIR GROND detector. The characteristics of the flash, such as duration and spectral shape, are consistent with typical bursts observed from soft gamma repeaters. The BAT error circle at 68\\% confidence range encloses the point-like X-ray source at the centre of the nebula, 1E 161348-5055. Its nature has been long debated because of a periodicity of 6.67 hr in X-rays, that could indicate either an extremely slow pulsating neutron star, or an orbital period of a very compact X-ray binary system. We found that the soft X-ray emission of 1E 161348-5055, 20 minutes earlier than the BAT detected burst, was already a factor $\\sim$ 100 higher with respect to the past two years, indicating that an outburst had started. By comparing the spectral and timing characteristics of the source in t...

  4. The anti-glitch of magnetar 1E 2259+586 in the wind braking scenario

    Energy Technology Data Exchange (ETDEWEB)

    Tong, H., E-mail: tonghao@xao.ac.cn [Xinjiang Astronomical Observatory, Chinese Academy of Sciences, Urumqi, Xinjiang (China)

    2014-04-01

    The anti-glitch of magnetar 1E 2259+586 is analyzed theoretically. An enhanced particle wind during the observational interval takes away additional rotational energy of the neutron star, which will result in a net spin-down of the magnetar, i.e., an anti-glitch. In the wind braking scenario of the anti-glitch, there are several predictions: (1) a radiative event will always accompany the anti-glitch, (2) there will be a decrease/variation of the braking index after the anti-glitch, and (3) the anti-glitch is just a period of enhanced spin-down. If there are enough timing observations, a period of enhanced spin-down is expected instead of an anti-glitch. Applications to previous timing events of SGR 1900+14 and PSR J1846–0258 are also included. It is shown that current timing events of 1E 2259+586, SGR 1900+14, and PSR J1846–0258 can be understood safely in the wind braking model. The enhanced spin-down and absence of an anti-glitch before the giant flare of SGR 1806–20 is consistent with the wind braking scenario.

  5. The speed of the `bullet' in the merging galaxy cluster 1E0657-56

    CERN Document Server

    Springel, V; Springel, Volker; Farrar, Glennys

    2007-01-01

    Deep Chandra exposures of the hot galaxy cluster 1E0657-56 have revealed that the cluster is observed shortly after the first core-passage of a massive infalling subcluster, which is preceded by a prominent bow shock with Mach number M~3. The inferred shock velocity of ~4700 km/s has been commonly interpreted as the velocity of the `bullet' subcluster itself. This velocity is unexpectedly high in the LCDM cosmology, which may require non-trivial modifications in the dark sector to be accommodated if taken at face value. Here we present explicit hydrodynamical toy models of galaxy cluster mergers which very well reproduce the observed dynamical state of 1E0657-56 and the mass models inferred from gravitational lensing observations. However, despite a shock speed of 4500 km/s, the subcluster's mass centroid is moving only with 2600 km/s in the rest frame of the system. The difference arises in part due to a gravitationally induced inflow velocity of the gas ahead of the shock, which amounts to ~1100 km/s for ou...

  6. Children's cancer centers

    Science.gov (United States)

    Pediatric cancer center; Pediatric oncology center; Comprehensive cancer center ... Treating childhood cancer is not the same as treating adult cancer. The cancers are different. So are the treatments and the ...

  7. Womens Business Center

    Data.gov (United States)

    Small Business Administration — Women's Business Centers (WBCs) represent a national network of nearly 100 educational centers throughout the United States and its territories, which are designed...

  8. Automation of The Guiding Center Expansion

    CERN Document Server

    Burby, J W; Qin, H

    2013-01-01

    We report on the use of the recently-developed Mathematica package \\emph{VEST} (Vector Einstein Summation Tools) to automatically derive the guiding center transformation. Our Mathematica code employs a recursive procedure to derive the transformation order-by-order. This procedure has several novel features. (1) It is designed to allow the user to easily explore the guiding center transformation's numerous non-unique forms or representations. (2) The procedure proceeds entirely in cartesian position and velocity coordinates, thereby producing manifestly gyrogauge invariant results; the commonly-used perpendicular unit vector fields $e_1,e_2$ are never even introduced. (3) It is easy to apply in the derivation of higher-order contributions to the guiding center transformation without fear of human error. Our code therefore stands as a useful tool for exploring subtle issues related to the physics of toroidal momentum conservation in tokamaks.

  9. Robinson-Schensted-Knuth Correspondence and Weak Polynomial Identities of M1,1(E)

    Institute of Scientific and Technical Information of China (English)

    Onofrio Mario Di Vincenzo; Roberto La Scala

    2005-01-01

    In this paper, it is proved that the ideal Iω of the weak polynomial identities of the superalgebra M1,1(E) is generated by the p roper polynomials [x1,x2, x3] and [x2,x1][xa,x1][x4, x1]. This is proved for any infinite field F of characteristic different a basis and the dimension of any multihomogeneous component of the quotient algebra B/(B ∩ Iw). We also compute the Hilbert series of this algebra. One of the main tools of this paper is a variant we found of the Robinson-Schensted-Knuth correspondence defined for single semistandard tableaux of double shape.

  10. E1, M1, E2 transition energies and probabilities of W$^{54+}$ ions

    CERN Document Server

    Ding, Xiao-bin; Liu, Jia-xin; Koike, Fumihiro; Murakami, Izumi; Kato, Daiji; Sakaue, Hiroyuki A; Nakamura, Nobuyuki; Dong, Chen-zhong

    2016-01-01

    A comprehensive theoretical study of the E1, M1, E2 transitions of Ca-like tungsten ions is presented. Using multi-configuration Dirac-Fock (MCDF) method with a restricted active space treatment, the wavelengths and probabilities of the M1 and E2 transitions between the multiplets of the ground state configuration ([Ne]3s$^{2}$3p$^{6}$3d$^{2}$) and of the E1 transitions between [Ne]3s$^{2}$3p$^{5}$3d$^{3}$ and [Ne]3s$^{2}$3p$^{6}$3d$^{2}$ have been calculated. The results are in reasonable agreement with available experimental data. The present E1 and M1 calculations are compared with previous theoretical values. For E2 transitions, the importance of electron correlation from 3s and 3p orbitals is pointed out. Several strong E1 transitions are predicted, which have potential advantage for plasma diagnostics.

  11. Deep NuSTAR and Swift monitoring observations of the magnetar 1E 1841-045

    DEFF Research Database (Denmark)

    An, Hongjun; Archibald, Robert F.; Hascoët, Romain;

    2015-01-01

    We report on a 350 ks NuSTAR observation of the magnetar 1E 1841-045 taken in 2013 September. During the observation, NuSTAR detected six bursts of short duration, with T90 ≲ 1 s. An elevated level of emission tail is detected after the brightest burst, persisting for ~1 ks. The emission showed...... and magnetic dipole axes of the magnetar αmag the twisted magnetic flux, 2.5 × 1026 G cm2, and the power released in the twisted magnetosphere, = 6 × 1036 erg s-1. Assuming this model for the hard-X-ray spectrum, the soft-X-ray component is well fit by a two-black body model, with the hotter blackbody...

  12. 1E 1740.7-2942 (the Great Annihilator) enters a low-intensity state

    NARCIS (Netherlands)

    E. Kuulkers; C. Ferrigno; M. Del Santo; A. Bazzano; J. Alfonso-Garzon; V. Beckmann; A.J. Bird; S. Brandt; J. Chenevez; T.J.L. Courvoisier; A. Domingo; K. Ebisawa; P.G. Jonker; P. Kretschmar; C.B. Markwardt; T. Oosterbroek; A. Paizis; K. Pottschmidt; C. Sanchez-Fernandez; R. Wijnands

    2012-01-01

    INTEGRAL has been monitoring the Galactic center region since the beginning of August 2012 during the Galactic bulge (GB) monitoring program (see ATel #438), the Target of Opportunity observations of Swift J174510.8-262411 (see ATel #4450), as well as during other observing programs. During the GB m

  13. Toward Selective Drug Development for the Human 5-Hydroxytryptamine 1E Receptor: A Comparison of 5-Hydroxytryptamine 1E and 1F Receptor Structure-Affinity RelationshipsS⃞

    OpenAIRE

    Klein, Michael T.; Dukat, Małgorzata; Glennon, Richard A.; Teitler, Milt

    2011-01-01

    The 5-hydroxytryptamine (5-HT) 1E receptor is highly expressed in the human frontal cortex and hippocampus, and this distribution suggests the function of 5-HT1E receptors might be linked to memory. To test this hypothesis, behavioral experiments are needed. Because rats and mice lack a 5-HT1E receptor gene, knockout strategies cannot be used to elucidate this receptor's functions. Thus, selective pharmacological tools must be developed. The tryptamine-related agonist BRL54443 [5-hydroxy-3-(1...

  14. Human Papillomavirus Type 1 E1^E4 Protein Is a Potent Inhibitor of the Serine-Arginine (SR) Protein Kinase SRPK1 and Inhibits Phosphorylation of Host SR Proteins and of the Viral Transcription and Replication Regulator E2

    OpenAIRE

    Prescott, Emma L.; Brimacombe, Claire L.; Hartley, Margaret; Bell, Ian; Graham, Sheila; Roberts, Sally

    2014-01-01

    The serine-arginine-specific protein kinase SRPK1 is a common binding partner of the E1^E4 protein of diverse human papillomavirus types. We show here for the first time that the interaction between HPV1 E1^E4 and SRPK1 leads to potent inhibition of SRPK1 phosphorylation of host serine-arginine (SR) proteins that have critical roles in mRNA metabolism, including pre-mRNA processing, mRNA export, and translation. Furthermore, we show that SRPK1 phosphorylates serine residues of SR/RS dipeptide...

  15. Student Success Center Toolkit

    Science.gov (United States)

    Jobs For the Future, 2014

    2014-01-01

    "Student Success Center Toolkit" is a compilation of materials organized to assist Student Success Center directors as they staff, launch, operate, and sustain Centers. The toolkit features materials created and used by existing Centers, such as staffing and budgeting templates, launch materials, sample meeting agendas, and fundraising…

  16. Cryoelectron Microscopic Structures of Eukaryotic Translation Termination Complexes Containing eRF1-eRF3 or eRF1-ABCE1

    Directory of Open Access Journals (Sweden)

    Anne Preis

    2014-07-01

    Full Text Available Termination and ribosome recycling are essential processes in translation. In eukaryotes, a stop codon in the ribosomal A site is decoded by a ternary complex consisting of release factors eRF1 and guanosine triphosphate (GTP-bound eRF3. After GTP hydrolysis, eRF3 dissociates, and ABCE1 can bind to eRF1-loaded ribosomes to stimulate peptide release and ribosomal subunit dissociation. Here, we present cryoelectron microscopic (cryo-EM structures of a pretermination complex containing eRF1-eRF3 and a termination/prerecycling complex containing eRF1-ABCE1. eRF1 undergoes drastic conformational changes: its central domain harboring the catalytically important GGQ loop is either packed against eRF3 or swung toward the peptidyl transferase center when bound to ABCE1. Additionally, in complex with eRF3, the N-terminal domain of eRF1 positions the conserved NIKS motif proximal to the stop codon, supporting its suggested role in decoding, yet it appears to be delocalized in the presence of ABCE1. These results suggest that stop codon decoding and peptide release can be uncoupled during termination.

  17. NACA Aircraft on Lakebed - D-558-2, X-1B, and X-1E

    Science.gov (United States)

    1955-01-01

    Early NACA research aircraft on the lakebed at the High Speed Research Station in 1955: Left to right: X-1E, D-558-2, X-1B There were four versions of the original Bell X-1 rocket-powered research aircraft that flew at the NACA High-Speed Flight Research Station, Edwards, California. The bullet-shaped X-1 aircraft were built by Bell Aircraft Corporation, Buffalo, N.Y. for the U.S. Army Air Forces (after 1947, U.S. Air Force) and the National Advisory Committee for Aeronautics (NACA). The X-1 Program was originally designated the XS-1 for EXperimental Supersonic. The X-1's mission was to investigate the transonic speed range (speeds from just below to just above the speed of sound) and, if possible, to break the 'sound barrier.' Three different X-1s were built and designated: X-1-1, X-1-2 (later modified to become the X-1E), and X-1-3. The basic X-1 aircraft were flown by a large number of different pilots from 1946 to 1951. The X-1 Program not only proved that humans could go beyond the speed of sound, it reinforced the understanding that technological barriers could be overcome. The X-1s pioneered many structural and aerodynamic advances including extremely thin, yet extremely strong wing sections; supersonic fuselage configurations; control system requirements; powerplant compatibility; and cockpit environments. The X-1 aircraft were the first transonic-capable aircraft to use an all-moving stabilizer. The flights of the X-1s opened up a new era in aviation. The first X-1 was air-launched unpowered from a Boeing B-29 Superfortress on January 25, 1946. Powered flights began in December 1946. On October 14, 1947, the X-1-1, piloted by Air Force Captain Charles 'Chuck' Yeager, became the first aircraft to exceed the speed of sound, reaching about 700 miles per hour (Mach 1.06) and an altitude of 43,000 feet. The number 2 X-1 was modified and redesignated the X-1E. The modifications included adding a conventional canopy, an ejection seat, a low-pressure fuel system

  18. NuSTAR and XMM-Newton Observations of 1E1743.1-2843: Indications of a Neutron Star LMXB Nature of the Compact Object

    Science.gov (United States)

    Lotti, Simone; Natalucci, Lorenzo; Mori, Kaya; Baganoff, Frederick K.; Boggs, Steven E.; Christensen, Finn E.; Craig, William W.; Hailey, Charles J.; Harrison, Fiona A.; Hong, Jaesub; Krivonos, Roman A.; Rahoui, Farid; Stern, Daniel; Tomsick, John A.; Zhang, Shuo; Zhang, William W.

    2016-05-01

    We report on the results of NuSTAR and XMM-Newton observations of the persistent X-ray source 1E1743.1-2843, located in the Galactic Center region. The source was observed between 2012 September and October by NuSTAR and XMM-Newton, providing almost simultaneous observations in the hard and soft X-ray bands. The high X-ray luminosity points to the presence of an accreting compact object. We analyze the possibilities of this accreting compact object being either a neutron star (NS) or a black hole, and conclude that the joint XMM-Newton and NuSTAR spectrum from 0.3 to 40 keV fits a blackbody spectrum with {kT}˜ 1.8 {keV} emitted from a hot spot or an equatorial strip on an NS surface. This spectrum is thermally Comptonized by electrons with {{kT}}e˜ 4.6 {keV}. Accepting this NS hypothesis, we probe the low-mass X-ray binary (LMXB) or high-mass X-ray binary (HMXB) nature of the source. While the lack of Type-I bursts can be explained in the LMXB scenario, the absence of pulsations in the 2 mHz-49 Hz frequency range, the lack of eclipses and of an IR companion, and the lack of a {K}α line from neutral or moderately ionized iron strongly disfavor interpreting this source as a HMXB. We therefore conclude that 1E1743.1-2843 is most likely an NS-LMXB located beyond the Galactic Center. There is weak statistical evidence for a soft X-ray excess which may indicate thermal emission from an accretion disk. However, the disk normalization remains unconstrained due to the high hydrogen column density ({N}{{H}}˜ 1.6× {10}23 {{cm}}-2).

  19. A1E reduces stemness and self-renewal in HPV 16-positive cervical cancer stem cells

    OpenAIRE

    Kwon, Taeho; Bak, Yesol; Ham, Sun-Young; Yu, Dae-Yeul; Yoon, Do-Young

    2016-01-01

    Background Cervical cancer is the second most common cancer in females. Recent reports have revealed the critical role of cervical cancer stem cells (CSCs) in tumorigenicity and metastasis. Previously we demonstrated that A1E exerts an anti-proliferative action, which inhibits the growth of cervical cancer cells. Methods A1E is composed of 11 oriental medicinal herbs. Cervical cancer cell culture, wund healing and invasion assay, flow cytometry, sheroid formation assay, and wstern blot assays...

  20. SPAK and OSR1 Sensitive Cell Membrane Protein Abundance and Activity of KCNQ1/E1 K+ Channels

    Directory of Open Access Journals (Sweden)

    Bernat Elvira

    2015-11-01

    Full Text Available Background/Aims: KCNQ1/E1 channels are expressed in diverse tissues and serve a variety of functions including endolymph secretion in the inner ear, cardiac repolarization, epithelial transport and cell volume regulation. Kinases involved in regulation of epithelial transport and cell volume include SPAK (SPS1-related proline/alanine-rich kinase and OSR1 (oxidative stress-responsive kinase 1, which are under control of WNK (with-no-K[Lys] kinases. The present study explored whether KCNQ1/E1 channels are regulated by SPAK and/or OSR1. Methods: cRNA encoding KCNQ1/E1 was injected into Xenopus oocytes with or without additional injection of cRNA encoding wild-type SPAK, constitutively active T233ESPAK, WNK insensitive T233ASPAK, catalytically inactive D212ASPAK, wild-type OSR1, constitutively active T185EOSR1, WNK insensitive T185AOSR1 and catalytically inactive D164AOSR1. Voltage gated K+ channel activity was quantified utilizing dual electrode voltage clamp and KCNQ1/E1 channel protein abundance in the cell membrane utilizing chemiluminescence of KCNQ1/E1 containing an extracellular Flag tag epitope (KCNQ1-Flag/E1. Results: KCNQ1/E1 activity and KCNQ1-Flag/E1 protein abundance were significantly enhanced by wild-type SPAK and T233ESPAK, but not by T233ASPAK and D212ASPAK. Similarly, KCNQ1/E1 activity and KCNQ1-Flag/E1 protein abundance were significantly increased by wild-type OSR1 and T185EOSR1, but not by T185AOSR1 and D164AOSR1. Conclusions: SPAK and OSR1 participate in the regulation of KCNQ1/E1 protein abundance and activity.

  1. Cosmology based on $f(R)$ gravity with ${\\cal O}(1)$ eV sterile neutrino

    CERN Document Server

    Chudaykin, A S; Starobinsky, A A; Burenin, R A

    2015-01-01

    We address the cosmological role of ${\\cal O}(1)$ eV sterile neutrino in modified gravity models. We confront the present cosmological data with the predictions of FLRW cosmological model based on a variant of $f(R)$ modified gravity proposed by one of the authors previously. This viable cosmological model which deviation from general relativity with an induced effective cosmological constant decreases as $R^{-2n}$ for large, but not too large values of the Ricci scalar $R$ provides an alternative to the bare cosmological constant explanation of the present dark energy and accelerated expansion of the Universe ($n=2$ is adopted). We used various up-to-date cosmological data sets including Planck CMB anisotropy, CMB lensing potential, BAO, cluster mass function and Hubble constant measurements. Using the low-z measurements of linear perturbation amplitude from galaxy cluster mass function data we find that sum of neutrino masses constrained by CMB+BAO data is not sufficient to compensate for the extra linear p...

  2. Ghosts of Milky Way's past: the globular cluster ESO 37-1 (E 3)

    CERN Document Server

    Marcos, R de la Fuente; Bidin, C Moni; Ortolani, S; Carraro, G

    2015-01-01

    Context. In the Milky Way, most globular clusters are highly conspicuous objects that were found centuries ago. However, a few dozen of them are faint, sparsely populated systems identified largely during the second half of the past century. One of the faintest is ESO 37-1 (E 3) and as such it remains poorly studied, with no spectroscopic observations published so far, although it was discovered in 1976. Aims. We investigate the globular cluster E 3 in an attempt to better constrain its fundamental parameters. Spectroscopy of stars in the field of E 3 is shown here for the first time. Methods. Deep, precise VI CCD photometry of E 3 down to V=26 mag is presented and analyzed. Low resolution, medium signal-to-noise ratio spectra of 9 candidate members are studied to derive radial velocity and metallicity. Proper motions from the UCAC4 catalogue are used to explore the kinematics of the bright members of E 3. Results. Isochrone fitting indicates that E 3 is probably very old, with an age of about 13 Gyr; its dis...

  3. NuSTAR Observations of the Magnetar 1E 2259+586

    DEFF Research Database (Denmark)

    Vogel, Julia K.; Hascoet, Romain; Kaspi, Victoria M.;

    2014-01-01

    We report on new broad band spectral and temporal observations of the magnetar 1E 2259+586, which is located in the supernova remnant CTB 109. Our data were obtained simultaneously with the Nuclear Spectroscopic Telescope Array (NuSTAR) and Swift, and cover the energy range from 0.5-79 keV. We...... present pulse profiles in various energy bands and compare them to previous RXTE results. The NuSTAR data show pulsations above 20 keV for the first time and we report evidence that one of the pulses in the double-peaked pulse profile shifts position with energy. The pulsed fraction of the magnetar is...... shown to increase strongly with energy. Our spectral analysis reveals that the soft X-ray spectrum is well characterized by an absorbed double blackbody or blackbody plus power-law model in agreement with previous reports. Our new hard X-ray data, however, suggest that an additional component, such as a...

  4. The Swift/Fermi GRB 080928 from 1 eV to 150 keV

    CERN Document Server

    Rossi, A; Klose, S; Kann, D A; Rau, A; Krimm, H A; Jóhannesson, G; Panaitescu, A; Yuan, F; Ferrero, P; Krühler, T; Greiner, J; Schady, P; Pandey, S B; Amati, L; Afonso, P M J; Akerlof, C W; Arnold, L; Clemens, C; Filgas, R; Hartmann, D H; Yoldaş, A Küpcü; McBreen, S; McKay, T A; Guelbenzu, A Nicuesa; E., F Olivares; Paciesas, B; Rykoff, E S; Szokoly, G; Updike, A C; Yoldaş, A

    2010-01-01

    We present the results of a comprehensive study of the Gamma-Ray Burst 080928 and of its afterglow. GRB 080928 was a long burst detected by Swift/BAT and Fermi/GBM. It is one of the exceptional cases where optical emission was already detected when the GRB itself was still radiating in the gamma-ray band. For nearly 100 seconds simultaneous optical, X-ray and gamma-ray data provide a coverage of the spectral energy distribution of the transient source from about 1 eV to 150 keV. Here we analyze the prompt emission, constrain its spectral properties, and set lower limits on the initial Lorentz factor of the relativistic outflow. In particular, we show that the SED during the main prompt emission phase is in agreement with synchrotron radiation. We construct the optical/near-infrared light curve and the spectral energy distribution based on Swift/UVOT, ROTSE-IIIa (Australia) and GROND (La Silla) data and compare it to the X-ray light curve retrieved from the Swift/XRT repository. We show that its bumpy shape ca...

  5. The X-ray Bursts from the Magnetar Candidate 1E 2259+586

    CERN Document Server

    Gavriil, F P; Woods, P M; Gavriil, Fotis P.; Kaspi, Victoria M.; Woods, Peter M.

    2004-01-01

    We present a statistical analysis of the X-ray bursts observed from the 2002 June 18 outburst of the Anomalous X-ray Pulsar (AXP) 1E 2259+586, observed with the Proportional Counter Array aboard the Rossi X-ray Timing Explorer. We show that the properties of these bursts are similar to those of Soft Gamma-Repeaters (SGRs). The similarities we find are: the burst durations follow a log-normal distribution which peaks at 99 ms, the differential burst fluence distribution is well described by a power law of index -1.7, the burst fluences are positively correlated with the burst durations, the distribution of waiting times is well described by a log-normal distribution of mean 47 s, and the bursts are generally asymmetric with faster rise than fall times. However, we find several quantitative differences between the AXP and SGR bursts. Specifically, there is a correlation of burst phase with pulsed intensity, the AXP bursts we observed exhibit a wider range of durations, the correlation between burst fluence and ...

  6. NuSTAR Observations of the Magnetar 1E 2259+586

    CERN Document Server

    Vogel, Julia K; Kaspi, Victoria M; An, Hongjun; Archibald, Robert; Beloborodov, Andrei M; Boggs, Steven E; Christensen, Finn E; Craig, William W; Gotthelf, Eric V; Grefenstette, Brian W; Hailey, Charles J; Harrison, Fiona A; Kennea, Jamie A; Madsen, Kristin K; Pivovaroff, Michael J; Stern, Daniel; Zhang, William W

    2014-01-01

    We report on new broad band spectral and temporal observations of the magnetar 1E 2259+586, which is located in the supernova remnant CTB 109. Our data were obtained simultaneously with the Nuclear Spectroscopic Telescope Array (NuSTAR) and Swift, and cover the energy range from 0.5-79 keV. We present pulse profiles in various energy bands and compare them to previous RXTE results. The NuSTAR data show pulsations above 20 keV for the first time and we report evidence that one of the pulses in the double-peaked pulse profile shifts position with energy. The pulsed fraction of the magnetar is shown to increase strongly with energy. Our spectral analysis reveals that the soft X-ray spectrum is well characterized by an absorbed double-blackbody or blackbody plus power-law model in agreement with previous reports. Our new hard X-ray data, however, suggests that an additional component, such as a power-law, is needed to describe the NuSTAR and Swift spectrum. We also fit the data with the recently developed coronal...

  7. Amino acids critical for the functions of the bovine papillomavirus type 1 E2 transactivator.

    Science.gov (United States)

    Brokaw, J L; Blanco, M; McBride, A A

    1996-01-01

    The N-terminal domain of the bovine papillomavirus type 1 E2 protein is important for viral DNA replication, for transcriptional transactivation, and for interaction with the E1 protein. To determine which residues of this 200-amino-acid domain are important for these activities, single conservative amino acid substitutions have been generated in 17 residues that are invariant among all papillomavirus E2 proteins. The resulting mutated E2 proteins were tested for the ability to support viral DNA replication, activate transcription, and cooperatively bind to the origin of replication with the E1 protein. We identified five mutated proteins that were completely defective for transcriptional activation and either were defective or could support viral DNA replication at only low levels. However, several of these proteins could still interact efficiently with the E1 protein. In addition, we identified several mutated proteins that were unable to efficiently cooperatively bind to the origin with the E1 protein. Although a number of the mutated proteins demonstrated wild-type activity in all of the functions tested, only 3 out of 17 mutated viral genomes were able to induce foci in a C127 focus formation assay when the mutations were generated in the background of the entire bovine papillomavirus type 1 genome. This finding suggests that the E2 protein may have additional activities that are important for the viral life cycle. PMID:8523530

  8. Rates of E1, E2, M1, and M2 transitions in Ni II

    Science.gov (United States)

    Cassidy, C. M.; Hibbert, A.; Ramsbottom, C. A.

    2016-03-01

    Aims: We present rates for all E1, E2, M1, and M2 transitions among the 295 fine-structure levels of the configurations 3d9, 3d84s, 3d74s2, 3d84p, and 3d74s4p, determined through an extensive configuration interaction calculation. Methods: The CIV3 code developed by Hibbert and coworkers is used to determine for these levels configuration interaction wave functions with relativistic effects introduced through the Breit-Pauli approximation. Results: Two different sets of calculations have been undertaken with different 3d and 4d functions to ascertain the effect of such variation. The main body of the text includes a representative selection of data, chosen so that key points can be discussed. Some analysis to assess the accuracy of the present data has been undertaken, including comparison with earlier calculations and the more limited range of experimental determinations. The full set of transition data is given in the supplementary material as it is very extensive. Conclusions: We believe that the present transition data are the best currently available. Full Table 4 and Tables 5-8 are only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (ftp://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/587/A107

  9. 1-eV GaInNAs solar cells for ultrahigh-frequency multijunction devices

    Energy Technology Data Exchange (ETDEWEB)

    Friedman, D.J.; Geisz, J.F.; Kurtz, S.R.; Olson, J.M. [National Renewable Energy Lab., Golden, CO (United States)

    1998-09-01

    The authors demonstrate working prototypes of a GaInNAs-based solar cell lattice-matched to GaAs with photoresponse down to 1 eV. This device is intended for use as the third junction of future-generation ultrahigh-efficiency three- and four-junction devices. Under the AM1.5 direct spectrum with all the light higher in energy than the GaAs band gap filtered out, the prototypes have open-circuit voltages ranging from 0.35 to 0.44 V, short-circuit currents of 1.8 mA/cm{sup 2}, and fill factors from 61--66%. The short-circuit currents are of principal concern: the internal quantum efficiencies rise only to about 0.2. The authors discuss the short diffusion lengths which are the reason for this low photocurrent. As a partial workaround for the poor diffusion lengths, they demonstrate a depletion-width-enhanced variation of one of the prototype devices that grades off decreased voltage for increased photocurrent, with a short-circuit current of 6.5 mA/cm{sup 2} and an open-circuit voltage of 0.29 V.

  10. A cascading activity-based probe sequentially targets E1-E2-E3 ubiquitin enzymes.

    Science.gov (United States)

    Mulder, Monique P C; Witting, Katharina; Berlin, Ilana; Pruneda, Jonathan N; Wu, Kuen-Phon; Chang, Jer-Gung; Merkx, Remco; Bialas, Johanna; Groettrup, Marcus; Vertegaal, Alfred C O; Schulman, Brenda A; Komander, David; Neefjes, Jacques; El Oualid, Farid; Ovaa, Huib

    2016-07-01

    Post-translational modifications of proteins with ubiquitin (Ub) and ubiquitin-like modifiers (Ubls), orchestrated by a cascade of specialized E1, E2 and E3 enzymes, control a wide range of cellular processes. To monitor catalysis along these complex reaction pathways, we developed a cascading activity-based probe, UbDha. Similarly to the native Ub, upon ATP-dependent activation by the E1, UbDha can travel downstream to the E2 (and subsequently E3) enzymes through sequential trans-thioesterifications. Unlike the native Ub, at each step along the cascade, UbDha has the option to react irreversibly with active site cysteine residues of target enzymes, thus enabling their detection. We show that our cascading probe 'hops' and 'traps' catalytically active Ub-modifying enzymes (but not their substrates) by a mechanism diversifiable to Ubls. Our founder methodology, amenable to structural studies, proteome-wide profiling and monitoring of enzymatic activity in living cells, presents novel and versatile tools to interrogate Ub and Ubl cascades. PMID:27182664

  11. Deep NuSTAR and Swift Monitoring Observations of the Magnetar 1E 1841-045

    CERN Document Server

    An, Hongjun; Hascoet, Romain; Archibald, Anne M; Beardmore, Andy; Boggs, Steven E; Christensen, Finn E; Craig, William W; Gehrels, Niel; Hailey, Charles J; Harrison, Fiona A; Kennea, Jamie; Kouveliotou, Chryssa; Stern, Daniel; Younes, George; Zhang, William W

    2015-01-01

    We report on a 350-ks NuSTAR observation of the magnetar 1E 1841-045 taken in 2013 September. During the observation, NuSTAR detected six bursts of short duration, with $T_{90}<1$ s. An elevated level of emission tail is detected after the brightest burst, persisting for $\\sim$1 ks. The emission showed a power-law decay with a temporal index of 0.5 before returning to the persistent emission level. The long observation also provided detailed phase-resolved spectra of the persistent X-ray emission of the source. By comparing the persistent spectrum with that previously reported, we find that the source hard-band emission has been stable over approximately 10 years. The persistent hard X-ray emission is well fitted by a coronal outflow model, where $e^{+/-}$ pairs in the magnetosphere upscatter thermal X-rays. Our fit of phase-resolved spectra allowed us to estimate the angle between the rotational and magnetic dipole axes of the magnetar, $\\alpha_{mag}=0.25$, the twisted magnetic flux, $2.5\\times10^{26}\\rm ...

  12. NuSTAR observations of the magnetar 1E 2259+586

    Energy Technology Data Exchange (ETDEWEB)

    Vogel, Julia K.; Craig, William W.; Pivovaroff, Michael J. [Physics Division, Physical and Life Sciences Directorate, Lawrence Livermore National Laboratory, Livermore, CA 94550 (United States); Hascoët, Romain; Beloborodov, Andrei M.; Gotthelf, Eric V.; Hailey, Charles J. [Physics Department and Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Kaspi, Victoria M.; An, Hongjun; Archibald, Robert [Department of Physics, McGill University, Montreal, Quebec H3A 2T8 (Canada); Boggs, Steven E. [Space Sciences Laboratory, University of California, Berkeley, CA 94720 (United States); Christensen, Finn E. [DTU Space, National Space Institute, Technical University of Denmark, Elektrovej 327, DK-2800 Lyngby (Denmark); Grefenstette, Brian W.; Harrison, Fiona A.; Madsen, Kristin K. [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Kennea, Jamie A. [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States); Stern, Daniel [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Zhang, William W. [Goddard Space Flight Center, Greenbelt, MD 20771 (United States)

    2014-07-01

    We report on new broad band spectral and temporal observations of the magnetar 1E 2259+586, which is located in the supernova remnant CTB 109. Our data were obtained simultaneously with the Nuclear Spectroscopic Telescope Array (NuSTAR) and Swift, and cover the energy range from 0.5-79 keV. We present pulse profiles in various energy bands and compare them to previous RXTE results. The NuSTAR data show pulsations above 20 keV for the first time and we report evidence that one of the pulses in the double-peaked pulse profile shifts position with energy. The pulsed fraction of the magnetar is shown to increase strongly with energy. Our spectral analysis reveals that the soft X-ray spectrum is well characterized by an absorbed double blackbody or blackbody plus power-law model in agreement with previous reports. Our new hard X-ray data, however, suggest that an additional component, such as a power law, is needed to describe the NuSTAR and Swift spectrum. We also fit the data with the recently developed coronal outflow model by Beloborodov for hard X-ray emission from magnetars. The outflow from a ring on the magnetar surface is statistically preferred over outflow from a polar cap.

  13. NuSTAR Observations of the Magnetar 1E 2259+586

    Science.gov (United States)

    Vogel, Julia K.; Hascoet, Romain; Kaspi, Victoria M.; An, Hongjun; Archibald, Robert; Beloborodov, Andrei M.; Boggs, Steven E.; Christensen, Finn E.; Craig, William W.; Gotthelf, Eric V.; Grefenstette, Brian W.; Hailey, Charles J.; Harrison, Fiona A.; Kennea, Jamie A.; Madsen, Kristin K.; Pivovaroff, Michael J.; Stern, Daniel; Zhang, William W.

    2014-01-01

    We report on new broad band spectral and temporal observations of the magnetar 1E 2259+586, which is located in the supernova remnant CTB 109. Our data were obtained simultaneously with the Nuclear Spectroscopic Telescope Array (NuSTAR) and Swift, and cover the energy range from 0.5-79 keV. We present pulse profiles in various energy bands and compare them to previous RXTE results. The NuSTAR data show pulsations above 20 keV for the first time and we report evidence that one of the pulses in the double-peaked pulse profile shifts position with energy. The pulsed fraction of the magnetar is shown to increase strongly with energy. Our spectral analysis reveals that the soft X-ray spectrum is well characterized by an absorbed double blackbody or blackbody plus power-law model in agreement with previous reports. Our new hard X-ray data, however, suggest that an additional component, such as a power law, is needed to describe the NuSTAR and Swift spectrum. We also fit the data with the recently developed coronal outflow model by Beloborodov for hard X-ray emission from magnetars. The outflow from a ring on the magnetar surface is statistically preferred over outflow from a polar cap.

  14. NuSTAR OBSERVATIONS OF THE MAGNETAR 1E 2259+586

    Energy Technology Data Exchange (ETDEWEB)

    Vogel, Julia K. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Hascoët, Romain [Columbia Univ., New York, NY (United States); Kaspi, Victoria M. [Univ. of Montreal, Quebec (Canada); An, Hongjun [Univ. of Montreal, Quebec (Canada); Archibald, Robert [Univ. of Montreal, Quebec (Canada); Beloborodov, Andrei M. [Columbia Univ., New York, NY (United States); Boggs, Steven E. [Univ. of California, Berkeley, CA (United States); Christensen, Finn E. [Technical Univ. of Denmark, Lyngby (Denmark); Craig, William W. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Gotthelf, Eric V. [Columbia Univ., New York, NY (United States); Grefenstette, Brian W. [California Inst. of Technology (CalTech), Pasadena, CA (United States); Hailey, Charles J. [Columbia Univ., New York, NY (United States); Harrison, Fiona A. [California Inst. of Technology (CalTech), Pasadena, CA (United States); Kennea, Jamie A. [Pennsylvania State Univ., State College, PA (United States); Madsen, Kristin K. [California Inst. of Technology (CalTech), Pasadena, CA (United States); Pivovaroff, Michael J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Stern, Daniel [California Inst. of Technology (CalTech), Pasadena, CA (United States); Zhang, William W. [NASA Goddard Space Flight Center (GSFC), Greenbelt, MD (United States)

    2014-07-01

    We report on new broad band spectral and temporal observations of the magnetar 1E 2259+586, which is located in the supernova remnant CTB 109. Our data were obtained simultaneously with the Nuclear Spectroscopic Telescope Array (NuSTAR) and Swift, and cover the energy range from 0.5-79 keV. We present pulse profiles in various energy bands and compare them to previous RXTE results. The NuSTAR data show pulsations above 20 keV for the first time and we report evidence that one of the pulses in the double-peaked pulse profile shifts position with energy. The pulsed fraction of the magnetar is shown to increase strongly with energy. Our spectral analysis reveals that the soft X-ray spectrum is well characterized by an absorbed double blackbody or blackbody plus power-law model in agreement with previous reports. Our new hard X-ray data, however, suggest that an additional component, such as a power law, is needed to describe the NuSTAR and Swift spectrum. We also fit the data with the recently developed coronal outflow model by Beloborodov for hard X-ray emission from magnetars. The outflow from a ring on the magnetar surface is statistically preferred over outflow from a polar cap.

  15. AKT1E17K Is Oncogenic in Mouse Lung and Cooperates with Chemical Carcinogens in Inducing Lung Cancer

    Science.gov (United States)

    Malanga, Donatella; Belmonte, Stefania; Colelli, Fabiana; Scarfò, Marzia; De Marco, Carmela; Oliveira, Duarte Mendes; Mirante, Teresa; Camastra, Caterina; Gagliardi, Monica; Rizzuto, Antonia; Mignogna, Chiara; Paciello, Orlando; Papparella, Serenella; Fagman, Henrik; Viglietto, Giuseppe

    2016-01-01

    The hotspot AKT1E17K mutation in the pleckstrin homology domain of AKT1 occurs in approximately 0.6–2% of human lung cancers. Recently, we have demonstrated that AKT1E17K transforms immortalized human bronchial cells. Here by use of a transgenic Cre-inducible murine strain in the wild type Rosa26 (R26) locus (R26-AKT1E17K mice) we demonstrate that AKT1E17K is a bona-fide oncogene and plays a role in the development of lung cancer in vivo. In fact, we report that mutant AKT1E17K induces bronchial and/or bronchiolar hyperplastic lesions in murine lung epithelium, which progress to frank carcinoma at very low frequency, and accelerates tumor formation induced by chemical carcinogens. In conclusion, AKT1E17K induces hyperplasia of mouse lung epithelium in vivo and cooperates with urethane to induce the fully malignant phenotype. PMID:26859676

  16. Expression and identification of the ADF-linker-3-1E gene of Eimeria acervulina of chicken.

    Science.gov (United States)

    Yuelan, Zhao; Yiwei, Liu; Liyuan, Liu; Yue, Zhao; Wenbo, Cao; Yongzhan, Bao; Jianhua, Qin

    2016-04-01

    Coccidiosis is a widely distributed disease with higher mortality and morbidity, which is caused by several species of protozoan parasites belonging to the genus Eimeria and recognized as a serious challenge for the poultry industry. This research was conducted to construct the recombinant plasmid pET32a(+)-ADF-linker-3-1E of Eimeria acervulina (E. acervulina) of the chicken and test the bioactivity of the ADF-linker-3-1E protein. The ADF-linker-3-1E gene of E. acervulina of the chicken was cloned by splicing by overlap extension by the polymerase chain reaction (SOE-PCR) and then inserted into the pET32a(+) to construct the recombinant plasmid pET32a(+)-ADF-linker-3-1E. The recombinant plasmid was transformed into Escherichia coli Rosetta (DE3) competent cells and then induced by IPTG (0.6 mmol/L). The expressed product in the culture medium was identified by the sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE). The bioactivity of the ADF-linker-3-1E protein was tested by Western blotting. The result showed that the amplified ADF-linker-3-1E gene was about 1346 bp. The PCR amplification with the recombinant plasmid pET-32a(+)-ADF-linker-3-1E as a template resulted in a special band of 1346 bp. The digested products resulted in two fragments of 1346 bp target fragment and 5.9 kb pET-32a(+)-vector fragment. The results indicated that the ADF-linker3-1E gene was successfully inserted into the pET-32a(+)-vector. The expressed products in the culture medium resulted in a single band of approximately 54.8 kDa by SDS-PAGE. Western blotting analysis indicated that the recombinant protein could be reacted specifically with His-Tag(2A8) Mouse mAb. This study indicated that the ADF-linker-3-1E protein with good bioactivity was successfully obtained, which laid a foundation for the exploitation of the nuclear vaccine by using the ADF-linker-3-1E protein. PMID:26767375

  17. The Swift/Fermi GRB 080928 from 1 eV to 150 keV

    Science.gov (United States)

    Sonbas, Eda; Rossi, A.; Schulze, S.; Klose, S.; Kann, D. A.; Ferrero, P.; NicuesaGuelbenzu, A.; Rau, A.; Kruehler, T.; Greiner, J.; Schady, P.; Afonso, P. M. J.; Clemens, C.; Filgas, R.; KuepcuYoldas, A.; McBreen, S.; Olivares, F.; Szokoly, G.; Yoldas, A.; Krimm, H. A.; Johannesson, G.; Panaitescu, A.; Yuan, F.; Pandey, S. B.; Akerlof, C. W.

