WorldWideScience

Sample records for center microquasar 1e

  1. Microquasars

    Science.gov (United States)

    Castro-Tirado, Alberto J.; Greiner, Jochen; Paredes, Josep M.

    2001-06-01

    The study of microquasars, sources in our Galaxy displaying powerful relativistic jets, is a rapidly advancing field in astrophysics. New instrumentation on the ground (MERLIN, SCUBA, VLA, and VLT) and aboard satellites (ASCA, BSAX, ISO, IXAE and RXTE) has provided important results, and much more is expected to come from Chandra and XMM-Newton. In the future, powerful instrumentation will come online in sub-mm (ALMA) and gamma rays (INTEGRAL), extending our coverage to important regions for the study of microquasars. Energy transport via relativistic jets is one of the most important physical mechanisms taking place in compact objects, either in binary systems or in the nuclei of active galaxies. Large efforts have been devoted to proper understanding of the disk-jet connection, and even the effects of rotation or magnetic fields. Several important advances have been made recently, both from the point of view of the theoretical treatment of jets and the different new observational tests. All of them are reflected in this book, the first one devoted to the study of these enigmatic objects. Link: http://www.wkap.nl/book.htm/0-7923-6923-8

  2. A Deep XMM-Newton Observation of the Enigmatic Microquasar 1E 1740.7-2942

    Science.gov (United States)

    Miller, Jon

    1E 1740.7-2942 is a microquasar residing in the Galactic center. It is persistently bright at X-ray energies and has been shown to power large scale bi-polar jets, thus making it an ideal source to probe the jet generation/launching mechanism in accreting black holes. Analysis of archival data hinted at the presence of a relativistically broadened iron line, providing a means to constrain the spin of the black hole in this system for the first time. In AO-10 we were awarded a 130 ks XMM-Newton category B target of oppurtunity (ToO) observation, with the aim of observing this system in the low-hard state. This observation was triggered in April 2012 and the data have been obtained, where a preliminary analysis reveals the expected broad iron line. Modeling this iron line will allow us to constrain the spin of the black hole and probe its relation to the presence of large scale jets in this system. We request a total of $63.7k funding to support the analysis of this deep XMM-Newton observation, including the primary target (1E 1740.7-2942) and the serendipitous sources in the field of view (destiny of the universe, and the nature of black holes, dark energy, dark matter, and gravity. and 2.4.2: Improve understanding of the many phenomena and processes associated with galaxy, stellar, and planetary system formation and evolution from the earliest epochs to today.

  3. VII Microquasar Workshop: Microquasars and Beyond

    Science.gov (United States)

    This workshop is the seventh of the series of conferences mainly devoted to Galactic black holes. The conference will cover all topics related to relativistic jet sources in the universe including microquasars, neutron stars, active galactic nuclei, and gamma-ray bursts. The results of the analysis of data from high energy missions (RXTE, Chandra, XMM-Newton, INTEGRAL, Swift, Suzaku, Agile) as well as from ground based observatories in the optical, infrared and radio bands will be presented. The emphasis will be on the formation and evolution of jets, and their relation to other accretion components. The broad context of the workshop will also allow researchers to present their results on the comparisons between microquasars, neutron stars, ultraluminous X-ray sources, active galactic nuclei and gamma-ray bursts. The workshop also intends to include presentations on recent missions (e.g. GLAST, ASTROSAT) and missions in preparation e.g. IXO concentrating on the prospects of black hole research with those missions. The program will be organized in sessions centered around a limited number of invited reviews, with contributed presentations and ample time for discussion. Young researchers will be encouraged to contribute.

  4. "Microquasar" Discoveries Win Prize for Astronomers

    Science.gov (United States)

    The discovery of "microquasars" within our own Milky Way Galaxy has won two astronomers a prize from the High Energy Astrophysics Division of the American Astronomical Society. Felix Mirabel of the Center for Studies at Saclay, France, and Luis Rodriguez of the Institute of Astronomy at the National Autonomous University in Mexico City, were awarded the Bruno Rossi Prize at the American Astronomical Society meeting in Toronto, Ontario, today. The two researchers, who have collaborated for more than 15 years, used an orbiting X-Ray observatory and the National Science Foundation's Very Large Array (VLA) radio telescope to discover the extremely energetic microquasars. Microquasars are thought to be binary-star systems with one of the stars either a superdense neutron star or a black hole. They emit X-rays and eject jets of subatomic particles at speeds approaching that of light. Though the neutron stars or black holes in microquasars are only a few times the mass of the sun, the phenomena associated with them, such as the jets, are similar to those seen in active galaxies and quasars, believed to be powered by the gravitational energy of black holes with millions of times the mass of the sun. As such, the microquasars provide much closer "laboratories" for study of these phenomena, which remain poorly understood. The Rossi Prize is awarded for "a significant contribution to high energy astrophysics, with particular emphasis on recent work," according to the High Energy Astrophysics Division. Mirabel and Rodriguez began the research that led to the microquasar discoveries in 1990. Using the French-Russian SIGMA- GRANAT X-Ray satellite, they discovered a microquasar near the Milky Way's center in 1992. With the VLA, they found radio emission from this object. In 1992, using the same satellite, they discovered a similar object, called GRS 1915+105. In 1994, that object experienced an outburst that made it bright enough at radio wavelengths to observe with the VLA

  5. Flaring variability of Microquasars

    CERN Document Server

    Trushkin, Sergei A; Nizhelskij, Nikolaj A

    2008-01-01

    We discuss flaring variability of radio emission of microquasars, measured in monitoring programs with the RATAN-600 radio telescope. We carried out a multi-frequency (1-30 GHz) daily monitoring of the radio flux variability of the microquasars SS433, GRS1915+105, and Cyg X-3 during the recent sets in 2005-2007. A lot of bright short-time flares were detected from GRS 1915+105 and they could be associated with active X-ray events. In January 2006 we detected a drop down of the quiescent fluxes from Cyg X-3 (from 100 to $\\sim$20 mJy), then the 1 Jy-flare was detected on 2 February 2006 after 18 days of quenched radio emission. The daily spectra of the flare in the maximum were flat from 2 to 110 GHz, using the quasi-simultaneous observations at 110 GHz with the RT45m telescope and the NMA millimeter array of NRO in Japan. Several bright radio flaring events (1-15 Jy) followed during the continuing state of very variable and intensive 1-12 keV X-ray emission ($\\sim$0.5 Crab), which was monitored in the RXTE ASM...

  6. Correlations of Active Galactic Nuclei with Microquasars

    Institute of Scientific and Technical Information of China (English)

    YE Yong-Chun; ZUO Xue-Qin; WANG Ding-Xiong

    2006-01-01

    Correlations of active galactic nuclei (AGNs) with microquasars are discussed based on the coexistence of the Blandford-Znajek (BZ) and magnetic coupling (MC) processes (CEBZMC) in black hole (BH) accretion disk.The proportions of several quantities of BH systems for both AGNs and microquasars are derived by combining the observational data with CEBZMC. It is shown that the square of the magnetic field at the BH horizon is inversely proportional to the BH mass, while the accretion rate of the disk is proportional to the BH mass. In addition, the very steep emissivity indexes from the recent XMM-Newton observations of the nearby bright Seyfert 1 galaxy MCG-6-30-15 and the microquasars XTE J1650-500 are well fitted by considering the MC effects on the disk radiation. These results suggest strongly the correlations of A GNs with microquasars.