    2010-01-01

    We present the results of a comprehensive study of the Gamma-Ray Burst 080928 and of its afterglow. GRB 08092 was a long burst detected by Swift/BAT and Fermi/GBM, It is one of the exceptional cases where optical emission was already detected when the GRB itself was still radiating in the gamma-ray band. for nearly 100 seconds simultaneous optical X-ray and gamma-ray data provide a coverage of the spectral energy distribution of the transient source from about 1 eV to 150 keV. Here we analyze the prompt emission, constrain its spectral propertIes. and set lower limits on the initial Lorentz factor of the relativistic outflow, In particular. we show that the SED during the main prompt emission phase is in agreement with synchrotron radiation. We construct the optical/near-infrared light curve and the spectral energy distribution based on Swift/UVOT. ROTSE-Illa (Australia) and GROND (La Silla) data and compare it to the X-ray light curve retrieved from the Swift/XRT repository. We show that its bumpy shape can be modeled by multiple energy injections into the forward shock. Furthermore, we provide evidence that the temporal and spectral evolution of the first strong flare seen in the early X-ray light curve can be explained by large-angle emission. Finally, we report on the results of our search for the GRB host galaxy, for which only a deep upper limit can be provided.

  18. Analysis of chromatin attachment and partitioning functions of bovine papillomavirus type 1 E2 protein.

    Science.gov (United States)

    Abroi, Aare; Ilves, Ivar; Kivi, Sirje; Ustav, Mart

    2004-02-01

    Recent studies have suggested that the tethering of viral genomes to host cell chromosomes could provide one of the ways to achieve their nuclear retention and partitioning during extrachromosomal maintenance in dividing cells. The data we present here provide firm evidence that the partitioning of the bovine papillomavirus type 1 (BPV1) genome is dependent on the chromatin attachment process mediated by viral E2 protein and its multiple binding sites. On the other hand, the attachment of E2 and the E2-mediated tethering of reporter plasmids to host chromosomes are not necessarily sufficient for efficient partitioning, suggesting that additional E2-dependent activities might be involved in the latter process. The activity of E2 protein in chromatin attachment and partitioning is more sensitive to the point mutations in the N-terminal domain than its transactivation and replication initiation functions. Therefore, at least part of the interactions of the E2 N-terminal domain with its targets during the chromatin attachment and partitioning processes are likely to involve specific receptors not involved in transactivation and replication activities of the protein. The mutational analysis also indicates that the binding of E2 to chromatin is not achieved through interaction of linear N-terminal subsequences of the E2 protein with putative receptors. Instead, the composite surface elements of the N-terminal domain build up the receptor-binding surface of E2. In this regard, the interaction of BPV1 E2 with its chromosomal targets clearly differs from the interactions of LANA1 protein from Kaposi's sarcoma-associated human herpesvirus and EBNA1 from Epstein-Barr virus with their specific receptors. PMID:14747575

  19. NuSTAR observations of magnetar 1E 1841–045

    Energy Technology Data Exchange (ETDEWEB)

    An, Hongjun; Kaspi, Victoria M.; Dufour, François; Archibald, Robert [Department of Physics, McGill University, Montreal, Quebec H3A 2T8 (Canada); Hascoët, Romain; Beloborodov, Andrei M.; Gotthelf, Eric V.; Hailey, Charles J. [Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Bachetti, Matteo [Université de Toulouse, UPS-OMP, IRAP, Toulouse (France); Boggs, Steven E.; Craig, William W. [Space Sciences Laboratory, University of California, Berkeley, CA 94720 (United States); Christensen, Finn E. [DTU Space, National Space Institute, Technical University of Denmark, Elektrovej 327, DK-2800 Lyngby (Denmark); Greffenstette, Brian W.; Harrison, Fiona A.; Madsen, Kristin K. [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Kitaguchi, Takao [RIKEN, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Kouveliotou, Chryssa [Space Science Office, ZP12, NASA Marshall Space Flight Center, Huntsville, AL 35812 (United States); Markwardt, Craig B. [Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Stern, Daniel [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Vogel, Julia K. [Lawrence Livermore National Laboratory, Livermore, CA 94550 (United States); and others

    2013-12-20

    We report new spectral and temporal observations of the magnetar 1E 1841–045 in the Kes 73 supernova remnant obtained with the Nuclear Spectroscopic Telescope Array. Combined with new Swift and archival XMM-Newton and Chandra observations, the phase-averaged spectrum is well characterized by a blackbody plus double power law, in agreement with previous multimission X-ray results. However, we are unable to reproduce the spectral results reported based on Suzaku observations. The pulsed fraction of the source is found to increase with photon energy. The measured rms pulsed fractions are ∼12% and ∼17% at ∼20 and ∼50 keV, respectively. We detect a new feature in the 24-35 keV band pulse profile that is uniquely double peaked. This feature may be associated with a possible absorption or emission feature in the phase-resolved spectrum. We fit the X-ray data using the recently developed electron-positron outflow model by Beloborodov for the hard X-ray emission from magnetars. This produces a satisfactory fit, allowing a constraint on the angle between the rotation and magnetic axes of the neutron star of ∼20° and on the angle between the rotation axis and line of sight of ∼50°. In this model, the soft X-ray component is inconsistent with a single blackbody; adding a second blackbody or a power-law component fits the data. The two-blackbody interpretation suggests a hot spot of temperature kT ≈ 0.9 keV occupying ∼1% of the stellar surface.

  20. Day Care Centers

    Data.gov (United States)

    Department of Homeland Security — This database contains locations of day care centers for 50 states and Washington D.C. and Puerto Rico. The dataset only includes center based day care locations...

  1. Poison Control Centers

    Science.gov (United States)

    ... 1222 immediately. Name State American Association of Poison Control Centers Address AAPCC Central Office NOT A POISON ... not for emergency use. Arkansas ASPCA Animal Poison Control Center Address 1717 S. Philo Road, Suite 36 Urbana, ...

  2. New Mexico Convention Centers

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — This dataset provides an initial version of the locations of convention centers in New Mexico, in point form, with limited attributes, compiled using available data...

  3. Carbon Monoxide Information Center

    Medline Plus

    Full Text Available ... Education / Safety Education Centers En Español Carbon Monoxide Information Center The Invisible Killer Carbon monoxide, also known ... Install one and check its batteries regularly. View Information About CO Alarms Other CO Topics Safety Tips ...

  4. Hydrologic Engineering Center

    Data.gov (United States)

    Federal Laboratory Consortium — The Hydrologic Engineering Center (HEC), an organization within the Institute for Water Resources, is the designated Center of Expertise for the U.S. Army Corps of...

  5. RSW Cell Centered Grids

    Data.gov (United States)

    National Aeronautics and Space Administration — New cell centered grids are generated to complement the node-centered ones uploaded. Six tarballs containing the coarse, medium, and fine mixed-element and pure...

  6. Tornadoes: A Center Approach.

    Science.gov (United States)

    Christman-Rothlein, Liz; Meinbach, Anita M.

    1981-01-01

    Information is given on how to put together a learning center. Discusses information and activity packets for a complete learning center on tornadoes including objectives, directions, materials, photographs of physical arrangements, and posttest. (DC)

  7. BKG Data Center

    Science.gov (United States)

    Thorandt, Volkmar; Wojdziak, Reiner

    2013-01-01

    This report summarizes the activities and background information of the IVS Data Center for the year 2012. Included is information about functions, structure, technical equipment, and staff members of the BKG Data Center.

  8. ACTS data center

    Science.gov (United States)

    Syed, Ali; Vogel, Wolfhard J.

    1993-01-01

    Viewgraphs on ACTS Data Center status report are included. Topics covered include: ACTS Data Center Functions; data flow overview; PPD flow; RAW data flow; data compression; PPD distribution; RAW Data Archival; PPD Audit; and data analysis.

  9. NIH Clinical Centers

    Data.gov (United States)

    Federal Laboratory Consortium — The NIH Clinical Center consists of two main facilities: The Mark O. Hatfield Clinical Research Center, which opened in 2005, houses inpatient units, day hospitals,...

  10. Center for Functional Nanomaterials

    Data.gov (United States)

    Federal Laboratory Consortium — The Center for Functional Nanomaterials (CFN) explores the unique properties of materials and processes at the nanoscale. The CFN is a user-oriented research center...

  11. CSNK1E/CTNNB1 Are Synthetic Lethal To TP53 in Colorectal Cancer and Are Markers for Prognosis

    Directory of Open Access Journals (Sweden)

    Khong-Loon Tiong

    2014-05-01

    Full Text Available Two genes are called synthetic lethal (SL if their simultaneous mutations lead to cell death, but each individual mutation does not. Targeting SL partners of mutated cancer genes can kill cancer cells specifically, but leave normal cells intact. We present an integrated approach to uncovering SL pairs in colorectal cancer (CRC. Screening verified SL pairs using microarray gene expression data of cancerous and normal tissues, we first identified potential functionally relevant (simultaneously differentially expressed gene pairs. From the top-ranked pairs, ~20 genes were chosen for immunohistochemistry (IHC staining in 171 CRC patients. To find novel SL pairs, all 169 combined pairs from the individual IHC were synergistically correlated to five clinicopathological features, e.g. overall survival. Of the 11 predicted SL pairs, MSH2-POLB and CSNK1E-MYC were consistent with literature, and we validated the top two pairs, CSNK1E-TP53 and CTNNB1-TP53 using RNAi knockdown and small molecule inhibitors of CSNK1E in isogenic HCT-116 and RKO cells. Furthermore, synthetic lethality of CSNK1E and TP53 was verified in mouse model. Importantly, multivariate analysis revealed that CSNK1E-P53, CTNNB1-P53, MSH2-RB1, and BRCA1-WNT5A were independent prognosis markers from stage, with CSNK1E-P53 applicable to early-stage and the remaining three throughout all stages. Our findings suggest that CSNK1E is a promising target for TP53-mutant CRC patients which constitute ~40% to 50% of patients, while to date safety regarding inhibition of TP53 is controversial. Thus the integrated approach is useful in finding novel SL pairs for cancer therapeutics, and it is readily accessible and applicable to other cancers.

  12. Center of buoyancy definition

    International Nuclear Information System (INIS)

    The center of buoyancy of an arbitrary shaped body is defined in analogy to the center of gravity. The definitions of the buoyant force and center of buoyancy in terms of integrals over the area of the body are converted to volume integrals and shown to have simple intuitive interpretations

  13. Cloning, sequence analysis, and expression of the genes encoding lytic functions of Bacteriophage phi g1e.

    Science.gov (United States)

    Oki, M; Kakikawa, M; Yamada, K; Taketo, A; Kodaira, K I

    1996-10-17

    The lysis genes of a Lactobacillus phage phi g1e were cloned, sequenced, and expressed in Escherichia coli. Nucleotide sequencing of a 3813-bp phi g1e DNA revealed five successive open reading frames (ORF), Rorf50, Rorf118, hol, and lys and Rorf175, in the same DNA strand. By comparative analysis of the DNA sequence, the putative hol product (holin) has an estimated molecular weight is 14.2 kDa, and contains two potential transmembrane helices and highly charged N- and C-termini, resembling predicted holins (which are thought to be a cytoplasmic membrane-disrupting protein) encoded by other phages such as mv1 from Lactobacillus bulgaricus, phi adh from Lactobacillus gasseri, as well as monocins from Listeria. On the other hand, the putative phi g1e lys product (lysin) of 48.4 kDa shows significant similarity with presumed muramidase, known as a cell wall peptidoglycandegrading enzyme, encoded by the Lactobacillus phage mv1 and phi adh, the Lactococcus lactis phage phi LC3, and the Streptococcus pneumoniae phages Cp-1, Cp-7 and Cp-9. When expressed in E. coli, the phi g1e lysin and/or holin decreased the cell turbidity significantly, suggesting that the phi g1e hol-lys system is involved in cytolytic process. PMID:8918256

  14. Analytic strong-coupling expansion in 1/e for the electron propagator without fermion loops in quantum electrodynamics

    International Nuclear Information System (INIS)

    Starting from the path-integral representation for the electron propagator without fermion loops in QED, we analytically investigate the strong-coupling behavior in an arbitrary background electromagnetic field through a series expansion in powers of 1/e. Contrary to the perturbation theory expansion in e the new series only contains positive powers of the derivative operator p. Due to infrared singularities in the path integral the series does not exist beyond the lowest orders, although one can build a systematic expansion in powers of p (not 1/e) which can be calculated up to any order. To handle infinities we regularize using a Pauli-Villars approach. The introduction of fermion loops would not correspond to higher orders in 1/e, so a priori our results are only pertinent to the sector of QED we have chosen. 17 refs., 1 fig

  15. Detailed atmosphere modelling for the neutron star 1E1207.4-5209: Evidence of Oxygen/Neon atmosphere

    OpenAIRE

    Mori, Kaya; Hailey, Charles J,

    2003-01-01

    We present a comprehensive investigation of the two broad absorption features observed in the X-ray spectrum of the neutron star 1E1207.4-5209 based on a recent analysis of the 260 ksec XMM-Newton data by Mori et al. 2005. Expanding on our earlier work (Hailey & Mori 2002) we have examined all previously proposed atmospheric models for 1E1207.4-5209. Using our atomic code, which rapidly solves Schrodinger's equation for arbitrary ion in strong magnetic field (Mori & Hailey 2002), we have syst...

  16. Investigation of the {sup 1}E{sub 2g}{sup {minus}} states in cyclic polyenes

    Energy Technology Data Exchange (ETDEWEB)

    Bracken, P.; Cizek, J. [Univ. of Waterloo, Ontario (Canada)

    1995-03-05

    An analysis withing the one-dimensional Hubbard model of the {sup 1}E{sub 2g}{sup {minus}} type state in cyclic polyenes is reported. In terms of the resonance integral {beta}, a small {beta} analysis and asymptotic large {beta} analysis have been carried out. Energy as a function of {beta} has been calculated numerically, and a second state with {sup 1}E{sub 2g}{sup {minus}} symmetry has been found. Some missing information about the higher momentum state of this symmetry is provided. 15 refs., 4 tabs.

  17. $Suzaku$ and $XMM-Newton$ observations of a newly-discovered early-stage cluster merger 1E2216.0-0401 and 1E2215.7-0404

    CERN Document Server

    Akamatsu, H; Shimwell, T W; Mernier, F; Mao, J; Urdampilleta, I; de Plaa, J; Röttgering, H J A; Kaastra, J S

    2016-01-01

    We present the results of $Suzaku$ and $XMM-Newton$ X-ray observations of the cluster pair 1E2216.0-0401 and 1E2215.7-0404. We discover an X-ray bridge between the clusters. $Suzaku$ and $XMM-Newton$ observations revealed that each cluster hosts gas with moderate temperature of $kT_{1E2216.0-0401}=$4.8$\\pm$0.1 keV and $kT_{1E2215.7-0404}=$5.8$\\pm$0.2 keV, respectively. On the other hand, the bridge region shows a remarkably high temperature ({\\it kT}=6.6$\\pm$0.5 keV). Furthermore, at the position of the bridge, we detected an enhancement in the wavelet-decomposed soft-band (0.5-4.0 keV) $XMM-Newton$ image at 3 sigma significance, this is most likely due to a compression of the intracluster medium (ICM) as a consequence of the merging activity. This X-ray intensity and temperature enhancement are not consistent with those expected from a late phase, but are in agreement with the predictions by numerical simulations of an early phase merger. From the temperature jump at the location of the bridge, the Mach numb...

  18. Relativistic Guiding Center Equations

    Energy Technology Data Exchange (ETDEWEB)

    White, R. B. [PPPL; Gobbin, M. [Euratom-ENEA Association

    2014-10-01

    In toroidal fusion devices it is relatively easy that electrons achieve relativistic velocities, so to simulate runaway electrons and other high energy phenomena a nonrelativistic guiding center formalism is not sufficient. Relativistic guiding center equations including flute mode time dependent field perturbations are derived. The same variables as used in a previous nonrelativistic guiding center code are adopted, so that a straightforward modifications of those equations can produce a relativistic version.

  19. Chemical Security Analysis Center

    Data.gov (United States)

    Federal Laboratory Consortium — In 2006, by Presidential Directive, DHS established the Chemical Security Analysis Center (CSAC) to identify and assess chemical threats and vulnerabilities in the...

  20. Surgery center joint ventures.

    Science.gov (United States)

    Zasa, R J

    1999-01-01

    Surgery centers have been accepted as a cost effective, patient friendly vehicle for delivery of quality ambulatory care. Hospitals and physician groups also have made them the vehicles for coming together. Surgery centers allow hospitals and physicians to align incentives and share benefits. It is one of the few types of health care businesses physicians can own without anti-fraud and abuse violation. As a result, many surgery center ventures are now jointly owned by hospitals and physician groups. This article outlines common structures that have been used successfully to allow both to own and govern surgery centers.

  1. Electron Microscopy Center (EMC)

    Data.gov (United States)

    Federal Laboratory Consortium — The Electron Microscopy Center (EMC) at Argonne National Laboratory develops and maintains unique capabilities for electron beam characterization and applies those...

  2. Test Control Center (TCC)

    Data.gov (United States)

    Federal Laboratory Consortium — The Test Control Center (TCC) provides a consolidated facility for planning, coordinating, controlling, monitoring, and analyzing distributed test events. ,The TCC...

  3. Center for Deployment Psychology

    Data.gov (United States)

    Federal Laboratory Consortium — The Center for Deployment Psychology was developed to promote the education of psychologists and other behavioral health specialists about issues pertaining to the...

  4. Airline Operation Center Workstation

    Data.gov (United States)

    Department of Transportation — The Airline Operation Center Workstation (AOC Workstation) represents equipment available to users of the National Airspace system, outside of the FAA, that enables...

  5. Environmental Modeling Center

    Data.gov (United States)

    Federal Laboratory Consortium — The Environmental Modeling Center provides the computational tools to perform geostatistical analysis, to model ground water and atmospheric releases for comparison...

  6. Data Center at NICT

    Science.gov (United States)

    Ichikawa, Ryuichi; Sekido, Mamoru

    2013-01-01

    The Data Center at the National Institute of Information and Communications Technology (NICT) archives and releases the databases and analysis results processed at the Correlator and the Analysis Center at NICT. Regular VLBI sessions of the Key Stone Project VLBI Network were the primary objective of the Data Center. These regular sessions continued until the end of November 2001. In addition to the Key Stone Project VLBI sessions, NICT has been conducting geodetic VLBI sessions for various purposes, and these data are also archived and released by the Data Center.

  7. Small Business Development Center

    Data.gov (United States)

    Small Business Administration — Small Business Development Centers (SBDCs) provide assistance to small businesses and aspiring entrepreneurs throughout the United States and its territories. SBDCs...

  8. Polymorphisms in CACNA1E and Camk2d are associated with seizure susceptibility of Sprague-Dawley rats.

    NARCIS (Netherlands)

    Rijkers, K.; Mescheriakova, J.; Majoie, M.; Lemmens, E.; Wijk, X.M.R. van; Philippens, M.; Kranen-Mastenbroek, V.H. van; Schijns, O.; Vles, J.; Hoogland, G.

    2010-01-01

    Seizures are associated with high intracellular calcium levels. However, conditions characterized by high intracellular calcium levels, such as stroke or traumatic brain injury, do not always evoke epilepsy. We hypothesized that polymorphisms in calcium-related genes CACNA1E and Camk2d contribute to

  9. A Burst and Simultaneous Short-Term Pulsed Flux Enhancement from the Magnetar Candidate 1E 1048.1-5937

    CERN Document Server

    Gavriil, F P; Woods, P M; Gavriil, Fotis P.; Kaspi, Victoria M.; Woods, Peter M.

    2006-01-01

    We report on the 2004 June 29 burst detected from the direction of the Anomalous X-ray Pulsar (AXP) 1E 1048.1-5937 using the Rossi X-ray Timing Explorer (RXTE). We find a simultaneous increase of ~3.5 times the quiescent value in the 2-10 keV pulsed flux of 1E 1048.1-5937 during the tail of the burst which identifies the AXP as the burst's origin. The burst was overall very similar to the two others reported from the direction of this source in 2001. The unambiguous identification of 1E 1048.1-5937 as the burster here confirms it was the origin of the 2001 bursts as well. The epoch of the burst peak was very close to the arrival time of 1E 1048.1-5937's pulse peak. The burst exhibited significant spectral evolution with the trend going from hard to soft. During the 11 days following the burst, the AXP was observed further with RXTE, XMM-Newton and Chandra. Pre- and post-burst observations revealed no change in the total flux or spectrum of the quiescent emission. Comparing all three bursts detected thus far f...

  10. Two distinct regions of the BPV1 E1 replication protein interact with the activation domain of E2.

    Science.gov (United States)

    Moscufo, N; Sverdrup, F; Breiding, D E; Androphy, E J

    1999-12-15

    Papillomavirus E1 and E2 proteins co-operation in viral DNA replication is mediated by protein-protein interactions that lead to formation of an E1-E2 complex. To identify the domains involved, portions of the two proteins were expressed as fusions to the DNA-binding protein LexA or the transactivation domain of VP16 and analyzed by the yeast two-hybrid system. The C-terminal 266 amino acids of BPV1 E1 (E1C266) interacted strongly with E2 in the yeast system and in a mammalian two-hybrid assay. VP16-E1C266 interacted with a region encompassing amino acids 1-200 of the transactivation domain of E2 that was fused to LexA. The interaction between E1 full length and E2 was clearly observed only when E1 was expressed as LexA-E1 chimera. In addition, we found that in the LexA context also the N-terminal region encompassing the first 340 amino acids of E1 (E1N340) interacted with E2 full length. The interactions of E1N340 and E1C266 with E2 were confirmed also by in vitro binding studies. These observations demonstrate that two distinct regions of E1 mediate the interaction with E2 in vivo. PMID:10581387

  11. Discovery of a pulsar wind nebula around the Magnetar Candidate AXP 1E1547.0-5408

    NARCIS (Netherlands)

    Vink, J.; Bamba, A.

    2009-01-01

    We report the detection of extended emission around the anomalous X-ray pulsar 1E1547.0-5408 using archival data of the Chandra X-ray satellite. The extended emission consists of an inner part, with an extent of 45 , and an outer part with an outer radius of 2. 9, which coincides with a supernova re

  12. The Relationship between Eating Disorders and ICAM-1, E-selection and Ghrelin Resting Level in Overweight People

    Directory of Open Access Journals (Sweden)

    Gholamreza Sharifi

    2014-11-01

    Full Text Available Introduction There is an agreement that eating disorder is related to psychological characteristics and on the other hand, level of ghrelin hormone, Intercellular adhesion molecule-1 (ICAM-1 and E-selection also change during eating disorders. We aimed to study the relationship between eating disorders and rest levels, ICAM-1, E-selection, and ghrelin hormone in obese people. Materials and Methods  In this quasi-experimental study, 120 obese men (25-30 years old were purposefully selected. Then the data about their eating disorders gathered with eating attitudes test (EAT-26 questionnaire. In the next phase in the rest condition and after overnight fasting, blood samples are collected for measurement of rest levels, ICAM-1, E-selection, and ghrelin hormone. Finally the data were analyzed with appropriate statistical tests in SPSS version 18. Results Mean and deviation of rest levels, ICAM-1, E-selection, and ghrelin hormone were respectively 3064.19, 61.5±19.7, and 2.5±1.5 and there was not any statistical significance relationship between eating disorders ICAM-1, E-selection, and ghrelin hormone in obese men (P

  13. NuSTAR Observations of X-ray Bursts from the Magnetar 1E 1048.1-5937

    DEFF Research Database (Denmark)

    An, Hongjun; Kaspi, Victoria M.; Beloborodov, Andrei M.;

    2014-01-01

    We report the detection of eight bright X-ray bursts from the 6.5 s magnetar 1E 1048.1–5937, during a 2013 July observation campaign with the Nuclear Spectroscopic Telescope Array. We study the morphological and spectral properties of these bursts and their evolution with time. The bursts resulte...

  14. Molecular Cloning and Expression of MaNPR1E Gene from Banana (Musa acuminata L. AAA group, cv. Cavendish)%香蕉NPR 1E 基因的克隆及表达分析

    Institute of Scientific and Technical Information of China (English)

    王卓; 徐碧玉; 贾彩红; 李健平; 刘菊华; 张建斌; 苗红霞; 金志强

    2015-01-01

    NPR1基因可参与调节植物对病原菌的广谱抗性,在植物系统抗性中起着关键的调控作用。通过RACE (rapid-amplification of cDNA ends)方法从香蕉根系中获得NPR1E基因,命名为MaNPR1E(GenBank登录号分别为: KF582550)。 MaNPR1E是香蕉NPR1基因编码框全长cDNA,包含一个1755 bp的最大开放阅读框,编码一个含584个氨基酸的蛋白质。经蛋白质序列同源比对发现,其含有完整的BTB/POZ结构域、锚蛋白重复ANK序列和NPR1-like-C结构域,属于典型的NPR1蛋白。系统进化树比对分析表明, MaNPR1E与海枣PdNPR3(XP_008808341.1)和油棕EgNPR3(XP_010914123.1)的亲缘关系较近。组织特异性研究表明,该基因组成型表达于香蕉各组织。实时荧光定量PCR分析表明,接种枯萎病菌后MaNPR1E的表达在感病品种中被抑制,而在抗病品种中被激活; MaNPR1E的表达受乙烯利和水杨酸的诱导。上述结果表明, MaNPR1E可能在香蕉抗枯萎病过程中扮演重要的调控角色。%NPR1(nonexpressor of PR gene 1), involved in regulating plant broad-spectrum resistance, plays important roles in plant system resistance. In this study, we report the molecular characteristics of NPR1E gene cloned from banana(Musa acuminate L. AAA group, cv. Cavendish)using a RACE-PCR-based strategy. MaNPR1E(accession number: KF582550) contained an open reading frame of 1 755 bp which encoded a polypeptide of 584 amino acids. Protein alignment showed that they contain the complete typical conserved BTB/POZ (BR-C, ttk and bab/Pox virus and Zinc finger)domain, ankyrin repeats and NPR1/NIM1 like defence protein C terminal, which belongs to a typical NPR1 protein. Phylogenetic analysis showed that the deduced amino acid sequences of MaNPR1E also have high similarity to PdNPR3 (XP_008808341.1) and EgNPR3 (XP_010914123.1) from Phoenix dactylifera and Elaeis guineensis, respectively. Tissue-specific studies showed that the expression of MaNPR1E was constitutive

  15. Caveolin-1, E-cadherin and β-catenin in Gastric Carcinoma, Precancerous Tissues and Chronic Non-atrophic Gastritis

    Institute of Scientific and Technical Information of China (English)

    Guo-yang Sun; Jun-xia Wu; Jian-sheng Wu; Yu-ting Pan; Rong Jin

    2012-01-01

    Objective:To investigate the expressions of caveolin-1,E-cadherin and β-catenin in gastric carcinoma,precancerous gastric and chronic non-atrophic gastritis tissues,and evaluate the correlation of these expressions with the development of gastric cancer.Methods:The expressions of caveolin-1,E-cadherin and β-catenin were detected by biotin-streptavidinperoxidase (SP) immunohistochemistry on 58 gastric cancer tissues,40 precancerous gastric tissues and 42 chronic non-atrophic gastritis tissues.The correlation between the expressions of caveolin-1,E-cadherin and β-catenin,and the clinicopathologic parameters of gastric cancer was analyzed retrospectively.Results:The positive rates of caveolin-1 and E-cadherin expressions in gastric carcinoma were significantly lower than precancerous gastric and chronic non-atrophic gastritis tissues (P<0.01).An abnormal rate of β-catenin expression in gastric carcinoma was higher than precancerous gastric and chronic non-atrophic gastritis tissues (P<0.01).Moreover,low expressions of caveolin-1,E-cadherin and β-catenin correlated with tumor size,depth of invasion,lymph node metastasis and TNM stage (P<0.05).The positive rates of caveolin-1 and E-cadherin expressions decreased (P<0.01),while an abnormal rate of β-catenin expression increased inversely,with the degree of atypical hyperplasia (P<0.01).Caveolin-1 expression correlated positively with E-cadherin (r=0.41,P<0.05).Caveolin-1 (r=-0.36,P<0.05) and E-cadherin (r=-0.45,P<0.05) expressions negatively correlated with abnormal β-catenin expression.Conclusion:These results suggested that dysregulated expressions of caveolin-1,E-cadherin and β-catenin correlated with the development of gastric cancer and its biological behavior.

  16. Funding Opportunity: Genomic Data Centers

    Science.gov (United States)

    Funding Opportunity CCG, Funding Opportunity Center for Cancer Genomics, CCG, Center for Cancer Genomics, CCG RFA, Center for cancer genomics rfa, genomic data analysis network, genomic data analysis network centers,

  17. Carbon Monoxide Information Center

    Medline Plus

    Full Text Available ... Consumers Businesses Contact CPSC Website Design Feedback Consumers: Español Businesses: Español , 中文 , Tiếng Việt Connect with Us : Twitter YouTube ... Safely Home / Safety Education / Safety Education Centers En Español Carbon Monoxide Information Center The Invisible Killer Carbon ...

  18. Technology Information Center

    International Nuclear Information System (INIS)

    A Transportation Technology Center (TTC) has been established at Sandia to address the transportation of nuclear waste and spent fuel. The Technology Information Center (TIC) acts as TTC's clearing house for nuclear material transportation information. TIC's activities are divided into three activities: public information, policy information, and technical information. Some of the uses of TIC's activities are briefly outlined

  19. Center for Women Veterans

    Science.gov (United States)

    ... VA » Center for Women Veterans (CWV) Center for Women Veterans (CWV) 10/27/2016 #VeteranOfTheDay Army Veteran ... Meet the Veteran of the Day » Employment and Women Veterans An interview with the Women Veteran Program ...

  20. Call Center Capacity Planning

    DEFF Research Database (Denmark)

    Nielsen, Thomas Bang

    The main topics of the thesis are theoretical and applied queueing theory within a call center setting. Call centers have in recent years become the main means of communication between customers and companies, and between citizens and public institutions. The extensively computerized infrastructu...

  1. NASA propagation information center

    Science.gov (United States)

    Smith, Ernest K.; Flock, Warren L.

    1990-07-01

    The NASA Propagation Information Center became formally operational in July 1988. It is located in the Department of Electrical and Computer Engineering of the University of Colorado at Boulder. The center is several things: a communications medium for the propagation with the outside world, a mechanism for internal communication within the program, and an aid to management.

  2. Simple Machine Science Centers

    Science.gov (United States)

    Chessin, Debby

    2007-01-01

    Science centers can engage students; accommodate different learning styles and individual interests; help students become independent and confident learners; and encourage social skills among students. In this article, the author worked with third-grade students as they completed activities at learning centers during a week-long unit on simple…

  3. Relative Lyapunov Center Bifurcations

    DEFF Research Database (Denmark)

    Wulff, Claudia; Schilder, Frank

    2014-01-01

    Relative equilibria (REs) and relative periodic orbits (RPOs) are ubiquitous in symmetric Hamiltonian systems and occur, for example, in celestial mechanics, molecular dynamics, and rigid body motion. REs are equilibria, and RPOs are periodic orbits of the symmetry reduced system. Relative Lyapunov...... center bifurcations are bifurcations of RPOs from REs corresponding to Lyapunov center bifurcations of the symmetry reduced dynamics. In this paper we first prove a relative Lyapunov center theorem by combining recent results on the persistence of RPOs in Hamiltonian systems with a symmetric Lyapunov...... center theorem of Montaldi, Roberts, and Stewart. We then develop numerical methods for the detection of relative Lyapunov center bifurcations along branches of RPOs and for their computation. We apply our methods to Lagrangian REs of the N-body problem....

  4. Qualification of electric motors class 1E for supply of motors and its repair; Calificacion de motores electricos clase 1E para el suministro de motores alternativos a los orginales y su reparacion

    Energy Technology Data Exchange (ETDEWEB)

    Perez, E.; Gonzalez, J. J.; Fernandez, A.; Garcia, D.

    2005-07-01

    Different original suppliers of nuclear grade equipment have either disappeared or discontinued the manufacture of this kind equipment. Under this situation nuclear plants are experiencing difficulties when dealing with the substitution or maintenance of these equipment. Tecnatom and Cantarey have developed a new line of Class 1E qualified electric low voltage motors which can be used as an alternative to originally installed safety-related motors or for its repair and maintenance. (Author)

  5. Energy efficient data centers

    Energy Technology Data Exchange (ETDEWEB)

    Tschudi, William; Xu, Tengfang; Sartor, Dale; Koomey, Jon; Nordman, Bruce; Sezgen, Osman

    2004-03-30

    Data Center facilities, prevalent in many industries and institutions are essential to California's economy. Energy intensive data centers are crucial to California's industries, and many other institutions (such as universities) in the state, and they play an important role in the constantly evolving communications industry. To better understand the impact of the energy requirements and energy efficiency improvement potential in these facilities, the California Energy Commission's PIER Industrial Program initiated this project with two primary focus areas: First, to characterize current data center electricity use; and secondly, to develop a research ''roadmap'' defining and prioritizing possible future public interest research and deployment efforts that would improve energy efficiency. Although there are many opinions concerning the energy intensity of data centers and the aggregate effect on California's electrical power systems, there is very little publicly available information. Through this project, actual energy consumption at its end use was measured in a number of data centers. This benchmark data was documented in case study reports, along with site-specific energy efficiency recommendations. Additionally, other data center energy benchmarks were obtained through synergistic projects, prior PG&E studies, and industry contacts. In total, energy benchmarks for sixteen data centers were obtained. For this project, a broad definition of ''data center'' was adopted which included internet hosting, corporate, institutional, governmental, educational and other miscellaneous data centers. Typically these facilities require specialized infrastructure to provide high quality power and cooling for IT equipment. All of these data center types were considered in the development of an estimate of the total power consumption in California. Finally, a research ''roadmap'' was developed

  6. User-centered design

    International Nuclear Information System (INIS)

    The simplification philosophy, as an example, that both of EPRI-URD and EUR emphasize is treated mostly for the cost reduction of the nuclear power plants, but not for the simplification of the structure of user's tasks, which is one of the principles of user-centered design. A user-centered design is a philosophy based on the needs and interests of the user, with an emphasis on making products usable and understandable. However, the nuclear power plants offered these days by which the predominant reactor vendors are hardly user-centered but still designer-centered or technology-centered in viewpoint of fulfilling user requirements. The main goal of user-centered design is that user requirements are elicited correctly, reflected properly into the system requirements, and verified thoroughly by the tests. Starting from the user requirements throughout to the final test, each requirement should be traceable. That's why requirement traceability is a key to the user-centered design, and main theme of a requirement management program, which is suggested to be added into EPRI-URD and EUR in the section of Design Process. (author)

  7. Lens auto-centering

    Science.gov (United States)

    Lamontagne, Frédéric; Desnoyers, Nichola; Doucet, Michel; Côté, Patrice; Gauvin, Jonny; Anctil, Geneviève; Tremblay, Mathieu

    2015-09-01

    In a typical optical system, optical elements usually need to be precisely positioned and aligned to perform the correct optical function. This positioning and alignment involves securing the optical element in a holder or mount. Proper centering of an optical element with respect to the holder is a delicate operation that generally requires tight manufacturing tolerances or active alignment, resulting in costly optical assemblies. To optimize optical performance and minimize manufacturing cost, there is a need for a lens mounting method that could relax manufacturing tolerance, reduce assembly time and provide high centering accuracy. This paper presents a patent pending lens mounting method developed at INO that can be compared to the drop-in technique for its simplicity while providing the level of accuracy close to that achievable with techniques using a centering machine (usually innovative auto-centering method is based on the use of geometrical relationship between the lens diameter, the lens radius of curvature and the thread angle of the retaining ring. The autocentering principle and centering test results performed on real optical assemblies are presented. In addition to the low assembly time, high centering accuracy, and environmental robustness, the INO auto-centering method has the advantage of relaxing lens and barrel bore diameter tolerances as well as lens wedge tolerances. The use of this novel lens mounting method significantly reduces manufacturing and assembly costs for high performance optical systems. Large volume productions would especially benefit from this advancement in precision lens mounting, potentially providing a drastic cost reduction.

  8. Fusion engineering design center

    International Nuclear Information System (INIS)

    In the spring of 1985, the Department of Energy (DOE) directed the Design Center to take a lead responsibility in assessing the engineering feasibility of a very compact tokamak experiment with copper coils. Following this assessment, the Design Center studied the Ignitor concept at the request of DOE and arrived at a design configuration. Many features of this configuration have been incorporated into the national baseline conceptual design for a Compact Ignition Tokamak (CIT). The Design Center continued to participate in the mirror program by contributing to the Minimars design effort, a two-year program to develop and describe an attractive tandem mirror reactor concept. The Design Center's principal role is in configuration definition of the candidate concepts. The Design Center continues to lead the engineering activities for the International Tokamak Reactor program. Advanced commercial tokamaks were studied by the Design Center as part of the Tokamak Power Systems Studies project coordinated by the DOE Office of Fusion Energy. The Design Center also provided design integration of the US effort. A cost accounting system that is applicable to all magnetic fusion reactor design studies was developed and applied to different confinement concepts and types of projects. The system provides the structure for development of a fusion cost database and validated cost estimating procedures

  9. The BPV-1 E2 DNA-contact helix cysteine is required for transcriptional activation but not replication in mammalian cells.

    Science.gov (United States)

    Grossel, M J; Barsoum, J; Prakash, S S; Androphy, E J

    1996-03-01

    The papillomavirus E2 protein contains an amino-terminal region thought necessary and sufficient to support transcriptional activation and a carboxy-terminal region shown to direct sequence-specific DNA binding and dimerization. A cysteine residue in the center of the E2 DNA recognition helix is highly conserved among papillomavirus E2 proteins. Mutations of this cysteine in bovine papillomavirus type 1 E2 to serine and glycine resulted in proteins which failed to activate E2-dependent promoters in mammalian cells. These E2 mutants were DNA-binding competent, dimeric, and nuclear. When fused to the VP16 transactivation domain, C-terminal regions of E2 containing the mutations at 340 supported transcriptional activation, indicating that the heterologous trans-activation domain did not require cysteine in the DNA-binding helix as did the full-length E2 transactivating protein. Although cysteine-340 was required for transcriptional activation it was not required for DNA replication in vivo. Together, these results suggest that the E2 DNA-binding domain may directly contribute to functions of transcriptional activation previously thought limited to the N-terminal domain. PMID:8599215

  10. NuSTAR and XMM-Newton observations of 1E1743.1-2843: indications of a neutron star LMXB nature of the compact object

    CERN Document Server

    Lotti, Simone; Mori, Kaya; Baganoff, Frederick K; Boggs, Steven E; Christensen, Finn E; Craig, William W; Hailey, Charles J; Harrison, Fiona A; Hong, Jaesub; Krivonos, Roman A; Rahoui, Farid; Stern, Daniel; Tomsick, John A; Zhang, Shuo; Zhang, William W

    2016-01-01

    We report on the results of NuSTAR and XMM-Newton observations of the persistent X-ray source \\object{1E1743.1-2843}, located in the Galactic Center region. The source was observed between September and October 2012 by NuSTAR and XMM-Newton, providing almost simultaneous observations in the hard and soft X-ray bands. The high X-ray luminosity points to the presence of an accreting compact object. We analyze the possibilities of this accreting compact object being either a neutron star (NS) or a black hole, and conclude that the joint XMM-Newton and NuSTAR spectrum from 0.3 to 40 $\\mathrm{keV}$ fits to a black body spectrum with $kT\\sim1.8~\\mathrm{keV}$ emitted from a hot spot or an equatorial strip on a neutron star surface. This spectrum is thermally Comptonized by electrons with $kT_{e}\\sim4.6~\\mathrm{keV}$. Accepting this neutron star hypothesis, we probe the Low Mass (LMXB) or High Mass (HMXB) X-ray Binary nature of the source. While the lack of Type-I bursts can be explained in the LMXB scenario, the abs...

  11. Effects of zinc supplementation and zinc chelation on in vitro β-cell function in INS-1E cells

    DEFF Research Database (Denmark)

    Nygaard, Sanne Bjørn; Larsen, Agnete; Knuhtsen, Astrid;

    2014-01-01

    BACKGROUND: Zinc is essential for the activities of pancreatic β-cells, especially insulin storage and secretion. Insulin secretion leads to co-release of zinc which contributes to the paracrine communication in the pancreatic islets. Zinc-transporting proteins (zinc-regulated transporter, iron......-regulated transporter-like proteins [ZIPs] and zinc transporters [ZnTs]) and metal-buffering proteins (metallothioneins, MTs) tightly regulate intracellular zinc homeostasis. The present study investigated how modulation of cellular zinc availability affects β-cell function using INS-1E cells. RESULTS: Using INS-1E...... cells, we found that zinc supplementation and zinc chelation had significant effects on insulin content and insulin secretion. Supplemental zinc within the physiological concentration range induced insulin secretion. Insulin content was reduced by zinc chelation with N,N,N',N-tektrakis(2-pyridylmethyl...