  7. Astronomers Trace Microquasar's Path Back in Time

    Science.gov (United States)

    2003-01-01

    Astronomers have traced the orbit through our Milky Way Galaxy of a voracious neutron star and a companion star it is cannibalizing, and conclude that the pair joined more than 30 million years ago and probably were catapulted out of a cluster of stars far from the Galaxy's center. Path of Microquasar and Sun Path of Microquasar (red) and Sun (yellow) through the Milky Way Galaxy for the past 230 million years. Animations: GIF Version MPEG Version CREDIT: Mirabel & Rodrigues, NRAO/AUI/NSF The pair of stars, called Scorpius X-1, form a "microquasar," in which material sucked from the "normal" star forms a rapidly-rotating disk around the superdense neutron star. The disk becomes so hot it emits X-rays, and also spits out "jets" of subatomic particles at nearly the speed of light. Using precise positional data from the National Science Foundation's Very Long Baseline Array (VLBA) and from optical telescopes, Felix Mirabel, an astrophysicist at the Institute for Astronomy and Space Physics of Argentina and French Atomic Energy Commission, and Irapuan Rodrigues, also of the French Atomic Energy Commission, calculated that Scorpius X-1 is not orbiting the Milky Way's center in step with most other stars, but instead follows an eccentric path far above and below the Galaxy's plane. Scorpius X-1, discovered with a rocket-borne X-ray telescope in 1962, is about 9,000 light-years from Earth. It is the brightest continuous source of X-rays beyond the Solar System. The 1962 discovery and associated work earned a share of the 2002 Nobel Prize in physics for Riccardo Giacconi. Mirabel and Rodrigues used a number of published observations to calculate the path of Scorpius X-1 over the past few million years. "This is the most accurate determination we have made of the path of an X-ray binary," said Mirabel. By tracing the object's path backward in time, the scientists were able to conclude that the neutron star and its companion have been traveling together for more than 30

  8. Microquasar models for 3EG J1828+0142 and 3EG J1735-1500

    CERN Document Server

    Bosch-Ramon, V; Romero, G E; Torres, D F

    2004-01-01

    Microquasars are promising candidates to emit high-energy gamma-rays. Moreover, statistical studies show that variable EGRET sources at low galactic latitudes could be associated with the inner spiral arms. The variable nature and the location in the Galaxy of the high-mass microquasars, concentrated in the galactic plane and within 55 degrees from the galactic center, give to these objects the status of likely counterparts of the variable low-latitude EGRET sources. We consider in this work the two most variable EGRET sources at low-latitudes: 3EG J1828+0142 and 3EG J1735-1500, proposing a microquasar model to explain the EGRET data in consistency with the observations at lower energies (from radio frequencies to soft gamma-rays) within the EGRET error box.

  9. Internal shock model for Microquasars

    CERN Document Server

    Kaiser, C R; Spruit, H C; Kaiser, Christian R.; Sunyaev, Rashid; Spruit, Henk C.

    2000-01-01

    We present a model for the radio outbursts of microquasars based on the assumption of quasi-continuous jet ejection. The jets are `lit up' by shock fronts traveling along the jets during outbursts. The observed comparatively flat decay light curves combined with gradually steepening spectral slopes are explained by a superposition of the radiation of the aging relativistic particle population left behind by the shocks. This scenario is the low energy, time-resolved equivalent to the internal shock model for GRBs. We show that this model predicts energy contents of the radiating plasma similar to the plasmon model. At the same time, the jet model relaxes the severe requirements on the central source in terms of the rate at which this energy must be supplied to the jet. Observations of `mini-bursts' with flat spectral slopes and of infrared emission far from the source centre suggest two different states of jet ejections: (i) A `mini-burst' mode with relatively stable jet production and weak radio emission with...

  10. AGNs and microquasars as high energy gamma-ray sources

    CERN Document Server

    Paredes, J M

    2004-01-01

    The extragalactic analogs of the microquasars, the quasars, are strong gamma-ray emitters at GeV energies. It is expected that microquasars are also gamma-ray sources, because of the analogy with quasars and because theoretical models predict the high-energy emission. There are two microquasars that appear as the possible counterparts for two unidentified high-energy gamma-ray sources.

  11. Sensitivity of the NEMO telescope to neutrinos from microquasars

    OpenAIRE

    Distefano, C.

    2006-01-01

    We present the results of Monte Carlo simulation studies of the capability of the proposed NEMO telescope to detect TeV muon neutrinos from Galactic microquasars. In particular we determined the number of the detectable events from each known microquasar together with the expected atmospheric neutrino and muon background events. We also discuss the detector sensitivity to neutrino fluxes expected from microquasars, optimizing the event selection in order to reject the atmospheric background, ...

  12. Toward a model for HFQPOs in Microquasars

    CERN Document Server

    Varniere, P; Vincent, F; Meheut, H

    2012-01-01

    There have been a long string of efforts to understand the source of the variability observed in microquasars but no model has yet gained wide acceptance, especially concerning the elusive High-Frequency Quasi-Periodic Oscillation (HFQPO). We first list the constraints arising from observations and how that translates for an HFQPO model. Then we present how a model based on having the Rossby Wave Instability (RWI) active in the disk could answer those constraints.

  13. The precessing jets of 1E 1740.7-2942

    CERN Document Server

    Luque-Escamilla, Pedro L; Martinez-Aroza, Josee

    2015-01-01

    Context. 1E 1740.7-2942 is believed to be one of the two prototypical microquasars towards the Galactic center region whose X-ray states strongly resemble those of Cygnus X-1. Yet, the bipolar radio jets of 1E 1740.7-2942 are very reminiscent of a radio galaxy. The true nature of the object has thus remained an open question for nearly a quarter of a century. Aims. Our main goal here is to confirm the Galactic membership of 1E 1740.7-2942 by searching for morphological changes of its extended radio jets in human timescales. This work was triggered as a result of recent positive detection of fast structural changes in the large-scale jets of its 'twin' GRS 1758-258. Methods. We carried out an in-depth exploration of the VLA public archives and fully recalibrated all 1E 1740.7-2942 extended data sets in the C configuration of the array. We obtained and analyzed matching beam radio maps for five epochs, covering years 1992, 1993, 1994, 1997 and 2000, with an angular resolution of a few arcseconds. Results. We cl...

  14. The precessing jets of 1E 1740.7-2942

    Science.gov (United States)

    Luque-Escamilla, Pedro L.; Martí, Josep; Martínez-Aroza, José

    2015-12-01

    Context. The source 1E 1740.7-2942 is believed to be one of the two prototypical microquasars towards the Galactic center region whose X-ray states strongly resemble those of Cygnus X-1. Yet, the bipolar radio jets of 1E 1740.7-2942 are very reminiscent of a radio galaxy. The true nature of the object has thus remained an open question for nearly a quarter of a century. Aims: Our main goal here is to confirm the Galactic membership of 1E 1740.7-2942 by searching for morphological changes of its extended radio jets in human timescales. This work was triggered as a result of recent positive detection of fast structural changes in the large-scale jets of the very similar source GRS 1758-258. Methods: We carried out an in-depth exploration of the Very Large Array public archives and fully recalibrated all 1E 1740.7-2942 extended data sets in the C configuration of the array. We obtained and analyzed matching beam radio maps for five epochs, covering years 1992, 1993, 1994, 1997 and 2000, with an angular resolution of a few arcseconds. Results: We clearly detected structural changes in the arc-minute jets of 1E 1740.7-2942 on timescales of roughly a year, which set a firm distance upper limit of 12 kpc. Moreover, a simple precessing twin-jet model was simultaneously fitted to the five observing epochs available. The observed changes in the jet flow are strongly suggestive of a precession period of ~1.3 yr. Conclusions: The fitting of the precession model to the data yields a distance of ~5 kpc. This value, and the observed changes, rule out any remaining doubts about the 1E 1740.7-2942 Galactic nature. To our knowledge, this microquasar is the second whose jet precession ephemeris become available after SS433. This kind of information is relevant to the physics of compact objects, since the genesis of the precession phenomenon occurs very close to the interplay region between the accretion disk and the compact object in the system. Appendix A and a movie associated to

  15. Sensitivity of the NEMO telescope to neutrinos from microquasars

    Energy Technology Data Exchange (ETDEWEB)

    Distefano, C. [LNS-INFN, via S. Sofia 62, 95123 Catania (Italy)

    2007-03-15

    We present the results of Monte Carlo simulation studies of the capability of the proposed NEMO telescope to detect TeV muon neutrinos from Galactic microquasars. In particular we determined the number of the detectable events from each known microquasar together with the expected atmospheric neutrino and muon background events. We also discuss the detector sensitivity to neutrino fluxes expected from microquasars, optimizing the event selection in order to reject the atmospheric background, and we show the number of events surviving the event selection.

  16. Sensitivity of the NEMO telescope to neutrinos from microquasars

    CERN Document Server

    Distefano, C

    2006-01-01

    We present the results of Monte Carlo simulation studies of the capability of the proposed NEMO telescope to detect TeV muon neutrinos from Galactic microquasars. In particular we determined the number of the detectable events from each known microquasar together with the expected atmospheric neutrino and muon background events. We also discuss the detector sensitivity to neutrino fluxes expected from microquasars, optimizing the event selection in order to reject the atmospheric background, and we show the number of events surviving the event selection.

  17. Microquasar Jet Irradiation of the Proto-Solar Nebula?

    CERN Document Server

    Butt, Y; Butt, Yousaf; Prantzos, Nikos

    2006-01-01

    We explore the possibility that a now-extinct microquasar may have irradiated the proto-solar neighborhood, causing the 'anomalously' high local 11B/10B isotopic ratio, and comment on some observational tests of the scenario.

  18. Sensitivity of the NEMO detector to galactic microquasars

    OpenAIRE

    Distefano, C.

    2007-01-01

    We present the results of Monte Carlo simulation studies of the capability of the proposed NEMO km$^3$ telescope to detect TeV muon neutrinos from Galactic microquasars. In particular we determined the detector sensitivity to each known microquasar, optimizing the event selection in order to reject the atmospheric background. We also determined the expected number of source and background events surviving the selection.

  19. Jet-Induced Nucleosynthesis in Misaligned Microquasars

    CERN Document Server

    Butt, Y M; Prantzos, N; Butt, Yousaf M.; Maccarone, Thomas J.; Prantzos, Nikos

    2002-01-01

    The jet axes and the orbital planes of microquasar systems are usually assumed to be approximately perpendicular, eventhough this is not currently an observational requirement. On the contrary, in one of the few systems where the relative orientations are well-constrained, V4641Sgr, the jet axis is known to lie not more than ~35 degrees from the binary plane. Such a jet, lying close to the binary plane, and traveling at a significant fraction of the speed of light may periodically impact the secondary star initiating nuclear reactions on its surface. The integrated yield of such nuclear reactions over the age of the binary system (less the radiative mass loss) will detectably alter the elemental abundances of the companion star. This scenario may explain the anomalously high Li enhancements (roughly ~20-200 times the sun's photospheric value; or, equivalently, 0.1-1 times the average solar system value) seen in the companions of some black-hole X-ray binary systems. (Such enhancements are puzzling since Li nu...

  20. The multifrequency monitoring of microquasars. SS433

    CERN Document Server

    Trushkin, S A; Nizhelskij, N A

    2003-01-01

    The principal results of daily observations with the RATAN-600 radio telescope of X-ray binary with relativistic jets microquasar SS433 in 1986--2003 are presented. We have measured the flux densities at 0.96, 2.3, 3.9, 7.7, 11.2 and 21.7 GHz in different sets, duration from a week to some months. In general there are 940 observations of SS433 and more than 4500 flux density measurements in the period. Observations show that radio spectra are well fitting by a power law. The mean spectral index remained the same, $-0.60\\pm0.14$ during almost 20 years at least, and mean accuracy of the index determination was better than 0.1 in our multi-frequency observations, i.e. it was higher than in the intensive two-frequency monitoring of SS433 with the three-element GBI interferometer. Flux density data and spectra `on-line' plotting are accessible on the CATS data base site: http://cats.sao.ru/.

  1. The physics of non-thermal radiation in microquasars

    CERN Document Server

    Bosch-Ramon, V

    2008-01-01

    Microquasars are binary systems that harbor a normal star and a compact object (black-hole or neutron star), and show relativistic outflows (or jets). The matter that forms these jets is of likely stellar origin, previously expelled from the star and trapped in the potential well of the compact object. This matter is accreted by the compact object, forming a disk due to its angular momentum, and is eventually ejected in the form of a bipolar outflow (the jets), which generates radio emission and could also be a very high-energy emitter. To study and understand the radiation from microquasars, there is a set of elements that can play a major role and are to be taken into account: the photons and the expelled matter from the star in the case of high-mass systems; the accreted matter radiation; the jet; the magnetic field carried by the jet or filling the binary system; and the medium surrounding the microquasar at large scales (~pc). In this lecture, we consider these elements of the microquasar scenario and br...

  2. The micro-quasars, witness of the extremes physics; Les microquasars, temoins de la physique des extremes

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-07-01

    Hopeful the micro-quasars, the astronomers reveal indirectly the black holes presence, invisible in the galaxies. They are extraordinary laboratories to understand the high energies physics and test the general relativity. For the first time, an international scientific team observes their energy emissions evolution. (A.L.B.)

  3. Gigantic Cosmic Corkscrew Reveals New Details About Mysterious Microquasar

    Science.gov (United States)

    2004-10-01

    Making an extra effort to image a faint, gigantic corkscrew traced by fast protons and electrons shot out from a mysterious microquasar paid off for a pair of astrophysicists who gained new insights into the beast's inner workings and also resolved a longstanding dispute over the object's distance. Microquasar SS 433 VLA Image of Microquasar SS 433 CREDIT: Blundell & Bowler, NRAO/AUI/NSF (Click on Image for Larger Version) The astrophysicists used the National Science Foundation's Very Large Array (VLA) radio telescope to capture the faintest details yet seen in the plasma jets emerging from the microquasar SS 433, an object once dubbed the "enigma of the century." As a result, they have changed scientists' understanding of the jets and settled the controversy over its distance "beyond all reasonable doubt," they said. SS 433 is a neutron star or black hole orbited by a "normal" companion star. The powerful gravity of the neutron star or black hole draws material from the stellar wind of its companion into an accretion disk of material tightly circling the dense central object prior to being pulled onto it. This disk propels jets of fast protons and electrons outward from its poles at about a quarter of the speed of light. The disk in SS 433 wobbles like a child's top, causing its jets to trace a corkscrew in the sky every 162 days. The new VLA study indicates that the speed of the ejected particles varies over time, contrary to the traditional model for SS 433. "We found that the actual speed varies between 24 percent to 28 percent of light speed, as opposed to staying constant," said Katherine Blundell, of the University of Oxford in the United Kingdom. "Amazingly, the jets going in both directions change their speeds simultaneously, producing identical speeds in both directions at any given time," Blundell added. Blundell worked with Michael Bowler, also of Oxford. The scientists' findings have been accepted by the Astrophysical Journal Letters. SS 433 New VLA

  4. Orbital Parameters of the Microquasar LSI +61 303

    CERN Document Server

    Casares, J; Paredes, J M; Martí, J; Allende-Prieto, C

    2005-01-01

    New optical spectroscopy of the HMXB microquasar LSI +61 303 is presented. Eccentric orbital fits to our radial velocity measurements yield updated orbital parameters in good agreement with previous work. Our orbital solution indicates that the periastron passage occurs at radio phase 0.23 and the X-ray/radio outbursts are triggered 2.5--4 days after the compact star passage. The spectrum of the optical star is consistent with a B0 V spectral type and contributes ~65 percent of the total light, the remaining due to emission by a circumstellar disc. We also measure the projected rotational velocity to be v sin i = 113 km/s.