  12. Characterization of the Functional Activities of the Bovine Papillomavirus Type 1 E2 Protein Single-Chain Heterodimers▿

    OpenAIRE

    Kurg, Reet; Tekkel, Helena; Abroi, Aare; Ustav, Mart

    2006-01-01

    Papillomaviruses are small DNA viruses which establish persistent infection in the epithelial tissue of various animal species. Three papillomavirus proteins encoded by the bovine papillomavirus type 1 E2 open reading frame have a common C-terminal DNA binding and dimerization domain and function as dimeric proteins in the regulation of viral gene expression, genome replication, and maintenance. The full-length E2 protein, expressed usually at the lowest level of the three, is an activator, w...

  13. Cooperative activation of transcription by bovine papillomavirus type 1 E2 can occur over a large distance.

    OpenAIRE

    Thierry, F; Dostatni, N; Arnos, F; Yaniv, M

    1990-01-01

    The viral transcriptional factors encoded by the E2 open reading frame bind to the specific DNA sequence elements ACCGNNNNCGGT, allowing activation or repression of transcription. We have analyzed bovine papillomavirus type 1 E2 transactivation using recombinant genes containing E2-binding sites inserted at either 3' or 5' positions relative to the heterologous transcriptional initiation site of the herpes simplex virus thymidine kinase gene. In these hybrid plasmids, strong transactivation r...

  14. AKT1 E17K mutation profiling in breast cancer: prevalence, concurrent oncogenic alterations, and blood-based detection

    OpenAIRE

    Rudolph, Marion; Anzeneder, Tobias; Schulz, Anke; Beckmann, Georg; Byrne, Annette T.; Jeffers, Michael; Pena, Carol; Politz, Oliver; Köchert, Karl; Vonk, Richardus; Reischl, Joachim

    2016-01-01

    Background: The single hotspot mutation AKT1 [G49A:E17K] has been described in several cancers, with the highest incidence observed in breast cancer. However, its precise role in disease etiology remains unknown.Methods: We analyzed more than 600 breast cancer tumor samples and circulating tumor DNA for AKT1 E17K and alterations in other cancer-associated genes using Beads, Emulsions, Amplification, and Magnetics digital polymerase chain reaction technology and targeted exome sequencing.Resul...

  15. AKT1 (E17K) mutation profiling in breast cancer: prevalence, concurrent oncogenic alterations, and blood-based detection.

    OpenAIRE

    Rudolph, Marion; Anzeneder, Tobias; Schulz, Anke; Beckmann, Georg; Byrne, Annette T.; Jeffers, Michael; Pena, Carol; Politz, Oliver; Köchert, Karl; Vonk, Richardus; Reischl, Joachim

    2016-01-01

    BACKGROUND: The single hotspot mutation AKT1 [G49A:E17K] has been described in several cancers, with the highest incidence observed in breast cancer. However, its precise role in disease etiology remains unknown. METHODS: We analyzed more than 600 breast cancer tumor samples and circulating tumor DNA for AKT1 (E17K) and alterations in other cancer-associated genes using Beads, Emulsions, Amplification, and Magnetics digital polymerase chain reaction technology and targeted exome sequencing...

  16. Observations of the magnetars 4U 0142+61 and 1E 2259+586 with the MAGIC telescopes

    CERN Document Server

    Aleksić, J; Antoranz, P; Asensio, M; de Almeida, U Barres; Barrio, J A; Bednarek, W; Berger, K; Bernardini, E; Biland, A; Blanch, O; Bock, R K; Boller, A; Bonnefoy, S; Bonnoli, G; Tridon, D Borla; Bretz, T; Carmona, E; Carosi, A; Fidalgo, D Carreto; Colin, P; Colombo, E; Contreras, J L; Cortina, J; Cossio, L; Covino, S; Da Vela, P; Dazzi, F; De Angelis, A; De Caneva, G; De Lotto, B; Mendez, C Delgado; Doert, M; Domínguez, A; Prester, D Dominis; Dorner, D; Doro, M; Eisenacher, D; Elsaesser, D; Ferenc, D; Fonseca, M V; Font, L; Fruck, C; López, R J García; Garczarczyk, M; Terrats, D Garrido; Gaug, M; Giavitto, G; Godinović, N; Muñoz, A González; Gozzini, S R; Hadamek, A; Hadasch, D; Herrero, A; Hose, J; Hrupec, D; Jankowski, F; Kadenius, V; Klepser, S; Knoetig, M L; Krähenbühl, T; Krause, J; Kushida, J; La Barbera, A; Lelas, D; Leonardo, E; Lewandowska, N; Lindfors, E; Lombardi, S; López, M; López-Coto, R; López-Oramas, A; Lorenz, E; Lozano, I; Makariev, M; Mallot, K; Maneva, G; Mankuzhiyil, N; Mannheim, K; Maraschi, L; Marcote, B; Mariotti, M; Martínez, M; Masbou, J; Mazin, D; Meucci, M; Miranda, J M; Mirzoyan, R; Moldón, J; Moralejo, A; Munar-Adrover, P; Nakajima, D; Niedzwiecki, A; Nieto, D; Nilsson, K; Nowak, N; Orito, R; Paiano, S; Palatiello, M; Paneque, D; Paoletti, R; Paredes, J M; Partini, S; Persic, M; Pilia, M; Prada, F; Moroni, P G Prada; Prandini, E; Puljak, I; Reichardt, I; Reinthal, R; Rhode, W; Ribó, M; Rico, J; Rügamer, S; Saggion, A; Saito, K; Saito, T Y; Salvati, M; Satalecka, K; Scalzotto, V; Scapin, V; Schultz, C; Schweizer, T; Shore, S N; Sillanpää, A; Sitarek, J; Snidaric, I; Sobczynska, D; Spanier, F; Spiro, S; Stamatescu, V; Stamerra, A; Steinke, B; Storz, J; Sun, S; Surić, T; Takalo, L; Takami, H; Tavecchio, F; Temnikov, P; Terzić, T; Tescaro, D; Teshima, M; Tibolla, O; Torres, D F; Toyama, T; Treves, A; Uellenbeck, M; Vogler, P; Wagner, R M; Weitzel, Q; Zandanel, F; Zanin, R; Rea, N

    2012-01-01

    Magnetars are an extreme, highly magnetized class of isolated neutron stars whose large X-ray luminosity is believed to be driven by their high magnetic field. In this work we study for the first time the possible very high energy gamma-ray emission above 100 GeV from magnetars, observing the sources 4U 0142+61 and 1E 2259+586. We observed the two sources with atmospheric Cherenkov telescopes in the very high energy range (E > 100 GeV). 4U 0142+61 was observed with the MAGIC I telescope in 2008 for ~25 h and 1E 2259+586 was observed with the MAGIC stereoscopic system in 2010 for ~14 h. The data were analyzed with the standard MAGIC analysis software. Neither magnetar was detected. Upper limits to the differential and integral flux above 200 GeV were computed using the Rolke algorithm. We obtain integral upper limits to the flux of 1.52*10^-12cm^-2 s^-1 and 2.7*10^-12cm^-2 s^-1 with a confidence level of 95% for 4U 0142+61 and 1E 2259+586, respectively. The resulting differential upper limits are presented tog...

  17. Optical and X-ray Spectroscopy of 1E 0449.4-1823 Demise of the original type 2 QSO

    CERN Document Server

    Halpern, J P; Forster, K; Halpern, Jules P.; Eracleous, Michael; Forster, Karl

    1998-01-01

    New optical spectra of the original narrow-line quasar 1E 0449.4-1823 show that it now has broad emission lines of considerable strength, eliminating it as a "type 2 QSO" candidate. We suggest that the behavior of 1E 0449.4-1823 is the same as that of some Seyfert 1.8 and 1.9 galaxies, in which Goodrich attributed long-term variations of their broad Balmer lines to dynamical motions of obscuring material located in or around the broad-line region. The optical continuum and broad emission-line regions of 1E 0449.4-1823 may still be partly covered in our line of sight, which would explain its large forbidden-line equivalent widths and flat alpha_ox relative to other low-redshift QSOs. Also present are apparent absorption features in the broad Balmer lines and in Mg II, which may be related to the past obscuration and current emergence of the broad-line region. However, it is difficult to distinguish absorption from broad emission-line peaks that are displaced in velocity; we consider the latter a plausible comp...

  18. A glitch and an anti-glitch in the anomalous X-ray pulsar 1E 1841-045

    CERN Document Server

    Mus, Sinem Sasmaz; Gogus, Ersin

    2014-01-01

    We investigated the long-term spin properties of the anomalous X-ray pulsar (AXP) 1E 1841-045 by performing a temporal analysis of archival RXTE observations spanning about 5.2 yr from 2006 September to 2011 December. We identified two peculiar timing anomalies within ~1 yr of each other: a glitch with Delta(nu)/nu ~ 4.8 x 10^{-6} near MJD 54303; and an anti-glitch with Delta(nu)/nu ~ -5.8 x 10^{-7} near MJD 54656. The glitch that we identified, which is the fourth glitch seen in this source in the 13 yr of RXTE monitoring, is similar to the last two detected glitches. The anti-glitch from 1E 1841-045, however, is the first to be identified. The amplitude of the anti-glitch was comparable with that recently observed in AXP 1E 2259+586. We found no significant variations in the pulsed X-ray output of the source during either the glitch or the anti-glitch. We discuss our results in relation to the standard pulsar glitch mechanisms for the glitch, and to plausible magnetospheric scenarios for the anti-glitch.

  19. Suppression of the Nuclear Factor Eny2 Increases Insulin Secretion in Poorly Functioning INS-1E Insulinoma Cells

    Directory of Open Access Journals (Sweden)

    P. Dames

    2012-01-01

    Full Text Available Eny2, the mammalian ortholog of yeast Sus1 and drosophila E(y2, is a nuclear factor that participates in several steps of gene transcription and in mRNA export. We had previously found that Eny2 expression changes in mouse pancreatic islets during the metabolic adaptation to pregnancy. We therefore hypothesized that the protein contributes to the regulation of islet endocrine cell function and tested this hypothesis in rat INS-1E insulinoma cells. Overexpression of Eny2 had no effect but siRNA-mediated knockdown of Eny2 resulted in markedly increased glucose and exendin-4-induced insulin secretion from otherwise poorly glucose-responsive INS-1E cells. Insulin content, cellular viability, and the expression levels of several key components of glucose sensing remained unchanged; however glucose-dependent cellular metabolism was higher after Eny2 knockdown. Suppression of Eny2 enhanced the intracellular incretin signal downstream of cAMP. The use of specific cAMP analogues and pathway inhibitors primarily implicated the PKA and to a lesser extent the EPAC pathway. In summary, we identified a potential link between the nuclear protein Eny2 and insulin secretion. Suppression of Eny2 resulted in increased glucose and incretin-induced insulin release from a poorly glucose-responsive INS-1E subline. Whether these findings extend to other experimental conditions or to in vivo physiology needs to be determined in further studies.

  20. Metronomic Cyclophosphamide and Methotrexate Chemotherapy Combined with 1E10 Anti-Idiotype Vaccine in Metastatic Breast Cancer

    Directory of Open Access Journals (Sweden)

    Jorge L. Soriano

    2011-01-01

    Full Text Available The use of low doses of cytotoxic agents continuously for prolonged periods is an alternative for the treatment of patients with metastatic breast cancer who have developed resistance to conventional chemotherapy. The combination of metronomic chemotherapy with therapeutic vaccines might increase the efficacy of the treatment. Twenty one patients with metastatic breast cancer in progression and a Karnosky index ≥60%, were treated with metronomic chemotherapy (50 mg of cyclophospamide orally daily and 2.5 mg of methotrexate orally bi-daily, in combination with five bi-weekly subcutaneous injections of 1 mg of aluminum hydroxide-precipitated 1E10 anti-idiotype MAb (1E10-Alum, followed by reimmunizations every 28 days. Five patients achieved objective response, eight showed stable disease and eight had disease progression. Median time to progression was 9,8 months, while median overall survival time was 12,93 months. The median duration of the response (CR+PR+SD was 18,43 months (12,20–24,10 months, being higher than 12 months in 76,9% of the patients. Overall toxicity was generally mild. Metronomic chemotherapy combined with 1E10-Alum vaccine immunotherapy might be a useful therapeutic option for the treatment of metastatic breast cancer due to its potential impact on survival and patient quality of live, low toxicity and advantages of the administration.

  1. Reliability Centered Maintenance - Methodologies

    Science.gov (United States)

    Kammerer, Catherine C.

    2009-01-01

    Journal article about Reliability Centered Maintenance (RCM) methodologies used by United Space Alliance, LLC (USA) in support of the Space Shuttle Program at Kennedy Space Center. The USA Reliability Centered Maintenance program differs from traditional RCM programs because various methodologies are utilized to take advantage of their respective strengths for each application. Based on operational experience, USA has customized the traditional RCM methodology into a streamlined lean logic path and has implemented the use of statistical tools to drive the process. USA RCM has integrated many of the L6S tools into both RCM methodologies. The tools utilized in the Measure, Analyze, and Improve phases of a Lean Six Sigma project lend themselves to application in the RCM process. All USA RCM methodologies meet the requirements defined in SAE JA 1011, Evaluation Criteria for Reliability-Centered Maintenance (RCM) Processes. The proposed article explores these methodologies.

  2. National Farm Medicine Center

    Science.gov (United States)

    Research Areas Applied Sciences Biomedical Informatics Clinical Research Epidemiology Farm Medicine Human Genetics Oral-Systemic Health Clinical ... Consulting Agritourism Farm MAPPER Lyme Disease ROPS Rebate Zika Virus National Farm Medicine Center The National Farm ...

  3. Cooperative Tagging Center (CTC)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Cooperative Tagging Center (CTC) began as the Cooperative Game Fish Tagging Program (GTP) at Woods Hole Oceanographic Institute (WHOI) in 1954. The GTP was...

  4. Carbon Monoxide Information Center

    Medline Plus

    Full Text Available ... Chairman Commissioners Contact Information Agency Reports Legislative Affairs Job Opportunities Inspector General Safety Guides Safety Education Centers OnSafety Blog Neighborhood Safety Network Community Outreach ...

  5. FEMA Disaster Recovery Centers

    Data.gov (United States)

    Department of Homeland Security — This is a search site for FEMA's Disaster Recovery Centers (DRC). A DRC is a readily accessible facility or mobile office set up by FEMA where applicants may go for...

  6. Health Center Controlled Network

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Health Center Controlled Network (HCCN) tool is a locator tool designed to make data and information concerning HCCN resources more easily available to our...

  7. Centering in Japanese Discourse

    CERN Document Server

    Walker, M; Côté, S; Walker, Marilyn; Iida, Masayo; Cote, Sharon

    1996-01-01

    In this paper we propose a computational treatment of the resolution of zero pronouns in Japanese discourse, using an adaptation of the centering algorithm. We are able to factor language-specific dependencies into one parameter of the centering algorithm. Previous analyses have stipulated that a zero pronoun and its cospecifier must share a grammatical function property such as {\\sc Subject} or {\\sc NonSubject}. We show that this property-sharing stipulation is unneeded. In addition we propose the notion of {\\sc topic ambiguity} within the centering framework, which predicts some ambiguities that occur in Japanese discourse. This analysis has implications for the design of language-independent discourse modules for Natural Language systems. The centering algorithm has been implemented in an HPSG Natural Language system with both English and Japanese grammars.

  8. HUD Homeownership Centers

    Data.gov (United States)

    Department of Housing and Urban Development — HUD Homeownership Centers (HOCs) insure single family Federal Housing Administration (FHA) mortgages and oversee the selling of HUD homes. FHA has four...

  9. Accredited Birth Centers

    Science.gov (United States)

    ... 717-933-9743 Accredited since January 2016 100 Bright Eyes Midwifery and Wild Rivers Women's Health Accredited ... Birthing Center-Cedar Park Accredited 1130 Cottonwood Creek Trail Building D Suite 2 Cedar Park, TX 78613 ...

  10. ADVANCED DATA CENTER ECONOMY

    OpenAIRE

    Sukhov, R.; Amzarakov, M.; Isaev, E.

    2013-01-01

    The article addresses basic Data Centers (DC) drivers of price and engineering, which specify rules and price evaluation for creation and further operation. DC energy efficiency concept, its influence on DC initial price, operation costs and Total Cost of Ownership.

  11. National Automotive Center - NAC

    Data.gov (United States)

    Federal Laboratory Consortium — Encouraged by the advantages of collaboration, the U.S. Army Tank Automotive Research, Development and Engineering Center (TARDEC) worked with the Secretary of the...

  12. World Trade Center

    Index Scriptorium Estoniae

    2006-01-01

    Esilinastus katastroofifilm "World Trade Center" : stsenarist Andrea Berloff : režissöör Oliver Stone : kunstnik Jan Roelfs : osades Nicholas Cage, Michael Pena, Stephen Dorff jpt : Ameerika Ühendriigid 2006. Ka filmi prototüüpidest

  13. Center for Contaminated Sediments

    Data.gov (United States)

    Federal Laboratory Consortium — The U.S. Army Corps of Engineers Center for Contaminated Sediments serves as a clearinghouse for technology and expertise concerned with contaminated sediments. The...

  14. USU Patient Simulation Center

    Data.gov (United States)

    Federal Laboratory Consortium — he National Capital Area (NCA) Medical Simulation Center is a state-of-the-art training facility located near the main USU campus. It uses simulated patients (i.e.,...

  15. Center Innovation Fund Program

    Data.gov (United States)

    National Aeronautics and Space Administration — To stimulate and encourage creativity and innovation within the NASA Centers. The activities are envisioned to fall within the scope of NASA Space Technology or...

  16. Hazardous Waste Research Center

    Data.gov (United States)

    Federal Laboratory Consortium — A full-service research and evaluation center equipped with safety equipment, a high-bay pilot studies area, and a large-scale pilot studies facility The U.S. Army...

  17. Advanced Missile Signature Center

    Data.gov (United States)

    Federal Laboratory Consortium — The Advanced Missile Signature Center (AMSC) is a national facility supporting the Missile Defense Agency (MDA) and other DoD programs and customers with analysis,...

  18. CNPC International Research Center

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    @@ CNPC International Research Center (CNPCIRC), jointly managed by CNODC and RIPED of China National Petroleum Corporation (CNPC), was established in 1999 for providing technical research support to all the overseas oil and gas projects of CNPC.

  19. The Galactic Center

    OpenAIRE

    R. Genzel; Karas, V.

    2007-01-01

    In the past decade high resolution measurements in the infrared employing adaptive optics imaging on 10m telescopes have allowed determining the three dimensional orbits stars within ten light hours of the compact radio source at the center of the Milky Way. These observations show the presence of a three million solar mass black hole in Sagittarius A* beyond any reasonable doubt. The Galactic Center thus constitutes the best astrophysical evidence for the existence of black holes which have ...

  20. Oil Reserve Center Established

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Like other countries,China has started to grow its strategic oil reserve in case oil supplies are cut On December 18,2007,the National Development and Reform Commission(NDRC),China’s top economic planner,announced that the national oil reserve center has been officially launched.The supervisory system over the oil reserves has three levels: the energy department of the NDRC,the oil reserve center,and the reserve bases.

  1. THE HUMORAL AND CELLULAR IMMUNE RESPONSES INDUCED BY HPV18L1-E6/E7 DNA VACCINES IN MICE

    Institute of Scientific and Technical Information of China (English)

    Yang Jin; Li Xu; Li Ang; Wang Yili; Si Lüsheng

    2006-01-01

    Objective To construct eukaryotic expression vector of HPV18 L1- E6, E7 chimeric gene and examine the humoral and cellular immune responses induced by this DNA vaccines in mice. Methods The C-terminal of major capsid protein L1 gene and mutant zinc finger domains of early E6/7 oncogenes in HPV18 were integrated and inserted into eukaryotic expression vector pVAX1 to generate vaccines pVAX1-L1E6Mxx, E7Mxx. CHO cells were transiently transfected with the individual construct. Target protein expressions in the lysate of the transfected cells were measured by ELISA and immunocytochemistry. After BALB/c mice were vaccinated with various recombinant plasmids(pVAX1-L1-E6M3 or pVAX1-L1-E7M3) and immunie adjuvants (pLXHDmB7-2 or LTB) through different administration routes (intramuscular or intranasal) , the great cellular immune responses were produced as revealed by delayed-type hypersensitivity (DTH) and lymphocyte proliferation, and the expression of IL-4 and IFN- γ cells in CD4+ and CD8+subpopulations. Results The highly efficient expression of pVAX1-L1E6Mxx, E7Mxx vector in host eukaryotic cells were demonstrated both by ELISA and immunocytochemistry. The level of specific serum IgG against HPV in experiment groups mice was much higher than that of control group, and intranuscular immunization group had the highest antibody level. Intramuscular immunization groups were superior to intranasal immunization groups in DTH response, splenocyte proliferation and CD8+ IFN-γ + cells number, but CD4+ IL4+ cell number was higher in intranasal immunization groups. The immunization groups using pLXHDmB7-2 as adjuvant were superior to other groups in immunoresponse. Conclusion These DNA vaccines produce remarkable cellular and humoral immuneresponses in the mouse and may provide as prophylatic and therapeutic candidates for HPV induced cancer treatment.

  2. Suzaku and XMM-Newton observations of the newly discovered early-stage cluster merger of 1E2216.0-0401 and 1E2215.7-0404

    Science.gov (United States)

    Akamatsu, H.; Gu, L.; Shimwell, T. W.; Mernier, F.; Mao, J.; Urdampilleta, I.; de Plaa, J.; Röttgering, H. J. A.; Kaastra, J. S.

    2016-09-01

    We present the results of Suzaku and XMM-Newton X-ray observations of the cluster pair 1E2216.0-0401 and 1E2215.7-0404. We discover an X-ray bridge between the clusters. Suzaku and XMM-Newton observations revealed that each cluster hosts gas with moderate temperature of kT0401 = 4.8 ± 0.1 keV and kT0404 = 5.8 ± 0.2 keV, respectively. On the other hand, the bridge region shows a remarkably high temperature (kT = 6.6 ± 0.5 keV). Furthermore, at the position of the bridge, we detected an enhancement in the wavelet-decomposed soft-band (0.5-4.0 keV) XMM-Newton image at 3 sigma significance, this is most likely due to a compression of the intracluster medium (ICM) as a consequence of the merging activity. This X-ray intensity and temperature enhancement are not consistent with those expected from a late phase, but are in agreement with the predictions by numerical simulations of an early phase merger. From the temperature jump at the location of the bridge, the Mach number is estimated to be ℳ = 1.4 ± 0.1, which corresponds to a shock propagation velocity of about 1570 km s-1. From the shock properties, we estimate that core-passage will occur in 0.3-0.6 Gyr and that the age of the shock structure is 50-100 Myr. Based on the measured properties of the ICM at the bridge and estimation of timescales, we find indications for non-equilibrium ionization. We also discover possible diffuse radio emission located between the merging clusters. Combining the radio, X-ray, and optical image data, we speculate that the detected radio sources are most likely related to the merger event. Thus, 1E2216.0-0401 and 1E2215.7-0404 is a new example of an early phase cluster merger with remarkable characteristics.

  3. UCSF Center for HIV Information

    Science.gov (United States)

    ... Program For providers and patients VA National Viral Hepatitis Program For providers and patients TARGET Center Technical assistance tools for the Ryan White Community AETC National Resource Center Education and training for clinicians UCSF-Gladstone Center for ...

  4. Changes in the X-Ray Emission from the Magnetar Candidate 1E 2259+586 During its 2002 Outburst

    Science.gov (United States)

    Woods, P. M.; Kaspi, V. M.; Thompson, C.; Gavrill, F. P.; Marshall, H. L.; Chakrabarty, D.; Flanagan, K.; Heyl, J.; Hernquist, L.

    2004-01-01

    An outburst of more than 80 individual bursts, similar to those seen from Soft Gamma Repeaters (SGRs), was detected from the anomalous X-ray pulsar (AXP) 1E 2259+586 in 2002 June. Coincident with this burst activity were gross changes in the pulsed flux, persistent flux, energy spectrum, pulse profile, and spin-down of the underlying X-ray source. We present Rossi X-Ray Timing Explorer and X-Ray Multi-Mirror Mission observations of 1E 2259+586 that show the evolution of the aforementioned source parameters during and following this episode and identify recovery timescales for each. Specifically, we observe an X-ray flux increase (pulsed and phase-averaged) by more than an order of magnitude having two distinct components. The first component is linked to the burst activity and decays within approx. 2 days, during which the energy spectrum is considerably harder than during the quiescent state of the source. The second component decays over the year following the glitch according to a power law in time with an exponent -0.22 +/- 0.01. The pulsed fraction decreased initially to approx. 15% rms but recovered rapidly to the preoutburst level of approx. 23% within the first 3 days. The pulse profile changed significantly during the outburst and recovered almost fully within 2 months of the outburst. A glitch of size Delta(sib (nu)max) = (4.24 +/- 0.11) x 10(exp -6) was observed in 1E 2259+586, which preceded the observed burst activity. The glitch could not be well fitted with a simple partial exponential recovery. An exponential rise of approx. 20% of the frequency jump with a timescale of approx. 14 days results in a significantly better fit to the data; however, contamination from a systematic drift in the phase of the pulse profile cannot be excluded. A fraction of the glitch (approx. 19%) was recovered in a quasi-exponential manner having a recovery timescale of approx. 16 days. The long-term postglitch spin-down rate decreased in magnitude relative to the

  5. Spectroscopic investigation, photophysical parameters and DFT calculations of 4,4'-(1E,1'E)-2,2'-(pyrazine-2,5-diyl)bis(ethene-2,1-diyl)bis(N,N-dimethylaniline) (PENDA) in different solvents.

    Science.gov (United States)

    Asiri, Abdullah M; Alamry, Khalid A; Pannipara, Mehboobali; Al-Sehemi, Abdullah G; El-Daly, Samy A

    2015-10-01

    A comprehensive investigation on the photophysics of a π-conjugated potential push-pull chromophore system 4,4'-(1E,1'E)-2,2'-(Pyrazine-2,5-diyl)bis(ethene-2,1-diyl)bis(N,N-dimethylaniline) (PENDA) has been carried out spectroscopically. The optical absorption and emission properties of this molecule have been studied in different solvents. The molecule PENDA shows strong solvatochromic emission upon changing the solvent polarity from nonpolar to polar; indicating that emission state is of intramolecular charge transfer (ICT) character. The solvent effect on the spectral properties such as singlet absorption, molar absorptivity, oscillator strength, dipole moment and fluorescence quantum yield of PENDA have been studied in detail. Lippert-Mataga and Reichardt correlations were used to estimate the difference between the excited and ground state dipole moments (Δμ). Ground and electronic excited states geometric optimizations were performed using density functional theory (DFT) and time-dependent density functional theory (TDDFT), respectively, with the Gaussian 09 package. A solution of (8×10(-5) M) PENDA in THF, dioxane, CH3CN and CHCl3 gives laser emission when pumped by a nitrogen laser pulse (λex=337.1 nm) of 800 ps duration and 1.48 mJ pulse energy. PENDA dye displays fluorescence quenching by colloidal silver nanoparticles (Ag NPs) in ethanol. The fluorescence data reveal that dynamic quenching and energy transfer play a major role in the fluorescence quenching mechanism. PMID:25988818

  6. Crystal Structure of UBA2[superscript ufd]-Ubc9: Insights into E1-E2 Interactions in Sumo Pathways

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Jing; Taherbhoy, Asad M.; Hunt, Harold W.; Seyedin, Steven N.; Miller, David W.; Miller, Darcie J.; Huang, Danny T.; Schulman, Brenda A. (SJCH)

    2012-04-30

    Canonical ubiquitin-like proteins (UBLs) such as ubiquitin, Sumo, NEDD8, and ISG15 are ligated to targets by E1-E2-E3 multienzyme cascades. The Sumo cascade, conserved among all eukaryotes, regulates numerous biological processes including protein localization, transcription, DNA replication, and mitosis. Sumo conjugation is initiated by the heterodimeric Aos1-Uba2 E1 enzyme (in humans called Sae1-Uba2), which activates Sumo's C-terminus, binds the dedicated E2 enzyme Ubc9, and promotes Sumo C-terminal transfer between the Uba2 and Ubc9 catalytic cysteines. To gain insights into details of E1-E2 interactions in the Sumo pathway, we determined crystal structures of the C-terminal ubiquitin fold domain (ufd) from yeast Uba2 (Uba2{sup ufd}), alone and in complex with Ubc9. The overall structures of both yeast Uba2{sup ufd} and Ubc9 superimpose well on their individual human counterparts, suggesting conservation of fundamental features of Sumo conjugation. Docking the Uba2{sup ufd}-Ubc9 and prior full-length human Uba2 structures allows generation of models for steps in Sumo transfer from Uba2 to Ubc9, and supports the notion that Uba2 undergoes remarkable conformational changes during the reaction. Comparisons to previous structures from the NEDD8 cascade demonstrate that UBL cascades generally utilize some parallel E1-E2 interaction surfaces. In addition, the structure of the Uba2{sup ufd}-Ubc9 complex reveals interactions unique to Sumo E1 and E2. Comparison with a previous Ubc9-E3 complex structure demonstrates overlap between Uba2 and E3 binding sites on Ubc9, indicating that loading with Sumo and E3-catalyzed transfer to substrates are strictly separate steps. The results suggest mechanisms establishing specificity and order in Sumo conjugation cascades.

  7. A Burst and Simultaneous Short-term Pulsed Flux Enhancement fom the Magnetar Candidate 1E 1048.1-5937

    Science.gov (United States)

    Gavriil, Fotis P.; Kaspi, Victoria M.; Woods, Peter M.; Lyutikov, Maxim

    2005-01-01

    We report on the latest X-ray burst detected from the direction of the Anomalous X-ray Pulsar (AXP) 1E 1048.1-5937 using the Rossi X-ray Timing Explorer (RXTE). Following the burst the AXP was observed further with RXTE, XMM-Newton and Chandra. We find a simultaneous increase of approx. 3.7 times the quiescent value (approx. 5 sigma) in the pulsed component of the pulsar's flux during the tail of the burst which identifies the AXP as the burst's origin. The burst was overall very similar to the two others reported from this source in 2001. The unambiguous identification of 1E 1048.1-5937 as the burster here suggests it was in 2001 as well. Pre- and post-burst observations revealed no change in the total flux or spectrum of the quiescent emission. Comparing all three bursts detected thus far from this source we find that this event was the most fluent (170+/-42 x 10(exp -10) erg cm-2), had the highest peak flux (71+/-16 x 10(exp -10) erg/s/sq cm), the longest duration (approx. 411 s). The epoch of the burst peak was consistent with the arrival time of 1E 1048.1-5937's pulse peak. The burst exhibited significant spectral evolution with the trend going from hard to soft. Although the average spectrum of the burst was comparable in hardness (Gamma approx. 1) to those of the 2001 bursts, the peak of this burst was much harder (Gamma approx. 0.5).

  8. Optical identification of the supersoft X-ray source 1E 0035.4 in the Small Magellanic Cloud

    Science.gov (United States)

    Orio, M.; Della Valle, M.; Massone, G.; Ogelman, H.

    1994-01-01

    We report the identification of the optical counterpart of the Small Magellanic Cloud (SMC) super-soft X-ray source 1E0035.4- 7230 with a variable star of the magnitude B = 19.9-20.2 within the 40 arcsecs Einstein error box. The star shows strong UV excess, a hot, blue continuum and weak lines of high ionization. The lines are red-shifted by 3-4 A, indicating SMC membership. This object appears similar to CAL 83 and CAL 87 and is probably a binary system hosting an accreting, hydrogen burning white dwarf.

  9. The IΔKI = 1, E1 Transitions in Odd-A isotopes of Tb and Eu

    International Nuclear Information System (INIS)

    Life-time measurements have been performed for the 5/2- [532] intrinsic state in the Tb isotopes with A = 155, 157, 159, and 161. The rates of the ΔK = 1 E1 transitions in these isotopes, as well as in 153Eu and 155Eu, are discussed. With the Nilsson model as a starting point, the effects of pairing correlations and Coriolis coupling are calculated. It is found that these effects are not sufficient to account for the essential features of the experimental results. It is suggested that dipole contributions arising through octupole excitations are of importance

  10. Amino-terminal domains of the bovine papillomavirus type 1 E1 and E2 proteins participate in complex formation.

    OpenAIRE

    Benson, J D; Howley, P M

    1995-01-01

    Interaction between the E1 and E2 papillomavirus proteins appear to play an important role in viral DNA replication, although the exact domains of each protein involved in this interaction have not been identified. Using bovine papillomavirus type 1 (BPV-1) as a model for examining interactions between E1 and E2, we have used the two-hybrid and glutathione S-transferase (GST) fusion systems to map domains of BPV-1 E1 and E2 that interact in vivo and in vitro. In the two-hybrid system experime...

  11. Bovine papillomavirus type 1 E2 transcriptional regulators directly bind two cellular transcription factors, TFIID and TFIIB.

    OpenAIRE

    Rank, N M; Lambert, P F

    1995-01-01

    The bovine papillomavirus type 1 (BPV-1) E2 translational open reading frame encodes three proteins that regulate viral transcription and DNA replication: the E2 transcriptional activator (E2TA), the E2 transcriptional repressor (E2TR) and the E8/E2 transcriptional repressor (E8/E2TR). E2TA is a strong activator of papillomaviral promoters and is required for viral DNA replication. E2TR and E8/E2TR inhibit the activities of E2TA but also possess weak transactivational properties of their own....

  12. A Burst and Simultaneous Short-Term Pulsed Flux Enhancement From The Magnetar Candidate 1E 1048.1-5937

    Science.gov (United States)

    Gavriil, Fotis P.; Kaspi, Victoria M.; Woods, Peter M.

    2006-01-01

    We report on the 2004 June 29 X-ray burst detected from the direction of the AXP 1E 1048.1-5937 using the RXTE. We find a simultaneous increase of approx. 3.5 times the quiescent value in the 2-10 keV pulsed flux of 1E 1048.1-5937 during the tail of the burst, which identifies the AXP as the burst s origin. The burst was overall very similar to the two others reported from the direction of this source in 2001. The unambiguous identification of 1E 1048.1-5937 as the burster here confirms that it was the origin of the 2001 bursts as well. The epoch of the burst peak was very close to the arrival time of 1E 1048.1-5937 s pulse peak. The burst exhibited significant spectral evolution, with the trend going from hard to soft. Although the average spectrum of the burst was comparable in hardness (Lambda approx. 1.6) to those,of the 2001 bursts, the peak of this burst was much harder (Lambda approx. 0.3). During the 11 days following the burst, the AXP was observed further with RXTE, XMM-Newton, and Chandra. Pre- and post-burst observations revealed no change in the total flux or spectrum of the quiescent emission. Comparing all three bursts detected thus far from this source, we find that this event was the most fluent (>3.3 x 10(exp-8 ergs/sq cm) in the 2-20 keV band), had the highest peak flux (59+/-9 x 10(exp -10)ergs/s/sq cm) in the 2-20 keV band), and had the longest duration (>699 s). The long duration of the burst difFerentiates it from SGR bursts, which have typical durations of approx.0.1 s. Bursts that occur preferentially at pulse maximum, have fast rises, and long X-tails containing the majority of the total burst energy have been seen uniquely from AXPs. The marked differences between AXP and SGRs bursts may provide new clues to help understand the physical differences between these objects.

  13. International Water Center

    Science.gov (United States)

    The urban district of Nancy and the Town of Nancy, France, have taken the initiative of creating an International Center of Water (Centre International de l'Eau à Nancy—NAN.C.I.E.) in association with two universities, six engineering colleges, the Research Centers of Nancy, the Rhine-Meuse Basin Agency, and the Chamber of Commerce and Industry. The aim of this center is to promote research and technology transfer in the areas of water and sanitation. In 1985 it will initiate a research program drawing on the experience of 350 researchers and engineers of various disciplines who have already been assigned to research in these fields. The research themes, the majority of which will be multidisciplinary, concern aspects of hygiene and health, the engineering of industrial processes, water resources, and the environment and agriculture. A specialist training program offering five types of training aimed at university graduates, graduates of engineering colleges, or experts, will start in October 1984.

  14. Patient-centered Care.

    Science.gov (United States)

    Reynolds, April

    2009-01-01

    Patient-centered care focuses on the patient and the individual's particular health care needs. The goal of patient-centered health care is to empower patients to become active participants in their care. This requires that physicians, radiologic technologists and other health care providers develop good communication skills and address patient needs effectively. Patient-centered care also requires that the health care provider become a patient advocate and strive to provide care that not only is effective but also safe. For radiologic technologists, patient-centered care encompasses principles such as the as low as reasonably achievable (ALARA) concept and contrast media safety. Patient-centered care is associated with a higher rate of patient satisfaction, adherence to suggested lifestyle changes and prescribed treatment, better outcomes and more cost-effective care. This article is a Directed Reading. Your access to Directed Reading quizzes for continuing education credit is determined by your area of interest. For access to other quizzes, go to www.asrt.org/store. According to one theory, most patients judge the quality of their healthcare much like they rate an airplane flight. They assume that the airplane is technically viable and is being piloted by competent people. Criteria for judging a particular airline are personal and include aspects like comfort, friendly service and on-time schedules. Similarly, patients judge the standard of their healthcare on nontechnical aspects, such as a healthcare practitioner's communication and "soft skills." Most are unable to evaluate a practitioner's level of technical skill or training, so the qualities they can assess become of the utmost importance in satisfying patients and providing patient-centered care.(1). PMID:19901351

  15. Center for Botanical Interaction Studies

    Data.gov (United States)

    Federal Laboratory Consortium — Research Area: Dietary Supplements, Herbs, Antioxidants Program:Centers for Dietary Supplements Research: Botanicals Description:This center will look at safety and...

  16. User Centered Design

    DEFF Research Database (Denmark)

    Egbert, Maria; Matthews, Ben

    2012-01-01

    The interdisciplinary approach of User Centered Design is presented here with a focus on innovation in the design and use of hearing technologies as well as on the potential of innovation in interaction. This approach is geared towards developing new products, systems, technologies and practices...... based on an understanding of why so few persons with hearing loss use the highly advanced hearing technologies. In integrating Conversation Analysis (“CA”), audiology and User Centered Design, three disciplines which are collaborating together for the first time, we are addressing the following...

  17. QUAD FAMILY CENTERING.

    Energy Technology Data Exchange (ETDEWEB)

    PINAYEV, I.

    2005-11-01

    It is well known that beam position monitors (BPM) utilizing signals from pickup electrodes (PUE) provide good resolution and relative accuracy. The absolute accuracy (i.e. position of the orbit in the vacuum chamber) is not very good due to the various reasons. To overcome the limitation it was suggested to use magnetic centers of quadrupoles for the calibration of the BPM [1]. The proposed method provides accuracy better then 200 microns for centering of the beam position monitors using modulation of the whole quadrupole family.

  18. Lied Transplant Center

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-02-01

    The Department of Energy has prepared an Environmental Assessment (DOE/EA-1143) evaluating the construction, equipping and operation of the proposed Lied Transplant Center at the University of Nebraska Medical Center in Omaha, Nebraska. Based on the analysis in the EA, the DOE has determined that the proposed action does not constitute a major federal action significantly affecting the quality of the human environment within the meaning of the National Environmental Policy Act of 1969 (NEPA). Therefore, the preparation of an Environmental Statement in not required.

  19. Xichang Satellite Launch Center

    Institute of Scientific and Technical Information of China (English)

    LiuJie

    2004-01-01

    Xichang Satellite Launch Center(XSLC) is mainly for geosynchronous orbit launches. The main purpose of XSLC is to launch spacecraft, such as broadcasting,communications and meteorological satellites, into geo-stationary orbit.Most of the commercial satellite launches of Long March vehicles have been from Xichang Satellite Launch Center. With 20 years' development,XSLC can launch 5 kinds of launch vehicles and send satellites into geostationary orbit and polar orbit. In the future, moon exploration satellites will also be launched from XSLC.

  20. Placental-Specific sFLT-1 e15a Protein Is Increased in Preeclampsia, Antagonizes Vascular Endothelial Growth Factor Signaling, and Has Antiangiogenic Activity.

    Science.gov (United States)

    Palmer, Kirsten R; Kaitu'u-Lino, Tu'uhevaha J; Hastie, Roxanne; Hannan, Natalie J; Ye, Louie; Binder, Natalie; Cannon, Ping; Tuohey, Laura; Johns, Terrance G; Shub, Alexis; Tong, Stephen

    2015-12-01

    In preeclampsia, the antiangiogenic factor soluble fms-like tyrosine kinase-1 (sFLT-1) is released from placenta into the maternal circulation, causing endothelial dysfunction and organ injury. A recently described splice variant, sFLT-1 e15a, is primate specific and the most abundant placentally derived sFLT-1. Therefore, it may be the major sFLT-1 isoform contributing to the pathophysiology of preeclampsia. sFLT-1 e15a protein remains poorly characterized: its bioactivity has not been comprehensively examined, and serum levels in normal and preeclamptic pregnancy have not been reported. We generated and validated an sFLT-1 e15a-specific ELISA to further characterize serum levels during pregnancy, and in the presence of preeclampsia. Furthermore, we performed assays to examine the bioactivity and antiangiogenic properties of sFLT-1 e15a protein. sFLT-1 e15a was expressed in the syncytiotrophoblast, and serum levels rose across pregnancy. Strikingly, serum levels were increased 10-fold in preterm preeclampsia compared with normotensive controls. We confirmed sFLT-1 e15a is bioactive and is able to inhibit vascular endothelial growth factor signaling of vascular endothelial growth factor receptor 2 and block downstream Akt phosphorylation. Furthermore, sFLT-1 e15a has antiangiogenic properties. sFLT-1 e15a decreased endothelial cell migration, invasion, and inhibited endothelial cell tube formation. Administering sFLT-1 e15a blocked vascular endothelial growth factor induced sprouts from mouse aortic rings ex vivo. We have demonstrated that sFLT-1 e15a is increased in preeclampsia, antagonizes vascular endothelial growth factor signaling, and has antiangiogenic activity. Future development of diagnostics and therapeutics for preeclampsia should consider targeting placentally derived sFLT-1 e15a.