  5. VLBA "Movie" Gives Scientists New Insights On Workings of Mysterious Microquasars

    Science.gov (United States)

    2004-01-01

    433 wobbles like a child's top, causing its jets to move in a circle every 164 days. By imaging SS 433 daily, the astronomers were able to trace individual ejections of material in these jets as they moved outward from the center. In addition, they could track the jets' precession, the movement caused by the disk's wobble. In other microquasars, blobs of material shot from the core become fainter, as seen with radio telescopes, as they move outward. However, in SS 433, blobs routinely brighten at specific distances from the core. From earlier studies, researchers had concluded that such brightening always occurs at one specific distance. The VLBA movie shows, instead, that there are multiple brightening regions and not all blobs brighten at all the regions. "We think the ejected material brightens because it's slamming into something," Rupen said. "However, whatever it's hitting has to be replenished somehow so that the brightening can occur again when the jet sweeps through that area the next time," he added. "It also appears that it isn't always replenished, because the brightening doesn't always happen," Mioduszewski pointed out. The VLBA movie revealed vital new information about another part of SS 433 -- material moving outward from the core, but not part of the superfast jets. This material moves outward in a direction not quite perpendicular to the direction of the jets. Discovered with the VLBA in 2000, this material had been seen only in one-time snapshots before, but the movie shows the steady evolution of its movement for the first time. That motion was the key to a possible answer to two riddles -- the source of the slower-moving material itself and the source of whatever the jet blobs are hitting when they brighten. "What seems most plausible to us is that the accretion disk is putting out a broad wind," Rupen explained. That broad wind from the disk hits a denser wind coming from the "normal" companion star to generate the radio waves seen coming from

  6. Sensitivity of an underwater Cerenkov km3 telescope to TeV neutrinos from Galactic Microquasars

    CERN Document Server

    Distefano, C; Ambriola, M; Ameli, F; Amore, I; Anghinolfi, M; Anzalone, A; Barbarino, G C; Barbarito, E; Battaglieri, M; Bellotti, R; Beverini, N; Bonori, M; Bouhadef, B; Brescia, M; Cacopardo, G; Cafagna, F; Capone, A; Caponetto, L; Castorina, E; Ceres, A; Chiarusi, T; Circella, M; Cocimano, R; Coniglione, R; Cordelli, M; Costa, M; Cuneo, S; D'Amico, A; De Bonis, G; De Marzo, C; De Rosa, G; De Vita, R; Falchini, E; Fiorello, C; Flaminio, V; Fratini, K; Gabrielli, A; Galeotti, S; Gandolfi, E; Giacomelli, G; Giorgi, F; Grimaldi, A; Habel, R; Leonora, E; Lonardo, A; Longo, G; Lo Presti, D; Lucarelli, F; Maccioni, E; Margiotta, A; Martini, A; Masullo, R; Megna, R; Migneco, E; Mongelli, M; Montaruli, T; Morganti, M; Musumeci, M; Nicolau, C A; Orlando, A; Osipenko, M; Osteria, G; Papaleo, R; Pappalardo, V; Petta, C; Piattelli, P; Raia, G; Randazzo, N; Reito, S; Ricco, G; Riccobene, G; Ripani, M; Rovelli, A; Ruppi, M; Russo, G V; Russo, S; Sapienza, P; Sedita, M; Shirokov, E; Simeone, F; Sipala, V; Spurio, M; Taiuti, M; Terreni, G; Trasatti, L; Urso, S; Valente, V; Vicini, P

    2006-01-01

    In this paper are presented the results of Monte Carlo simulations on the capability of the proposed NEMO-km$^3$ telescope to detect TeV muon neutrinos from Galactic microquasars. For each known microquasar we compute the number of detectable events, together with the atmospheric neutrino and muon background events. We also discuss the detector sensitivity to neutrino fluxes expected from known microquasars, optimizing the event selection also to reject the background; the number of events surviving the event selection are given.

  7. Positron annihilation signatures associated with the outburst of the microquasar V404 Cygni

    CERN Document Server

    Siegert, Thomas; Greiner, Jochen; Krause, Martin G H; Beloborodov, Andrei M; Bel, Marion Cadolle; Guglielmetti, Fabrizia; Rodriguez, Jerome; Strong, Andrew W; Zhang, Xiaoling

    2016-01-01

    Microquasars are stellar-mass black holes accreting matter from a companion star and ejecting plasma jets at almost the speed of light. They are analogues of quasars that contain supermassive black holes of $10^6$ to $10^{10}$ solar masses. Accretion in microquasars varies on much shorter timescales than in quasars and occasionally produces exceptionally bright X-ray flares. How the flares are produced is unclear, as is the mechanism for launching the relativistic jets and their composition. An emission line near 511 kiloelectronvolts has long been sought in the emission spectrum of microquasars as evidence for the expected electron-positron plasma. Transient high-energy spectral features have been reported in two objects, but their positron interpretation remains contentious. Here we report observations of $\\gamma$-ray emission from the microquasar V404 Cygni during a recent period of strong flaring activity. The emission spectrum around 511 kiloelectronvolts shows clear signatures of variable positron annih...

  8. RXTE Observations of the Microquasar GRS 1915+105

    CERN Document Server

    Rodríguez, J; Tagger, M

    2001-01-01

    We analyse a set of three RXTE Target of Opportunity observations of the Galactic microquasar GRS 1915+105, observed in April 2000. We concentrate on the timing properties of the source, and examine the properties of a low frequency QPO, with its harmonic, in several energy ranges. The source was found in two different states of the spectro/temporal classification of Belloni et al. (2000), and exhibited in the three observations a strong, low frequency QPO together with a strong harmonic. We discuss the properties of the QPO, of its harmonic and of their spectral behaviour in the framework of the Accretion Ejection Instability (AEI) (Tagger & Pellat, 1999; Varni\\`ere, Rodriguez & Tagger, 2001; Rodriguez et al., 2001).

  9. Jet Formation and Dynamics: Comparison of Quasars and Microquasars

    Science.gov (United States)

    Kundt, Wolfgang

    Quasars and Microquasars share the following properties: (i) They have similar, elongated morphologies - reminiscent of being driven by supersonic beams - consisting of cores, knots, and heads, with jet-opening angles rams the jet channels and blows the cocoons (subsonically) after having been stalled in a head. The supersonic jets form on passing a central deLaval nozzle, first proposed by Blandford and Rees in 1974, which forms naturally due to the huge density contrast of 10^-8.3T_4 with respect to the ambient medium (of temperature T, T_4:=T/10^4 K). Beam stability and narrowness are likewise guaranteed by the density contrast (of jet fluid and CSM). Observed are both the (thermal) radiation of the rammed channel-wall material, and the synchrotron radiation of the deflected beam particles.

  10. Veritas observations of the microquasar Cygnus X-3

    Energy Technology Data Exchange (ETDEWEB)

    Archambault, S. [Physics Department, McGill University, Montreal, QC H3A 2T8 (Canada); Beilicke, M.; Buckley, J. H.; Bugaev, V. [Department of Physics, Washington University, St. Louis, MO 63130 (United States); Benbow, W.; Cerruti, M. [Fred Lawrence Whipple Observatory, Harvard-Smithsonian Center for Astrophysics, Amado, AZ 85645 (United States); Berger, K. [Department of Physics and Astronomy and the Bartol Research Institute, University of Delaware, Newark, DE 19716 (United States); Bird, R. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Bouvier, A. [Santa Cruz Institute for Particle Physics and Department of Physics, University of California, Santa Cruz, CA 95064 (United States); Byrum, K. [Argonne National Laboratory, 9700 S. Cass Avenue, Argonne, IL 60439 (United States); Chen, X.; Federici, S. [Institute of Physics and Astronomy, University of Potsdam, D-14476 Potsdam-Golm (Germany); Ciupik, L. [Astronomy Department, Adler Planetarium and Astronomy Museum, Chicago, IL 60605 (United States); Connolly, M. P. [School of Physics, National University of Ireland Galway, University Road, Galway (Ireland); Cui, W.; Feng, Q. [Department of Physics, Purdue University, West Lafayette, IN 47907 (United States); Duke, C. [Department of Physics, Grinnell College, Grinnell, IA 50112-1690 (United States); Dumm, J. [School of Physics and Astronomy, University of Minnesota, Minneapolis, MN 55455 (United States); Errando, M. [Department of Physics and Astronomy, Barnard College, Columbia University, NY 10027 (United States); Falcone, A., E-mail: avarlott@purdue.edu, E-mail: cui@purdue.edu [Department of Astronomy and Astrophysics, 525 Davey Lab, Pennsylvania State University, University Park, PA 16802 (United States); Collaboration: VERITAS Collaboration) and; Smithsonian Astrophysical Observatory; and others

    2013-12-20

    We report results from TeV gamma-ray observations of the microquasar Cygnus X-3. The observations were made with the Very Energetic Radiation Imaging Telescope Array System (VERITAS) over a time period from 2007 June 11 to 2011 November 28. VERITAS is most sensitive to gamma rays at energies between 85 GeV and 30 TeV. The effective exposure time amounts to a total of about 44 hr, with the observations covering six distinct radio/X-ray states of the object. No significant TeV gamma-ray emission was detected in any of the states, nor with all observations combined. The lack of a positive signal, especially in the states where GeV gamma rays were detected, places constraints on TeV gamma-ray production in Cygnus X-3. We discuss the implications of the results.

  11. NuSTAR and integral observations of a low/hard state of 1E1740.7-2942

    Energy Technology Data Exchange (ETDEWEB)

    Natalucci, Lorenzo; Bazzano, Angela; Fiocchi, Mariateresa; Ubertini, Pietro [Istituto di Astrofisica e Planetologia Spaziali, INAF, via del Fosso del Cavaliere, I-00133 Roma (Italy); Tomsick, John A.; Boggs, Steven E.; Craig, William W.; Krivonos, Roman [Space Sciences Laboratory, 7 Gauss Way, University of California, Berkeley, CA 94720-7450 (United States); Smith, David M. [Physics Department and Santa Cruz Institute for Particle Physics, University of California, Santa Cruz, CA 95064 (United States); Bachetti, Matteo; Barret, Didier [Université de Toulouse, UPS-OMP, IRAP, Toulouse (France); Christensen, Finn E. [DTU Space, National Space Institute, Technical University of Denmark, Elektrovej 327, DK-2800 Lyngby (Denmark); Fürst, Felix; Grefenstette, Brian W.; Harrison, Fiona A. [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Hailey, Charles J. [Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Kuulkers, Erik [European Space Astronomy Centre (ESA/ESAC), Science Operations Department, E-28691 Villanueva de la Cañada (Madrid) (Spain); Miller, Jon M. [Department of Astronomy, University of Michigan, 500 Church Street, Ann Arbor, MI 48109 (United States); Pottschmidt, Katja [CRESST and NASA Goddard Space Flight Center, Astrophysics Science Division, Code 661, Greenbelt, MD 20771 (United States); Stern, Daniel, E-mail: lorenzo.natalucci@iaps.inaf.it [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); and others

    2014-01-01

    The microquasar 1E1740.7-2942, also known as the 'Great Annihilator,' was observed by NuSTAR in the summer of 2012. We have analyzed in detail two observations taken ∼2 weeks apart, for which we measure hard and smooth spectra typical of the low/hard state. A few weeks later the source flux declined significantly. Nearly simultaneous coverage by INTEGRAL is available from its Galactic Center monitoring campaign lasting ∼2.5 months. These data probe the hard state spectrum from 1E1740.7-2942 before the flux decline. We find good agreement between the spectra taken with IBIS/ISGRI and NuSTAR, with the measurements being compatible with a change in flux with no spectral variability. We present a detailed analysis of the NuSTAR spectral and timing data and upper limits for reflection of the high energy emission. We show that the high energy spectrum of this X-ray binary is well described by thermal Comptonization.

  12. NuSTAR and INTEGRAL observations of a low/hard state of 1E1740.7-2942

    CERN Document Server

    Natalucci, Lorenzo; Bazzano, Angela; Smith, David M; Bachetti, Matteo; Barret, Didier; Boggs, Steven E; Christensen, Finn E; Craig, William W; Fiocchi, Mariateresa; Fuerst, Felix; Grefenstette, Brian W; Hailey, Charles J; Harrison, Fiona A; Krivonos, Roman; Kuulkers, Erik; Miller, Jon M; Pottschmidt, Katja; Stern, Daniel; Ubertini, Pietro; Walton, Dominic J; Zhang, William W

    2013-01-01

    The microquasar 1E1740.7-2942, also known as the "Great Annihilator", was observed by NuSTAR in the Summer of 2012. We have analyzed in detail two observations taken ~2 weeks apart, for which we measure hard and smooth spectra typical of the low/hard state. A few weeks later the source flux declined significantly. Nearly simultaneous coverage by INTEGRAL is available from its Galactic Center monitoring campaign lasting ~2.5 months. These data probe the hard state spectrum from 1E1740.7-2942 before the flux decline. We find good agreement between the spectra taken with IBIS/ISGRI and NuSTAR, with the measurements being compatible with a change in flux with no spectral variability. We present a detailed analysis of the NuSTAR spectral and timing data and upper limits for reflection of the high energy emission. We show that the high energy spectrum of this X-ray binary is well described by thermal Comptonization.

  13. Optical spectroscopy of the microquasar GRS 1758-258: a possible intermediate mass system?

    CERN Document Server

    Martí, Josep; Muñoz-Arjonilla, Álvaro J

    2016-01-01

    Context. GRS 1758-258 is one of two prototypical microquasars towards the Galactic Center direction discovered almost a quarter of a century ago. The system remains poorly studied in the optical domain due to its counterpart being a very faint and absorbed target in a crowded region of the sky. Aims. Our aim is to investigate GRS 1758-258 in order to shed light on the nature of the stellar binary components. In particular, the main physical parameters of the donor star, such as the mass or the spectral type, are not yet well constrained. Methods. GRS 1758-258 has remained so far elusive to optical spectroscopy owing to its observational difficulties. Here, we use this traditional tool of stellar astronomy at low spectral resolution with a 10 m class telescope and a long slit spectrograph. Results. An improved spectrum is obtained as compared to previous work. The quality of the data does not allow the detection of emission or absorption features but, nevertheless, we manage to partially achieve our aims compa...

  14. Long-term multi-frequency monitoring of microquasars

    CERN Document Server

    Trushkin, Sergei A; Bursov, Nikolaj N

    2008-01-01

    We discuss the results of the radio studies of the X-ray binaries with relativistic jets. We carried out a multi-frequency (1-30 GHz) daily monitoring of the radio flux variability of the microquasars SS433, GRS1915+105, and Cyg X-3 with the RATAN-600 radio telescope during the recent sets from 1 November 2006 to 31 August 2008. From December 2005 radio emission of Cyg X-3 after four years relatively quiescent levels (100-200 mJy) dropped down to $\\sim$20 mJy, and then we detected a lot of bright radio flaring events (1-20 Jy) followed the very variable (from 0 to 0.5 crabs) 15-50 keV X-ray emission, which was monitored in the Swift/BAT ASM program. Again from December 2007 to March 2008 we have daily measured almost quiescent fluxes from Cyg X-3 but in April 2008 a bright radio flare with clear synchrotron self-absorption was detected. We detected several bright short-term flares from GRS 1915+105 which could be associated with active soft X-ray events. In intense measurements of SS433 fluxes (often mutually...