  1. User-Centered Design through Learner-Centered Instruction

    Science.gov (United States)

    Altay, Burçak

    2014-01-01

    This article initially demonstrates the parallels between the learner-centered approach in education and the user-centered approach in design disciplines. Afterward, a course on human factors that applies learner-centered methods to teach user-centered design is introduced. The focus is on three tasks to identify the application of theoretical and…

  2. Economics of data center optics

    Science.gov (United States)

    Huff, Lisa

    2016-03-01

    Traffic to and from data centers is now reaching Zettabytes/year. Even the smallest of businesses now rely on data centers for revenue generation. And, the largest data centers today are orders of magnitude larger than the supercomputing centers of a few years ago. Until quite recently, for most data center managers, optical data centers were nice to dream about, but not really essential. Today, the all-optical data center - perhaps even an all-single mode fiber (SMF) data center is something that even managers of medium-sized data centers should be considering. Economical transceivers are the key to increased adoption of data center optics. An analysis of current and near future data center optics economics will be discussed in this paper.

  3. Long-Term RXTE Monitoring of the Anomalous X-ray Pulsar 1E 1048.1-5937

    CERN Document Server

    Kaspi, V M; Chakraborty, D; Lackey, J R; Muno, M P; Kaspi, Victoria M.; Gavriil, Fotis P.; Chakrabarty, Deepto; Lackey, Jessica R.; Muno, Michael P.

    2000-01-01

    We report on long-term monitoring of the anomalous X-ray pulsar (AXP) 1E 1048.1-5937 using the Rossi X-ray Timing Explorer (RXTE). The timing behavior of this pulsar is different from that of other AXPs being monitored with RXTE. In particular, we show that the pulsar shows significant deviations from simple spin-down such that phase-coherent timing has not been possible over time spans longer than a few months. We find that the deviations from simple spin down are not consistent with single "glitch" type events, nor are they consistent with radiative precession. We show that in spite of the rotational irregularities, the pulsar exhibits neither pulse profile changes nor large pulsed flux variations. We discuss the implications of our results for AXP models. In the context of the magnetar model, we suggest that 1E 1048.1-5937 may be a transition object between the soft gamma-ray repeater and AXP populations, and the AXP most likely to one day undergo an outburst.

  4. A Mutation in DAOA Modifies the Age of Onset in PSEN1 E280A Alzheimer's Disease

    Science.gov (United States)

    Vélez, Jorge I.; Rivera, Dora; Mastronardi, Claudio A.; Patel, Hardip R.; Tobón, Carlos; Villegas, Andrés; Cai, Yeping; Easteal, Simon; Arcos-Burgos, Mauricio

    2016-01-01

    We previously reported age of onset (AOO) modifier genes in the world's largest pedigree segregating early-onset Alzheimer's disease (AD), caused by the p.Glu280Ala (E280A) mutation in the PSEN1 gene. Here we report the results of a targeted analysis of functional exonic variants in those AOO modifier genes in sixty individuals with PSEN1 E280A AD who were whole-exome genotyped for ~250,000 variants. Standard quality control, filtering, and annotation for functional variants were applied, and common functional variants located in those previously reported as AOO modifier loci were selected. Multiloci linear mixed-effects models were used to test the association between these variants and AOO. An exonic missense mutation in the G72 (DAOA) gene (rs2391191, P = 1.94 × 10−4, PFDR = 9.34 × 10−3) was found to modify AOO in PSEN1 E280A AD. Nominal associations of missense mutations in the CLUAP1 (rs9790, P = 7.63 × 10−3, PFDR = 0.1832) and EXOC2 (rs17136239, P = 0.0325, PFDR = 0.391) genes were also found. Previous studies have linked polymorphisms in the DAOA gene with the occurrence of neuropsychiatric symptoms such as depression, apathy, aggression, delusions, hallucinations, and psychosis in AD. Our findings strongly suggest that this new conspicuous functional AOO modifier within the G72 (DAOA) gene could be pivotal for understanding the genetic basis of AD. PMID:26949549

  5. Influence of the neutron star 1E 161348-5055 in RCW 103 on the surrounding medium

    CERN Document Server

    Reynoso, E M; Johnston, S; Goss, W M; Dubner, G M; Giacani, E B

    2003-01-01

    We have carried out a study of the neutral hydrogen in the direction of the X-ray source 1E 161348-5055, a compact central object (CCO) located in the interior of the supernova remnant (SNR) RCW 103. The HI 21 cm line observations were carried out using the Australia Telescope Compact Array, complemented with single dish data from the Parkes radio telescope to recover information at all spatial scales. We derive a distance to RCW 103 of 3.3 kpc, in agreement with previous distance measurements. We have also detected a small hole in the HI emission which is positionally and kinematically coincident with the location of the CCO which confirms the association between the SNR and the CCO. This is the third case of a depression in HI emission seemingly associated with CCOs in SNRs. The characteristic parameters of the holes such as their size, eccentricity and evacuated mass are similar in all three cases. We estimate the absorbing HI column density towards 1E 161348-5055 to be ~6 x 10^{21} cm^{-2}, a value compat...

  6. Long-Term X-ray Monitoring of 1E 1740.7-2942 and GRS 1758-258

    CERN Document Server

    Main, D S; Heindl, W A; Swank, J H; Leventhal, M; Mirabel, I F; Rodríguez, L F

    1999-01-01

    We report on long-term observations of the Galactic-bulge black hole candidates 1E 1740.7-2942 and GRS 1758-258 with the Rossi X-Ray Timing Explorer. 1E 1740.7-2942 has been observed 77 times and GRS 1758-258 has been observed 82 times over the past 1000 days. The flux of each object has varied by no more than a factor of 2.5 during this period, and the indices of the energy spectra have varied by no more than 0.4. The power spectra are similar to other black-hole candidates: flat-topped noise, breaking to a power law. Each object has exhibited a brightening that lasted for several months, and we have a found a time lag between the photon power-law index and the count rate. In both sources, the spectrum is softest during the decline from the brightening. This behavior can be understood in the context of thin-disk and advection-dominated accretion flows coexisting over a wide range of radii, with the implication that both sources have low-mass companions and accrete via Roche-lobe overflow.

  7. Starting a sleep center.

    Science.gov (United States)

    Epstein, Lawrence J; Valentine, Paul S

    2010-05-01

    The demand for sleep medicine services has grown tremendously during the last decade and will likely continue. To date, growth in demand has been met by growth in the number of new sleep centers. The need for more new centers will be dependent on market drivers that include increasing regulatory requirements, personnel shortages, integration of home sleep testing, changes in reimbursement, a shift in emphasis from diagnostics to treatment, and an increased consumer focus on sleep. The decision to open a new center should be based on understanding the market dynamics, completing a market analysis, and developing a business plan. The business plan should include an overview of the facility, a personnel and organizational structure, an evaluation of the business environment, a financial plan, a description of services provided, and a strategy for obtaining, managing, and extending a referral base. Implementation of the business plan and successful operation require ongoing planning and monitoring of operational parameters. The need for new sleep centers will likely continue, but the shifting market dynamics indicate a greater need for understanding the marketplace and careful planning. PMID:20442123

  8. INTERMOUNTAIN INDUSTRIAL ASSESSMENT CENTER

    Energy Technology Data Exchange (ETDEWEB)

    MELINDA KRAHENBUHL

    2010-05-28

    The U. S. Department of Energy’s Intermountain Industrial Assessment Center (IIAC) at the University of Utah has been providing eligible small- and medium-sized manufacturers with no-cost plant assessments since 2001, offering cost-effective recommendations for improvements in the areas of energy efficiency, pollution prevention, and productivity improvement.

  9. The Rural Information Center.

    Science.gov (United States)

    John, Patricia La Caille

    1989-01-01

    Describes the events that led to the creation of the Rural Information Center (RIC), a joint venture between the Extension Service and the National Agricultural Library to provide information to government officials involved in rural development. The databases accessed by RIC are described, and plans for a gateway system and network of all…

  10. Carolinas Energy Career Center

    Energy Technology Data Exchange (ETDEWEB)

    Classens, Anver; Hooper, Dick; Johnson, Bruce

    2013-03-31

    Central Piedmont Community College (CPCC), located in Charlotte, North Carolina, established the Carolinas Energy Career Center (Center) - a comprehensive training entity to meet the dynamic needs of the Charlotte region's energy workforce. The Center provides training for high-demand careers in both conventional energy (fossil) and renewable energy (nuclear and solar technologies/energy efficiency). CPCC completed four tasks that will position the Center as a leading resource for energy career training in the Southeast: • Development and Pilot of a New Advanced Welding Curriculum, • Program Enhancement of Non-Destructive Examination (NDE) Technology, • Student Support through implementation of a model targeted toward Energy and STEM Careers to support student learning, • Project Management and Reporting. As a result of DOE funding support, CPCC achieved the following outcomes: • Increased capacity to serve and train students in emerging energy industry careers; • Developed new courses and curricula to support emerging energy industry careers; • Established new training/laboratory resources; • Generated a pool of highly qualified, technically skilled workers to support the growing energy industry sector.

  11. Carbon Monoxide Information Center

    Medline Plus

    Full Text Available ... Flickr SlideShare All Pages & Documents Recalls & News Releases Home Recalls CPSC Recall API Recall Lawsuits Recalls by ... CO Poster Contest Toy Recall Statistics Pool Safely Home / Safety Education / Safety Education Centers En Español Carbon ...

  12. DISABILITY STATISTICS CENTER

    Science.gov (United States)

    The purpose of the Disability Statistics Center is to produce and disseminate statistical information on disability and the status of people with disabilities in American society and to establish and monitor indicators of how conditions are changing over time to meet their health...

  13. Memorial Alexander Center

    Directory of Open Access Journals (Sweden)

    AECK Associates, Arquitectos

    1958-05-01

    Full Text Available En Atlanta, el Instituto Tecnológico de Georgia acaba de ampliar sus instalaciones deportivas, construyendo el Alexander Memorial Center. Consta este nuevo Centro de dos edificios: una pista de baloncesto cubierta y un edificio anejo con vestuarios, duchas, una pista de entrenamiento, equipos técnicos y la emisora de radio Georgia Tech W. G. S. T.

  14. Carbon Monoxide Information Center

    Medline Plus

    Full Text Available ... an Unsafe Product Consumers Businesses Contact CPSC Website Design Feedback Consumers: Español Businesses: Español , 中文 , Tiếng Việt ... Chairman Commissioners Contact Information Agency Reports Legislative Affairs Job Opportunities Inspector General Safety Guides Safety Education Centers ...

  15. Precision Joining Center

    Energy Technology Data Exchange (ETDEWEB)

    Powell, J.W.; Westphal, D.A.

    1991-08-01

    A workshop to obtain input from industry on the establishment of the Precision Joining Center (PJC) was held on July 10--12, 1991. The PJC is a center for training Joining Technologists in advanced joining techniques and concepts in order to promote the competitiveness of US industry. The center will be established as part of the DOE Defense Programs Technology Commercialization Initiative, and operated by EG G Rocky Flats in cooperation with the American Welding Society and the Colorado School of Mines Center for Welding and Joining Research. The overall objectives of the workshop were to validate the need for a Joining Technologists to fill the gap between the welding operator and the welding engineer, and to assure that the PJC will train individuals to satisfy that need. The consensus of the workshop participants was that the Joining Technologist is a necessary position in industry, and is currently used, with some variation, by many companies. It was agreed that the PJC core curriculum, as presented, would produce a Joining Technologist of value to industries that use precision joining techniques. The advantage of the PJC would be to train the Joining Technologist much more quickly and more completely. The proposed emphasis of the PJC curriculum on equipment intensive and hands-on training was judged to be essential.

  16. vCenter troubleshooting

    CERN Document Server

    Mills, Chuck

    2015-01-01

    The book is designed for the competent vCenter administrator or anyone who is responsible for the vSphere environment. It can be used as a guide by vSphere architects and VMware consultants for a successful vSphere solution. You should have good knowledge and an understanding of core elements and applications of the vSphere environment.

  17. American Overseas Research Centers Program

    Science.gov (United States)

    Office of Postsecondary Education, US Department of Education, 2012

    2012-01-01

    The American Overseas Research Centers Program provides grants to overseas research centers that are consortia of U.S. institutions of higher education to enable the centers to promote postgraduate research, exchanges, and area studies. Eligible applicants are those consortia of U.S. institutions of higher education centers that: (1) Receive more…

  18. CDH1/E-cadherin and solid tumors. An updated gene-disease association analysis using bioinformatics tools.

    Science.gov (United States)

    Abascal, María Florencia; Besso, María José; Rosso, Marina; Mencucci, María Victoria; Aparicio, Evangelina; Szapiro, Gala; Furlong, Laura Inés; Vazquez-Levin, Mónica Hebe

    2016-02-01

    Cancer is a group of diseases that causes millions of deaths worldwide. Among cancers, Solid Tumors (ST) stand-out due to their high incidence and mortality rates. Disruption of cell-cell adhesion is highly relevant during tumor progression. Epithelial-cadherin (protein: E-cadherin, gene: CDH1) is a key molecule in cell-cell adhesion and an abnormal expression or/and function(s) contributes to tumor progression and is altered in ST. A systematic study was carried out to gather and summarize current knowledge on CDH1/E-cadherin and ST using bioinformatics resources. The DisGeNET database was exploited to survey CDH1-associated diseases. Reported mutations in specific ST were obtained by interrogating COSMIC and IntOGen tools. CDH1 Single Nucleotide Polymorphisms (SNP) were retrieved from the dbSNP database. DisGeNET analysis identified 609 genes annotated to ST, among which CDH1 was listed. Using CDH1 as query term, 26 disease concepts were found, 21 of which were neoplasms-related terms. Using DisGeNET ALL Databases, 172 disease concepts were identified. Of those, 80 ST disease-related terms were subjected to manual curation and 75/80 (93.75%) associations were validated. On selected ST, 489 CDH1 somatic mutations were listed in COSMIC and IntOGen databases. Breast neoplasms had the highest CDH1-mutation rate. CDH1 was positioned among the 20 genes with highest mutation frequency and was confirmed as driver gene in breast cancer. Over 14,000 SNP for CDH1 were found in the dbSNP database. This report used DisGeNET to gather/compile current knowledge on gene-disease association for CDH1/E-cadherin and ST; data curation expanded the number of terms that relate them. An updated list of CDH1 somatic mutations was obtained with COSMIC and IntOGen databases and of SNP from dbSNP. This information can be used to further understand the role of CDH1/E-cadherin in health and disease.

  19. Thermal, Electrical, and Optical Properties of Synthesized (1E, 2E-(4-bromophenyl(hydroxyiminoacetaldehyde Oxime Complexes

    Directory of Open Access Journals (Sweden)

    Emin Karapinar

    2013-01-01

    Full Text Available The (1E, 2E-(4-bromophenyl(hydroxyiminoacetaldehyde oxime complexes, [ML2], M = Co(II, Cu(II, and Ni(II, were synthesized and characterized by elemental analysis, magnetic susceptibility, FT-IR spectra, and thermal analysis techniques. The optical band gap of this ligand and its complexes were determined by UV-vis spectrophotometer in the wavelength range 300–800 nm. A decrease in the energy band gap of the [CoL2], [NiL2], and [CuL2] complexes has been observed compared with LH ligand. Temperature-dependent conductivity measurements showed that all samples behave like semiconductor. Activation energies calculated from Arrhenius plots showed that the conduction occurs via both intramolecular and the intermolecular processes.

  20. Application Center 2000

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    @@ 在NET Enterprise Servers中,Application Center 2000扮演着企业管理电子商务分布式应用程序的重要角色.ApplicationCenter 2000是可以建立在Windows 2000上的网站应用程序,能够有效率地管理、降低企业成本.它也是一个向外拓展的技术,且通过丛集服务(Cluster Service),可随需求增加其扩展性与可用性,以此降低随之而来的高成本和管理方式,以及提供配置(Deploy)丛集服务器的能力.

  1. Compact focusing spectrometer: Visible (1 eV) to hard x-rays (200 keV)

    Science.gov (United States)

    Baronova, E. O.; Stepanenko, A. M.; Pereira, N. R.

    2014-11-01

    A low-cost spectrometer that covers a wide range of photon energies can be useful to teach spectroscopy, and for simple, rapid measurements of the photon spectrum produced by small plasma devices. The spectrometer here achieves its wide range, nominally from 1 eV to 200 keV, with a series of spherically and cylindrically bent gratings or crystals that all have the same shape and the same radius of curvature; they are complemented by matching apertures and diagnostics on the Rowland circle that serves as the circular part of the spectrometer's vacuum vessel. Spectral lines are easily identified with software that finds their positions from the dispersion of each diffractive element and the known energies of the lines.

  2. Entanglement with Centers

    CERN Document Server

    Ma, Chen-Te

    2015-01-01

    Entanglement is a physical phenomenon that each state cannot be described individually. Entanglement entropy gives quantitative understanding to the entanglement. We use decomposition of the Hilbert space to discuss properties of the entanglement. Therefore, partial trace operator becomes important to define the reduced density matrix from different centers, which commutes with all elements in the Hilbert space, corresponding to different entanglement choices or different observations on entangling surface. Entanglement entropy is expected to satisfy the strong subadditivity. We discuss decomposition of the Hilbert space for the strong subadditivity and other related inequalities. The entanglement entropy with centers can be computed from the Hamitonian formulations systematically, provided that we know wavefunctional. In the Hamitonian formulation, it is easier to obtain symmetry structure. We consider massless $p$-form theory as an example. The massless $p$-form theory in ($2p+2)$-dimensions has global symm...

  3. Synthesis, Characterization and Anti-microbial Evaluation of Some 2-Iodo-N'-[(1E-Substituted Phenylmethylidene] Benzohydrazide Analogues

    Directory of Open Access Journals (Sweden)

    Harer Sunil L.

    2010-04-01

    Full Text Available Reaction of 2-iodo benzohydrazide (1 with appropriately substituted aromatic aldehyde in glacial acetic acid yielded corresponding 2-Iodo-N'-[(1E-Substituted Phenylmethylidene] Benzohydrazides (2. Structures of all the compounds (2 were established on the basis of elemental analysis and spectral data. These compounds were screened for anti-bacterial and anti-fungal activities at 200µg/0.1ml (T1 and 400µg/0.1ml (T2. Results obtained illustrates that the compounds F, C, D and G showed highly significant response while compound H showed less significant response for anti-microbial activity at both concentrations 200µg/0.1ml (T1 and 400µg/0.1ml (T2.

  4. Improved energy of the 21.5 keV M1 + E2 nuclear transition in {sup 151}Eu

    Energy Technology Data Exchange (ETDEWEB)

    Inoyatov, A.Kh. [JINR, Laboratory of Nuclear Problems, Dubna, Moscow Region (Russian Federation); National University, Institute of Applied Physics, Tashkent (Uzbekistan); Kovalik, A. [JINR, Laboratory of Nuclear Problems, Dubna, Moscow Region (Russian Federation); Nuclear Physics Institute of the ASCR, Rez near Prague (Czech Republic); Filosofov, D.V.; Perevoshchikov, L.L. [JINR, Laboratory of Nuclear Problems, Dubna, Moscow Region (Russian Federation); Rysavy, M. [Nuclear Physics Institute of the ASCR, Rez near Prague (Czech Republic); Baimukhanova, A. [JINR, Laboratory of Nuclear Problems, Dubna, Moscow Region (Russian Federation); Institute of Nuclear Physics, Almaty (Kazakhstan)

    2016-05-15

    Using internal conversion electron spectroscopy, improved energy 21 541.5±0.5 eV was determined for the 21.5 keV M1+E2 nuclear transition in {sup 151}Eu populated in the electron capture decay of {sup 151}Gd. This value was found to agree well with the present adopted value but is much more accurate. A value of 0.0305±0.0011 derived for the E2 admixture parameter vertical stroke δ(E2/M1) vertical stroke from the measured conversion electron line intensities corresponds to the present adopted value. A possible effect of nuclear structure on the multipolarity of the 21.5 keV transition was also investigated. (orig.)

  5. Discovery of a new BL Lacertae object /1E 1402.3 + 0416/ with the Einstein Observatory

    Science.gov (United States)

    Stocke, J.; Liebert, J.; Stockman, H.; Danziger, J.; Lub, J.; Maccacaro, T.; Griffiths, R.; Giommi, P.

    1982-01-01

    It is noted that only one BL Lac object, designated 1E 1402.3 + 0416, has so far been discovered as part of an optical identification program for a complete sample of faint X-ray sources detected with the Einstein Observatory. Consistent with previously X-ray-discovered BL Lacs, this object is blue and radio weak (17 mJy at 6 cm). It is pointed out that the percentage of BL Lacs in the faint extragalactic X-ray sample (2%) is smaller than the percentage at higher X-ray fluxes (6%). Over the same range in X-ray flux, the percentage of emission-line active galaxy nuclei (QSO + Seyferts) rises from 40% to 74%). This is seen as suggesting that BL Lacs do not evolve in a manner similar to quasars and are, therefore, not substantial contributors to the X-ray background.

  6. Teacher Education in Use of Computers. The Illinois Series on Educational Application of Computers, No. 1e.

    Science.gov (United States)

    Dennis, J. Richard

    Two model programs have been developed for preservice and inservice training of teachers in the instructional applications of computers. The preservice model features a background in computer science, foundations of instructional computing using a total school view and content specific view, a task-centered practicum in instructional computing,…

  7. 4 Exhibition Centers

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    China's convention and exhibition industry has grown rapidly in recent years, with some of the nation's key cities becoming hubs of internationally renowned expositions, spurred by the construction of new exhibition centers.In 2003, a total of 3,298 conventions and exhibitions were held in China, up from 3,075 in the previous year. The number is estimated to have hit 4,000 in 2004.

  8. COMPUTATIONAL SCIENCE CENTER

    Energy Technology Data Exchange (ETDEWEB)

    DAVENPORT,J.

    2004-11-01

    The Brookhaven Computational Science Center brings together researchers in biology, chemistry, physics, and medicine with applied mathematicians and computer scientists to exploit the remarkable opportunities for scientific discovery which have been enabled by modern computers. These opportunities are especially great in computational biology and nanoscience, but extend throughout science and technology and include for example, nuclear and high energy physics, astrophysics, materials and chemical science, sustainable energy, environment, and homeland security.

  9. A Mutation in DAOA Modifies the Age of Onset in PSEN1 E280A Alzheimer’s Disease

    Directory of Open Access Journals (Sweden)

    Jorge I. Vélez

    2016-01-01

    Full Text Available We previously reported age of onset (AOO modifier genes in the world’s largest pedigree segregating early-onset Alzheimer’s disease (AD, caused by the p.Glu280Ala (E280A mutation in the PSEN1 gene. Here we report the results of a targeted analysis of functional exonic variants in those AOO modifier genes in sixty individuals with PSEN1 E280A AD who were whole-exome genotyped for ~250,000 variants. Standard quality control, filtering, and annotation for functional variants were applied, and common functional variants located in those previously reported as AOO modifier loci were selected. Multiloci linear mixed-effects models were used to test the association between these variants and AOO. An exonic missense mutation in the G72 (DAOA gene (rs2391191, P = 1.94 × 10−4, PFDR = 9.34 × 10−3 was found to modify AOO in PSEN1 E280A AD. Nominal associations of missense mutations in the CLUAP1 (rs9790, P = 7.63 × 10−3, PFDR = 0.1832 and EXOC2 (rs17136239, P = 0.0325, PFDR = 0.391 genes were also found. Previous studies have linked polymorphisms in the DAOA gene with the occurrence of neuropsychiatric symptoms such as depression, apathy, aggression, delusions, hallucinations, and psychosis in AD. Our findings strongly suggest that this new conspicuous functional AOO modifier within the G72 (DAOA gene could be pivotal for understanding the genetic basis of AD.

  10. [6]-Shogaol Induces Ca2+ Signals by Activating the TRPV1 Channels in the Rat Insulinoma INS-1E Cells

    Directory of Open Access Journals (Sweden)

    Paola Rebellato

    2014-01-01

    Full Text Available Context [6]-shogaol is a vanilloid compound present in steamed ginger (Zingiber officinale, a commonly used spice. Pancreatic beta-cells respond to nutrients like glucose, amino acids and fatty acids, by an increase in the cytoplasmic free Ca2+ concentration ([Ca2+]i, which mediates diverse cellular processes in these cells. Some vanilloid compounds activate the transient receptor potential vanilloid receptor type 1 (TRPV1 channel. Objective We investigated whether [6]-shogaol could trigger Ca2+ signals in the beta-cell. Methods [Ca2+]i was measured from single INS-1E cells by microscope-based fluorometry using fura-2 as the Ca2+ indicator. Results In fura-2 loaded single rat insulinoma INS-1E cells, a widely used model of beta-cell, [6]-shogaol increased [Ca2+]i in a concentration-dependent manner. [Ca2+]i increase by [6]-shogaol was completely blocked when Ca2+ was omitted from the extracellular medium. Capsazepine, an inhibitor of the TRPV1 ion channel completely inhibited the [6]-shogaol-induced [Ca2+]i increase. [Ca2+]i increase obtained by 1 μM [6]-shogaol was greater than that obtained by 10 mM glucose. Moreover, a sub-stimulatory concentration of [6]-shogaol (300 nM, significantly enhanced the glucose-induced [Ca2+]i increase in these cells. Conclusion We conclude that [6]-shogaol induces Ca2+ signals in the beta-cell by activating the TRPV1 channels, and it sensitizes the beta-cells to stimulation by glucose.

  11. Study of thermal behavior of the adobe with the simulator DOE 2.1E; Estudio de comportamiento termico del adobe con el simulador DOE 2.1E

    Energy Technology Data Exchange (ETDEWEB)

    Luna, Anibal; Gallegos, Ricardo; Bojorquez, Gonzalo [Universidad Autonoma de Baja California, Mexicali, Baja California (Mexico)

    2000-07-01

    A thermal analysis of the envelope of one of the most used housing models for low income groups, as those offered by the Mexican Government is presented in this report. The building's thermal gain in walls was determined, using: concrete block, brick and adobe; and considering concrete of roofing, concrete floors, windows and doors equal in all the cases. The objective of this study is to know the contribution to the building's thermal load of each one of the materials applied. The calculation was conducted using the Doe 2.1E thermal simulator software, using meteorological data for the city of El Centro, California, USA. This was so, because there is no reliable weather data for the city of Mexicali, B.C., where the housing units are. Because of geographical proximity between of these cities the same data was used. The properties for each one of the three building materials were taken from specialized bibliography. It was determined that the housing built with adobe walls has thermal advantages over the units built with concrete block and brick. The adobe unit has a lower thermal load of 13% over the concrete block, and of 3.44% over the clay brick unit. [Spanish] Se presenta el analisis termico de la envolvente de uno de los modelos de casas mas utilizados en la construccion de viviendas de interes social en Mexico. Se determino la ganancia, termica del edificio por muros, aplicando: bloque de concreto, ladrillo de barro y adobe. Se considero techo, piso, ventanas y puertas iguales en todos los casos. El objetivo del estudio es conocer la distribucion de la carga termica segun los materiales aplicados. El calculo se realizo con el simulador termico DOE 2.1E con datos meteorologicos de la ciudad de El Centro, California, E. U., por no contar con datos de Mexicali, B. C.: debido a la proximidad y similitud topografica entre ambas ciudades se uso la misma informacion. Las propiedades aplicadas para cada uno de los tres materiales fueron tomadas de

  12. Jets in quasars, microquasars and gamma-ray bursts

    OpenAIRE

    Mirabel, I.F.

    2000-01-01

    Relativistic outflows are common in accreting and forming black holes. Despite the enormous differences in scale, stellar-mass black holes in X-ray binaries and supermassive black holes in Galactic Nuclei produce jets with analogous properties. In both are observed two types of relativistic outflows: 1) quasi-steady compact jets with flat-spectrum, and 2) episodic large-scale ejections with steep-spectrum and apparent superluminal motions. Because of the short time scale of the phenomena in b...

  13. Optical results of the black hole microquasar SS 433

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    We present optical spectroscopic observations of SS 433 during different precessional and orbital phases.Our 2004,2007 and 2008 data provide us a good chance to study the variability of the Hα line at different orbital phases for nearly the same disk inclination.The data show that the Hα of SS 433 usually had a symmetric profile between orbital phases 0.25-0.75,while an asymmetric structure with a strong red peak was observed for other orbital phases.We suggest that the orbital variability of Hα emission is connected with accretion flow from the donor star to the accretion disk.In addition,we attribute the dramatic increase of Hα emission during our 2007 observational run,which had a time scale of one day,to the emergence of strong jets.

  14. Hadronic gamma-ray production in microquasars with equatorial winds

    Directory of Open Access Journals (Sweden)

    Mariana Orellana

    2006-01-01

    Full Text Available Los microcuas ares son sistemas binarios con emisi on en rayos X vinculada a acreci on, en los cuales se han detectado chorros de part culas relativistas (jets a trav es de su emisi on en bandas de radio. La transferencia de masa al objeto compacto puede darse a trav es del viento ecuatorial de la primaria, cuando esta es de tipo espectral temprano, como es el caso del microcu asar LSI +61 303. En estos casos se dar a inevitablemente una interacci on entre el viento estelar y los jets, que puede resultar en la emisi on de fotones con muy alta energ a. El inter es por este escenario resurge a partir de la con rmaci on de los microcu asares como fuentes detectadas a energ as en el rango TeV. Presentamos un modelo para la emisi on de rayos gamma que se origina en la interacci on de protones relativistas del jet, con los protones fr os de un viento con nado en un disco circunestelar. Se calcul o tambi en, en forma simpli cada, la emisi on de los leptones secundarios. Teniendo en cuenta efectos de opacidad en la fost osfera, hemos podido estimar una curva de luz y un espectro que pueden ser contrastados con las mediciones de observatorios en altas energ as como MAGIC o HESS.

  15. Simultaneous multi-wavelength observations of Microquasars (the mine collaboration

    Directory of Open Access Journals (Sweden)

    Y. Fuchs

    2004-01-01

    Full Text Available Presentamos la colaboraci on internacional MINE (Multi- INTEGRAL NEtwork cuya meta es llevar a cabo observaciones en m ultiples longitudes de onda de microcuasares de forma simult anea al sat elite INTEGRAL. Los primeros resultados con GRS 1915+105 son muy esperanzadores y junto con los que se obtendr an en el futuro nos ayudar an a comprender la f sica de los fen omenos de acreci on y eyecci on relacionados con los sistemas binarios compactos.

  16. The Microquasar Cyg X-1: A Short Review

    CERN Document Server

    Nowak, Michael A; Pottschmidt, Katja; Markoff, Sera

    2011-01-01

    We review the spectral properties of the black hole candidate Cygnus X-1. Specifically, we discuss two recent sets of multi-satellite observations. One comprises a 0.5-500 keV spectrum, obtained with every flying X-ray satellite at that time, that is among the hardest Cyg X-1 spectra observed to date. The second set is comprised of 0.5-40 keV Chandra-HETG plus RXTE-PCA spectra from a radio-quiet, spectrally soft state. We first discuss the "messy astrophysics" often neglected in the study of Cyg X-1, i.e., ionized absorption from the wind of the secondary and the foreground dust scattering halo. We then discuss components common to both state extremes: a low temperature accretion disk, and a relativistically broadened Fe line and reflection. Hard state spectral models indicate that the disk inner edge does not extend beyond ~40 GM/c^2, and may even approach as close as ~6 GM/c^2. The soft state exhibits a much more prominent disk component; however, its very low normalization plausibly indicates a spinning bl...

  17. Solution structure of GxTX-1E, a high affinity tarantula toxin interacting with voltage sensors in Kv2.1 potassium channels†

    OpenAIRE

    Lee, Seungkyu; Milescu, Mirela; Jung, Hyun Ho; Lee, Ju Yeon; Bae, Chan Hyung; Lee, Chul Won; Kim, Ha Hyung; Swartz, Kenton J.; Kim, Jae Il

    2010-01-01

    GxTX-1E is a neurotoxin recently isolated from Plesiophrictus guangxiensis venom that inhibits the Kv2.1 channel in pancreatic β-cells. The sequence of the toxin is related to previously studied tarantula toxins that interact with the voltage sensors in Kv channels, and GxTX-1E interacts with the Kv2.1 channel with unusually high affinity, making it particularly useful for structural and mechanistic studies. Here we determined the three-dimensional solution structure of GxTX-1E using NMR spec...

  18. Solar Technology Center

    Energy Technology Data Exchange (ETDEWEB)

    Boehm, Bob

    2011-04-27

    The Department of Energy, Golden Field Office, awarded a grant to the UNLV Research Foundation (UNLVRF) on August 1, 2005 to develop a solar and renewable energy information center. The Solar Technology Center (STC) is to be developed in two phases, with Phase I consisting of all activities necessary to determine feasibility of the project, including design and engineering, identification of land access issues and permitting necessary to determine project viability without permanently disturbing the project site, and completion of a National Environmental Policy Act (NEPA) Environmental Assessment. Phase II is the installation of infrastructure and related structures, which leads to commencement of operations of the STC. The STC is located in the Boulder City designated 3,000-acre Eldorado Valley Energy Zone, approximately 15 miles southwest of downtown Boulder City and fronting on Eldorado Valley Drive. The 33-acre vacant parcel has been leased to the Nevada Test Site Development Corporation (NTSDC) by Boulder City to accommodate a planned facility that will be synergistic with present and planned energy projects in the Zone. The parcel will be developed by the UNLVRF. The NTSDC is the economic development arm of the UNLVRF. UNLVRF will be the entity responsible for overseeing the lease and the development project to assure compliance with the lease stipulations established by Boulder City. The STC will be operated and maintained by University of Nevada, Las Vegas (UNLV) and its Center for Energy Research (UNLV-CER). Land parcels in the Eldorado Valley Energy Zone near the 33-acre lease are committed to the construction and operation of an electrical grid connected solar energy production facility. Other projects supporting renewable and solar technologies have been developed within the energy zone, with several more developments in the horizon.

  19. The MAGIC Data Center

    OpenAIRE

    Reichardt, Ignasi; Rico, Javier; Carmona, Emiliano; Contreras, Jose Luis; Cortina, Juan; Firpo, Roger; Font, Lluis; Moralejo, Abelardo; Nieto, Daniel; Oya, Igor; Reyes, Raquel de los

    2009-01-01

    The MAGIC I telescope produces currently around 100TByte of raw data per year that is calibrated and reduced on-site at the Observatorio del Roque de los Muchachos (La Palma). Since February 2007 most of the data have been stored and further processed in the Port d'Informacio Cientifica (PIC), Barcelona. This facility, which supports the GRID Tier 1 center for LHC in Spain, provides resources to give the entire MAGIC Collaboration access to the reduced telescope data. It is expected that the ...

  20. COMPUTATIONAL SCIENCE CENTER

    Energy Technology Data Exchange (ETDEWEB)

    DAVENPORT, J.

    2005-11-01

    The Brookhaven Computational Science Center brings together researchers in biology, chemistry, physics, and medicine with applied mathematicians and computer scientists to exploit the remarkable opportunities for scientific discovery which have been enabled by modern computers. These opportunities are especially great in computational biology and nanoscience, but extend throughout science and technology and include, for example, nuclear and high energy physics, astrophysics, materials and chemical science, sustainable energy, environment, and homeland security. To achieve our goals we have established a close alliance with applied mathematicians and computer scientists at Stony Brook and Columbia Universities.

  1. Neurovirulência e neuroinvasividade de herpesvírus bovinos tipos 1 e 5 em coelhos

    Directory of Open Access Journals (Sweden)

    Spilki Fernando R.

    2002-01-01

    Full Text Available Com o objetivo de avaliar a capacidade dos herpesvírus bovinos tipos 1 e 5 (BHV-1 e BHV-5 de invadir e replicar no sistema nervoso central (SNC (neuroinvasividade, bem como sua capacidade de induzir doença neurológica (neurovirulência, coelhos com 30 a 35 dias de idade foram inoculados com uma amostra do Herpesvírus da Encefalite Bovina (BHV-5; amostra EVI 88/95 ou com amostras de BHV-1 (Los Angeles ou Cooper, pelas vias intratecal (IT e intranasal (IN. A inoculação da amostra de BHV-5, tanto pela via IT como IN, induziu sinais clínicos neurológicos em 100% (12/12 dos coelhos inoculados. Os exames histopatológicos revelaram um quadro de meningoencefalite não-purulenta multifocal, caracterizada por gliose multifocal e infiltrados perivasculares. O vírus foi isolado de várias áreas do SNC desses animais. As amostras de BHV-1, quando inoculadas pela via IT, não foram neurovirulentas. A amostra Los Angeles de BHV-1, quando administrada pela via IN, induziu sinais respiratórios severos, além de sinais neurológicos em 57% (4/7 dos animais inoculados. Entretanto, o exame histopatológico destes quatro animais revelou vasculite e trombose no pulmão e cérebro, este último apresentando focos de necrose neuronal, porém sem lesões indicativas de encefalite. Isso sugere que os sinais neurológicos foram, provavelmente, conseqüentes a prejuízos no fluxo sangüíneo encefálico, e não a danos neuronais provocados pela inoculação desse vírus. A amostra Cooper de BHV-1, quando inoculada pela via IN, induziu apenas sinais leves de infecção respiratória. Estes resultados indicam que apenas a amostra de BHV-5 foi capaz de invadir e replicar no encéfalo dos coelhos quando inoculada tanto por via IN como IT, apresentando neuroinvasividade e neurovirulência. É possível que estas observações tenham relação com o fato de amostras de BHV-5 freqüentemente causarem encefalites, em contraposição a infecções pelo BHV-1, onde

  2. Center for Beam Physics, 1992

    International Nuclear Information System (INIS)

    This report contains the following information on the center for beam physics: Facilities; Organizational Chart; Roster; Profiles of Staff; Affiliates; Center Publications (1991--1993); and 1992 Summary of Activities

  3. National Center for Biotechnology Information

    Science.gov (United States)

    ... to NCBI Sign Out NCBI National Center for Biotechnology Information Search database All Databases Assembly BioProject BioSample ... Search Welcome to NCBI The National Center for Biotechnology Information advances science and health by providing access ...

  4. Contact Center Manager Administration (CCMA)

    Data.gov (United States)

    Social Security Administration — CCMA is the server that provides a browser-based tool for contact center administrators and supervisors. It is used to manage and configure contact center resources...

  5. Center for Beam Physics, 1992

    Energy Technology Data Exchange (ETDEWEB)

    1993-06-01

    This report contains the following information on the center for beam physics: Facilities; Organizational Chart; Roster; Profiles of Staff; Affiliates; Center Publications (1991--1993); and 1992 Summary of Activities.

  6. Oceans and Human Health Center

    Science.gov (United States)

    ... through a deeper understanding of the causes of ocean-related health threats About Find out more about our Center ... research taking place at the University of Miami Oceans & Human Health Center More Gallery Check out our photo and ...

  7. Italy INAF Data Center Report

    Science.gov (United States)

    Negusini, M.; Sarti, P.

    2013-01-01

    This report summarizes the activities of the Italian INAF VLBI Data Center. Our Data Center is located in Bologna, Italy and belongs to the Institute of Radioastronomy, which is part of the National Institute of Astrophysics.

  8. Dialysis centers - what to expect

    Science.gov (United States)

    ... what to expect; Renal replacement therapy - dialysis centers; End-stage renal disease - dialysis centers; Kidney failure - dialysis ... swells and the hand on that side feels cold Your hand gets cold, numb, or weak Also ...

  9. Patient-centered Radiology.

    Science.gov (United States)

    Itri, Jason N

    2015-10-01

    Patient-centered care (ie, care organized around the patient) is a model in which health care providers partner with patients and families to identify and satisfy patients' needs and preferences. In this model, providers respect patients' values and preferences, address their emotional and social needs, and involve them and their families in decision making. Radiologists have traditionally been characterized as "doctor-to-doctor" consultants who are distanced from patients and work within a culture that does not value patient centeredness. As medicine becomes more patient driven and the trajectory of health care is toward increasing patient self-reliance, radiologists must change the perception that they are merely consultants and become more active participants in patient care by embracing greater patient interaction. The traditional business model for radiology practices, which devalues interaction between patients and radiologists, must be transformed into a patient-centered model in which radiologists are reintegrated into direct patient care and imaging processes are reorganized around patients' needs and preferences. Expanding radiology's core assets to include direct patient care may be the most effective deterrent to the threat of commoditization. As the assault on the growth of Medicare spending continues, with medical imaging as a highly visible target, radiologists must adapt to the changing landscape by focusing on their most important consumer: the patient. This may yield substantial benefits in the form of improved quality and patient safety, reduced costs, higher-value care, improved patient outcomes, and greater patient and provider satisfaction. PMID:26466190

  10. Sustainable Biofuels Development Center

    Energy Technology Data Exchange (ETDEWEB)

    Reardon, Kenneth F. [Colorado State Univ., Fort Collins, CO (United States)

    2015-03-01

    The mission of the Sustainable Bioenergy Development Center (SBDC) is to enhance the capability of America’s bioenergy industry to produce transportation fuels and chemical feedstocks on a large scale, with significant energy yields, at competitive cost, through sustainable production techniques. Research within the SBDC is organized in five areas: (1) Development of Sustainable Crops and Agricultural Strategies, (2) Improvement of Biomass Processing Technologies, (3) Biofuel Characterization and Engine Adaptation, (4) Production of Byproducts for Sustainable Biorefining, and (5) Sustainability Assessment, including evaluation of the ecosystem/climate change implication of center research and evaluation of the policy implications of widespread production and utilization of bioenergy. The overall goal of this project is to develop new sustainable bioenergy-related technologies. To achieve that goal, three specific activities were supported with DOE funds: bioenergy-related research initiation projects, bioenergy research and education via support of undergraduate and graduate students, and Research Support Activities (equipment purchases, travel to attend bioenergy conferences, and seminars). Numerous research findings in diverse fields related to bioenergy were produced from these activities and are summarized in this report.