  15. Recent Radio Monitoring of Microquasars with RATAN-600 Radio Telescope

    CERN Document Server

    Trushkin, S A; Kotani, T; Nizhelskij, N A; Namiki, M; Tsuboi, M; Voitsik, P A

    2007-01-01

    We report about the multi-frequency (1-30 GHz) daily monitoring of the radio flux variability of the three microquasars: SS433, GRS1915+105 and Cyg X-3 during the period from September 2005 to May 2006. 1. We detected clear correlation of the flaring radio fluxes and X-rays 'spikes' at 2-12 keV emission detected in RXTE ASM from GRS1915+105 during eight relatively bright (200-600 mJy) radio flares in October 2005. The 1-22 GHz spectra of these flares in maximum were optically thick at frequencies lower 2.3 GHz and optically thin at the higher frequencies. During the radio flares the spectra of the X-ray spikes become softer than those of the quiescent phase. Thus these data indicated the transitions from very high/hard states to high/soft ones during which massive ejections are probably happened. These ejections are visible as the detected radio flares. 2. After of the quiescent radio emission we have detected a drop down of the fluxes (~20 mJy) from Cyg X-3. That is a sign of the following bright flare. Inde...

  16. On hadronic beam models for quasars and microquasars

    CERN Document Server

    Torres, Diego F

    2011-01-01

    Most of the hadronic jet models for quasars (QSOs) and microquasars (MQs) found in literature represent beams of particles (e.g. protons). These particles interact with the matter in the stellar wind of the companion star in the system or with crossing clouds, generating gamma-rays via proton-proton processes. Our aim is to derive the particle distribution in the jet as seen by the observer, so that proper computation of the $\\gamma$-ray and neutrino yields can be done. We use relativistic invariants to obtain the transformed expressions in the case of a power-law and power-law with a cutoff particle distribution in the beam. We compare with previous expressions used earlier in the literature. We show that formerly used expressions for the particle distributions in the beam as seen by the observer are in error, differences being strongly dependent on the viewing angle. For example, for $\\Gamma =10$ ($\\Gamma$ is the Lorentz factor of the blob) and angles larger than $\\sim 20^o$, the earlier-used calculation en...

  17. Jet-induced star formation by a microquasar

    CERN Document Server

    Mirabel, I F; Rodriguez, L F; Sauvage, M

    2014-01-01

    Theoretical and observational work show that jets from AGN can trigger star formation. However, in the Milky Way the first -and so far- only clear case of relativistic jets inducing star formation has been found in the surroundings of the microquasar GRS 1915+105. Here we summarize the multiwavelength observations of two compact star formation IRAS sources axisymmetrically located and aligned with the position angle of the sub-arcsec relativistic jets from the stellar black hole binary GRS 1915+105 (Mirabel & Rodriguez 1994). The observations of these two star forming regions at centimeter (Rodriguez & Mirabel 1998), millimeter and infrared (Chaty et al. 2001) wavelengths had suggested -despite the large uncertainties in the distances a decade ago- that the jets from GRS 1915+105 are triggering along the radio jet axis the formation of massive stars in a radio lobe of bow shock structure. Recently, Reid et al.(2014) found that the jet source and the IRAS sources are at the same distance, enhancing the...

  18. Optical spectroscopy of the microquasar GRS 1758-258: a possible intermediate mass system?

    Science.gov (United States)

    Martí, Josep; Luque-Escamilla, Pedro L.; Muñoz-Arjonilla, Álvaro J.

    2016-11-01

    Context. GRS 1758-258 is one of two prototypical microquasars towards the Galactic center direction discovered almost a quarter of a century ago. The system remains poorly studied in the optical domain due to its counterpart being a very faint and absorbed target in a crowded region of the sky. Aims: Our aim is to investigate GRS 1758-258 in order to shed light on the nature of the stellar binary components. In particular, the main physical parameters of the donor star, such as the mass or the spectral type, are not yet well constrained. Methods: GRS 1758-258 has remained so far elusive to optical spectroscopy owing to its observational difficulties. Here, we use this traditional tool of stellar astronomy at low spectral resolution with a 10 m class telescope and a long slit spectrograph. Results: An improved spectrum is obtained as compared to previous work. The quality of the data does not allow the detection of emission or absorption features but, nevertheless, we manage to partially achieve our aims comparing the de-reddened continuum with the spectral energy distribution expected from an irradiated disc model and different donor star templates. Conclusions: We tentatively propose that GRS 1758-258 does not host a giant star companion. Instead, a main sequence star with mid-A spectral type appears to better agree with our data. The main impacts of this finding are the possibility that we are dealing with an intermediate mass system and, in this case, the prediction of an orbital period significantly shorter than previously proposed.

  19. Stellar Pair Shot Out from Its Birthplace: Astronomers Link Moving Microquasar to Star Cluster

    Science.gov (United States)

    2004-07-01

    Astronomers studying data from the National Science Foundation's Very Long Baseline Array (VLBA) and other telescopes have concluded that a binary pair of stars forming an energetic microquasar was blasted out of the cluster in which it was born by a supernova explosion some 1.7 million years ago. This is the first time that a fast-moving stellar pair has been tracked back to a specific star cluster. Microquasar and Star Cluster The microquasar, circled in red, and stars of the cluster (yellow) in visible-light image. Green arrow indicates microquasar's motion in sky and yellow arrow indicates star cluster's motion. Red arrow indicates microquasar's motion relative to (away from) star cluster. CREDIT: NRAO/AUI/NSF (Click on Image for Larger Version) The scientists analyzed numerous observations of a microquasar called LSI +61 303, and concluded that it is moving away from a star cluster named IC 1805 at nearly 17 miles per second. A microquasar is a pair of stars, one of which is either a dense neutron star or a black hole, in which material sucked from a "normal" star forms a rapidly-rotating disk around the denser object. The disk becomes so hot it emits X-rays, and also spits out "jets" of subatomic particles at nearly the speed of light. "In this case, both the microquasar and the star cluster are about 7,500 light-years from Earth and the characteristics of the 'normal' star in the microquasar match those of the other stars in the cluster, so we feel confident that the microquasar was shot out from a birthplace in this cluster," said Felix Mirabel, an astrophysicist at the Institute for Astronomy and Space Physics of Argentina and French Atomic Energy Commission. Mirabel worked with Irapuan Rodrigues, of the Federal University of Rio Grande do Sul, Brazil, and Qingzhong Liu of the Purple Mountain Observatory in Nanjing, China. The astronomers reported their results in the August 1 issue of the scientific journal Astronomy & Astrophysics. Many neutron stars

  20. Probability 1/e

    Science.gov (United States)

    Koo, Reginald; Jones, Martin L.

    2011-01-01

    Quite a number of interesting problems in probability feature an event with probability equal to 1/e. This article discusses three such problems and attempts to explain why this probability occurs with such frequency.

  1. Main: 1E1E [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1E トウモロコシ Corn Zea mays L. Beta-Glucosidase, Chloroplast Precursor Name=Glu1; Zea...TDDAYASQEVNGPDGKPIGPPMGNPWIYMYPEGLKDLLMIMKNKYGNPPIYITENGIGDVDTKETPLPMEAALNDYKRLDYIQRHIATLKESIDLGSNVQGYFAWSLLDNFEWFAGFTERYGIVYVDRNNNCTRYMKESAKWLKEFNTAKKPSKKILTPA corn_1E1E.jpg ...

  2. Non-linear variability in microquasars in relation with the winds from their accretion disks

    CERN Document Server

    Janiuk, Agnieszka; Sukova, Petra; Capitanio, Fiamma; Bianchi, Stefano; Kowalski, Wojtek

    2016-01-01

    The microquasar IGR J17091, which is the recently discovered analogue of the well known source GRS 1915+105, exhibits quasi-periodic outbursts, with a period of 5-70 seconds, and regular amplitudes, referred to as "heartbeat state". We argue that these states are plausibly explained by accretion disk instability, driven by the dominant radiation pressure. Using our GLobal Accretion DIsk Simulation hydrodynamical code, we model these outbursts quantitatively. We also find a correlation between the presence of massive outflows launched from the accretion disk and the stabilization of its oscillations. We verify the theoretical predictions with the available timing and spectral observations. Furthermore, we postulate that the underlying non-linear differential equations that govern the evolution of an accretion disk are responsible for the variability pattern of several other microquasars, including XTE J1550-564, GX 339-4, and GRO J1655-40. This is based on the signatures of deterministic chaos in the observed ...