  11. The MAGIC Data Center

    CERN Document Server

    Reichardt, Ignasi; Carmona, Emiliano; Contreras, Jose Luis; Cortina, Juan; Firpo, Roger; Font, Lluis; Moralejo, Abelardo; Nieto, Daniel; Oya, Igor; Reyes, Raquel de los

    2009-01-01

    The MAGIC I telescope produces currently around 100TByte of raw data per year that is calibrated and reduced on-site at the Observatorio del Roque de los Muchachos (La Palma). Since February 2007 most of the data have been stored and further processed in the Port d'Informacio Cientifica (PIC), Barcelona. This facility, which supports the GRID Tier 1 center for LHC in Spain, provides resources to give the entire MAGIC Collaboration access to the reduced telescope data. It is expected that the data volume will increase by a factor 3 after the start-up of the second telescope, MAGIC II. The project to improve the MAGIC Data Center to meet these requirements is presented. In addition, we discuss the production of high level data products that will allow a more flexible analysis and will contribute to the international network of astronomical data (European Virtual Observatory). For this purpose, we will have to develop a new software able to adapt the analysis process to different data taking conditions, such as ...

  12. Core Research Center

    Science.gov (United States)

    Hicks, Joshua; Adrian, Betty

    2009-01-01

    The Core Research Center (CRC) of the U.S. Geological Survey (USGS), located at the Denver Federal Center in Lakewood, Colo., currently houses rock core from more than 8,500 boreholes representing about 1.7 million feet of rock core from 35 States and cuttings from 54,000 boreholes representing 238 million feet of drilling in 28 States. Although most of the boreholes are located in the Rocky Mountain region, the geologic and geographic diversity of samples have helped the CRC become one of the largest and most heavily used public core repositories in the United States. Many of the boreholes represented in the collection were drilled for energy and mineral exploration, and many of the cores and cuttings were donated to the CRC by private companies in these industries. Some cores and cuttings were collected by the USGS along with other government agencies. Approximately one-half of the cores are slabbed and photographed. More than 18,000 thin sections and a large volume of analytical data from the cores and cuttings are also accessible. A growing collection of digital images of the cores are also becoming available on the CRC Web site Internet http://geology.cr.usgs.gov/crc/.

  13. Sustainable Biofuels Development Center

    Energy Technology Data Exchange (ETDEWEB)

    SRIVASTAVA, PREM

    2015-03-02

    The mission of the Sustainable Bioenergy Development Center (SBDC) is to enhance the capability of America’s bioenergy industry to produce transportation fuels and chemical feedstocks on a large scale, with significant energy yields, at competitive cost, through sustainable production techniques. Research within the SBDC is organized in five areas: (1) Development of Sustainable Crops and Agricultural Strategies, (2) Improvement of Biomass Processing Technologies, (3) Biofuel Characterization and Engine Adaptation, (4) Production of Byproducts for Sustainable Biorefining, and (5) Sustainability Assessment, including evaluation of the ecosystem/climate change implication of center research and evaluation of the policy implications of widespread production and utilization of bioenergy. The overall goal of this project is to develop new sustainable bioenergy-related technologies. To achieve that goal, three specific activities were supported with DOE funds: bioenergy-related research initiation projects, bioenergy research and education via support of undergraduate and graduate students, and Research Support Activities (equipment purchases, travel to attend bioenergy conferences, and seminars). Numerous research findings in diverse fields related to bioenergy were produced from these activities and are summarized in this report.

  14. The Backgrounds Data Center

    Science.gov (United States)

    Snyder, W. A.; Gursky, H.; Heckathorn, H. M.; Lucke, R. L.; Berg, S. L.; Dombrowski, E. G.; Kessel, R. A.

    1993-01-01

    The Strategic Defense Initiative Organization has created data centers for midcourse, plumes, and backgrounds phenomenologies. The Backgrounds Data Center (BDC) has been designated as the prime archive for data collected by SDIO programs. The BDC maintains a Summary Catalog that contains 'metadata,' that is, information about data, such as when the data were obtained, what the spectral range of the data is, and what region of the Earth or sky was observed. Queries to this catalog result in a listing of all data sets (from all experiments in the Summary Catalog) that satisfy the specified criteria. Thus, the user can identify different experiments that made similar observations and order them from the BDC for analysis. On-site users can use the Science Analysis Facility (SAFE for this purpose. For some programs, the BDC maintains a Program Catalog, which can classify data in as many ways as desired (rather than just by position, time, and spectral range as in the Summary Catalog). For example, data sets could be tagged with such diverse parameters as solar illumination angle, signal level, or the value of a particular spectral ratio, as long as these quantities can be read from the digital record or calculated from it by the ingest program. All unclassified catalogs and unclassified data will be remotely accessible.

  15. Schmidt. Sinfonie Nr. 1 E-Dur; Strauss. Vier sinfonische Zwischenspiele aus Intermezzo. Detroit Symphony Orchestra, Neeme Järvi / Helge Grünewald

    Index Scriptorium Estoniae

    Grünewald, Helge

    1996-01-01

    Uuest heliplaadist "Schmidt. Sinfonie Nr. 1 E-Dur; Strauss. Vier sinfonische Zwischenspiele aus Intermezzo. Detroit Symphony Orchestra, Neeme Järvi. Chandos/Koch CD 9357 (WD: 68'20") DDD (WD:114'36")

  16. Strong and Weak Lensing United III: Measuring the Mass Distribution of the Merging Galaxy Cluster 1E0657-56

    Energy Technology Data Exchange (ETDEWEB)

    Bradac, Marusa; Clowe, Douglas; Gonzalez, Anthony H.; Marshall, Phil; Forman, William; Jones, Christine; Markevitch, Maxim; Randall, Scott; Schrabback, Tim; Zaritsky,; /KIPAC, Menlo Park /Bonn, Inst. Astrophys. /Arizona U., Astron. Dept. - Steward Observ. /Florida U. /Harvard-Smithsonian Ctr. Astrophys.

    2006-09-27

    The galaxy cluster 1E0657-56 (z = 0.296) is remarkably well-suited for addressing outstanding issues in both galaxy evolution and fundamental physics. We present a reconstruction of the mass distribution from both strong and weak gravitational lensing data. Multi-color, high-resolution HST ACS images allow detection of many more arc candidates than were previously known, especially around the subcluster. Using the known redshift of one of the multiply imaged systems, we determine the remaining source redshifts using the predictive power of the strong lens model. Combining this information with shape measurements of ''weakly'' lensed sources, we derive a high-resolution, absolutely-calibrated mass map, using no assumptions regarding the physical properties of the underlying cluster potential. This map provides the best available quantification of the total mass of the central part of the cluster. We also confirm the result from Clowe et al. (2004, 2006a) that the total mass does not trace the baryonic mass.

  17. Sequence-based Association Analysis Reveals an MGST1 eQTL with Pleiotropic Effects on Bovine Milk Composition

    Science.gov (United States)

    Littlejohn, Mathew D.; Tiplady, Kathryn; Fink, Tania A.; Lehnert, Klaus; Lopdell, Thomas; Johnson, Thomas; Couldrey, Christine; Keehan, Mike; Sherlock, Richard G.; Harland, Chad; Scott, Andrew; Snell, Russell G.; Davis, Stephen R.; Spelman, Richard J.

    2016-01-01

    The mammary gland is a prolific lipogenic organ, synthesising copious amounts of triglycerides for secretion into milk. The fat content of milk varies widely both between and within species, and recent independent genome-wide association studies have highlighted a milk fat percentage quantitative trait locus (QTL) of large effect on bovine chromosome 5. Although both EPS8 and MGST1 have been proposed to underlie these signals, the causative status of these genes has not been functionally confirmed. To investigate this QTL in detail, we report genome sequence-based imputation and association mapping in a population of 64,244 taurine cattle. This analysis reveals a cluster of 17 non-coding variants spanning MGST1 that are highly associated with milk fat percentage, and a range of other milk composition traits. Further, we exploit a high-depth mammary RNA sequence dataset to conduct expression QTL (eQTL) mapping in 375 lactating cows, revealing a strong MGST1 eQTL underpinning these effects. These data demonstrate the utility of DNA and RNA sequence-based association mapping, and implicate MGST1, a gene with no obvious mechanistic relationship to milk composition regulation, as causally involved in these processes. PMID:27146958

  18. An ultra-bright, dust-obscured, millimeter-galaxy beyond the Bullet Cluster (1E0657-56)

    CERN Document Server

    Wilson, G W; Hughes, D; Ezawa, H; Austermann, J E; Doyle, S; Hernandez-Curiel, I; Kawabe, R; Kitayama, T; Kohno, K; Kuboi, A; Matsuo, H; Mauskopf, P D; Murakoshi, Y; Montana, A; Natarajan, P; Oshima, T; Ota, N; Perera, T; Rand, J; Scott, K S; Tanaka, K; Tsuboi, M; Williams, C C; Yun, M S

    2008-01-01

    Deep 1.1 mm continuum observations of the interacting galaxy-clusters 1E0657-56 (the Bullet Cluster) taken with the millimeter-wavelength camera AzTEC on the 10-m Atacama Submillimeter Telescope Experiment (ASTE), have revealed an extremely bright (S_1.1mm=15.9mJy) unresolved source. This source, MMJ065837-5557.0, lies close to a maximum in the density of underlying mass-distribution as traced by the weak-lensing analysis of Clowe et al. 2006, towards the larger of the two interacting clusters. A lensing-derived mass model for the Bullet Cluster shows a critical-line (caustic) of magnification very near the AzTEC source, likely providing a high boost (> 20) to its millimeter flux. We explore various scenarios to explain the colors, morphologies and positional offsets between the potential optical and IR counterparts, and their relationship with MMJ065837-5557.0. One interpretation is that MMJ065837-5557.0 is an individual distant LIRG, with multiple HST and Spitzer images due to the strong lensing by the Bull...

  19. Sunyaev-Zel'dovich Effect Observations of the Bullet Cluster (1E 0657-56) with APEX-SZ

    CERN Document Server

    Halverson, N W; Ade, P A R; Basu, K; Bender, A N; Benson, B A; Bertoldi, F; Cho, H -M; Chon, G; Clarke, J; Dobbs, M; Ferrusca, D; Guesten, R; Holzapfel, W L; Kovács, A; Kennedy, J; Kermish, Z; Kneissl, R; Lee, A T; Lueker, M; Mehl, J; Menten, K M; Muders, D; Nord, M; Pacaud, F; Plagge, T; Reichardt, C; Richards, P L; Schaaf, R; Schilke, P; Schuller, F; Schwan, D; Spieler, H; Tucker, C; Weiss, A; Zahn, O

    2008-01-01

    We present observations of the Sunyaev-Zel'dovich effect (SZE) in the Bullet cluster (1E 0657-56) using the APEX-SZ instrument at 150 GHz with a resolution of 1 arcmin. The main results are maps of the SZE in this massive, merging galaxy cluster. The cluster is detected with 23 sigma significance within the central 1 arcmin radius of the source position. The SZE map has a broadly similar morphology to that in existing X-ray maps of this system, and we find no evidence for significant contamination of the SZE emission by radio or IR sources. In order to make simple quantitative comparisons with cluster gas models derived from X-ray observations, we fit our data to an isothermal elliptical beta model, despite the inadequacy of such a model for this complex merging system. With an X-ray derived prior on the power-law index, beta = 1.04 +0.16/-0.10, we find a core radius r_c =144 +/- 19 arcsec, an axial ratio of 0.881 +/- 0.086, and a central temperature decrement of -880 +/- 80 micro-K_CMB, including a +/- 6% fl...

  20. A Comprehensive Study of the X-ray Bursts from the Magnetar Candidate 1E 2259+586

    CERN Document Server

    Gavriil, F P; Woods, P M; Gavriil, Fotis P.; Kaspi, Victoria M.; Woods, Peter M.

    2003-01-01

    We present a statistical analysis of the X-ray bursts observed from the 2002 June 18 outburst of the Anomalous X-ray Pulsar (AXP) 1E 2259+586, observed with the Proportional Counter Array (PCA) aboard the Rossi X-ray Timing Explorer. We show that the properties of these bursts are similar to those of Soft Gamma-Repeaters (SGRs). The similarities we find are the burst durations follow a log-normal distribution which peaks at 99 ms, the differential burst fluence distribution is well described by a power law of index -1.7, the burst fluences are positively correlated with the burst durations, the distribution of waiting times is well described by a log-normal distribution of mean 47 s, and the bursts are generally asymmetric with faster rise than fall times. However, we find several quantitative differences between the AXP and SGR bursts. Specifically, the AXP bursts we observed exhibit a wider range of durations, the correlation between burst fluence and duration is flatter than for SGRs, the observed AXP burs...

  1. Prunella vulgaris Suppresses HG-Induced Vascular Inflammation via Nrf2/HO-1/eNOS Activation

    Directory of Open Access Journals (Sweden)

    Ho Sub Lee

    2012-01-01

    Full Text Available Vascular inflammation is an important factor which can promote diabetic complications. In this study, the inhibitory effects of aqueous extract from Prunella vulgaris (APV on high glucose (HG-induced expression of cell adhesion molecules in human umbilical vein endothelial cells (HUVEC are reported. APV decreased HG-induced expression of intercellular adhesion molecule-1 (ICAM-1, vascular cell adhesion molecule-1 (VCAM-1, and E-selectin. APV also dose-dependently inhibited HG-induced adhesion of HL-60 monocytic cells. APV suppressed p65 NF-κB activation in HG-treated cells. APV significantly inhibited the formation of intracellular reactive oxygen species (ROS. HG-stimulated HUVEC secreted gelatinases, however, APV inhibited it. APV induced Akt phosphorylation as well as activation of heme oxygenase-1 (HO-1, eNOS, and nuclear factor E2-related factor 2 (Nrf2, which may protect vascular inflammation caused by HG. In conclusion, APV exerts anti-inflammatory effect via inhibition of ROS/NF-κB pathway by inducing HO-1 and eNOS expression mediated by Nrf2, thereby suggesting that Prunella vulgaris may be a possible therapeutic approach to the inhibition of diabetic vascular diseases.

  2. ANTI-GLITCH INDUCED BY COLLISION OF A SOLID BODY WITH THE MAGNETAR 1E 2259+586

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Y. F.; Geng, J. J., E-mail: hyf@nju.edu.cn [Also at Key Laboratory of Modern Astronomy and Astrophysics (Nanjing University), Ministry of Education, Nanjing 210093, China. (China)

    2014-02-20

    Glitches have been frequently observed in neutron stars. Previously, these glitches have unexceptionally manifested as sudden spin-ups that can be explained as being due to impulsive transfer of angular momentum from the interior superfluid component to the outer solid crust. Alternatively, they may also be due to large-scale crust-cracking events. However, an unprecedented anti-glitch was recently reported for the magnetar 1E 2259+586, which clearly exhibited a sudden spin-down, strongly challenging previous glitch theories. Here we show that the anti-glitch can be well explained by the collision of a small solid body with the magnetar. The intruder has a mass of about 1.1 × 10{sup 21} g. Its orbital angular momentum is assumed to be antiparallel to that of the spinning magnetar, so that the sudden spin-down can be naturally accounted for. The observed hard X-ray burst and decaying softer X-ray emission associated with the anti-glitch can also be reasonably explained. Our study indicates that a completely different type of glitch due to collisions between small bodies and neutron stars should exist and may have already been observed previously. It also hints at a new way of studying capture events by neutron stars: through accurate timing observations of pulsars.

  3. NuSTAR observations of X-ray bursts from the magnetar 1E 1048.1–5937

    Energy Technology Data Exchange (ETDEWEB)

    An, Hongjun; Kaspi, Victoria M.; Archibald, Robert F. [Department of Physics, McGill University, Montreal, Quebec, H3A 2T8 (Canada); Beloborodov, Andrei M.; Gotthelf, Eric V.; Hailey, Charles J.; Mori, Kaya [Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Kouveliotou, Chryssa [Space Science Office, ZP12, NASA Marshall Space Flight Center, Huntsville, AL 35812 (United States); Boggs, Steven E.; Craig, William W. [Space Sciences Laboratory, University of California, Berkeley, CA 94720 (United States); Christensen, Finn E. [DTU Space, National Space Institute, Technical University of Denmark, Elektrovej 327, DK-2800 Lyngby (Denmark); Grefenstette, Brian W.; Harrison, Fiona A.; Madsen, Kristin K. [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Stern, Daniel [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Zhang, William W. [Goddard Space Flight Center, Greenbelt, MD 20771 (United States)

    2014-07-20

    We report the detection of eight bright X-ray bursts from the 6.5 s magnetar 1E 1048.1–5937, during a 2013 July observation campaign with the Nuclear Spectroscopic Telescope Array. We study the morphological and spectral properties of these bursts and their evolution with time. The bursts resulted in count rate increases by orders of magnitude, sometimes limited by the detector dead time, and showed blackbody spectra with kT ∼ 6-8 keV in the T{sub 90} duration of 1-4 s, similar to earlier bursts detected from the source. We find that the spectra during the tail of the bursts can be modeled with an absorbed blackbody with temperature decreasing with flux. The burst flux decays followed a power law of index 0.8-0.9. In the burst tail spectra, we detect a ∼13 keV emission feature, similar to those reported in previous bursts from this source as well as from other magnetars observed with the Rossi X-ray Timing Explorer. We explore possible origins of the spectral feature such as proton cyclotron emission, which implies a magnetic field strength of B ∼ 2 × 10{sup 15} G in the emission region. However, the consistency of the energy of the feature in different objects requires further explanation.

  4. NuSTAR Observations of X-Ray Bursts from the Magnetar 1E 1048.1-5937

    Science.gov (United States)

    An, Hongjun; Kaspi, Victoria M.; Beloborodov, Andrei M.; Kouveliotou, Chryssa; Archibald, Robert T.; Boggs, Steven E.; Christensen, Finn E.; Craig, William W.; Gotthelf, Eric V.; Stern, Daniel; Zhang, William W.

    2014-01-01

    We report the detection of eight bright X-ray bursts from the 6.5 s magnetar 1E 1048.1-5937, during a 2013 July observation campaign with the Nuclear Spectroscopic Telescope Array. We study the morphological and spectral properties of these bursts and their evolution with time. The bursts resulted in count rate increases by orders of magnitude, sometimes limited by the detector dead time, and showed blackbody spectra with kT is approx. 6-8 keV in the T90 duration of 1-4 s, similar to earlier bursts detected from the source. We find that the spectra during the tail of the bursts can be modeled with an absorbed blackbody with temperature decreasing with flux. The burst flux decays followed a power law of index 0.8-0.9. In the burst tail spectra, we detect a is approx. 13 keV emission feature, similar to those reported in previous bursts from this source as well as from other magnetars observed with the Rossi X-ray Timing Explorer.We explore possible origins of the spectral feature such as proton cyclotron emission, which implies a magnetic field strength of B is approx. 2×10(exp15) G in the emission region. However, the consistency of the energy of the feature in different objects requires further explanation.

  5. On chains of centered valuations

    Directory of Open Access Journals (Sweden)

    Rachid Chibloun

    2003-01-01

    Full Text Available We study chains of centered valuations of a domain A and chains of centered valuations of A [X1,…,Xn] corresponding to valuations of A. Finally, we make some applications to chains of valuations centered on the same ideal of A [X1,…,Xn] and extending the same valuation of A.

  6. CURRICULUM GUIDE, CHILD CARE CENTERS.

    Science.gov (United States)

    California State Dept. of Education, Sacramento.

    CALIFORNIA CHILD CARE CENTERS WERE ESTABLISHED IN 1943 TO SUPPLY SERVICES TO CHILDREN OF WORKING MOTHERS. THE CHILD CARE PROGRAM PROVIDES, WITHIN NURSERY AND SCHOOLAGE CENTERS, CARE AND EDUCATIONAL SUPERVISION FOR PRESCHOOL AND ELEMENTARY SCHOOL AGE CHILDREN. THE PHILOSOPHY OF THE CHILD CENTER PROGRAM IS BASED UPON THE BELIEF THAT EACH CHILD…

  7. Affinity Maturation of Monoclonal Antibody 1E11 by Targeted Randomization in CDR3 Regions Optimizes Therapeutic Antibody Targeting of HER2-Positive Gastric Cancer.

    Science.gov (United States)

    Ko, Bong-Kook; Choi, Soyoung; Cui, Lei Guang; Lee, Young-Ha; Hwang, In-Sik; Kim, Kyu-Tae; Shim, Hyunbo; Lee, Jong-Seo

    2015-01-01

    Anti-HER2 murine monoclonal antibody 1E11 has strong and synergistic anti-tumor activity in HER2-overexpressing gastric cancer cells when used in combination with trastuzumab. We presently optimized this antibody for human therapeutics. First, the complementarity determining regions (CDRs) of the murine antibody were grafted onto human germline immunoglobulin variable genes. No difference in affinity and biological activity was observed between chimeric 1E11 (ch1E11) and humanized 1E11 (hz1E11). Next, affinity maturation of hz1E11 was performed by the randomization of CDR-L3 and H3 residues followed by stringent biopanning selection. Milder selection pressure favored the selection of more diverse clones, whereas higher selection stringency resulted in the convergence of the panning output to a smaller number of clones with improved affinity. Clone 1A12 had four amino acid substitutions in CDR-L3, and showed a 10-fold increase in affinity compared to the parental clone and increased potency in an in vitro anti-proliferative activity assay with HER2-overepxressing gastric cancer cells. Clone 1A12 inhibited tumor growth of NCI-N87 xenograft model with similar efficacy to trastuzumab alone, and the combination treatment of 1A12 and trastuzumab completely removed the established tumors. These results suggest that humanized and affinity matured monoclonal antibody 1A12 is a highly optimized molecule for future therapeutic development against HER2-positive tumors.

  8. Application of Escherichia coli phage K1E DNA-dependent RNA polymerase for in vitro RNA synthesis and in vivo protein production in Bacillus megaterium.

    Science.gov (United States)

    Stammen, Simon; Schuller, Franziska; Dietrich, Sylvia; Gamer, Martin; Biedendieck, Rebekka; Jahn, Dieter

    2010-09-01

    Gene "7" of Escherichia coli phage K1E was proposed to encode a novel DNA-dependent RNA polymerase (RNAP). The corresponding protein was produced recombinantly, purified to apparent homogeneity via affinity chromatography, and successfully employed for in vitro RNA synthesis. Optimal assay conditions (pH 8, 37 degrees C, 10 mM magnesium chloride and 1.3 mM spermidine) were established. The corresponding promoter regions were identified on the phage genome and summarized in a sequence logo. Surprisingly, next to K1E promoters, the SP6 promoter was also recognized efficiently in vitro by K1E RNAP, while the T7 RNAP promoter was not recognized at all. Based on these results, a system for high-yield in vitro RNA synthesis using K1E RNAP was established. The template plasmid is a pUC18 derivative, which enables blue/white screening for positive cloning of the target DNA. Production of more than 5 microg of purified RNA per microgram plasmid DNA was achieved. Finally, in vivo protein production systems for Bacillus megaterium were established based on K1E and SP6 phage RNAP transcription. Up to 61.4 mg g (CDW) (-1) (K1E RNAP) of the reporter protein Gfp was produced in shaking flask cultures of B. megaterium. PMID:20596705

  9. COMPUTATIONAL SCIENCE CENTER

    Energy Technology Data Exchange (ETDEWEB)

    DAVENPORT, J.

    2006-11-01

    Computational Science is an integral component of Brookhaven's multi science mission, and is a reflection of the increased role of computation across all of science. Brookhaven currently has major efforts in data storage and analysis for the Relativistic Heavy Ion Collider (RHIC) and the ATLAS detector at CERN, and in quantum chromodynamics. The Laboratory is host for the QCDOC machines (quantum chromodynamics on a chip), 10 teraflop/s computers which boast 12,288 processors each. There are two here, one for the Riken/BNL Research Center and the other supported by DOE for the US Lattice Gauge Community and other scientific users. A 100 teraflop/s supercomputer will be installed at Brookhaven in the coming year, managed jointly by Brookhaven and Stony Brook, and funded by a grant from New York State. This machine will be used for computational science across Brookhaven's entire research program, and also by researchers at Stony Brook and across New York State. With Stony Brook, Brookhaven has formed the New York Center for Computational Science (NYCCS) as a focal point for interdisciplinary computational science, which is closely linked to Brookhaven's Computational Science Center (CSC). The CSC has established a strong program in computational science, with an emphasis on nanoscale electronic structure and molecular dynamics, accelerator design, computational fluid dynamics, medical imaging, parallel computing and numerical algorithms. We have been an active participant in DOES SciDAC program (Scientific Discovery through Advanced Computing). We are also planning a major expansion in computational biology in keeping with Laboratory initiatives. Additional laboratory initiatives with a dependence on a high level of computation include the development of hydrodynamics models for the interpretation of RHIC data, computational models for the atmospheric transport of aerosols, and models for combustion and for energy utilization. The CSC was formed to

  10. Citizen centered design

    Directory of Open Access Journals (Sweden)

    Ingrid Mulder

    2015-11-01

    Full Text Available Today architecture has to design for rapidly changing futures, in a citizen-centered way. That is, architecture needs to embrace meaningful design. Societal challenges ask for a new paradigm in city-making, which combines top-down public management with bottom-up social innovation to reach meaningful design. The biggest challenge is indeed to embrace a new collaborative attitude, a participatory approach, and to have the proper infrastructure that supports this social fabric. Participatory design and transition management are future-oriented, address people and institutions. Only through understanding people in context and the corresponding dynamics, one is able to design for liveable and sustainable urban environments, embracing the human scale.

  11. Interactive design center.

    Energy Technology Data Exchange (ETDEWEB)

    Pomplun, Alan R. (Sandia National Laboratories, Livermore, CA)

    2005-07-01

    Sandia's advanced computing resources provide researchers, engineers and analysts with the ability to develop and render highly detailed large-scale models and simulations. To take full advantage of these multi-million data point visualizations, display systems with comparable pixel counts are needed. The Interactive Design Center (IDC) is a second generation visualization theater designed to meet this need. The main display integrates twenty-seven projectors in a 9-wide by 3-high array with a total display resolution of more than 35 million pixels. Six individual SmartBoard displays offer interactive capabilities that include on-screen annotation and touch panel control of the facility's display systems. This report details the design, implementation and operation of this innovative facility.

  12. Mi Pueblo Food Center

    Directory of Open Access Journals (Sweden)

    Alexis A. Babb

    2016-04-01

    Full Text Available This case describes a current growth opportunity for Mi Pueblo Food Center, a Hispanic grocery chain with locations throughout the Bay Area, California. The CEO of Mi Pueblo is contemplating opening a new store location in East Palo Alto, CA, which has been without a local, full-service grocery store for over 20 years. Case objectives are for students to develop an understanding of how the grocery industry operates, the risks and opportunities associated with opening a new grocery store location, and the impact on social, environmental, and economic sustainability. The SWOT (Strengths, Weaknesses, Opportunities, Threats framework is used to analyze whether or not it is feasible for Mi Pueblo to open a new location in East Palo Alto. This case may be used with students in graduate and advanced undergraduate courses.

  13. Industrial Assessment Center Program

    Energy Technology Data Exchange (ETDEWEB)

    Dr. Dereje Agonafer

    2007-11-30

    The work described in this report was performed under the direction of the Industrial Assessment Center (IAC) at University of Texas at Arlington. The IAC at The University of Texas at Arlington is managed by Rutgers University under agreement with the United States Department of Energy Office of Industrial Technology, which financially supports the program. The objective of the IAC is to identify, evaluate, and recommend, through analysis of an industrial plant’s operations, opportunities to conserve energy and prevent pollution, thereby reducing the associated costs. IAC team members visit and survey the plant. Based upon observations made in the plant, preventive/corrective actions are recommended. At all times we try to offer specific and quantitative recommendations of cost savings, energy conservation, and pollution prevention to the plants we serve.

  14. Concurrent engineering research center

    Science.gov (United States)

    Callahan, John R.

    1995-01-01

    The projects undertaken by The Concurrent Engineering Research Center (CERC) at West Virginia University are reported and summarized. CERC's participation in the Department of Defense's Defense Advanced Research Project relating to technology needed to improve the product development process is described, particularly in the area of advanced weapon systems. The efforts committed to improving collaboration among the diverse and distributed health care providers are reported, along with the research activities for NASA in Independent Software Verification and Validation. CERC also takes part in the electronic respirator certification initiated by The National Institute for Occupational Safety and Health, as well as in the efforts to find a solution to the problem of producing environment-friendly end-products for product developers worldwide. The 3M Fiber Metal Matrix Composite Model Factory Program is discussed. CERC technologies, facilities,and personnel-related issues are described, along with its library and technical services and recent publications.

  15. Supernova Science Center

    Energy Technology Data Exchange (ETDEWEB)

    S. E. Woosley

    2008-05-05

    The Supernova Science Center (SNSC) was founded in 2001 to carry out theoretical and computational research leading to a better understanding of supernovae and related transients. The SNSC, a four-institutional collaboration, included scientists from LANL, LLNL, the University of Arizona (UA), and the University of California at Santa Cruz (UCSC). Intitially, the SNSC was funded for three years of operation, but in 2004 an opportunity was provided to submit a renewal proposal for two years. That proposal was funded and subsequently, at UCSC, a one year no-cost extension was granted. The total operational time of the SNSC was thus July 15, 2001 - July 15, 2007. This document summarizes the research and findings of the SNSC and provides a cummulative publication list.

  16. Data-analysis center

    International Nuclear Information System (INIS)

    Changes at the data analysis center are summarized. The most dramatic change in the operation of the Data-Analysis Center (DAC) has been the implementation of a VAX cluster. The cluster is a network of loosely coupled VAX computers tied together with a high-speed network and sharing common disks. System software was enhanced with the addition of DECalc, a spread-sheet program for the VAX. EUNICE, a UNIX environment package that is layered on VMS, was added to VAX machine MPFG0. Networking capabilities in the DAC were significantly increased during 1984. Specifically, access to remote networks, such as TELENET, was made easier through the C-Division computers. In addition, the DAC acquired dial-out modems and software so that users could transfer files between DAC machines and other computers over phone lines. A major project in the data-acquisition section in the past year was a special-purpose multiprocessor system to analyze data generated at LAMPF. During the year requirements for the system have been defined, hardware for a prototype system (PDP-11/730s and Ethernet) has been selected, and the system software has been designed. During 1984 both Q replay and data acquisition using VAXes and the VMS operating system were fully implemented and released to users. VAX data acquisition was used successfully in experiments at EPICS at LAMPF, at the Bates Linear Accelerator in Massachusetts, and at the Bevalac at Lawrence Berkeley National Laboratory. The EPICS VAX-11/730 system was upgraded to a VAX-11/750 at the end of 1984 to improve on-line response and performance. Another VAX-11/750 is being purchased for HRS

  17. A Crosslinking Analysis of GAP-43 Interactions with Other Proteins in Differentiated N1E-115 Cells

    Directory of Open Access Journals (Sweden)

    John B. Denny

    2008-09-01

    Full Text Available It has been suggested that GAP-43 (growth-associated protein binds to various proteins in growing neurons as part of its mechanism of action. To test this hypothesis in vivo, differentiated N1E-115 neuroblastoma cells were labeled with [35S]-amino acids and were treated with a cleavable crosslinking reagent. The cells were lysed in detergent and the lysates were centrifuged at 100,000 x g to isolate crosslinked complexes. Following cleavage of the crosslinks and analysis by two-dimensional gel electrophoresis, it was found that the crosslinker increased the level of various proteins, and particularly actin, in this pellet fraction. However, GAP-43 was not present, suggesting that GAP-43 was not extensively crosslinked to proteins of the cytoskeleton and membrane skeleton and did not sediment with them. GAP-43 also did not sediment with the membrane skeleton following nonionic detergent lysis. Calmodulin, but not actin or other proposed interaction partners, co-immunoprecipitated with GAP-43 from the 100,000 x g supernatant following crosslinker addition to cells or cell lysates. Faint spots at 34 kDa and 60 kDa were also present. Additional GAP-43 was recovered from GAP-43 immunoprecipitation supernatants with anti-calmodulin but not with anti-actin. The results suggest that GAP-43 is not present in complexes with actin or other membrane skeletal or cytoskeletal proteins in these cells, but it is nevertheless possible that a small fraction of the total GAP-43 may interact with other proteins.

  18. Sunyaev-Zel'Dovich effect observations of the bullet cluster (1E 0657-56) with APEX-SZ

    Energy Technology Data Exchange (ETDEWEB)

    Halverson, N.W.; Lanting, T.; Ade, P.A.R.; Basu, K.; Bender, A.N.; Benson, B.A.; Bertoldi, F.; Cho, H.-M.; Chon, G.; Clarke, J.; Dobbs, M.; Ferrusca, D.; Gusten, R.; Holzapfel, W.L.; Kovacs, A.; Kennedy, J.; Kermish, Z.; Kneissl, R.; Lee, A.T.; Lueker, M.; Mehl, J.; Menten, K.M.; Muders, D.; Nord, M.; Pacaud, F.; Plagge, T.; Reichardt, C.; Richards, P.L.; Schaaf, R.; Schilke, P.; Schuller, F.; Schwan, D.; Spieler, H.; Tucker, C.; Weiss, A.; Zahn, O.

    2008-07-25

    We present observations of the Sunyaev-Zel'dovich effect (SZE) in the Bullet cluster (1E 0657-56) using the APEX-SZ instrument at 150 GHz with a resolution of 1'. The main results are maps of the SZE in this massive, merging galaxy cluster. The cluster is detected with 23 sigma significance within the central 1' radius of the source position. The SZE map has a broadly similar morphology to that in existing X-ray maps of this system, and we find no evidence for significant contamination of the SZE emission by radio or IR sources. In order to make simple quantitative comparisons with cluster gas models derived from X-ray observations, we fit our data to an isothermal elliptical beta model, despite the inadequacy of such a model for this complex merging system. With an X-ray derived prior on the power-law index, beta = 1.04+0.16-0.10, we find a core radius rc = 142" +- 18", an axial ratio of 0.889 +- 0.072, and a central temperature decrement of -771 +- 71 muKCMB, including a +-5.5percent flux calibration uncertainty. Combining the APEX-SZ map with a map of projected electron surface density from Chandra X-ray observations, we determine the mass-weighted temperature of the cluster gas to be Tmg = 10.8 +- 0.9 keV, significantly lower than some previously reported X-ray spectroscopic temperatures. Under the assumption of an isothermal cluster gas distribution in hydrostatic equilibrium, we compute the gas mass fraction for prolate and oblate spheroidal geometries and find it to be consistent with previous results from X-ray and weak-lensing observations. This work is the first result from the APEX-SZ experiment and represents the first reported scientific result from observations with a large array of multiplexed superconducting transition-edge sensor bolometers.

  19. Quantitative analysis of infiltrating immune cells and bovine papillomavirus type 1 E2-positive cells in equine sarcoids.

    Science.gov (United States)

    Geisshüsler, H; Marti, E; Stoffel, M H; Kühni, K; Stojiljkovic, A; von Tscharner, C; Vidondo, B; Gerber, V; Koch, C

    2016-10-01

    Sarcoids are the most frequently observed skin tumours in equids and consist of cutaneous accumulations of transformed fibroblasts. Their aetiopathogenesis is closely linked to a presumably abortive infection by bovine papillomavirus (BPV) types 1 and 2. In cattle, dermal fibropapillomas induced by BPV1/2 usually regress spontaneously due to a local, cell-mediated, immune response; however, equids appear to lack an effective immune response to BPV1/2 and mechanisms of immune evasion have been postulated. As a consequence, equine sarcoids tend to persist and are prone to recur. In this study, cryosections were analysed by immunofluorescent staining and a high content analysis system to determine the presence and distribution of CD4(+), CD8(+), FoxP3(+), RORγt(-), CD206(+) and CD14(+) cells, along with expression of the BPV1 early regulatory protein E2. A higher density of cells was positive for BPV1 E2(+) within the transformed tissue than in perilesional tissue or normal skin of horses with sarcoids and control horses. The proportion of CD8(+) cytotoxic T cells was significantly increased in perilesional and lesional tissues, whereas CD4(+) T helper cells were present in higher density only in lesional tissue compared to normal skin from horses with and without sarcoids. The proportion of pro-inflammatory CD4(+)FoxP3(+)RORγt(+) regulatory T cells was decreased in sarcoid tissue compared to perilesional, distant and control tissue. There were no significant differences in densities of CD4(+)FoxP3(+) RORγt(-) regulatory T cells between sarcoids and control tissues. Equine sarcoids are characterised by infiltrations of CD8(+) and CD4(+) T cells, with decreased representation by pro-inflammatory CD4(+)FoxP3(+)RORγt(+) regulatory T cells. PMID:27687925

  20. Crystallization and preliminary X-ray diffraction studies of AsaP1_E294A and AsaP1_E294Q, two inactive mutants of the toxic zinc metallopeptidase AsaP1 from Aeromonas salmonicida subsp. achromogenes

    OpenAIRE

    Bogdanović, Xenia; Singh, Rajesh Kumar; Hentschke, Johanna; Gudmundsdóttir, Bjarnheidur K.; Hinrichs, Winfried

    2009-01-01

    Crystallization and preliminary X-ray diffraction studies of AsaP1_E294A and AsaP1_E294Q, two inactive mutants of the toxic zinc metallopeptidase AsaP1 from A. salmonicida subsp. achromogenes, are reported.

  1. Interstellar HOCN in the Galactic center region

    CERN Document Server

    Bruenken, S; Martin, S; Verheyen, L; Menten, K M

    2010-01-01

    Aims. Our aim is to confirm the interstellar detection of cyanic acid, HOCN, in the Galactic center clouds. It has previously been tentatively detected only in Sgr B2(OH). Methods. We used a complete line survey of the hot cores Sgr B2(N) and (M) in the 3 mm range, complemented by additional observations carried out with the IRAM 30 m telescope at selected frequencies in the 2 mm band and towards four additional positions in the Sgr B2 cloud complex in the 2 and 3 mm bands. The spectral survey was analysed in the local thermodynamical equilibrium approximation (LTE) by modeling the emission of all identified molecules simultaneously. This allowed us to distinguish weak features of HOCN from the rich line spectrum observed in Sgr B2(N) and (M). Lines of the more stable (by 1.1 eV) isomer isocyanic acid, HNCO, in these sources, as well as those of HOCN and HNCO towards the other positions, were analysed in the LTE approximation as well. Results. Four transitions of HOCN were detected in a quiescent molecular cl...

  2. Kennedy Space Center

    Science.gov (United States)

    Griffin, Amanda

    2012-01-01

    Among 2011's many accomplishments, we safely retired the Space Shuttle Program after 30 incredible years; completed the International Space Station and are taking steps to enable it to reach its full potential as a multi-purpose laboratory; and helped to expand scientific knowledge with missions like Aquarius, GRAIL, and the Mars Science Laboratory. Responding to national budget challenges, we are prioritizing critical capabilities and divesting ourselves of assets no longer needed for NASA's future exploration programs. Since these facilities do not have to be maintained or demolished, the government saves money. At the same time, our commercial partners save money because they do not have to build new facilities. It is a win-win for everyone. Moving forward, 2012 will be even more historically significant as we celebrate the 50th Anniversary of Kennedy Space Center. In the coming year, KSC will facilitate commercial transportation to low-Earth orbit and support the evolution of the Space Launch System and Orion crew vehicle as they ready for exploration missions, which will shape how human beings view the universe. While NASA's Vision is to lead scientific and technological advances in aeronautics and space for a Nation on the frontier of discovery KSC's vision is to be the world's preeminent launch complex for government and commercial space access, enabling the world to explore and work in space. KSC's Mission is to safely manage, develop, integrate, and sustain space systems through partnerships that enable innovative, diverse access to space and inspires the Nation's future explorers.