  3. A Search for Time Dependent Neutrino Emission from Microquasars with the ANTARES Telescope

    CERN Document Server

    Adrián-Martínez, S; André, M; Anghinolfi, M; Anton, G; Ardid, M; Astraatmadja, T; Aubert, J -J; Baret, B; Barrios, J; Basa, S; Bertin, V; Biagi, S; Bigongiari, C; Bogazzi, C; Bouhou, B; Bouwhuis, M C; Brunner, J; Busto, J; Capone, A; Caramete, L; Cârloganu, C; Carr, J; Cecchini, S; Charif, Z; Charvis, P; Chiarusi, T; Circella, M; Coniglione, R; Core, L; Costantini, H; Coyle, P; Creusot, A; De Rosa, G; Dekeyser, I; Deschamps, A; De Bonis, G; Distefano, C; Donzaud, C; Dornic, D; Dorosti, Q; Drouhin, D; Dumas, A; Eberl, T; Elsässer, D; Emanuele, U; Enzenhöfer, A; Ernenwein, J -P; Escoffier, S; Fehn, K; Felis, I; Fermani, P; Folger, F; Fusco, L A; Galatà, S; Gay, P; Geißelsöder, S; Geyer, K; Giordano, V; Gleixner, A; Gómez-González, J P; Graf, K; Guillard, G; van Haren, H; Heijboer, A J; Hello, Y; Hernández-Rey, J J; Herold, B; Hößl, J; Hofestädt, J; James, C W; de Jong, M; Kadler, M; Kalekin, O; Kappes, A; Katz, U; Kooijman, P; Kouchner, A; Kreykenbohm, I; Kulikovskiy, V; Lahmann, R; Lambard, E; Lambard, G; Larosa, G; Lattuada, D; Lefèvre, D; Leonora, E; Loehner, H; Loucatos, S; Mangano, S; Marcelin, M; Margiotta, A; Martínez-Mora, J A; Martini, S; Mathieu, A; Michael, T; Migliozzi, P; Montaruli, T; Müller, C; Neff, M; Nezri, E; Palioselitis, D; Păvălaş, G E; Perrina, C; Piattelli, P; Popa, V; Pradier, T; Racca, C; Riccobene, G; Richter, R; Rivière, C; Robert, A; Roensch, K; Rostovtsev, A; Salda\; Samtleben, D F E; Sánchez-Losa, A; Sanguineti, M; Sapienza, P; Schmid, J; Schnabel, J; Schulte, S; Schüssler, F; Seitz, T; Sieger, C; Spies, A; Spurio, M; Steijger, J J M; Stolarczyk, T; Taiuti, M; Tamburini, C; Tayalati, Y; Trovato, A; Vallage, B; Vallée, C; Van Elewyck, V; Vernin, P; Visser, E; Vivolo, D; Wagner, S; Wilms, J; de Wolf, E; Yatkin, K; Yepes, H; Zornoza, J D; Zúñiga, J

    2014-01-01

    Results are presented on a search for neutrino emission from a sample of six microquasars, based on the data collected by the ANTARES neutrino telescope between 2007 and 2010. By means of appropriate time cuts, the neutrino search has been restricted to the periods when the acceleration of relativistic jets was taking place at the microquasars under study. The time cuts have been chosen using the information from the X-ray telescopes RXTE/ASM and Swift/BAT, and, in one case, the gamma-ray telescope Fermi/LAT. Since none of the searches has produced a statistically significant signal, upper limits on the neutrino fluences are derived and compared to the predictions from theoretical models.

  4. Time-Dependent Synchrotron and Compton Spectra from Jets of Microquasars

    CERN Document Server

    Gupta, S; Dermer, C D; Boettcher, Markus; Dermer, Charles D.; Gupta, Swati

    2006-01-01

    Jet models for the high-energy emission of Galactic X-ray binary sources have regained significant interest with detailed spectral and timing studies of the X-ray emission from microquasars, the recent detection by the HESS collaboration of very-high-energy gamma-rays from the microquasar LS~5039, and the earlier suggestion of jet models for ultraluminous X-ray sources observed in many nearby galaxies. Here we study the synchrotron and Compton signatures of time-dependent electron injection and acceleration, adiabatic and radiative cooling, and different jet geometries in the jets of Galactic microquasars. Synchrotron, synchrotron-self-Compton, and external-Compton radiation processes with soft photons provided by the companion star and the accretion disk are treated. An analytical solution is presented to the electron kinetic equation for general power-law geometries of the jets for Compton scattering in the Thomson regime. We pay particular attention to predictions concerning the rapid flux and spectral var...

  5. Accretion disk winds as the jet suppression mechanism in the microquasar GRS 1915+105.

    Science.gov (United States)

    Neilsen, Joseph; Lee, Julia C

    2009-03-26

    Stellar-mass black holes with relativistic jets, also known as microquasars, mimic the behaviour of quasars and active galactic nuclei. Because timescales around stellar-mass black holes are orders of magnitude smaller than those around more distant supermassive black holes, microquasars are ideal nearby 'laboratories' for studying the evolution of accretion disks and jet formation in black-hole systems. Whereas studies of black holes have revealed a complex array of accretion activity, the mechanisms that trigger and suppress jet formation remain a mystery. Here we report the presence of a broad emission line in the faint, hard states and narrow absorption lines in the bright, soft states of the microquasar GRS 1915+105. ('Hard' and 'soft' denote the character of the emitted X-rays.) Because the hard states exhibit prominent radio jets, we argue that the broad emission line arises when the jet illuminates the inner accretion disk. The jet is weak or absent during the soft states, and we show that the absorption lines originate when the powerful radiation field around the black hole drives a hot wind off the accretion disk. Our analysis shows that this wind carries enough mass away from the disk to halt the flow of matter into the radio jet.

  6. Blazing trails: Microquasars as head-tail sources and the seeding of magnetized plasma into the ISM

    CERN Document Server

    Heinz, S; Sunyaev, R A; Fender, R P

    2008-01-01

    We discuss the dynamics of microquasar jets in the interstellar medium, with specific focus on the effects of the X-ray binaries' space velocity with respect to the local Galactic standard of rest. We argue that, during late stages in the evolution of large scale radio nebulae around microquasars, the ram pressure of the interstellar medium due to the microquasar's space velocity becomes important and that microquasars with high velocities form the Galactic equivalent of extragalactic head-tail sources, i.e., that they leave behind trails of stripped radio plasma. Because of their higher space velocities, low-mass X-ray binaries are more likely to leave trails than high-mass X-ray binaries. We show that the volume of radio plasma released by microquasars over the history of the Galaxy is comparable to the disk volume and argue that a fraction of a few percent of the radio plasma left behind by the X-ray binary is likely mixed with the neutral phases of the ISM before the plasma is removed from the disk by buo...

  7. Ejection of the corona at State transitions: a common behaviour in microquasars?

    CERN Document Server

    Prat, Lionel

    2009-01-01

    The onset of most microquasar outbursts is characterized by a state transition between a Low/Hard State (LHS) and a High/Soft State (HSS). Besides drastic spectral and timing changes, this transition often shows a discrete ejection event detectable in the radio range. However, the exact nature of the ejected material and the mechanisms that give birth to these phenomena are yet to be unraveled. Recent simultaneous radio and X-ray observations on several sources point to a coronal nature of the ejected material. In the cases of GRS 1915+105, XTE J1550-564, and the 2002 outburst of GX 339-4, the flux of the Compton component decreases sharply just before an ejection is detected in the radio range. Finally, in the case of H1743-322, drastic physical changes occurred in the corona just before the state transition, compatible with the disappearance of part of this medium. Thus, the behaviour of at least 4 microquasars points in the direction of an ejection of the corona at the state transition, feature that is yet...