  3. Identification of two novel mutations, PSEN1 E280K and PRNP G127S, in a Malaysian family

    Directory of Open Access Journals (Sweden)

    Ch’ng GS

    2015-09-01

    Full Text Available Gaik-Siew Ch’ng,1,* Seong Soo A An,2,* Sun Oh Bae,2 Eva Bagyinszky,2 SangYun Kim3,41Department of Genetics, Kuala Lumpur Hospital, Malaysia; 2Department of Bionano Technology, Gachon University, 3Department of Neurology, Seoul National University College of Medicine, 4Seoul National University Bundang Hospital, South Korea*These authors contributed equally to this workAbstract: Alzheimer’s disease (AD is the most common form of dementia, which can be categorized into two main forms: early onset AD and late onset AD. The genetic background of early onset AD is well understood, and three genes, the APP, PSEN1, and PSEN2 have been identified as causative genes. In the current study, we tested three siblings from Malaysia who were diagnosed with early onset dementia, as well as their available family members. The family history was positive as their deceased father was similarly affected. Patients were tested for mutations in APP, PSEN1, PSEN2, and PRNP. A novel variant, E280K, was discovered in exon 8 of PSEN1 in the three siblings. In silico analyses with SIFT, SNAP, and PolyPhen2 prediction tools and three-dimensional modeling were performed, and the results suggested that the mutation is probably a pathogenic variant. Two additional pathogenic mutations were previously been described for codon 280, E280A, and E280G, which could support the importance of the E280 residue in the PS1 protein contributing to the pathogenic nature of E280K. Additional ten family members were screened for the E280K mutation, and all of them were negative. Six of them presented with a variety of neuropsychiatric symptoms, including learning disabilities, epilepsy, and schizophrenia, while four family members were asymptomatic. A novel PRNP G127S mutation was found in a step-niece of the three siblings harboring the PSEN1 E280K mutation. In silico predictions for PRNP G127S mutation suggested that this might be possibly a damaging variant. Additional studies to

  4. Chandra and XMM-Newton study of the supernova remnant Kes 73 hosting the magnetar 1E 1841-045

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Harsha S.; Safi-Harb, Samar [Department of Physics and Astronomy, University of Manitoba, Winnipeg MB R3T 2N2 (Canada); Slane, Patrick O. [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA 02138 (United States); Gotthelf, E. V., E-mail: harsha@physics.umanitoba.ca, E-mail: samar@physics.umanitoba.ca, E-mail: slane@cfa.harvard.edu, E-mail: eric@astro.columbia.edu [Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States)

    2014-01-20

    We present a Chandra and XMM-Newton study of the supernova remnant (SNR) Kes 73 hosting the anomalous X-ray pulsar 1E 1841–045. The Chandra image reveals clumpy structures across the remnant with enhanced emission along the western rim. The X-ray emission fills the radio shell and spatially correlates with the infrared image. The global X-ray spectrum is described by a two-component thermal model with a column density N {sub H} = 2.6{sub −0.3}{sup +0.4}×10{sup 22} cm{sup –2} and a total luminosity of L{sub X} = 3.3{sub −0.5}{sup +0.7}×10{sup 37} erg s{sup –1} (0.5-10 keV, at an assumed distance of 8.5 kpc). The soft component is characterized by a temperature kT{sub s} = 0.5{sub −0.2}{sup +0.1} keV, a high ionization timescale, and enhanced Si and S abundances, suggesting emission that is dominated by shocked ejecta. The hard component has a temperature kT{sub h} = 1.6{sub −0.7}{sup +0.8} keV, a relatively low ionization timescale, and mostly solar abundances suggesting emission that is dominated by interstellar/circumstellar shocked material. A spatially resolved spectroscopy study reveals no significant variations in the spectral properties. We infer an SNR age ranging between 750 yr and 2100 yr, an explosion energy of 3.0{sub −1.8}{sup +2.8}×10{sup 50} erg and a shock velocity of (1.2 ± 0.3)×10{sup 3} km s{sup –1} (under the Sedov phase assumption). We also discuss the possible scenario for Kes 73 expanding into the late red-supergiant wind phase of its massive progenitor. Comparing the inferred metal abundances to core-collapse nucleosynthesis model yields, we estimate a progenitor mass ≳20 M {sub ☉}, adding a candidate to the growing list of highly magnetized neutron stars proposed to be associated with very massive progenitors.

  5. Center for Neuroscience & Regenerative Medicine

    Data.gov (United States)

    Federal Laboratory Consortium — The Center for Neuroscience and Regenerative Medicine (CNRM) was established as a collaborative intramural federal program involving the U.S. Department of Defense...

  6. Consolidated Copayment Processing Center (CCPC)

    Data.gov (United States)

    Department of Veterans Affairs — The Consolidated Copayment Processing Center (CCPC) database contains Veteran patient contact and billing information in order to support the printing and mailing...

  7. Center for Environmental Health Sciences

    Data.gov (United States)

    Federal Laboratory Consortium — The primary research objective of the Center for Environmental Health Sciences (CEHS) at the University of Montana is to advance knowledge of environmental impacts...

  8. Energetics Manufacturing Technology Center (EMTC)

    Data.gov (United States)

    Federal Laboratory Consortium — The Energetics Manufacturing Technology Center (EMTC), established in 1994 by the Office of Naval Research (ONR) Manufacturing Technology (ManTech) Program, is Navy...

  9. Satellite medical centers project

    Science.gov (United States)

    Aggarwal, Arvind

    2002-08-01

    World class health care for common man at low affordable cost: anywhere, anytime The project envisages to set up a national network of satellite Medical centers. Each SMC would be manned by doctors, nurses and technicians, six doctors, six nurses, six technicians would be required to provide 24 hour cover, each SMC would operate 24 hours x 7 days. It would be equipped with the Digital telemedicine devices for capturing clinical patient information and investigations in the form of voice, images and data and create an audiovisual text file - a virtual Digital patient. Through the broad band connectivity the virtual patient can be sent to the central hub, manned by specialists, specialists from several specialists sitting together can view the virtual patient and provide a specialized opinion, they can see the virtual patient, see the examination on line through video conference or even PCs, talk to the patient and the doctor at the SMC and controlle capturing of information during examination and investigations of the patient at the SMC - thus creating a virtual Digital consultant at the SMC. Central hub shall be connected to the doctors and consultants in remote locations or tertiary care hospitals any where in the world, thus creating a virtual hub the hierarchical system shall provide upgradation of knowledge to thedoctors in central hub and smc and thus continued medical education and benefit the patient thru the world class treatment in the smc located at his door step. SMC shall be set up by franchisee who shall get safe business opportunity with high returns, patients shall get Low cost user friendly worldclass health care anywhere anytime, Doctors can get better meaningful selfemplyment with better earnings, flexibility of working time and place. SMC shall provide a wide variety of services from primary care to world class Global consultation for difficult patients.

  10. ROSAT Science Data Center

    Science.gov (United States)

    Murray, Stephen; Pisarski, Ryszard L. (Technical Monitor)

    2001-01-01

    This report provides a summary of the Smithsonian Astrophysical Observatory (SAO) ROSAT SCIENCE DATA CENTER (RSDC) activities for the recent years of our contract. Details have already been reported in the monthly reports. The SAO was responsible for the High Resolution Imager (HRI) detector on ROSAT. We also provided and supported the HRI standard analysis software used in the pipeline processing (SASS). Working with our colleagues at the Max Planck in Garching Germany (MPE), we fixed bugs and provided enhancements. The last major effort in this area was the port from VMS/VAX to VMS/ALPHA architecture. In 1998, a timing bug was found in the HRI standard processing system which degraded the positional accuracy because events accessed incorrect aspect solutions. The bug was fixed and we developed off-line correction routines and provided them to the community. The Post Reduction Off-line Software (PROS) package was developed by SAO and runs in the IRAF environment. Although in recent years PROS was not a contractual responsibility of the RSDC, we continued to maintain the system and provided new capabilities such as the ability to deal with simulated AXAF data in preparation for the NASA call for proposals for Chandra. Our most recent activities in this area included the debugging necessary for newer versions of IRAF which broke some of our software. At SAO we have an operating version of PROS and hope to release a patch even though almost all functionality that was lost was subsequently recovered via an IRAF patch (i.e. most of our problems were caused by an IRAF bug).

  11. The study of ctx B and rstR variations of toxigenic Vibrio cholerae O1 E1 Tor strains isolated from 1961 to 2010 in China

    Institute of Scientific and Technical Information of China (English)

    梁未丽

    2014-01-01

    Objective To understand the ctx B and rstR variations of toxigenic Vibrio cholerae(V.cholerae)O1 E1 Tor strains isolated from different provinces in China from1961 to 2010.Methods All 385 toxigenic V.cholerae O1 E1 Tor strains were selected,which were isolated in China between year 1961 and 2010.ctx B gene was amplified by PCR method and sequenced for further analysis.rstR was detected with PCR by using the genotype

  12. PED/PEA-15 inhibits hydrogen peroxide-induced apoptosis in Ins-1E pancreatic beta-cells via PLD-1.

    Directory of Open Access Journals (Sweden)

    Francesca Fiory

    Full Text Available The small scaffold protein PED/PEA-15 is involved in several different physiologic and pathologic processes, such as cell proliferation and survival, diabetes and cancer. PED/PEA-15 exerts an anti-apoptotic function due to its ability to interfere with both extrinsic and intrinsic apoptotic pathways in different cell types. Recent evidence shows that mice overexpressing PED/PEA-15 present larger pancreatic islets and increased beta-cells mass. In the present work we investigated PED/PEA-15 role in hydrogen peroxide-induced apoptosis in Ins-1E beta-cells. In pancreatic islets isolated from Tg(PED/PEA-15 mice hydrogen peroxide-induced DNA fragmentation was lower compared to WT islets. TUNEL analysis showed that PED/PEA-15 overexpression increases the viability of Ins-1E beta-cells and enhances their resistance to apoptosis induced by hydrogen peroxide exposure. The activity of caspase-3 and the cleavage of PARP-1 were markedly reduced in Ins-1E cells overexpressing PED/PEA-15 (Ins-1E(PED/PEA-15. In parallel, we observed a decrease of the mRNA levels of pro-apoptotic genes Bcl-xS and Bad. In contrast, the expression of the anti-apoptotic gene Bcl-xL was enhanced. Accordingly, DNA fragmentation was higher in control cells compared to Ins-1E(PED/PEA-15 cells. Interestingly, the preincubation with propranolol, an inhibitor of the pathway of PLD-1, a known interactor of PED/PEA-15, responsible for its deleterious effects on glucose tolerance, abolishes the antiapoptotic effects of PED/PEA-15 overexpression in Ins-1E beta-cells. The same results have been obtained by inhibiting PED/PEA-15 interaction with PLD-1 in Ins-1E(PED/PEA-15. These results show that PED/PEA-15 overexpression is sufficient to block hydrogen peroxide-induced apoptosis in Ins-1E cells through a PLD-1 mediated mechanism.

  13. Clean Energy Application Center

    Energy Technology Data Exchange (ETDEWEB)

    Freihaut, Jim

    2013-09-30

    The Mid Atlantic Clean Energy Application Center (MACEAC), managed by The Penn State College of Engineering, serves the six states in the Mid-Atlantic region (Pennsylvania, New Jersey, Delaware, Maryland, Virginia and West Virginia) plus the District of Columbia. The goals of the Mid-Atlantic CEAC are to promote the adoption of Combined Heat and Power (CHP), Waste Heat Recovery (WHR) and District Energy Systems (DES) in the Mid Atlantic area through education and technical support to more than 1,200 regional industry and government representatives in the region. The successful promotion of these technologies by the MACEAC was accomplished through the following efforts; (1)The MACEAC developed a series of technology transfer networks with State energy and environmental offices, Association of Energy Engineers local chapters, local community development organizations, utilities and, Penn State Department of Architectural Engineering alumni and their firms to effectively educate local practitioners about the energy utilization, environmental and economic advantages of CHP, WHR and DES; (2) Completed assessments of the regional technical and market potential for CHP, WHR and DE technologies application in the context of state specific energy prices, state energy and efficiency portfolio development. The studies were completed for Pennsylvania, New Jersey and Maryland and included a set of incentive adoption probability models used as a to guide during implementation discussions with State energy policy makers; (3) Using the technical and market assessments and adoption incentive models, the Mid Atlantic CEAC developed regional strategic action plans for the promotion of CHP Application technology for Pennsylvania, New Jersey and Maryland; (4) The CHP market assessment and incentive adoption model information was discussed, on a continuing basis, with relevant state agencies, policy makers and Public Utility Commission organizations resulting in CHP favorable incentive

  14. Danish Chinese Center for Nanometals

    DEFF Research Database (Denmark)

    Winther, Grethe

    The Danish-Chinese Center for Nanometals is funded by the Danish National Research Foundation and the National Natural Science Foundation of China. The Chinese partners in the Center are Institute of Metal Research in Shenyang, Tsinghua University and Chongqing University. The Danish part...

  15. Acoustic Center or Time Origin?

    DEFF Research Database (Denmark)

    Staffeldt, Henrik

    1999-01-01

    The paper discusses the acoustic center in relation to measurements of loudspeaker polar data. Also, it presents the related concept time origin and discusses the deviation that appears between positions of the acoustic center found by wavefront based and time based measuring methods....

  16. Learning Centers: Development and Operation.

    Science.gov (United States)

    Bennie, Frances

    There has been in recent years a growing acceptance of individualized learning concepts. Learning Centers have come to be viewed as an economical and viable strategy for accommodating diverse learning styles and needs. This book provides the educator with an understanding of the learning center concept, its origins, present manifestations, and…

  17. Pengembangan Model Manajemen ICT Center

    Directory of Open Access Journals (Sweden)

    Hakkun Elmunsyah

    2013-01-01

    Full Text Available Abstrak: Pengembangan Model Manajemen ICT Center. Kemendiknas telah melakukan investasi  cukup besar berupa pembangunan Jejaring komputer pendidikan nasional yang disebut Jaringan Pendidikan Nasional (Jardiknas, pada sekolah menengah kejuruan (SMK di seluruh Indonesia yang dikenal dengan nama ICT center. Penelitian ini bertujuan untuk menemukan model manajemen ICT center sesuai karakteristik SMK sehingga dapat memberikan kontribusi mutu pada SMK tersebut. Penelitian ini merupakan penelitian pengembangan atau Research and Development yang dikembangkan oleh Borg and Gall. Hasil secara keseluruhan penelitian menunjukkan berdasarkan uji coba keefektivan kinerja manajemen pada skala terbatas dan lebih luas menunjukkan bahwa model manajemen ICT center memenuhi kriteria sangat efektif. Kata-kata kunci: Jardiknas, SMK, model manajemen ICT center, kontribusi mutu

  18. Gliadin fragments and a specific gliadin 33-mer peptide close KATP channels and induce insulin secretion in INS-1E cells and rat islets of langerhans.

    Directory of Open Access Journals (Sweden)

    Morten Dall

    Full Text Available In non-obese diabetic (NOD mice, diabetes incidence is reduced by a gluten-free diet. Gluten peptides, such as the compound gliadin, can cross the intestinal barrier and may directly affect pancreatic beta cells. We investigated the effects of enzymatically-digested gliadin in NOD mice, INS-1E cells and rat islets. Six injections of gliadin digest in 6-week-old NOD mice did not affect diabetes development, but increased weight gain (20% increase by day 100. In INS-1E cells, incubation with gliadin digest induced a dose-dependent increase in insulin secretion, up to 2.5-fold after 24 hours. A similar effect was observed in isolated rat islets (1.6-fold increase. In INS-1E cells, diazoxide reduced the stimulatory effect of gliadin digest. Additionally, gliadin digest was shown to decrease current through KATP-channels. A specific gliadin 33-mer had a similar effect, both on current and insulin secretion. Finally, INS-1E incubation with gliadin digest potentiated palmitate-induced insulin secretion by 13% compared to controls. Our data suggest that gliadin fragments may contribute to the beta-cell hyperactivity observed prior to the development of type 1 diabetes.

  19. Gliadin Fragments and a Specific Gliadin 33-mer Peptide Close KATP Channels and Induce Insulin Secretion in INS-1E Cells and Rat Islets of Langerhans

    DEFF Research Database (Denmark)

    Dall, Morten; Calloe, Kirstine; Haupt-Jorgensen, Martin;

    2013-01-01

    . A similar effect was observed in isolated rat islets (1.6-fold increase). In INS-1E cells, diazoxide reduced the stimulatory effect of gliadin digest. Additionally, gliadin digest was shown to decrease current through KATP-channels. A specific gliadin 33-mer had a similar effect, both on current and insulin...

  20. A model for the parabolic slices Per1(e2πip/q) in moduli space of quadratic rational maps

    DEFF Research Database (Denmark)

    Uhre, Eva

    2010-01-01

    The notion of relatedness loci in the parabolic slices Per1(e2πip/q) in moduli space of quadratic rational maps is introduced. They are counterparts of the disconnectedness or escape locus in the slice of quadratic polynomials. A model for these loci is presented, and a strategy of proof of the f...

  1. Validation of the hepatocyte-like HPCT-1E3 cell line as an in vitro model for the prediction of acute in vivo toxicity.

    Science.gov (United States)

    Halwachs, Sandra; Lakoma, Cathleen; Honscha, Walther

    2013-11-01

    In a pilot study, we tested 20 randomly-selected chemicals for their cytotoxicity toward the HPCT-1E3 cell model, in order to prove the ability of this in vitro model to predict human acute in vivo toxicity. The study revealed that, in contrast to most other in vitro models, results from the HPCT-1E3 cell-based system show better correlation with the more-relevant human acute lethal doses, whereas results from most other systems have a high predictivity for human lethal serum concentrations. For the prevalidation of the HPCT-1E3 model as a surrogate for regulatory acute in vivo toxicity tests, we have now expanded the list of tested chemicals to 57 substances, and have compared the results with data from the HepG2 cell assay. Again, a better correlation of HPCT-1E3 IC50 values with human oral lethal doses, as compared to correlation with human lethal serum concentrations, was observed after the pooling of all the tested substances (r(2) = 0.53 [P in vivo toxicity tests.

  2. Limits on the presence of sulfur in the young SNRs LMC N132D and SMC 1E0102.2-7219

    International Nuclear Information System (INIS)

    A new area-spectroscopy search for sulfur as a tracer of the Si Group of elements in the ejecta of the young SNRs, LMC N132D and SMC 1E0102.2--7219, yields negative results for [S II]λλ6719, 6731 and [S III]λλ9064, 9532

  3. Full-length human placental sFlt-1-e15a isoform induces distinct maternal phenotypes of preeclampsia in mice.

    Directory of Open Access Journals (Sweden)

    Gabor Szalai

    Full Text Available Most anti-angiogenic preeclampsia models in rodents utilized the overexpression of a truncated soluble fms-like tyrosine kinase-1 (sFlt-1 not expressed in any species. Other limitations of mouse preeclampsia models included stressful blood pressure measurements and the lack of postpartum monitoring. We aimed to 1 develop a mouse model of preeclampsia by administering the most abundant human placental sFlt-1 isoform (hsFlt-1-e15a in preeclampsia; 2 determine blood pressures in non-stressed conditions; and 3 develop a survival surgery that enables the collection of fetuses and placentas and postpartum (PP monitoring.Pregnancy status of CD-1 mice was evaluated with high-frequency ultrasound on gestational days (GD 6 and 7. Telemetry catheters were implanted in the carotid artery on GD7, and their positions were verified by ultrasound on GD13. Mice were injected through tail-vein with adenoviruses expressing hsFlt-1-e15a (n = 11 or green fluorescent protein (GFP; n = 9 on GD8/GD11. Placentas and pups were delivered by cesarean section on GD18 allowing PP monitoring. Urine samples were collected with cystocentesis on GD6/GD7, GD13, GD18, and PPD8, and albumin/creatinine ratios were determined. GFP and hsFlt-1-e15a expression profiles were determined by qRT-PCR. Aortic ring assays were performed to assess the effect of hsFlt-1-e15a on endothelia.Ultrasound predicted pregnancy on GD7 in 97% of cases. Cesarean section survival rate was 100%. Mean arterial blood pressure was higher in hsFlt-1-e15a-treated than in GFP-treated mice (∆MAP = 13.2 mmHg, p = 0.00107; GD18. Focal glomerular changes were found in hsFlt-1-e15a -treated mice, which had higher urine albumin/creatinine ratios than controls (109.3 ± 51.7 μg/mg vs. 19.3 ± 5.6 μg/mg, p = 4.4 x 10(-2; GD18. Aortic ring assays showed a 46% lesser microvessel outgrowth in hsFlt-1-e15a-treated than in GFP-treated mice (p = 1.2 x 10(-2. Placental and fetal weights did not differ between the groups

  4. Interaction of the amyloid precursor protein-like protein 1 (APLP1) E2 domain with heparan sulfate involves two distinct binding modes

    Energy Technology Data Exchange (ETDEWEB)

    Dahms, Sven O., E-mail: sdahms@fli-leibniz.de [Leibniz Institute for Age Research (FLI), Beutenbergstrasse 11, 07745 Jena (Germany); Mayer, Magnus C. [Freie Universität Berlin, Thielallee 63, 14195 Berlin (Germany); Miltenyi Biotec GmbH, Robert-Koch-Strasse 1, 17166 Teterow (Germany); Roeser, Dirk [Leibniz Institute for Age Research (FLI), Beutenbergstrasse 11, 07745 Jena (Germany); Multhaup, Gerd [McGill University Montreal, Montreal, Quebec H3G 1Y6 (Canada); Than, Manuel E., E-mail: sdahms@fli-leibniz.de [Leibniz Institute for Age Research (FLI), Beutenbergstrasse 11, 07745 Jena (Germany)

    2015-03-01

    Two X-ray structures of APLP1 E2 with and without a heparin dodecasaccharide are presented, revealing two distinct binding modes of the protein to heparan sulfate. The data provide a mechanistic explanation of how APP-like proteins bind to heparan sulfates and how they specifically recognize nonreducing structures of heparan sulfates. Beyond the pathology of Alzheimer’s disease, the members of the amyloid precursor protein (APP) family are essential for neuronal development and cell homeostasis in mammals. APP and its paralogues APP-like protein 1 (APLP1) and APP-like protein 2 (APLP2) contain the highly conserved heparan sulfate (HS) binding domain E2, which effects various (patho)physiological functions. Here, two crystal structures of the E2 domain of APLP1 are presented in the apo form and in complex with a heparin dodecasaccharide at 2.5 Å resolution. The apo structure of APLP1 E2 revealed an unfolded and hence flexible N-terminal helix αA. The (APLP1 E2){sub 2}–(heparin){sub 2} complex structure revealed two distinct binding modes, with APLP1 E2 explicitly recognizing the heparin terminus but also interacting with a continuous heparin chain. The latter only requires a certain register of the sugar moieties that fits to a positively charged surface patch and contributes to the general heparin-binding capability of APP-family proteins. Terminal binding of APLP1 E2 to heparin specifically involves a structure of the nonreducing end that is very similar to heparanase-processed HS chains. These data reveal a conserved mechanism for the binding of APP-family proteins to HS and imply a specific regulatory role of HS modifications in the biology of APP and APP-like proteins.

  5. Emergency Operations Center ribbon cutting

    Science.gov (United States)

    2009-01-01

    Center Director Gene Goldman and special guests celebrate the opening of the site's new Emergency Operations Center on June 2. Participants included (l t r): Steven Cooper, deputy director of the National Weather Service Southern Region; Tom Luedtke, NASA associate administrator for institutions and management; Charles Scales, NASA associate deputy administrator; Mississippi Gov. Haley Barbour; Gene Goldman, director of Stennis Space Center; Jack Forsythe, NASA assistant administrator for the Office of Security and Program Protection; Dr. Richard Williams, NASA chief health and medical officer; and Weldon Starks, president of Starks Contracting Company Inc. of Biloxi.

  6. Shopping Malls - ShoppingCenters

    Data.gov (United States)

    NSGIC GIS Inventory (aka Ramona) — Collected from a variety of sources both commercial and internal, this layer represents shopping center locations within Volusia County and is maintained by the...

  7. Human-Centered Design Capability

    Science.gov (United States)

    Fitts, David J.; Howard, Robert

    2009-01-01

    For NASA, human-centered design (HCD) seeks opportunities to mitigate the challenges of living and working in space in order to enhance human productivity and well-being. Direct design participation during the development stage is difficult, however, during project formulation, a HCD approach can lead to better more cost-effective products. HCD can also help a program enter the development stage with a clear vision for product acquisition. HCD tools for clarifying design intent are listed. To infuse HCD into the spaceflight lifecycle the Space and Life Sciences Directorate developed the Habitability Design Center. The Center has collaborated successfully with program and project design teams and with JSC's Engineering Directorate. This presentation discusses HCD capabilities and depicts the Center's design examples and capabilities.

  8. Poison control center - emergency number

    Science.gov (United States)

    ... ANYWHERE IN THE UNITED STATES This national hotline number will let you talk to experts in poisoning. ... centers in the United States use this national number. You should call if you have any questions ...

  9. Poison control center - emergency number

    Science.gov (United States)

    For a POISON EMERGENCY call: 1-800-222-1222 ANYWHERE IN THE UNITED STATES This national hotline number will let you ... is a free and confidential service. All local poison control centers in the United States use this ...

  10. FEMA Disaster Recovery Centers - KML

    Data.gov (United States)

    Department of Homeland Security — This is a KML file for FEMA's Disaster Recovery Centers (DRC). A DRC is a readily accessible facility or mobile office set up by FEMA where applicants may go for...

  11. Aim to International Shipping Center

    Institute of Scientific and Technical Information of China (English)

    Hu Wenxiu

    2009-01-01

    @@ Since 1990s,various countries in the world have been focusing on the construction of the key ports,leading to a fiercer competition between ports.For example,in East Asia,South Korea and Japan are rivaling for the international shipping center in Northeast Asia.Taking Busan Port and Gwangyang Port as the central ports,South Korea is boosting the ports expansion plans,to construct a"logistic center in Northeast Asia".Meanwhile.Japan is projecting the optimizmg and integration of port resources,to regain the international shipping center in Asia.The central government of China made plans for constructing Shanghai Shipping Center as early in 1996.and after 13 years'construction,now Shanghai Port has the largest cargo throughput and the second largest container throughput in the world.

  12. Center for Creative Studies, Detroit

    Science.gov (United States)

    AIA Journal, 1976

    1976-01-01

    One of the ten buildings chosen to receive 1976 AIA honor awards, the arts center houses the departments of sculpture, painting, graphics, advertising art, photography, and industrial design. (Author/MLF)

  13. CMS Innovation Center Model Participants

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Innovation Center develops new payment and service delivery models in accordance with the requirements of section 1115A of the Social Security Act....

  14. Clean Energy Solutions Center Services

    Energy Technology Data Exchange (ETDEWEB)

    2016-03-01

    The Solutions Center offers no-cost expert policy assistance, webinars and training forums, clean energy policy reports, data, and tools provided in partnership with more than 35 leading international and regional clean energy organizations.

  15. Center for Beam Physics, 1993

    Energy Technology Data Exchange (ETDEWEB)

    1994-05-01

    The Center for Beam Physics is a multi-disciplinary research and development unit in the Accelerator and Fusion Research Division at Lawrence Berkeley Laboratory. At the heart of the Center`s mission is the fundamental quest for mechanisms of acceleration, radiation and focusing of energy. Dedicated to exploring the frontiers of the physics of (and with) particle and photon beams, its primary mission is to promote the science and technology of the production, manipulation, storage and control systems of charged particles and photons. The Center serves this mission via conceptual studies, theoretical and experimental research, design and development, institutional project involvement, external collaborations, association with industry and technology transfer. This roster provides a glimpse at the scientists, engineers, technical support, students, and administrative staff that make up this team and a flavor of their multifaceted activities during 1993.

  16. Records Center Program Billing System

    Data.gov (United States)

    National Archives and Records Administration — RCPBS supports the Records center programs (RCP) in producing invoices for the storage (NARS-5) and servicing of National Archives and Records Administration’s...

  17. CENTER FOR CYBER SECURITY STUDIES

    Data.gov (United States)

    Federal Laboratory Consortium — The mission of the Center for Cyber Security Studies is to enhance the education of midshipmen in all areas of cyber warfare, to facilitate the sharing of expertise...

  18. Relativistic two-center continuum

    OpenAIRE

    Wietschorke, Karl-Heinz; Schlüter, Paul; Soff, Gerhard; Rumrich, Klaus; Greiner, Walter

    2006-01-01

    A method is presented to define unique continuum states for the two-center Dirac Hamiltonian. In the spherical limit these states become the familiar angular-momentum eigenstates of the radial Coulomb potential. The different states for a fixed total energy ‖E‖>m may be distinguished by considering the asymptotic spin-angular distribution of states with unique scattering phases. The first numerical solutions of the two-center Dirac equation for continuum states are presented.

  19. User-Centered Data Management

    CERN Document Server

    Catarci, Tiziana; Kimani, Stephen

    2010-01-01

    This lecture covers several core issues in user-centered data management, including how to design usable interfaces that suitably support database tasks, and relevant approaches to visual querying, information visualization, and visual data mining. Novel interaction paradigms, e.g., mobile and interfaces that go beyond the visual dimension, are also discussed. Table of Contents: Why User-Centered / The Early Days: Visual Query Systems / Beyond Querying / More Advanced Applications / Non-Visual Interfaces / Conclusions

  20. Centered Sublattice and its Application

    Institute of Scientific and Technical Information of China (English)

    宋振明; 徐扬; 等

    1993-01-01

    In this paper,the concept of the centered sublattice is introduceed for lattice theory and the dis-composition theorem of a lattice is given.Based on the centered sublattice,we give some new descriptions of a modular lattice,a distributive lattice,a complemented lattice and an relatively complemented lattice,etc.These new decriptions established now researching methods for lattice theory.

  1. Italy INAF Analysis Center Report

    Science.gov (United States)

    Negusini, M.; Sarti, P.

    2013-01-01

    This report summarizes the activity of the Italian INAF VLBI Analysis Center. Our Analysis Center is located in Bologna, Italy and belongs to the Institute of Radioastronomy, which is part of the National Institute of Astrophysics. IRA runs the observatories of Medicina and Noto, where two 32-m VLBI AZ-EL telescopes are situated. This report contains the AC's VLBI data analysis activities and shortly outlines the investigations into the co-locations of space geodetic instruments.

  2. Vitamin C Inhibits Benzo[a]pyrene-lnduced Cell Cycle Changes Partly via Cyclin D1/ E2F Pathway in Human Embryo Lung Fibroblasts

    Institute of Scientific and Technical Information of China (English)

    AI GAO; BING-CI LIU; XIANG-LIN SHI; CHUAN-SHU HUANG; XIAO-WEI JLA; BAO-RONG YOU; MENG YE; FU-HAI SHEN; HONG-JU DU

    2006-01-01

    Objective To study the molecular mechanism of the inhibitory effects of vitamin C on benzo[a]pyrene (B[a]P)-induced changes of cell cycle in human embryo lung fibroblast (HELF) cells. Methods The stable transfectants, HELF transfected with antisense cyclin D1 and antisense CDK4, were established. Cells were cultured and pretreated with vitamin C before stimulation with B[a]P for 24 h. The expression levels of cyclin D1, CDK4, E2F1, and E2F4 were determined by Western blot. Flow cytometric analysis was employed to detect the distributions of cell cycle. Results B[a]P significantly elevated the expression levels of cyclin D1, E2F1, and E2F4 in HELF cells. Vitamin C decreased the expression levels of cyclin D1, E2F1, and E2F4 in B[a]P-stimulated HELF cells. Dose-dependent relationships were not found between the different concentrations of vitamin C (10, 100, 500, 1000, and 5000 μmol/L) and the expression levels of cyclin D1, E2F1, and E2F4 in HELF cells. The expression levels of cyclin D1, E2F1, and E2F4 in B[a]P-treated transfectants were lower than those in B[a]P-treated HELF cells. The expression levels of cyclin D1 and E2F4 treated with vitamin C and antisense cyclin D1 were decreased compared with those treated with antisense cyclin D1 alone. The effects of vitamin C combined with antisense CDK4 on the expression levels of cyclin D1 and E2F1/E2F4 were similar to those of antisense CDK4 alone. B[a]P progressed HELF cells from G1 to S phase. Both vitamin C and antisense cyclin D1 suppressed the changes of cell cycle progressed by B[a]P. However, antisenseCDK4 did not attenuate the above changes. Vitamin C combined with antisense CDK4 markedly suppressed B[a]P-induced changes of cell cycle as compared with antisense CDK4. But the inhibitory effects of vitamin C combined with antisense cyclin D1 on B[a]P-induced changes of cell cycle were similar to those of vitamin C alone or antisense cyclin D1 alone. Conclusions B[a]P progressed HELF cells from G1 to S phase via

  3. The Research Role of a National Center.

    Science.gov (United States)

    Silberman, Harry F.

    The functional role of a national center for vocational education depends on the people doing the work; consequently, the center sets its own agenda when it makes personal decisions. A center's role should include two elements: in setting its own research agenda, a center should take a broad perspective on vocational education; and a center should…

  4. Advanced Call Center Supporting WAP Access

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    Traditional call centers can be accessed via speech only, and the call center based on web provides both data and speech access, but it needs a powerful terminal-computer. By analyzing traditional call centers and call centers based on web, this paper presents the framework of an advanced call center supporting WAP access. A typical service is also described in detail.

  5. The Variable X-ray and Near-IR Behavior of the Particularly Anomaloux X-ray Pulsar 1E 1048.1-5937

    CERN Document Server

    Tam, Cindy R; Dib, Rim; Kaspi, Victoria M; Woods, Peter M; Bassa, Cees

    2007-01-01

    We present the results of X-ray and near-IR observations of the anomalous X-ray pulsar 1E 1048.1-5937, believed to be a magnetar. This AXP underwent a period of extreme variability during 2001-2004, but subsequently entered an extended and unexpected quiescence in 2004-2006, during which we monitored it with RXTE, CXO, and HST. Its timing properties were stable for >3 years throughout the quiescent period. 1E 1048.1-5937 again went into outburst in March 2007, which saw a factor of >7 total X-ray flux increase which was anti-correlated with a pulsed fraction decrease, and correlated with spectral hardening, among other effects. The near-IR counterpart also brightened following the 2007 event. We discuss our findings in the context of the magnetar and other models.

  6. Preocupações parentais e coping numa amostra de pais de crianças entre 1 e 9 anos

    OpenAIRE

    Gomes, Cátia Alexandra Cordeiro

    2008-01-01

    Dissertação de Mestrado apresentada ao Instituto Superior de Psicologia Aplicada para obtenção de grau de Mestre na especialidade de Psicologia Clínica. Objectivo: Comparar as Preocupações e Estratégias de Coping dos pais de crianças, entre 1 e 9 anos, procurando-se verificar se existem diferenças significativas nestas variáveis, em função da idade das crianças. Método: Estudo observacional descritivo, de comparação entre grupos. Participaram 34 pais de crianças com 1 e 2 anos,...

  7. Determination of the flexoelectric coefficient (e1-e3) in nematic liquid crystal by using fully leaky optical-guided mode

    Science.gov (United States)

    Zheng, Guili; Zhang, Hui; Ye, Wenjiang; Zhang, Zhidong; Song, Hong-wei; Xuan, Li

    2016-02-01

    Fully leaky optical-guided mode was employed to determine the difference in the splay and bend flexoelectric coefficient (e1-e3) in negative nematic liquid crystal MS-N01300-000. The experimental curves of reflectivity versus internal angle (angle of incident light to the liquid crystal) were obtained when a laser beam passed through the hybrid-aligned nematic in-plane switching liquid crystal cell; the cell was embedded in pyramid-coupled waveguide with different alternating current (AC) and direct current (DC) voltages. The curves of the applied DC with voltage similar to that of AC shift to the left or the right. Experimental results were then compared with theoretical results derived from elastic continuum theory and multi-layer optical theory of liquid crystals. The approximate value of the flexoelectric coefficient (e1-e3) of MS-N01300-000 is 9.0 × 10-11 C/m.

  8. A Hybrid Spin-Down Model and its Application to the Radio Quiet X-Ray Pulsar 1E 1207.4-5209

    Institute of Scientific and Technical Information of China (English)

    张灵娣; 彭秋和; 罗新炼

    2003-01-01

    A series of newly published papers are focusing on the formation of the absorption features discovered by Chandra and XMM-Newton from the young radio quiet x-ray pulsar 1E 1207.4-5209. We try to interpret it as cyclotron absorption lines since this possibility could not be ruled out. With new development and application of a hybrid model, i.e., the magnetic dipole spin-down model combined with the neutrino cyclotron radiation spin-down model, we can easily avoid the contradiction between the normal rotation energy loss rate and the relatively lower magnetic field, and then we obtain the possible initial spin period (~0.420s). We suppose that the progenitor of 1E 1207.4-5209 may be a white dwarf.

  9. Peroxisome proliferator-activated receptor alpha (PPARalpha) protects against oleate-induced INS-1E beta cell dysfunction by preserving carbohydrate metabolism

    DEFF Research Database (Denmark)

    Frigerio, F; Brun, T; Bartley, C;

    2009-01-01

    and investigated key metabolic pathways and genes responsible for metabolism-secretion coupling during a culture period of 3 days in the presence of 0.4 mmol/l oleate. RESULTS: In INS-1E cells, the secretory dysfunction primarily induced by oleate was aggravated by silencing of PPARalpha. Conversely, PPARalpha...... enzyme pyruvate carboxylase. PPARalpha overproduction increased both beta-oxidation and fatty acid storage in the form of neutral triacylglycerol, revealing overall induction of lipid metabolism. These observations were substantiated by expression levels of associated genes. CONCLUSIONS....../INTERPRETATION: PPARalpha protected INS-1E beta cells from oleate-induced dysfunction, promoting both preservation of glucose metabolic pathways and fatty acid turnover....

  10. Center for Electron Microscopy, CEN-DTU; The building

    DEFF Research Database (Denmark)

    Horsewell, Andy

    Center for electron nanoscopy, CEN●DTU; The building Andy Horsewell Technical University of Denmark, DTU Materials Technology, Building 204, 2800 Lyngby ABSTRACT CEN●DTU, having been given[1] the opportunity to create a world-class facility with a unique suite of electron microscopes, is in full...... and construction: vibrations transmitted through the ground and acoustically; variations in room temperature and rates of airflow; variations in microscope cooling; magnetic fields. At the same time, we have been keen to design a pleasant, creative and dynamic working environment for the study of nanostructures...... swing with the construction of a purpose-built building. The microscopes are very special: 2 Titans, both Cs corrected, with monochromators and full analytical capabilities are to achieve spatial resolutions of 0.7Å and spectroscopy resolutions of 0.1eV. One of the Titans is to be equipped...

  11. 17 CFR 240.15c3-1e - Deductions for market and credit risk for certain brokers or dealers (Appendix E to 17 CFR 240...

    Science.gov (United States)

    2010-04-01

    ... credit risk for certain brokers or dealers (Appendix E to 17 CFR 240.15c3-1). 240.15c3-1e Section 240... risk for certain brokers or dealers (Appendix E to 17 CFR 240.15c3-1). Preliminary Note: Appendices E....15c3-1(c)(2)(vi) and (c)(2)(vii) and to compute deductions for credit risk pursuant to this Appendix...

  12. Extracellular Biofabrication, Characterization, and Antimicrobial Efficacy of Silver Nanoparticles Loaded on Cotton Fabrics Using Newly Isolated Streptomyces sp. SSHH-1E

    Directory of Open Access Journals (Sweden)

    Noura El-Ahmady El-Naggar

    2016-01-01

    Full Text Available Biological method for silver nanoparticles synthesis has been developed to obtain cost effective, clean, nontoxic, and ecofriendly size-controlled nanoparticles. The objective of this study is extracellular biosynthesis of antimicrobial AgNPs using cell-free supernatant of a local Streptomyces sp. strain SSHH-1E. Different medium composition and fermentation conditions were screened for maximal AgNPs biosynthesis using Plackett-Burman experimental design and the variables with statistically significant effects were selected to study their combined effects and to find out the optimum values using a Box-Behnken design. The synthesized AgNPs were characterized using UV-visible spectroscopy, transmission electron microscopy, Fourier transform infrared spectroscopy, and energy dispersive X-ray spectroscopy. Rapid biosynthesis of AgNPs was achieved by addition of 1 mM AgNO3 solution to the cell-free supernatant. The produced particles showed a single surface plasmon resonance peak at 400 nm by UV-Vis spectroscopy which confirmed the presence of AgNPs. Streptomyces sp. SSHH-1E was identified as Streptomyces narbonensis SSHH-1E. Transmission electron microscopy study indicated that the shape of AgNPs is spherical and the size is ranging from 20 to 40 nm. Fourier transform infrared spectroscopy analysis provides evidence for proteins as possible reducing and capping agents. Furthermore, the biosynthesized AgNPs significantly inhibited the growth of medically important pathogenic Gram-positive and Gram-negative bacteria and yeast. The maximum biosynthesis of AgNPs was achieved at initial pH of 8, peptone of 0.5 g, and inoculum age of 48 h. The statistical optimization resulted in a 4.5-fold increase in the production of AgNPs by Streptomyces narbonensis SSHH-1E.

  13. Effects of Hyperglycemia on Angiotensin II Receptor Type 1 Expression and Insulin Secretion in an INS-1E Pancreatic Beta-Cell Line

    Directory of Open Access Journals (Sweden)

    Kwan Keung Leung

    2008-05-01

    Full Text Available Context A local pancreatic islet renin-angiotensin system has been identified and found to be upregulated in type 2 diabetes mellitus. Inhibition of this system improves beta-cell function and structure. The effects of hyperglycemia, a condition observed in diabetes, on angiotensin II type 1 receptor (AT1R expression and beta-cell secretory function have yet to be explored. Objective This study investigated the effects of chronic hyperglycemia (glucotoxicity on the expression of AT1Rs, and possibly thereby on oxidative stress-induced insulin release, in an INS-1E beta-cell line. Settings INS-1E beta-cells cultured and incubated in different glucose concentrations with a varying time course. Main outcome measures Immunocytochemistry was employed for the precise localization of AT1Rs in INS-1E cells. The effects of hyperglycemia-induced AT1R expression changes in gene and protein levels were examined by real-time RT-PCR and Western blot analysis, respectively. AT1R activation-mediated oxidative stress was assessed by changes in NADPH oxidase expression, and the level of superoxide production was determined by nitroblue tetrazolium (NBT assay. Glucotoxicity-induced AT1R activation- mediated secretory dysfunction was also assessed by insulin release from INS-1E cells Results AT1R immunoreactivity was found to be localized specifically on the cell membrane. Chronic hyperglycemia resulted in dose-dependent upregulation of AT1R gene and protein expression accompanied by concomitantly-enhanced oxidative stress. Glucose-stimulated insulin secretion via AT1R activation was impaired by hyperglycemia. Conclusion These data indicate that hyperglycemia-induced AT1R activation impairs insulin secretion; this impairment may be mediated via AT1R-dependent oxidative stress.

  14. Boosting of synaptic potentials and spine Ca transients by the peptide toxin SNX-482 requires alpha-1E-encoded voltage-gated Ca channels.

    Directory of Open Access Journals (Sweden)

    Andrew J Giessel

    Full Text Available The majority of glutamatergic synapses formed onto principal neurons of the mammalian central nervous system are associated with dendritic spines. Spines are tiny protuberances that house the proteins that mediate the response of the postsynaptic cell to the presynaptic release of glutamate. Postsynaptic signals are regulated by an ion channel signaling cascade that is active in individual dendritic spines and involves voltage-gated calcium (Ca channels, small conductance (SK-type Ca-activated potassium channels, and NMDA-type glutamate receptors. Pharmacological studies using the toxin SNX-482 indicated that the voltage-gated Ca channels that signal within spines to open SK channels belong to the class Ca(V2.3, which is encoded by the Alpha-1E pore-forming subunit. In order to specifically test this conclusion, we examined the effects of SNX-482 on synaptic signals in acute hippocampal slices from knock-out mice lacking the Alpha-1E gene. We find that in these mice, application of SNX-482 has no effect on glutamate-uncaging evoked synaptic potentials and Ca influx, indicating that that SNX-482 indeed acts via the Alpha-1E-encoded Ca(V2.3 channel.

  15. Geniposide protects pancreatic INS-1E β cells from hIAPP-induced cell damage: potential involvement of insulin degrading-enzyme.

    Science.gov (United States)

    Zhang, Yonglan; Yin, Fei; Liu, Jianhui; Wang, Yanwen

    2015-04-01

    Islet amyloid deposition is increasingly seen as a pathogenic feature of type 2 diabetes mellitus (T2DM), with the deposits containing the unique amyloidogenic peptide islet amyloid polypeptide (IAPP, also known as amylin). The fibril precursors of IAPP contribute to its cytotoxicity on pancreatic β cells and be important in causing β-cell dysfunction in T2DM. However, the development of effective this study, inhibitors against the toxicity of IAPP has been extremely challenging. We have found that pre-incubation with geniposide dose-dependently prevented human IAPP (hIAPP)-induced cell damage in INS-1E cells, and bacitracin, an inhibitor of IDE activity, prevented significantly the protective effects of geniposide in pancreatic INS-1E cells significantly. Geniposide induced the expression of insulin-degrading enzyme (IDE), a key degrading protein of hIAPP, but had no significant effect on the aggregation of hIAPP. These findings indicate that geniposide prevents hIAPP-induced cytotoxicity in INS-1E cells involving upregulation of IDE expression.

  16. A ultra-sonografia do pâncreas é eficaz em diagnosticar o diabete melito tipo 1 e tipo 2?

    Directory of Open Access Journals (Sweden)

    Pimenta Walkyria de Paula

    2002-01-01

    Full Text Available Este trabalho foi realizado para verificar se a ultra-sonografia do pâncreas oferece dados auxiliares na classificação de diabéticos adultos dos tipos 1 e 2. O tamanho e a ecogenicidade do pâncreas foram determinados pela ultra-sonografia em 81 diabéticos, sendo 20 do tipo 1 e 61 do tipo 2 (53 obesos e oito não-obesos. Os pacientes tipo 2 obesos diferiram dos demais por apresentarem área total e diâmetro ântero-posterior do corpo do pâncreas significativamente maiores. Quanto à ecogenicidade pancreática, esta estava aumentada com maior freqüência nos diabéticos tipo 2 obesos que nos diabéticos tipo 1. Consideramos, assim, que a ultra-sonografia do pâncreas constitui metodologia auxiliar na classificação de diabéticos entre os tipo 1 e 2, sendo menos eficaz quando os últimos não são obesos.

  17. Precise Localization of the Soft Gamma Repeater SGR 1627-41 with Chandra and the Anomalous X-Ray Pulsar AXP 1E1841-045 with Chandra

    Science.gov (United States)

    Wachter, Stefanie; Patel, Sandeep K.; Kouveliotou, Chryssa; Bouchet, Patrice; Ozel, Feryal; Tennant, Allyn F.; Woods, Peter M.; Hurley, Kevin; Becker, Werner; Slane, Patrick

    2004-01-01

    We present precise localizations of AXP 1E184-045 and SGR 1627-41 with Chandra. We obtained new infrared observations of SGR 1627-41 and reanalyzed archival observations of AXP 1E1841-045 in order to refine their positions and search for infrared counterparts. A faint source is detected inside the error circle of AXP 1E1841-045. In the case of SGR 1627-41, several sources are located within the error radius of the X-ray position, and we discuss the likelihood of one of them being the counterpart. We compare the properties of our candidates to those of other known anomalous X-ray pulsar (AXP) and soft gamma repeater (SGR) counterparts. We find that the counterpart candidates for SGR 1627-41 and SGR 1806-20 would have to be intrinsically much brighter than AXPs in order to have counterparts detectable with the observational limits currently available for these sources. To confirm the reported counterpart of SGR 1806-20, we obtained new infrared observations during the 2003 July burst activation of the source. No brightening of the suggested counterpart is detected, implying that the counterpart of SGR 1806-20 remains yet to be identified.

  18. Caracterização de herpesvírus bovinos tipos 1 (BHV-1 e 5 (BHV-5 com anticorpos monoclonais

    Directory of Open Access Journals (Sweden)

    Souza V.F.

    2002-01-01

    Full Text Available O perfil antigênico de 45 herpesvírus (44 de bovinos, sendo seis amostras de referência de BHV-1 e 15 prováveis BHV-1; três amostras de referência de BHV-5 e 20 prováveis BHV-5 e uma amostra de herpesvírus bubalino (BuHV foi examinado com um painel de anticorpos monoclonais (Acms produzidos contra antígenos de herpesvírus bovinos. Para os exames, foi utilizada a prova de imunoperoxidase (IPX sobre cultivos de células infectadas, tendo os Acms como anticorpos primários. A determinação dos padrões de reatividade das amostras de vírus frente aos Acms permitiu a diferenciação entre os tipos 1 e 5. Todas as amostras isoladas de casos de encefalite apresentaram perfil de BHV-5. Quatro amostras de BHV-5 isoladas de áreas geograficamente distintas apresentaram perfís de reatividade diferenciados em relação às demais amostras do tipo 5. Duas amostras de vírus com perfil antigênico de BHV-5 foram isoladas de sêmen de animais infectados. Estes resultados comprovam a utilidade da caracterização antigênica com este painel de Acms na tipagem de amostras de BHV-1 e BHV-5.

  19. Designing of 1 eV GaNAs/GaInAs superlattice subcell in current-matched four-junction solar cell

    Science.gov (United States)

    Haixiao, Wang; Xinhe, Zheng; Xingyuan, Gan; Naiming, Wang; Hui, Yang

    2016-01-01

    A reasonably-thick GaNAs/GaInAs superlattice could be an option as a roughly 1 eV subcell to achieve high-efficiency multi-junction solar cells on a lattice-matched Ge substrate. A detailed consideration of a high-efficiency design for a GaInP/GaAs/1 eV/Ge device is presented. Calculations have been done for this structure to obtain the confined energies of the electrons and holes by utilizing the Kronig-Penney model, as well as the absorption coefficient and thereby the external quantum efficiency. The effect of well layers, GaNAs or GaInAs, on the absorption and photocurrent density under the AM 1.5 condition is discussed in order to realize a requirement of current matching in the four-junction solar cells. The management of these considerations implies the feasibility of the GaNAs/GaInAs superlattice subcell design to improve the overall conversion efficiency of lattice matched GaInP/GaAs/1 eV/Ge cells. Project supported by the National Natural Science Foundation of China (No. 61274134) and the International Cooperation Program of Suzhou, China (No. SH201215).

  20. Comparison of osteogenic potentials of human rat BMP4 and BMP6 gene therapy using [E1-] and [E1-,E2b-] adenoviral vectors

    Directory of Open Access Journals (Sweden)

    Hongwei Li, Jin Zhong Li, Debra D. Pittman, Andy Amalfitano, Gerald R. Hankins, Gregory A. Helm

    2006-01-01

    Full Text Available Osteogenic potentials of some recombinant human bone morphogenetic protein (BMP first-generation adenoviral vectors (ADhBMPs are significantly limited in immunocompetent animals. It is unclear what role expression of viral proteins and foreign proteins transduced by adenoviral vectors play in the host immune response and in ectopic bone formation. In this study two sets of experiments were designed and performed. First, rat BMP6 cDNA were amplified, sequenced, and recombined in first-generation adenoviral vector (ADrBMP6. A comparison of human and rat BMP6 adenoviral vectors demonstrated identical osteogenic activities in both immunodeficient and immunocompetent rats. Second, the activities of recombinant human BMP6 in E1- (ADhBMP6 and [E1-,E2b-] ( [E1-,E2b-]ADGFP&hBMP6, and [E1-,E2b-]ADhBMP6 adenoviral vectors were compared in both in vitro and in vivo models. Similar activities of these two generations of BMP adenoviral vectors were found in all models. These results indicate that the amount of viral gene expression and the source of the BMP cDNA are not major factors in the interruption of osteogenic potentials of recombinant BMP6 adenoviral vectors in immunocompetent animals.

  1. A Shift from Teacher Centered to Learner Centered Approach

    Directory of Open Access Journals (Sweden)

    Jeanne Schreurs

    2014-06-01

    Full Text Available In the framework of the project Western Eastern Teachers' Education Network (WETEN funded by the Tempus program the network of university teachers were established to share expertise on effective teaching and learning in universities. This network for pedagogical innovation in higher education brought together the experts from EU to share good practice and new teaching methods with academic staff from two eastern countries, Moldova and Ukraine. The learner centered concept was analyzed and guidelines for creating learner centered courses were developed and piloted. The concepts and some experiences in course design were also implemented by trained teachers in the developed courses within the WETEN project.

  2. Finding Communities by Their Centers.

    Science.gov (United States)

    Chen, Yan; Zhao, Pei; Li, Ping; Zhang, Kai; Zhang, Jie

    2016-01-01

    Detecting communities or clusters in a real-world, networked system is of considerable interest in various fields such as sociology, biology, physics, engineering science, and interdisciplinary subjects, with significant efforts devoted in recent years. Many existing algorithms are only designed to identify the composition of communities, but not the structures. Whereas we believe that the local structures of communities can also shed important light on their detection. In this work, we develop a simple yet effective approach that simultaneously uncovers communities and their centers. The idea is based on the premise that organization of a community generally can be viewed as a high-density node surrounded by neighbors with lower densities, and community centers reside far apart from each other. We propose so-called "community centrality" to quantify likelihood of a node being the community centers in such a landscape, and then propagate multiple, significant center likelihood throughout the network via a diffusion process. Our approach is an efficient linear algorithm, and has demonstrated superior performance on a wide spectrum of synthetic and real world networks especially those with sparse connections amongst the community centers. PMID:27053090

  3. Finding Communities by Their Centers

    Science.gov (United States)

    Chen, Yan; Zhao, Pei; Li, Ping; Zhang, Kai; Zhang, Jie

    2016-04-01

    Detecting communities or clusters in a real-world, networked system is of considerable interest in various fields such as sociology, biology, physics, engineering science, and interdisciplinary subjects, with significant efforts devoted in recent years. Many existing algorithms are only designed to identify the composition of communities, but not the structures. Whereas we believe that the local structures of communities can also shed important light on their detection. In this work, we develop a simple yet effective approach that simultaneously uncovers communities and their centers. The idea is based on the premise that organization of a community generally can be viewed as a high-density node surrounded by neighbors with lower densities, and community centers reside far apart from each other. We propose so-called “community centrality” to quantify likelihood of a node being the community centers in such a landscape, and then propagate multiple, significant center likelihood throughout the network via a diffusion process. Our approach is an efficient linear algorithm, and has demonstrated superior performance on a wide spectrum of synthetic and real world networks especially those with sparse connections amongst the community centers.

  4. INIS National Center in Syria

    International Nuclear Information System (INIS)

    International Nuclear Information System (INIS) is the world's leading information system on the peaceful uses of nuclear science and technology and it is operated by the International Atomic Energy Agency (IAEA) in Vienna, Austria. An overview of INIS products, services, philosophy and operation is given. INIS hold a database containing over 2.5 million references increasing at approximately 85,000 references per year and a collection of full text non-conventional, or grey literature that would be hard to obtain elsewhere. In addition, the PC-based software for inputs preparation (WinFIBRE) is demonstrated. INIS national center in Syria is considered as a regional center for INIS inputs preparation. The center is responsible for selecting the relevant nuclear literature produced and published in Syria and preparing the national inputs and send them to INIS Secretariat to be included in the INIS database. The center also provides INIS services and products to users within Syria. Availability of INIS Database on CD-ROMs, which updated monthly, and the internet version, which updated weekly, and the NCL collections are also presented. Finally, translation activity of the center, such as INIS Booklet entitled Presenting INIS, and the INIS Thesaurus into Arabic were mentioned. This was an in-kind contribution from the Atomic Energy Commission of Syria to support the valuable work of the INIS and Nuclear Knowledge Management (NKM) section and will contribute significantly the dissemination of information among the researchers and scientists in the Arab Countries. (author)

  5. Center Innovation Fund: KSC CIF Program

    Data.gov (United States)

    National Aeronautics and Space Administration — Each individual NASA Center has full discretion on the use of the funds and the Center Chief Technologists coordinates a competitive process at their Center for the...

  6. How to Understand Transplant Center Statistics

    Science.gov (United States)

    ... Print this page How to understand transplant center statistics Because statistics can be hard to understand, we recommend you ... NMDP transplant centers How to understand transplant center statistics Because statistics can be hard to understand, we ...

  7. 78 FR 14549 - National Contact Center; Information Collection; National Contact Center Customer Evaluation Survey

    Science.gov (United States)

    2013-03-06

    ... ADMINISTRATION National Contact Center; Information Collection; National Contact Center Customer Evaluation... requirement regarding the National Contact Center customer evaluation surveys. In this request, the previously... compare its customer service levels to those of private industry contact centers. DATES: Submit...

  8. Center for Beam Physics, 1993

    International Nuclear Information System (INIS)

    The Center for Beam Physics is a multi-disciplinary research and development unit in the Accelerator and Fusion Research Division at Lawrence Berkeley Laboratory. At the heart of the Center's mission is the fundamental quest for mechanisms of acceleration, radiation and focusing of energy. Dedicated to exploring the frontiers of the physics of (and with) particle and photon beams, its primary mission is to promote the science and technology of the production, manipulation, storage and control systems of charged particles and photons. The Center serves this mission via conceptual studies, theoretical and experimental research, design and development, institutional project involvement, external collaborations, association with industry and technology transfer. This roster provides a glimpse at the scientists, engineers, technical support, students, and administrative staff that make up this team and a flavor of their multifaceted activities during 1993

  9. Self-Access Centers: Maximizing Learners’ Access to Center Resources

    Directory of Open Access Journals (Sweden)

    Mark W. Tanner

    2010-09-01

    Full Text Available Originally published in TESL-EJ March 2009, Volume 12, Number 4 (http://tesl-ej.org/ej48/a2.html. Reprinted with permission from the authors.Although some students have discovered how to use self-access centers effectively, the majority appear to be unaware of available resources. A website and database of materials were created to help students locate materials and use the Self-Access Study Center (SASC at Brigham Young University’s English Language Center (ELC more effectively. Students took two surveys regarding their use of the SASC. The first survey was given before the website and database were made available. A second survey was administered 12 weeks after students had been introduced to the resource. An analysis of the data shows that students tend to use SASC resources more autonomously as a result of having a web-based database. The survey results suggest that SAC managers can encourage more autonomous use of center materials by provided a website and database to help students find appropriate materials to use to learn English.

  10. NASA(Field Center Based) Technology Commercialization Centers

    Science.gov (United States)

    1995-01-01

    Under the direction of the IC(sup 2) Institute, the Johnson Technology Commercialization Center has met or exceeded all planned milestones and metrics during the first two and a half years of the NTCC program. The Center has established itself as an agent for technology transfer and economic development in- the Clear Lake community, and is positioned to continue as a stand-alone operation. This report presents data on the experimental JTCC program, including all objective measures tracked over its duration. While the metrics are all positive, the data indicates a shortage of NASA technologies with strong commercial potential, barriers to the identification and transfer of technologies which may have potential, and small financial return to NASA via royalty-bearing licenses. The Center has not yet reached the goal of self-sufficiency based on rental income, and remains dependent on NASA funding. The most important issues raised by the report are the need for broader and deeper community participation in the Center, technology sourcing beyond JSC, and the form of future funding which will be appropriate.

  11. Center Innovation Fund: JPL CIF Program

    Data.gov (United States)

    National Aeronautics and Space Administration — Funds are distributed to each NASA Center to support emerging technologies and creative initiatives that leverage Center talent and capabilities. NASA scientists...

  12. PACS strategy for imaging centers.

    Science.gov (United States)

    Bedel, Victoria; Zdanowicz, Mark

    2004-01-01

    Picture archiving and communications systems (PACS) have been available in imaging centers for many years, but they often were less functional, were not well integrated into patient information systems, and lacked the network backbone to implement a system. As modalities are replaced and technology improves, the ability and time for an imaging center to acquire, integrate, and utilize PACS has arrived. However, each imaging center must determine why it should invest in PACS. A business plan is the fundamental need. Each imaging center must understand its target market, growth rate, and staffing plans. Additional considerations lie in current and future modality availability, the need for offsite delivery of images and reports, and the potential need for remote transmission of images. These issues must be identified and prioritized. A multidisciplinary team is essential. The most successful PACS implementation begins with complete involvement from all levels. The team should be comprised of people with complementary skills who are committed to a common purpose, set of performance goals, and approach for which they hold themselves mutually accountable. The team must jointly decide on the project's objectives. These objectives fall under 4 categories: clinical, service, financial, and performance. PACS must be considered a tool to help accomplish each objective. The imaging center must determine its top priorities, then translate them into a technology "wish list." The center can then list those pieces of technology that are most important and prioritize them. There are even more considerations for connecting multiple imaging centers. The team must create a comprehensive request for proposal (RFP) and determine the vendors that will receive the document. Once the RFP responses have been received and the vendor has been selected, an effective training plan must be executed. Training plans should be competency-based, ensuring comfort and competency among all staff. Upon

  13. User-centered agile method

    CERN Document Server

    Deuff, Dominique

    2013-01-01

    Agile development methods began to emerge around 20 years ago. However, it was not until the early 2000s that they began to be widely used in industry. This growth was often due to the advent of Internet services requiring faster cycles of development in order to heighten the rate at which an ever-greater number of functionalities were made available. In parallel, user-centered design (UCD) methods were also becoming more and more widely used: hence, user-centered design and agile methods were bound to cross paths, at least in the telecoms industry! During this period, in the field of telec

  14. Center for electron nanoscopy, DTU

    DEFF Research Database (Denmark)

    Horsewell, Andy; Somers, Marcel A. J.; Chorkendorff, Ib

    2006-01-01

    DTU has been given[1] the opportunity to create a world-class facility with a unique suite of 8 electron microscopes, preparation equipment and facilities for image analysis and interpretation; all to be placed in a purpose-built building. This opportunity comes at the beginning of a new era...... in which several dramatic advances have recently taken place on two fronts. The first is in the field of transmission electron microscopy, TEM: I) As a result of Cs correction and monochromators, high resolution TEM can achieve spatial resolutions of 0.7Å and spectroscopy resolutions of 0.1eV; II) Using...... front is in the field of scanning electron microscopy, SEM, which has already seen major advances due to field emission electron guns, FEG: I) Adding a focussed ion beam, so that specimen surface layers can be removed by controlled sputtering, a dual-beam FEGSEM FIB allows reconstruction...

  15. Directions in Center Director Training

    Science.gov (United States)

    Bloom, Paula Jorde; Vinci, Yasmina; Rafanello, Donna; Donohue, Chip

    2011-01-01

    Exchange invited some of the leading trend watchers in the arena of director training to share their insights on the current state and future directions in this country. This article presents the authors' insights on the directions in center director training. They also share their views on whether the amount of and quality of training out there…

  16. Financial Management in Imaging Center

    Directory of Open Access Journals (Sweden)

    Arash Deljou

    2009-01-01

    Full Text Available "nIn this article, we provide a brief overview of the three main financial statements: income statement, balance sheet, and statement of cash flows, and we discuss the major landmarks in each. We discuss financial ratios and other measures of performance that radiologists and CFOs of radiology department can use to detect problems and isolate their root cause. "nInterest rates are a factor in a number of decisions (more specifically in an inflated economy, including the required rate of return on a new diagnostic imaging center, expansion, refinancing, lease versus buy decisions, and others. We discuss the factors that cause interest rates to rise or fall and what can be done about them. "nWhen considering the development of a new diagnostic imaging center, one of the key factors that a financing source, manufacturer-based, independent bank, or other third party, considers is how much cash equity the owners are putting into the project. They want to know this answer for a variety of reasons and will analyze the answer in a few different ways. "nDiagnostic imaging center equity is usually defined as the amount of cash required to get the center up and running, and until it begins to cash flow positively on its own. The art of determining equity comes from a couple of factors and from the early stages of the development of a project.  

  17. Kepler Science Operations Center Architecture

    Science.gov (United States)

    Middour, Christopher; Klaus, Todd; Jenkins, Jon; Pletcher, David; Cote, Miles; Chandrasekaran, Hema; Wohler, Bill; Girouard, Forrest; Gunter, Jay P.; Uddin, Kamal; Allen, Christopher; Hall, Jennifer; Ibrahim, Khadeejah; Clarke, Bruce; Li, Jie; McCauliff, Sean; Quintana, Elisa; Sommers, Jeneen; Stroozas, Brett; Tenenbaum, Peter; Twicken, Joseph; Wu, Hayley; Caldwell, Doug; Bryson, Stephen; Bhavsar,Paresh

    2010-01-01

    We give an overview of the operational concepts and architecture of the Kepler Science Data Pipeline. Designed, developed, operated, and maintained by the Science Operations Center (SOC) at NASA Ames Research Center, the Kepler Science Data Pipeline is central element of the Kepler Ground Data System. The SOC charter is to analyze stellar photometric data from the Kepler spacecraft and report results to the Kepler Science Office for further analysis. We describe how this is accomplished via the Kepler Science Data Pipeline, including the hardware infrastructure, scientific algorithms, and operational procedures. The SOC consists of an office at Ames Research Center, software development and operations departments, and a data center that hosts the computers required to perform data analysis. We discuss the high-performance, parallel computing software modules of the Kepler Science Data Pipeline that perform transit photometry, pixel-level calibration, systematic error-correction, attitude determination, stellar target management, and instrument characterization. We explain how data processing environments are divided to support operational processing and test needs. We explain the operational timelines for data processing and the data constructs that flow into the Kepler Science Data Pipeline.

  18. VMware vCenter cookbook

    CERN Document Server

    Kuminsky, Konstantin

    2015-01-01

    If you are a system administrator who has some experience with virtualization and already uses VMware vCenter, but wishes to learn more, then this is the book for you. If you are looking for tips or shortcuts for common administration tasks as well as workarounds for pain points in vSphere administration, you'll find this guide useful.

  19. Kempinski Hotel Beijing Lufthansa Center

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    A shining star on the eastern part of Beijing Kempinski Hotel Beijing Lufthansa Center is located at the heart of the city, a fully integrated business complex with serviced apartments, top-class offices and showrooms. The hotel offers unrivaled conference, business and leisure facilities ideal for business travelers and leisure guests alike. Its impressive blend of grand Chinese cul-

  20. An International Development Technology Center

    Science.gov (United States)

    Morgan, Robert P.

    1969-01-01

    Main focus of the Center is "the application of science and technology to the solution of problems faced by people in less-developed areas of the world. Adapted from paper presented at ASEE Annual Meeting, The Pennsylvania State University, June, 1969. (Author/WM)

  1. School-Based Health Centers

    Science.gov (United States)

    ... in school increase high school graduation rates decrease school discipline cases Studies show that teens, who might resist going to a doctor, are more willing to get help for problems like depression and weight issues at a school-based health center. This might be because they ...

  2. Mapping of fluorescent protein-expressing neurons and axon pathways in adult and developing Thy1-eYFP-H transgenic mice.

    Science.gov (United States)

    Porrero, Cesar; Rubio-Garrido, Pablo; Avendaño, Carlos; Clascá, Francisco

    2010-07-23

    Transgenic mouse lines in which a fluorescent protein is constitutively expressed under the Thy1 gene promoter have become important models in cell biology and pathology studies of specific neuronal populations. As a result of positional insertion and/or copy number effects on the transgene, the populations expressing the fluorescent protein (eYFP+) vary markedly among the different mice lines. However, identification of the eYFP+ subpopulations has remained sketchy and fragmentary even for the most widely used lines such as Thy1-eYFP-H mice (Feng, G., Mellor, R.H., Bernstein, M., Keller-Peck, C., Nguyen, Q.T., Wallace, M., Nerbonne, J.M., Lichtman and J.W., Sanes. J.R. 2000. Imaging neuronal subsets in transgenic mice expressing multiple spectral variants of GFP. Neuron 28, 41-51). Here, we provide a comprehensive mapping of labeled cell types throughout the central nervous system in adult and postnatal (P0-P30) Thy1-eYFP-H mice. Cell type identification was based on somatodendritic morphology, axon trajectories, and, for cortical cells, retrograde labeling with Fast Blue to distinguish between subpopulations with different axonal targets. In the neocortex, eYFP+ cells are layers 5 and 6 pyramidal neurons, whose abundance and sublaminar distribution varies markedly between areas. Labeling is particularly prevalent in the corticospinal cells; as a result, the pyramidal pathway axons are conspicuously labeled down to the spinal cord. Large populations of hippocampal, subicular and amygdaloid projection neurons are eYFP+ as well. Additional eYFP+ cell groups are located in specific brainstem nuclei. Present results provide a comprehensive reference dataset for adult and developmental studies using the Thy1-eYFP-H mice strain, and show that this animal model may be particularly suitable for studies on the cell biology of corticospinal neurons.

  3. Prediction of the Adaptability of Pseudomonas putida DOT-T1E to a Second Phase of a Solvent for Economically Sound Two-Phase Biotransformations

    OpenAIRE

    Neumann, Grit; Kabelitz, Nadja; Zehnsdorf, Andreas; Miltner, Anja; Lippold, Holger; Meyer, Daniel; Schmid, Andreas; Heipieper, Hermann J

    2005-01-01

    The strain Pseudomonas putida DOT-T1E was tested for its ability to tolerate second phases of different alkanols for their use as solvents in two-liquid-phase biotransformations. Although 1-decanol showed an about 10-fold higher toxicity to the cells than 1-octanol, the cells were able to adapt completely to 1-decanol only and could not be adapted in order to grow stably in the presence of a second phase of 1-octanol. The main explanation for this observation can be seen in the higher water a...

  4. Fission cross section measurements of Cm-247, Cf-250 and Es-254 from 0.1 eV to 80 keV

    International Nuclear Information System (INIS)

    Fission cross section measurements were made with the RINS system over the neutron energy range from approximately 0.1 eV to 80 keV upon samples of Cm-247, Cf-250 and Es-254. The Cm-247 measurement was undertaken to complete the RINS fission cross section measurement sequence of the curium isotopes, Es-254 was measured because it is a very heavy odd-odd nucleus which might show interesting nuclear structure effects in its fission cross section, and Cf-250 was measured to account for its buildup as a daughter product from the 276-day halflife Es-254. 6 refs., 3 figs

  5. Full-Length Human Placental sFlt-1-e15a Isoform Induces Distinct Maternal Phenotypes of Preeclampsia in Mice

    OpenAIRE

    Gabor Szalai; Roberto Romero; Tinnakorn Chaiworapongsa; Yi Xu; Bing Wang; Hyunyoung Ahn; Zhonghui Xu; Po Jen Chiang; Birgitta Sundell; Rona Wang; Yang Jiang; Olesya Plazyo; Mary Olive; Adi L Tarca; Zhong Dong

    2015-01-01

    Objective Most anti-angiogenic preeclampsia models in rodents utilized the overexpression of a truncated soluble fms-like tyrosine kinase-1 (sFlt-1) not expressed in any species. Other limitations of mouse preeclampsia models included stressful blood pressure measurements and the lack of postpartum monitoring. We aimed to 1) develop a mouse model of preeclampsia by administering the most abundant human placental sFlt-1 isoform (hsFlt-1-e15a) in preeclampsia; 2) determine blood pressures in no...

  6. Chandra X-ray Observatory Arcsecond Imaging of the Young, Oxygen-rich Supernova Remnant 1E0102.2-7219

    OpenAIRE

    Gaetz, T. J.; Butt, Yousaf M.; Edgar, Richard J.; Eriksen, Kristoffer A.; Plucinsky, Paul P.; Schlegel, Eric M.; Smith, Randall K.

    2000-01-01

    We present observations of the young, Oxygen-rich supernova remnant 1E0102.2-7219 taken by the Chandra X-ray Observatory during Chandra's Orbital Activation and Checkout phase. The boundary of the blast wave shock is clearly seen for the first time, allowing the diameter of the remnant and the mean blast wave velocity to be determined accurately. The prominent X-ray bright ring of material may be the result of the reverse shock encountering ejecta; the radial variation of O VII vs. O VIII emi...

  7. HCV E1E2-MF59 vaccine in chronic hepatitis C patients treated with PEG-IFNα2a and Ribavirin: a randomized controlled trial.

    Science.gov (United States)

    Colombatto, P; Brunetto, M R; Maina, A M; Romagnoli, V; Almasio, P; Rumi, M G; Ascione, A; Pinzello, G; Mondelli, M; Muratori, L; Rappuoli, R; Rosa, D; Houghton, M; Abrignani, S; Bonino, F

    2014-07-01

    Hepatitis C virus (HCV) vaccines may be able to increase viral clearance in combination with antiviral therapy. We analysed viral dynamics and HCV-specific immune response during retreatment for experienced patients in a phase Ib study with E1E2MF59 vaccine. Seventy-eight genotype 1a/1b patients [relapsers (30), partial responders (16) and nonresponders (32) to interferon-(IFN)/ribavirin-(RBV)] were randomly assigned to vaccine (V:23), Peg-IFNα2a-180-ug/qw and ribavirin 1000-1200-mg/qd for 48 weeks (P/R:25), or their combination (P/R + V:30). Vaccine (100 μg/0.5 mL) was administered intramuscularly at week 0-4-8-12-24-28-32-36. Neutralizing of binding (NOB) antibodies and lymphocyte proliferation assay (LPA) for E1E2-specific-CD4 + T cells were performed at week 0-12-16-48. Viral kinetics were analysed up to week 16. The vaccine was safe, and a sustained virological response (SVR) was achieved in 4 P/R + V and 2 P/R patients. Higher SVR rates were observed in prior relapsers (P/R + V = 27.3%; P/R = 12.5%). Higher NOB titres and LPA indexes were found at week 12 and 16 in P/R + V as compared to P/R patients (P = 0.023 and 0.025, P = 0.019 and <0.001, respectively). Among the 22 patients with the strongest direct antiviral effects of IFN (ε ≥ 0.800), those treated with P/R + V (10) reached lower HCV-RNA levels (P = 0.026) at week 16. HCV E1E2MF59 vaccine in combination with Peg-IFNα2a + RBV was safe and elicited E1E2 neutralizing antibodies and specific CD4 + T cell proliferation. Upon early response to IFN, vaccinations were associated with an enhanced second phase viral load decline. These results prompt phase II trials in combination with new antiviral therapies.

  8. Compton-backscattered annihilation radiation from the Galactic Center region

    Science.gov (United States)

    Smith, D. M.; Lin, R. P.; Feffer, P.; Slassi, S.; Hurley, K.; Matteson, J.; Bowman, H. B.; Pelling, R. M.; Briggs, M.; Gruber, D.

    1993-01-01

    On 1989 May 22, the High Energy X-ray and Gamma-ray Observatory for Nuclear Emissions, a balloon-borne high-resolution germanium spectrometer with an 18-deg FOV, observed the Galactic Center (GC) from 25 to 2500 keV. The GC photon spectrum is obtained from the count spectrum by a model-independent method which accounts for the effects of passive material in the instrument and scattering in the atmosphere. Besides a positron annihilation line with a flux of (10.0 +/- 2.4) x 10 exp -4 photons/sq cm s and a full width at half-maximum (FWHM) of (2.9 + 1.0, -1.1) keV, the spectrum shows a peak centered at (163.7 +/- 3.4) keV with a flux of (1.55 +/- 0.47) x 10 exp -3 photons/sq cm s and a FWHM of (24.4 +/- 9.2) keV. The energy range 450-507 keV shows no positronium continuum associated with the annihilation line, with a 2-sigma upper limit of 0.90 on the positronium fraction. The 164 keV feature is interpreted as Compton backscatter of broadened and redshifted annihilation radiation, possibly from the source 1E 1740.7-2942.

  9. Advanced Call Center Supporting WAP Access

    Institute of Scientific and Technical Information of China (English)

    YUANXiao-hua; CHENJun-liang

    2001-01-01

    Traditional call centers can be accessed via speech only, and the call center based on web provides both da-ta and speech access,but it needs a powerful terminal-computer.By analyzing traditional call centers and call cen-ters based on web, this paper presents the framework of an advanced call center supporting WAP access.A typical service is also described in detail.

  10. Fuzzy Logic Reliability Centered Maintenance

    Directory of Open Access Journals (Sweden)

    Felecia .

    2014-01-01

    Full Text Available Reliability Centered Maintenence (RCM is a systematic maintenence strategy based on system reliability. Application of RCM process will not always come out with a binary output of “yes” and “no”. Most of the time they are not supported with available detail information to calculate system reliability. The fuzzy logic method attempts to eliminate the uncertainty by providing “truth” in different degrees.Data and responses from maintenance department will be processed using the two methods (reliability centered maintenance and fuzzy logic to design maintenance strategy for the company. The results of the fuzzy logic RCM application are maintenance strategy which fit with current and future condition.

  11. Rolex learning center English guide

    CERN Document Server

    Della Casa, Francesco

    2012-01-01

    The novel architectural form of this building, conceived of by the architects of SAANA (winners of the Pritzker Prize in 2010), compelled the building engineers to come up with unprecedented structural, technical and logistical solutions. And yet, once the Rolex Learning Center was complete, the ingenuity required for its construction had become practically invisible in the eyes of the uninitiated. This richly illustrated guide provides, in condensed form, an account of the extraordinary adventure of the realization of the Rolex Learning Center. It explains in detail the context of its construction and brings to light the spatial subtleties of its architecture. In addition, it provides the visitor of the building with all the needed technical information and many novel facts and figures.

  12. Jellyfish: Networking Data Centers Randomly

    CERN Document Server

    Singla, Ankit; Popa, Lucian; Godfrey, P Brighten

    2011-01-01

    Industry experience indicates that the ability to incrementally expand data centers is essential. However, existing high-bandwidth network designs have rigid structure that interferes with incremental expansion. We present Jellyfish, a high-capacity network interconnect, which, by adopting a random graph topology, yields itself naturally to incremental expansion. Somewhat surprisingly, Jellyfish is more cost-efficient than a fat-tree: A Jellyfish interconnect built using the same equipment as a fat-tree, supports as many as 25% more servers at full capacity at the scale of a few thousand nodes, and this advantage improves with scale. Jellyfish also allows great flexibility in building networks with different degrees of oversubscription. However, Jellyfish's unstructured design brings new challenges in routing, physical layout, and wiring. We describe and evaluate approaches that resolve these challenges effectively, indicating that Jellyfish could be deployed in today's data centers.

  13. The Fermilab Particle Astrophysics Center

    Energy Technology Data Exchange (ETDEWEB)

    2004-11-01

    The Particle Astrophysics Center was established in fall of 2004. Fermilab director Michael S. Witherell has named Fermilab cosmologist Edward ''Rocky'' Kolb as its first director. The Center will function as an intellectual focus for particle astrophysics at Fermilab, bringing together the Theoretical and Experimental Astrophysics Groups. It also encompasses existing astrophysics projects, including the Sloan Digital Sky Survey, the Cryogenic Dark Matter Search, and the Pierre Auger Cosmic Ray Observatory, as well as proposed projects, including the SuperNova Acceleration Probe to study dark energy as part of the Joint Dark Energy Mission, and the ground-based Dark Energy Survey aimed at measuring the dark energy equation of state.

  14. The potential of metabolomic analysis techniques for the characterisation of α1-adrenergic receptors in cultured N1E-115 mouse neuroblastoma cells.

    Science.gov (United States)

    Wenner, Maria I; Maker, Garth L; Dawson, Linda F; Drummond, Peter D; Mullaney, Ian

    2016-08-01

    Several studies of neuropathic pain have linked abnormal adrenergic signalling to the development and maintenance of pain, although the mechanisms underlying this are not yet fully understood. Metabolomic analysis is a technique that can be used to give a snapshot of biochemical status, and can aid in the identification of the mechanisms behind pathological changes identified in cells, tissues and biological fluids. This study aimed to use gas chromatography-mass spectrometry-based metabolomic profiling in combination with reverse transcriptase-polymerase chain reaction and immunocytochemistry to identify functional α1-adrenergic receptors on cultured N1E-115 mouse neuroblastoma cells. The study was able to confirm the presence of mRNA for the α1D subtype, as well as protein expression of the α1-adrenergic receptor. Furthermore, metabolomic data revealed changes to the metabolite profile of cells when exposed to adrenergic pharmacological intervention. Agonist treatment with phenylephrine hydrochloride (10 µM) resulted in altered levels of several metabolites including myo-inositol, glucose, fructose, alanine, leucine, phenylalanine, valine, and n-acetylglutamic acid. Many of the changes observed in N1E-115 cells by agonist treatment were modulated by additional antagonist treatment (prazosin hydrochloride, 100 µM). A number of these changes reflected what is known about the biochemistry of α1-adrenergic receptor activation. This preliminary study therefore demonstrates the potential of metabolomic profiling to confirm the presence of functional receptors on cultured cells. PMID:26408527

  15. Isolation of 1E4 IgM Anti-Fasciola hepatica Rediae Monoclonal Antibody from Ascites: Comparison of Two Purification Protocols.

    Science.gov (United States)

    Alba, Annia; Marcet, Ricardo; Otero, Oscar; Hernández, Hilda M; Figueredo, Mabel; Sarracent, Jorge

    2016-02-01

    Purification of immunoglobulin M (IgM) antibodies could be challenging, and is often characterized by the optimization of the purification protocol to best suit the particular features of the molecule. Here, two different schemes were compared to purify, from ascites, the 1E4 IgM monoclonal antibody (mAb) previously raised against the stage of redia of the trematode Fasciola hepatica. This immunoglobulin is used as capture antibody in an immunoenzymatic assay to detect parasite ongoing infection in its intermediate hosts. The first purification protocol of the 1E4 mAb involved two chromatographic steps: an affinity chromatography on a Concanavalin A matrix followed by size exclusion chromatography. An immunoaffinity chromatography was selected as the second protocol for one-step purification of the antibody using the crude extract of adult parasites coupled to a commercial matrix. Immunoreactivity of the fractions during purification schemes was assessed by indirect immunoenzymatic assays against the crude extract of F. hepatica rediae, while purity was estimated by protein electrophoresis. Losses on the recovery of the antibody isolated by the first purification protocol occurred due to protein precipitation during the concentration of the sample and to low resolution of the size exclusion molecular chromatography step regarding this particular immunoglobulin. The immunoaffinity chromatography using F. hepatica antigens as ligands proved to be the most suitable protocol yielding a pure and immunoreactive antibody. The purification protocols used are discussed regarding efficiency and difficulties. PMID:26828226

  16. Requirements for a GaAsBi 1 eV sub-cell in a GaAs-based multi-junction solar cell

    Science.gov (United States)

    Thomas, T.; Mellor, A.; Hylton, N. P.; Führer, M.; Alonso-Álvarez, D.; Braun, A.; Ekins-Daukes, N. J.; David, J. P. R.; Sweeney, S. J.

    2015-09-01

    Multi-junction solar cells achieve high efficiency by stacking sub-cells of different bandgaps (typically GaInP/GaAs/Ge) resulting in efficiencies in excess of 40%. The efficiency can be improved by introducing a 1 eV absorber into the stack, either replacing Ge in a triple-junction configuration or on top of Ge in a quad-junction configuration. GaAs0.94Bi0.06 yields a direct-gap at 1 eV with only 0.7% strain on GaAs and the feasibility of the material has been demonstrated from GaAsBi photodetector devices. The relatively high absorption coefficient of GaAsBi suggests sufficient current can be generated to match the sub-cell photocurrent from the other sub-cells of a standard multi-junction solar cell. However, minority carrier transport and background doping levels place constraints on both p/n and p-i-n diode configurations. In the possible case of short minority carrier diffusion lengths we recommend the use of a p-i-n diode, and predict the material parameters that are necessary to achieve high efficiencies in a GaInP/GaAs/GaAsBi/Ge quad-junction cell.

  17. Requirements for a GaAsBi 1 eV sub-cell in a GaAs-based multi-junction solar cell

    International Nuclear Information System (INIS)

    Multi-junction solar cells achieve high efficiency by stacking sub-cells of different bandgaps (typically GaInP/GaAs/Ge) resulting in efficiencies in excess of 40%. The efficiency can be improved by introducing a 1 eV absorber into the stack, either replacing Ge in a triple-junction configuration or on top of Ge in a quad-junction configuration. GaAs0.94Bi0.06 yields a direct-gap at 1 eV with only 0.7% strain on GaAs and the feasibility of the material has been demonstrated from GaAsBi photodetector devices. The relatively high absorption coefficient of GaAsBi suggests sufficient current can be generated to match the sub-cell photocurrent from the other sub-cells of a standard multi-junction solar cell. However, minority carrier transport and background doping levels place constraints on both p/n and p-i-n diode configurations. In the possible case of short minority carrier diffusion lengths we recommend the use of a p-i-n diode, and predict the material parameters that are necessary to achieve high efficiencies in a GaInP/GaAs/GaAsBi/Ge quad-junction cell. (paper)

  18. Near-infrared Observations of Magnetars: XTE J1810-197, 1RXS J1708-4009, 1E 1841-045 and SGR 1900+14

    CERN Document Server

    Testa, V; Mignani, R P; Israel, G L; Perna, R; Chaty, S; Stella, L; Covino, S; Turolla, R; Zane, S; Curto, G Lo; Campana, S; Marconi, G; Mereghetti, S

    2007-01-01

    . We report on near-infrared (IR) observations of the three anomalous X-ray pulsars XTE J1810-197, 1RXS J1708-4009, 1E 1841-045 and the soft gamma-ray repeater SGR 1900+14, taken with the ESO-VLT, the Gemini, and the CFHT telescopes. . This work is aimed at identifying and/or confirming the IR counterparts of these magnetars, as well as at measuring their possible IR variability. . In order to perform photometry of objects as faint as Ks~20, we have used data taken with the largest telescopes, equipped with the most advanced IR detectors and in most of the cases with Adaptive Optics devices. The latter are critical to achieve the sharp spatial accuracy required to pinpoint faint objects in crowded fields. . We confirm with high confidence the identification of the IR counterpart to XTE J1810-197, and its IR variability. For 1E 1841-045 and SGR 1900+14 we propose two candidate IR counterparts based on the detection of IR variability. For 1RXS J1708-4009 we show that none of the potential counterparts within th...

  19. Measurement of the neutron capture cross section of the s-only isotope 204Pb from 1 eV to 440 keV

    CERN Document Server

    Domingo-Pardo, C; Aerts, G; Alvarez-Pol, H; Alvarez-Velarde, F; Andriamonje, S; Andrzejewski, J; Assimakopoulos, P; Audouin, L; Badurek, G; Baumann, P; Becvar, F; Berthoumieux, E; Bisterzo, S; Calvino, F; Cano-Ott, D; Capote, R; Carrapico, C; Cennini, P; Chepel, V; Chiaveri, E; Colonna, N; Cortes, G; Couture, A; Cox, J; Dahlfors, M; David, S; Dillmann, I; Dolfini, R; Dridi, W; Duran, I; Eleftheriadis, C; Embid-Segura, M; Ferrant, L; Ferrari, A; Ferreira-Marques, R; Fitzpatrick, L; Frais-Koelbl, H; Fujii, K; Furman, W; Gallino, R; Goncalves, I; Gonzalez-Romero, E; Goverdovski, A; Gramegna, F; Griesmayer, E; Guerrero, C; Gunsing, F; Haas, B; Haight, R; Heil, M; Herrera-Martinez, A; Igashira, M; Isaev, S; Jericha, E; Kadi, Y; Kappeler, F; Karamanis, D; Karadimos, D; Kerveno, M; Ketlerov, V; Koehler, P; Konovalov, V; Kossionides, E; Krticka, M; Lamboudis, C; Leeb, H; Lindote, A; Lopes, I; Lozano, M; Lukic, S; Marganiec, J; Marrone, S; Mastinu, P; Mengoni, A; Milazzo, P.M; Moreau, C; Mosconi, M; Neves, F; Oberhummer, H; Oshima, M; O'Brien, S; Pancin, J; Papachristodoulou, C; Papadopoulos, C; Paradela, C; Patronis, N; Pavlik, A; Pavlopoulos, P; Perrot, L; Plag, R; Plompen, A; Plukis, A; Poch, A; Pretel, C; Quesada, J; Rauscher, T; Reifarth, R; Rosetti, M; Rubbia, C; Rudolf, G; Rullhusen, P; Salgado, J; Sarchiapone, L; Savvidis, I; Stephan, C; Tagliente, G; Tain, J.L; Tassan-Got, L; Tavora, L; Terlizzi, R; Vannini, G; Vaz, P; Ventura, A; Villamarin, D; Vincente, M.C; Vlachoudis, V; Vlastou, R; Voss, F; Walter, S; Wendler, H; Wiescher, M; Wisshak, K

    2007-01-01

    The neutron capture cross section of 204Pb has been measured at the CERN n_TOF installation with high resolution in the energy range from 1 eV to 440 keV. An R-matrix analysis of the resolved resonance region, between 1 eV and 100 keV, was carried out using the SAMMY code. In the interval between 100 keV and 440 keV we report the average capture cross section. The background in the entire neutron energy range could be reliably determined from the measurement of a 208Pb sample. Other systematic effects in this measurement could be investigated and precisely corrected by means of detailed Monte Carlo simulations. We obtain a Maxwellian average capture cross section for 204Pb at kT=30 keV of 79(3) mb, in agreement with previous experiments. However our cross section at kT=5 keV is about 35% larger than the values reported so far. The implications of the new cross section for the s-process abundance contributions in the Pb/Bi region are discussed.

  20. Land Center for Human Rights

    OpenAIRE

    Saber, Karam

    2013-01-01

    Why Land Center for Human Rights? The farmers’ issue represents a new and very important dimension for the Human Rights movement in Egypt for several reasons. The inadequacy of a legislative structure to protect agrarian laborers. In consequence, they are exposed to daily violations. The main targeted categories are women, children and permanent or seasonal agrarian laborers. The widening gap between urban and rural Egypt, especially in the services. Thus, a wide category of people are expose...

  1. Drinfeld center of planar algebra

    CERN Document Server

    Das, Paramita; Gupta, Ved Prakash

    2012-01-01

    We introduce fusion and contragadient of affine representations of a planar algebra $P$ (not necessarily having finite depth). We prove that if $N \\subset M$ is a subfactor realization of $P$, then the Drinfeld center of the $N$-$N$-bimodule category generated by $_N L^2 (M)_M$, is equivalent to the category Hilbert affine representations of $P$ satisfying certain finiteness criterion. As a consequence, we prove Kevin Walker's conjecture for planar algebras.

  2. Human Centered Design for Development

    OpenAIRE

    Knoche, Hendrik; Rao, Sheshagiri, P. R.; Huang, Jeffrey

    2011-01-01

    This paper describes the challenges faced in ICTD by reviewing the lessons learned from a project geared at improving the livelihood of marginal farmers in India through wireless sensor networks. Insufficient user participation, lack of attention to user needs, and a primary focus on technology in the design process led to unconvinced target users who were not interested in the new technology. The authors discuss benefits that ICTD can reap from incorporating human-centered design (HCD) princ...

  3. Expeditionary mobile operations center (EMOC)

    OpenAIRE

    Gonzalez, Jose

    2014-01-01

    This research explores a viable solution to the U.S.Marine Corps’ (USMC) communications gap at the tactical edge. The aim is to leverage commercial-off-the-shelf (COTS) technology to provide a combat operations center (COC) like communication architecture to small units operating in austere environments. The proposed architecture required must be lightweight, energy efficient, and allow greater mobility through a reduced footprint and energy consumption. By reducing the energy required for un...

  4. The Scientific Data Management Center

    OpenAIRE

    Shoshani, Arie

    2006-01-01

    With the increasing volume and complexity of data produced by ultra-scale simulations and high-throughput experiments, understanding the science is largely hampered by the lack of comprehensive, end-to-end data management solutions ranging from initial data acquisition to final analysis and visualization. The Scientific Data Management (SDM) Center is bringing a set of advanced data management technologies to DOE scientists in various application domains including astrophysics, climate, ...

  5. Clean Energy Solutions Center (Presentation)

    Energy Technology Data Exchange (ETDEWEB)

    Reategui, S.

    2012-07-01

    The Clean Energy Ministerial launched the Clean Energy Solutions Center in April, 2011 for major economy countries, led by Australia and U.S. with other CEM partners. Partnership with UN-Energy is extending scope to support all developing countries: 1. Enhance resources on policies relating to energy access, small to medium enterprises (SMEs), and financing programs; 2. Offer expert policy assistance to all countries; 3. Expand peer to peer learning, training, and deployment and policy data for developing countries.

  6. The Fort Collins Science Center

    Science.gov (United States)

    Wilson, Juliette T.; Banowetz, Michele M.

    2012-01-01

    With a focus on biological research, the U.S. Geological Survey Fort Collins Science Center (FORT) develops and disseminates science-based information and tools to support natural resource decision-making. This brochure succinctly describes the integrated science capabilities, products, and services that the FORT science community offers across the disciplines of aquatic systems, ecosystem dynamics, information science, invasive species science, policy analysis and social science assistance, and trust species and habitats.

  7. Learning System Center App Controller

    CERN Document Server

    Naeem, Nasir

    2015-01-01

    This book is intended for IT professionals working with Hyper-V, Azure cloud, VMM, and private cloud technologies who are looking for a quick way to get up and running with System Center 2012 R2 App Controller. To get the most out of this book, you should be familiar with Microsoft Hyper-V technology. Knowledge of Virtual Machine Manager is helpful but not mandatory.

  8. Hydrogen Bonds Involving Metal Centers

    OpenAIRE

    Pavlović, G.; Raos, N.

    2006-01-01

    Hydrogen bonds involving metal center as a hydrogen donor or hydrogen acceptor are only a specific type of metal-hydrogen interactions; it is therefore not easy to differentiate hydrogen bond from other metal-hydrogen interactions, especially agostic ones. The first part of the review is therefore devoted to the results of structural chemistry and molecular spectroscopy (NMR, IR), as a tool for differentiating hydrogen bondings from other hydrogen interactions. The classical examples of Pt···...

  9. Fuzzy Logic Reliability Centered Maintenance

    OpenAIRE

    , Felecia

    2014-01-01

    Reliability Centered Maintenence (RCM) is a systematic maintenence strategy based on system reliability. Application of RCM process will not always come out with a binary output of “yes” and “no”. Most of the time they are not supported with available detail information to calculate system reliability. The fuzzy logic method attempts to eliminate the uncertainty by providing “truth” in different degrees.Data and responses from maintenance department will be processed using the two methods (re...

  10. Northeast Regional Planetary Data Center

    Science.gov (United States)

    Schultz, Peter H.; Saunders, Stephen (Technical Monitor)

    2005-01-01

    In 1980, the Northeast Planetary Data Center (NEPDC) was established with Tim Mutch as its Director. The Center was originally located in the Sciences Library due to space limitations but moved to the Lincoln Field Building in 1983 where it could serve the Planetary Group and outside visitors more effectively. In 1984 Dr. Peter Schultz moved to Brown University and became its Director after serving in a similar capacity at the Lunar and Planetary Institute since 1976. Debbie Glavin has served as the Data Center Coordinator since 1982. Initially the NEPDC was build around Tim Mutch's research collection of Lunar Orbiter and Mariner 9 images with only partial sets of Apollo and Viking materials. Its collection was broadened and deepened as the Director (PHS) searched for materials to fill in gaps. Two important acquisitions included the transfer of a Viking collection from a previous PI in Tucson and the donation of surplused lunar materials (Apollo) from the USGS/Menlo Park prior to its building being torn down. Later additions included the pipeline of distributed materials such as the Viking photomosaic series and certain Magellan products. Not all materials sent to Brown, however, found their way to the Data Center, e.g., Voyager prints and negatives. In addition to the NEPDC, the planetary research collection is separately maintained in conjunction with past and ongoing mission activities. These materials (e.g., Viking, Magellan, Galileo, MGS mission products) are housed elsewhere and maintained independently from the NEPDC. They are unavailable to other researchers, educators, and general public. Consequently, the NEPDC represents the only generally accessible reference collection for use by researchers, students, faculty, educators, and general public in the Northeast corridor.

  11. Center Pivot Irrigated Agriculture, Libya

    Science.gov (United States)

    1981-01-01

    A view of the Faregh Agricultural Station in the Great Calanscio Sand Sea, Libya (26.5N, 22.0E) about 300 miles southeast of Benghazi. A pattern of water wells have been drilled several miles apart to support a quarter mile center-pivot-swing-arm agricultural irrigation system. The crop grown is alfalfa which is eaten on location by flocks of sheep following the swing arm as it rotates. At maturity, the sheep are flown to market throughout Libya.

  12. Northern Prairie Wildlife Research Center

    Science.gov (United States)

    ,

    2009-01-01

    The Northern Prairie Wildlife Research Center (NPWRC) conducts integrated research to fulfill the Department of the Interior's responsibilities to the Nation's natural resources. Located on 600 acres along the James River Valley near Jamestown, North Dakota, the NPWRC develops and disseminates scientific information needed to understand, conserve, and wisely manage the Nation's biological resources. Research emphasis is primarily on midcontinental plant and animal species and ecosystems of the United States. During the center's 40-year history, its scientists have earned an international reputation for leadership and expertise on the biology of waterfowl and grassland birds, wetland ecology and classification, mammalian behavior and ecology, grassland ecosystems, and application of statistics and geographic information systems. To address current science challenges, NPWRC scientists collaborate with researchers from other U.S. Geological Survey centers and disciplines (Biology, Geography, Geology, and Water) and with biologists and managers in the Department of the Interior (DOI), other Federal agencies, State agencies, universities, and nongovernmental organizations. Expanding upon its scientific expertise and leadership, the NPWRC is moving in new directions, including invasive plant species, restoration of native habitats, carbon sequestration and marketing, and ungulate management on DOI lands.

  13. 1eV吸收带边GaInAs/GaNAs超晶格太阳能电池的阱层设计%Well layer design for 1eV absorption band edge of GaInAs/GaNAs super-lattice solar cell

    Institute of Scientific and Technical Information of China (English)

    王海啸; 郑新和; 吴渊渊; 甘兴源; 王乃明; 杨辉

    2013-01-01

    使用In, N分离的GaInAs/GaNAs超晶格作为有源区是实现高质量1eV带隙GaInNAs基太阳能电池的重要方案之一。为在实验上生长出高质量相应吸收带边的超晶格结构,本文采用计算超晶格电子态常用的Kronig-Penney模型比较了不同阱层材料选择下,吸收带边为1 eV的GaInAs/GaNAs超晶格相关参数的对应关系以及超晶格应变状态。结果表明:GaNAs与GaInAs作为超晶格阱层材料在实现1 eV的吸收带边时具有不同的考虑和要求;在固定1 eV的吸收带边时, GaNAs材料作为阱层可获得较好的超晶格应变补偿,将有利于生长高质量且充分吸收的太阳能电池有源区。%The GaInAs/GaNAs super-lattice with a feature of space separation of In and N constituents as an active region, is one of the most important ways to achieve 1 eV GaInNAs-based solar cells. To experimentally realize the high-quality super-lattice structure with the required band-gap, Kronig-Penney model is used to obtain the barrier thickness dependence on the well thickness and its composition. Meanwhile, the strain state of GaInAs/GaNAs SLs with various well choices is also discussed. Results show that when both the GaNAs and GaInAs act as the well layers the super-lattice can achieve 1 eV band-gap, and when the GaN0.04As0.96 is considered to act as the well layer, the entire GaInAs/GaNAs SLs have smaller strain accumulations as compared with the case of Ga0.7In0.3As as the well layer in the super-lattice structure.

  14. 核级差压变送器静压影响的分析%The analysis of static pressure effect on 1E differential pressure transmitters

    Institute of Scientific and Technical Information of China (English)

    王占元; 廖圣勇

    2013-01-01

      The instrument of nuclear power plant is an important device to ensure the safety and economic operation of nuclear power plants.For the nuclear power plant using instrumentation,especially 1E instrument have higher in terms of accuracy,stability or reliability is vital.According to the requirements of relevant safety standards,measurement and protection channel must calculate instrument channel accuracy to verify whether or not it can meet the designing requirement.There is special precision requirement for the transmitter accuracy in the whole accuracy channel.The error from the static pressure has many influences upon the transmitter accuracy calculation,and it may cause transmitters to miss the designing requirement.This paper mainly introduces the influencing factors of 1E functional accuracy calculations and the static pressure elimination method of 1E differential pressure transmitters.%  核电站仪表是保证核电站安全和经济运行的重要设备。对于核电站用仪表,尤其是核级仪表无论在精确度、稳定性还是可靠性等方面都有较高的要求。根据相关安全准则要求,测量保护通道必须计算仪表的通道精度来验证其是否满足设计要求。在整个通道精度中对变送器的精度有特殊要求。而变送器的静压产生的误差会严重影响通道精度计算,导致其无法满足设计要求。本文主要介绍核电站用核级变送器的功能精度影响因素及差压变送器静压影响消除方法。

  15. Information on the Karlsruhe Nuclear Research Center

    International Nuclear Information System (INIS)

    A short overview is given about the origins of Karlsruhe Nuclear Research Center. The historical development of the different companies operating the Center is shown. Because the original task assigned to the Center was the construction and testing of the first German reactor exclusively built by German companies, a detailed description of this reactor and the changes made afterwards is presented. Next, today's organizational structure of the Center is outlined and the development of the Center's financing since its foundation is shown. A short overview about the structure of employees from the Center's beginning up to now is also included as well as a short description of today's main activities. (orig.)

  16. Liquid cooled data center design selection

    Energy Technology Data Exchange (ETDEWEB)

    Chainer, Timothy J.; Iyengar, Madhusudan K.; Parida, Pritish R.

    2016-09-13

    Input data, specifying aspects of a thermal design of a liquid cooled data center, is obtained. The input data includes data indicative of ambient outdoor temperature for a location of the data center; and/or data representing workload power dissipation for the data center. The input data is evaluated to obtain performance of the data center thermal design. The performance includes cooling energy usage; and/or one pertinent temperature associated with the data center. The performance of the data center thermal design is output.

  17. Process Engineering Technology Center Initiative

    Science.gov (United States)

    Centeno, Martha A.

    2002-01-01

    NASA's Kennedy Space Center (KSC) is developing as a world-class Spaceport Technology Center (STC). From a process engineering (PE) perspective, the facilities used for flight hardware processing at KSC are NASA's premier factories. The products of these factories are safe, successful shuttle and expendable vehicle launches carrying state-of-the-art payloads. PE is devoted to process design, process management, and process improvement, rather than product design. PE also emphasizes the relationships of workers with systems and processes. Thus, it is difficult to speak of having a laboratory for PE at K.S.C. because the entire facility is practically a laboratory when observed from a macro level perspective. However, it becomes necessary, at times, to show and display how K.S.C. has benefited from PE and how K.S.C. has contributed to the development of PE; hence, it has been proposed that a Process Engineering Technology Center (PETC) be developed to offer a place with a centralized focus on PE projects, and a place where K.S.C.'s PE capabilities can be showcased, and a venue where new Process Engineering technologies can be investigated and tested. Graphics for showcasing PE capabilities have been designed, and two initial test beds for PE technology research have been identified. Specifically, one test bed will look into the use of wearable computers with head mounted displays to deliver work instructions; the other test bed will look into developing simulation models that can be assembled into one to create a hierarchical model.

  18. The Northeast Climate Science Center

    Science.gov (United States)

    Ratnaswamy, M. J.; Palmer, R. N.; Morelli, T.; Staudinger, M.; Holland, A. R.

    2013-12-01

    The Department of Interior Northeast Climate Science Center (NE CSC) is part of a federal network of eight Climate Science Centers created to provide scientific information, tools, and techniques that managers and other parties interested in land, water, wildlife and cultural resources can use to anticipate, monitor, and adapt to climate change. Recognizing the critical threats, unique climate challenges, and expansive and diverse nature of the northeast region, the University of Massachusetts Amherst, College of Menominee Nation, Columbia University, Marine Biological Laboratory, University of Minnesota, University of Missouri Columbia, and University of Wisconsin-Madison have formed a consortium to host the NE CSC. This partnership with the U.S. Geological Survey climate science center network provides wide-reaching expertise, resources, and established professional collaborations in both climate science and natural and cultural resources management. This interdisciplinary approach is needed for successfully meeting the regional needs for climate impact assessment, adaptive management, education, and stakeholder outreach throughout the northeast region. Thus, the NE CSC conducts research, both through its general funds and its annual competitive award process, that responds to the needs of natural resource management partners that exist, in part or whole, within the NE CSC bounds. This domain includes the North Atlantic, Upper Midwest and Great Lakes, Eastern Tallgrass and Big Rivers, and Appalachian Landscape Conservation Cooperatives (LCCs), among other management stakeholders. For example, researchers are developing techniques to monitor tree range dynamics as affected by natural disturbances which can enable adaptation of projected climate impacts; conducting a Designing Sustainable Landscapes project to assess the capability of current and potential future landscapes in the Northeast to provide integral ecosystems and suitable habitat for a suite of

  19. Burst and Persistent Emission Properties during the Recent Active Episode of the Anomalous X-Ray Pulsar 1E 1841-045

    Science.gov (United States)

    Lin, Lin; Kouveliotou, Chryssa; Gogus, Ersin; van der Horst, Alexander J.; Watts, Anna L.; Baring, Matthew G.; Kaneko, Yuki; Wijers, Ralph A. M. J.; Woods, Peter M.; Barthelmy, Scott; Burgess, J. Michael; Chaplin, Vandiver; Gehrels, Neil; Goldstein, Adam; Granot, Jonathan; Guiriec, Sylvain; Mcenery, Julie; Preece, Robert D.; Tierney, David; van der Klis, Michiel; von Kienlin, Andreas; Zhang, Shuang Nan

    2011-01-01

    SWift/BAT detected the first burst from 1E 1841-045 in May 2010 with intermittent burst activity recorded through at least July 2011. Here we present Swift and Fermi/GBM observations of this burst activity and search for correlated changes to the persistent X-ray emission of the source. The T90 durations of the bursts range between 18 - 140 ms, comparable to other magnetar burst durations, while the energy released in each burst ranges between (0.8-25) x 1038 erg, which is in the low side of SGR bursts. We find that the bursting activity did not have a significant effect on the persistent flux level of the source. We argue that the mechanism leading to this sporadic burst activity in IE 1841-045 might not involve large scale restructuring (either crustal or magnetospheric) as seen in other magnetar sources.

  20. A search for muon neutrino to electron neutrino oscillations at delta(m^2)>0.1 eV^2

    Energy Technology Data Exchange (ETDEWEB)

    Patterson, Ryan Benton; /Princeton U.

    2007-11-01

    The evidence is compelling that neutrinos undergo flavor change as they propagate. In recent years, experiments have observed this phenomenon of neutrino oscillations using disparate neutrino sources: the sun, fission reactors, accelerators, and secondary cosmic rays. The standard model of particle physics needs only simple extensions - neutrino masses and mixing - to accommodate all neutrino oscillation results to date, save one. The 3.8{sigma}-significant {bar {nu}}{sub e} excess reported by the LSND collaboration is consistent with {bar {nu}}{sub {mu}} {yields}{bar {nu}}{sub e} oscillations with a mass-squared splitting of {Delta}m{sup 2} {approx} 1 eV{sup 2}. This signal, which has not been independently verified, is inconsistent with other oscillation evidence unless more daring standard model extensions (e.g. sterile neutrinos) are considered.

  1. The Long-term Radiative Evolution of Anomalous X-ray Pulsar 1E~2259+586 after its 2002 Outburst

    CERN Document Server

    Zhu, Weiwei; Woods, Peter M; Gavriil, Fotis P; Dib, Rim

    2007-01-01

    We present an analysis of five X-ray Multi-Mirror Mission (XMM) observations of the Anomalous X-ray Pulsar (AXP) 1E 2259+586 taken in 2004 and 2005 during its relaxation following its 2002 outburst. We compare these data with those of five previous XMM observations taken in 2002 and 2003, and find the observed flux decay is well described by a power-law of index -0.69+/-0.03. As of mid-2005, the source may still have been brighter than pre-outburst, and was certainly hotter. We find a strong correlation between hardness and flux, as seen in other AXP outbursts. We discuss the implications of these results for the magnetar model.

  2. Transient viral DNA replication and repression of viral transcription are supported by the C-terminal domain of the bovine papillomavirus type 1 E1 protein.

    Science.gov (United States)

    Ferran, M C; McBride, A A

    1998-01-01

    The bovine papillomavirus type 1 E1 protein is important for viral DNA replication and transcriptional repression. It has been proposed that the full-length E1 protein consists of a small N-terminal and a larger C-terminal domain. In this study, it is shown that an E1 polypeptide containing residues 132 to 605 (which represents the C-terminal domain) is able to support transient viral DNA replication, although at a level lower than that supported by the wild-type protein. This domain can also repress E2-mediated transactivation from the P89 promoter as well as the wild-type E1 protein can. PMID:9420289

  3. A search for muon neutrino to electron neutrino oscillations at Δm2 > 0.1 eV2

    Energy Technology Data Exchange (ETDEWEB)

    Patterson, Ryan Benton [Princeton Univ., NJ (United States)

    2007-11-01

    The evidence is compelling that neutrinos undergo flavor change as they propagate. In recent years, experiments have observed this phenomenon of neutrino oscillations using disparate neutrino sources: the sun, fission reactors, accelerators, and secondary cosmic rays. The standard model of particle physics needs only simple extensions - neutrino masses and mixing - to accommodate all neutrino oscillation results to date, save one. The 3.8σ-significant $\\bar{v}$e excess reported by the LSND collaboration is consistent with $\\bar{v}$μ →$\\bar{v}$e oscillations with a mass-squared splitting of Δm2 ~ 1 eV2. This signal, which has not been independently verified, is inconsistent with other oscillation evidence unless more daring standard model extensions (e.g. sterile neutrinos) are considered.

  4. The nature of pulses delayed by 5 mcs in scintillation detectors from showers with the energy above 1E17 eV

    CERN Document Server

    Knurenko, S P

    2013-01-01

    Here we consider EAS events with energy above 1E17 eV with recorded pulses delayed by t>=5 mcs in scintillation detectors with different thresholds: 10, 5 and 1.8 MeV. In order to identify pulses from electrons, muons and neutrons, experimental data were compared to computational results performed within the framework of QGSJET01d model. Preliminary, one may speculate of registration of low-energy electrons arisen from moderation of neutrons in a detector or a medium surrounding a detector or in the snow cover and frozen crust (albedo particles). The fact that such pulses were registered mostly in low-threshold detectors confirms this hypothesis.

  5. Kennedy Space Center Spaceport Analysis

    Science.gov (United States)

    Wary, Samantha A.

    2013-01-01

    Until the Shuttle Atlantis' final landing on July 21, 2011, Kennedy Space Center (KSC) served as NASA's main spaceport, which is a launch and landing facility for rockets and spacecraft that are attempting to enter orbit. Many of the facilities at KSC were created to assist the Shuttle Program. One of the most important and used facilities is the Shuttle Landing Facility (SLF), This was the main landing area for the return of the shuttle after her mission in space. · However, the SLF has also been used for a number of other projects including straight-line testing by Gibbs Racing, weather data collection by NOAA, and an airfield for the KSC helicopters. This runway is three miles long with control tower at midfield and a fire department located at the end in care of an emergency. This facility, which was part of the great space race, will continue to be used for historical events as Kennedy begins to commercialize its facilities. KSC continues to be an important spaceport to the government, and it will transform into an important spaceport for the commercial industry as well. During my internship at KSC's Center Planning and Development Directorate, I had the opportunity to be a part of the negotiation team working on the agreement for Space Florida to control the Shuttle Landing Facility. This gave me the opportunity to learn about all the changes that are occurring here at Kennedy Space Center. Through various meetings, I discovered the Master Plan and its focus is to transform the existing facilities that were primarily used for the Shuttle Program, to support government operations and commercial flights in the future. This. idea is also in a new strategic business plan and completion of a space industry market analysis. All of these different documentations were brought to my attention and I. saw how they came together in the discussions of transitioning the SLF to a commercial operator, Space Florida. After attending meetings and partaking in discussions for

  6. Human-Centered Information Fusion

    CERN Document Server

    Hall, David L

    2010-01-01

    Information fusion refers to the merging of information from disparate sources with differing conceptual, contextual and typographical representations. Rather than focusing on traditional data fusion applications which have been mainly concerned with physical military targets, this unique resource explores new human-centered trends, such as locations, identity, and interactions of individuals and groups (social networks). Moreover, the book discusses two new major sources of information: human observations and web-based information.This cutting-edge volume presents a new view of multi-sensor d

  7. Air Risk Information Support Center

    Energy Technology Data Exchange (ETDEWEB)

    Shoaf, C.R.; Guth, D.J. [Environmental Protection Agency, Washington, DC (United States)

    1990-12-31

    The Air Risk Information Support Center (Air RISC) was initiated in early 1988 by the US Environmental Protection Agency`s (EPA) Office of Health and Environmental Assessment (OHEA) and the Office of Air Quality Planning and Standards (OAQPS) as a technology transfer effort that would focus on providing information to state and local environmental agencies and to EPA Regional Offices in the areas of health, risk, and exposure assessment for toxic air pollutants. Technical information is fostered and disseminated by Air RISCs three primary activities: (1) a {open_quotes}hotline{close_quotes}, (2) quick turn-around technical assistance projects, and (3) general technical guidance projects. 1 ref., 2 figs.

  8. Parâmetros hematológicos de frangos de corte alimentados com ração contendo aflatoxina B1 e fumonisina B1

    Directory of Open Access Journals (Sweden)

    Tessari Eliana Neire Castiglioni

    2006-01-01

    Full Text Available O objetivo deste trabalho foi avaliar os efeitos da aflatoxina B1 (AFB1 e da fumonisina B1 (FB1 sobre o hemograma e o leucograma de frangos alimentados com ração contendo as toxinas isoladamente e em associação, nos níveis de 0, 50 e 200mig de AFB1/kg, e/ou 0, 50 e 200mg de FB1/kg. O delineamento experimental foi inteiramente casualizado, em esquema fatorial 3x3, com 9 tratamentos e 12 repetições, totalizando 108 aves. Os frangos foram alimentados com as rações contaminadas do 8degrees até o 41degrees dia de vida. As aves de todos os grupos alimentados com micotoxinas apresentaram redução (P<0,05 nos valores de hematócrito, hemoglobina e número de hemácias, caracterizando um quadro de anemia, sendo que os grupos mais afetados foram os que receberam as maiores concentrações das toxinas em associação. Observou-se um menor (P<0,05 número de leucócitos em todos os tratamentos, porém esta redução foi mais intensa nos grupos tratados com 200mig/kg de AFB1, com ou sem FB1. Conclui-se que a AFB1 e a FB1, isoladas ou em associação, nos níveis utilizados no estudo, podem afetar negativamente os parâmetros hematológicos de frangos de corte.

  9. Melatonin-Mediated Intracellular Insulin during 2-Deoxy-d-glucose Treatment Is Reduced through Autophagy and EDC3 Protein in Insulinoma INS-1E Cells

    Directory of Open Access Journals (Sweden)

    Han Sung Kim

    2016-01-01

    Full Text Available 2-DG triggers glucose deprivation without altering other nutrients or metabolic pathways and then activates autophagy via activation of AMPK and endoplasmic reticulum (ER stress. We investigated whether 2-DG reduced intracellular insulin increased by melatonin via autophagy/EDC3 in insulinoma INS-1E cells. p-AMPK and GRP78/BiP level were significantly increased by 2-DG in the presence/absence of melatonin, but IRE1α level was reduced in 2-DG treatment. Levels of p85α, p110, p-Akt (Ser473, Thr308, and p-mTOR (Ser2481 were also significantly reduced by 2-DG in the presence/absence of melatonin. Mn-SOD increased with 2-DG plus melatonin compared to groups treated with/without melatonin alone. Bcl-2 was decreased and Bax increased with 2-DG plus melatonin. LC3II level increased with 2-DG treatment in the presence/absence of melatonin. Intracellular insulin production increased in melatonin plus 2-DG but reduced in treatment with 2-DG with/without melatonin. EDC3 was increased by 2-DG in the presence/absence of melatonin. Rapamycin, an mTOR inhibitor, increased GRP78/BiP and EDC3 levels in a dose-dependent manner and subsequently resulted in a decrease in intracellular production of insulin. These results suggest that melatonin-mediated insulin synthesis during 2-DG treatment involves autophagy and EDC3 protein in rat insulinoma INS-1E cells and subsequently results in a decrease in intracellular production of insulin.

  10. Effects of collagen membranes enriched with in vitro-differentiated N1E-115 cells on rat sciatic nerve regeneration after end-to-end repair

    Directory of Open Access Journals (Sweden)

    Fornaro Michele

    2010-02-01

    Full Text Available Abstract Peripheral nerves possess the capacity of self-regeneration after traumatic injury but the extent of regeneration is often poor and may benefit from exogenous factors that enhance growth. The use of cellular systems is a rational approach for delivering neurotrophic factors at the nerve lesion site, and in the present study we investigated the effects of enwrapping the site of end-to-end rat sciatic nerve repair with an equine type III collagen membrane enriched or not with N1E-115 pre-differentiated neural cells. After neurotmesis, the sciatic nerve was repaired by end-to-end suture (End-to-End group, end-to-end suture enwrapped with an equine collagen type III membrane (End-to-EndMemb group; and end-to-end suture enwrapped with an equine collagen type III membrane previously covered with neural cells pre-differentiated in vitro from N1E-115 cells (End-to-EndMembCell group. Along the postoperative, motor and sensory functional recovery was evaluated using extensor postural thrust (EPT, withdrawal reflex latency (WRL and ankle kinematics. After 20 weeks animals were sacrificed and the repaired sciatic nerves were processed for histological and stereological analysis. Results showed that enwrapment of the rapair site with a collagen membrane, with or without neural cell enrichment, did not lead to any significant improvement in most of functional and stereological predictors of nerve regeneration that we have assessed, with the exception of EPT which recovered significantly better after neural cell enriched membrane employment. It can thus be concluded that this particular type of nerve tissue engineering approach has very limited effects on nerve regeneration after sciatic end-to-end nerve reconstruction in the rat.

  11. Immunization with Human Papillomavirus 16 L1+E2 Chimeric Capsomers Elicits Cellular Immune Response and Antitumor Activity in a Mouse Model.

    Science.gov (United States)

    López-Toledo, Gabriela; Schädlich, Lysann; Alonso-Castro, Ángel Josabad; Monroy-García, Alberto; García-Rocha, Rosario; Guido, Miriam C; Gissmann, Lutz; García-Carrancá, Alejandro

    2016-06-01

    Development of cervical cancer is associated with persistent infections by high-risk human papillomavirus (HPV). Although current HPV L1-based prophylactic vaccines prevent infection, they do not help to eliminate prevalent infections or lesions. Our aims were (i) to generate a vaccine combining prophylactic and therapeutic properties by producing chimeric capsomers after fusion of the L1 protein to different fragments of E2 from HPV 16, and (ii) to evaluate their capacity to generate an antitumoral cellular response, while conserving L1 neutralizing epitopes. Chimeric proteins were produced in Escherichia coli and purified by glutathione S-transferase (GST)-affinity chromatography. Their structure was characterized using size exclusion chromatography, sucrose gradient centrifugation, electron microscopy, and anti-L1 enzyme-linked immunosorbent assay. All chimeric proteins form capsomers and heterogeneous aggregates. One, containing part of the carboxy-terminal domain of E2 and its hinge region (L1Δ+E2H/NC, aa 206-307), conserved the neutralizing epitope H16.V5. We then evaluated the capacity of this chimeric protein to induce a cytotoxic T-cell response against HPV 16 E2. In (51)Cr release cytotoxicity assays, splenocytes from C57BL/6 immunized mice recognized and lysed TC-1/E2 cells, which express and present endogenously processed E2 peptides. Moreover, this E2-specific cytotoxic response inhibited the growth of tumors of TC-1/E2 cells in mice. Finally, we identified an epitope (aa 292-301) of E2 involved in this cytotoxic response. We conclude that the L1Δ+E2H/NC chimeric protein produced in bacteria can be an effective and economically interesting candidate for a combined prophylactic and therapeutic vaccine that could help eliminating HPV16-positive low-grade cervical lesions and persistent viral infections, thus preventing the development of lesions and, at the same time, the establishment of new infections. PMID:27058179

  12. 2011 Las Conchas Post Fire Center Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — This data set consists of photo centers of raw aerial images representing multi-spectral (red, green, blue, near-infrared) digital aerial imagery of the Las Conchas...

  13. National Center On Deaf-Blindness

    Science.gov (United States)

    ... My Profile Logout Menu NCDB: National Center on Deaf-Blindness NCDB: National Center on Deaf-Blindness Help ... Collaborate Project Staff Service Provider Family Member State Deaf-Blind Projects Click on a state on the ...

  14. Center Innovation Fund: AFRC CIF Program

    Data.gov (United States)

    National Aeronautics and Space Administration — The Armstrong Flight Research Center is NASA’s primary center for atmospheric flight research and operations, with a vision “to fly what others...

  15. New Mexico Museums and Cultural Centers

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — This dataset provides an initial version of the locations of museums and cultural centers in New Mexico, in point form, with limited attributes, compiled using...

  16. Single Center Experience of Acute Disseminated Encephalomyelitis

    OpenAIRE

    J Gordon Millichap

    2013-01-01

    Investigators at Department of Pediatrics, Neurology Division, Adana Medical Research Center; and Division of Child Neurology, Ankara, Turkey, retrospectively evaluated 15 children with acute disseminated encephalomyelitis (ADEM) in children from the center in Adana.

  17. How To Build an Online Learning Center.

    Science.gov (United States)

    Boxer, Kenneth M.; Johnson, Bernardine

    2002-01-01

    The Global Learning Center was launched by W. R. Grace, a global speciality chemicals company, in 2001. The center is organized around core competencies, with lists of approved training programs, recommended reading lists, strategy guides, and a rental library. (JOW)

  18. ENVIRONMENTAL BIOINFORMATICS AND COMPUTATIONAL TOXICOLOGY CENTER

    Science.gov (United States)

    The Center activities focused on integrating developmental efforts from the various research projects of the Center, and collaborative applications involving scientists from other institutions and EPA, to enhance research in critical areas. A representative sample of specif...

  19. [Communication center in public health].

    Science.gov (United States)

    George, W; Grimminger, F; Krause, B

    2002-06-01

    The Communications Center's portfolio covers areas such as marketing, contacts, distribution of information, sales activities and collection of bills by telephone (encashment). A special emphasis is Customer Care Management (Customer Relationship Management) to the patient and his caregivers (relatives), the customers, especially the physicians who send their patients to the hospital and the hospital doctor. By providing communication centers, the hospital would be able to improve the communication with the G.P.s, and identify the wishes and requirements more accurately and easily from the beginning. Dealing effectively with information and communication is already also of special importance for hospital doctors today. One can assume that the demands on doctors in this respect will become even more complex in the future. Doctors who are involved in scientific research are of course fully aware of the growing importance of the Internet with its new information and communication channels. Therefore analysing the current situation, the demands on a future information management system can be formulated: A system that will help doctors to avoid dealing with little goal-oriented information and thus setting up effective communication channels; an information system which is multi-media oriented towards the interests and needs of the patients and patient's relatives and which is further developed continually and directly by those involved. PMID:12094467

  20. Midwest Clean Energy Application Center

    Energy Technology Data Exchange (ETDEWEB)

    Cuttica, John; Haefke, Cliff

    2013-12-31

    The Midwest Clean Energy Application Center (CEAC) was one of eight regional centers that promoted and assisted in transforming the market for combined heat and power (CHP), waste heat to power (WHP), and district energy (DE) technologies and concepts throughout the United States between October 1, 2009 and December 31, 2013. The key services the CEACs provided included:  Market Opportunity Analyses – Supporting analyses of CHP market opportunities in diverse markets including industrial, federal, institutional, and commercial sectors.  Education and Outreach – Providing information on the energy and non-energy benefits and applications of CHP to state and local policy makers, regulators, energy end-users, trade associations and others. Information was shared on the Midwest CEAC website: www.midwestcleanergy.org.  Technical Assistance – Providing technical assistance to end-users and stakeholders to help them consider CHP, waste heat to power, and/or district energy with CHP in their facility and to help them through the project development process from initial CHP screening to installation. The Midwest CEAC provided services to the Midwest Region that included the states of Illinois, Indiana, Iowa, Kansas, Michigan, Minnesota, Missouri, Nebraska, North Dakota, Ohio, South Dakota, and Wisconsin.