  8. Leptonic/hadronic models for electromagnetic emission in microquasars: the case of GX 339-4

    CERN Document Server

    Vila, Gabriela S

    2010-01-01

    We present a general self-consistent lepto/hadronic jet model for the non-thermal electromagnetic emission of microquasars. The model is applied to the low-mass microquasar (LMMQ) GX 339-4 and predicts its high-energy features. We assume that both leptons and hadrons are accelerated up to relativistic energies by diffusive shock acceleration, and calculate their contribution to the electromagnetic spectrum through all main radiative processes. The radiative contribution of secondary particles (pions, muons and electron-positron pairs) is included. We use a set of simultaneous observations in radio and X-rays to constrain the model parameters and find the best fit to the data. We obtain different spectral energy distributions that can explain the observations, and make predictions for the high-energy emission. Observations with gamma-ray instruments like Fermi can be used to test the model and determine the proton content of the jets. Finally, we estimate the positron injection in the surrounding medium. Our f...

  9. Modelling Oscillations in the Jet Emission from Microquasar GRS 1915+105

    CERN Document Server

    Collins, R S; Cox, S J; Collins, Ross S.; Kaiser, Christian R.; Cox, Simon J.

    2003-01-01

    The variability in the infrared to millimetre emission from microquasar GRS 1915+105 is believed to be dominated by the system's relativistic jet. In this paper we develop a time-dependent version of the Blandford & Konigl (1979) jet emission model and apply it to the oscillations in the infrared and millimetre emission from GRS 1915+105 observed by Fender & Pooley (2000). The resulting model provides a reasonable description of the observed flux oscillations from GRS 1915+105. From a fit of the observed time lag between the flux peaks in the infrared and millimetre emission together with the flux normalisation we were able to determine the model parameters for the GRS 1915+105 jet. We find that to achieve the observed flux levels with the model requires an unphysically large electron density within the jet. We therefore conclude that the Blandford & Konigl (1979) model cannot explain these observations, either because it does not provide the correct description of the emission from microquasar je...

  10. Spectrum of jet emitting disc: Application to microquasar XTE J1118+480

    CERN Document Server

    Zhang, Jian-Fu

    2013-01-01

    Under the framework of the magnetized accretion ejection structures, we analyze the energy balance properties, and study the spectral energy distributions (SEDs) of the Jet Emitting Disc (JED) model for black hole X-ray transients. Various radiative processes are considered, i.e. synchrotron, bremsstrahlung, and their Comptonizations, and external Comptonization of radiation from outer thin disc. With these cooling terms taken into account, we solve the thermal equilibrium equation self-consistently and find three solutions, of which the cold and the hot solutions are stable. Subsequently we investigate the theoretical SEDs for these two stable solutions.We find the hot JED model can naturally explain the spectra of the Galactic microquasars in their hard states. As an example, we apply this model to the case of XTE J1118+480.

  11. MASTER optical polarization variability detection in the Microquasar V404 Cyg/GS2023+33

    CERN Document Server

    Lipunov, Vladimir M; Kornilov, V; Krushinskiy, V; Vlasenko, D; Tiurina, N; Balanutsa, P; Kuznetsov, A; Budnev, N; Gress, O; Tlatov, A; Lopez, R Rebolo; Serra-Ricart, M; Buckley, D A H; Israelian, G; Lodieu, N; Ivanov, K; Yazev, S; Sergienko, Yu; Gabovich, A; Yurkov, V; Levato, H; Saffe, C; Podesta, R; Mallamaci, C; Lopez, C

    2016-01-01

    On 2015 June 15 the Swift space observatory discovered that the Galactic black hole candidate V404 Cyg was undergoing another active X-ray phase, after 25 years of inactivity (Barthelmy et al. 2015). Twelve telescopes of the MASTER Global Robotic Net located at six sites across four continents were the first ground based observatories to start optical monitoring of the microquasar after its gamma-ray wakeup at 18h 34m 09s U.T. on 2015 June 15 (Lipunov et al. 2015). In this paper we report, for the first time, the discovery of variable optical linear polarization, changing by 4-6% over a timescale of approximately 1 h, on two different epochs. We can conclude that the additional variable polarization arisies from the relativistic jet generated by the black hole in V404Cyg. The polarization variability correlates with optical brightness changes, increasing when the flux decreases.

  12. Enhanced high-energy gamma-ray emission from the microquasar Cygnus X-3 detected by Fermi/LAT

    Science.gov (United States)

    Loh, Alan; Corbel, Stephane

    2017-02-01

    Following the recent decrease of the hard X-ray emission from the high-mass X-ray binary Cygnus X-3 as seen by the Swift/Burst Alert Telescope (https://swift.gsfc.nasa.gov/results/transients/CygX-3/), the Large Area Telescope (LAT), one of the two instruments on the Fermi Gamma-ray Space Telescope, has observed significant gamma-ray emission originating from the microquasar.

  13. What do we understand from multi-frequency monitoring of microquasars?

    CERN Document Server

    Trushkin, S A; Nizhelskij, N A; Majorova, E K; Voitsik, P A

    2006-01-01

    We discuss the results of the monitoring programs of the X-ray binaries with relativistic jets studies. We carried out a multi-frequency (1-30 GHz) daily monitoring of the radio flux variability of the microquasars SS433, GRS1915+105, V4641 Sgr and Cyg X-3 with RATAN-600 radio telescope during the recent sets in 2002-2006. We detected a lot of bright short-time flares from GRS 1915+105 which could be associated with active X-ray events. In 2004 we have detected two flares from V4641 Sgr, which followed after recurrent X-ray activity of the transient. From September 2005 to May 2006 and then in July we have daily measured flux densities from Cyg X-3. In January 2006 we detected a drop down of its quiescent fluxes (from 100 to ~20 mJy), then the 1Jy-flare was detected on 2 February 2006 after 18 days of quenched radio emission. The daily spectra of the flare in the maximum were flat from 2 to 110 GHz, using the quasi-simultaneous observations at 110 GHz with the RT45m telescope and the NMA millimeter array of t...

  14. High-mass microquasars and low-latitude gamma-ray sources

    CERN Document Server

    Bosch-Ramon, V; Paredes, J M

    2004-01-01

    Population studies of unidentified EGRET sources suggest that there exist at least three different populations of galactic gamma-ray sources. One of these populations is formed by young objects distributed along the galactic plane with a strong concentration toward the inner spiral arms of the Galaxy. Variability, spectral and correlation analysis indicate that this population is not homogeneous. In particular, there is a subgroup of sources that display clear variability in their gamma-ray fluxes on timescales from days to months. Following the proposal by Kaufman Bernad\\'o et al. (2002), we suggest that this group of sources might be high-mass microquasars, i.e. accreting black holes or neutron stars with relativistic jets and early-type stellar companions. We present detailed inhomogeneous models for the gamma-ray emission of these systems that include both external and synchrotron self-Compton interactions. We have included effects of interactions between the jet and all external photon fields to which it...

  15. RXTE observations of Galactic microquasar XTE J1748-288 during its 1998 outburst

    CERN Document Server

    Revnivtsev, M G; Borozdin, K N

    1999-01-01

    We present an analysis of the RXTE observations of recently discovered Galactic microquasar XTE J1748-288 during its 1998 outburst. The spectral evolution of the source during the outburst can be considered as a sequence of three qualitatively distinct states. During the first observations corresponding to the maximum of X-ray flux the spectrum of the source was formed by the sum of the dominating hard power law component and soft thermal component, which can be described by the model of multicolor disk emission. Hard component contributed >=80% to the X-ray luminosity in 3-25 keV energy band. This spectral shape is quite different from spectra of high and low spectral states typical for Galactic black hole systems. Later on, as the X-ray source faded, its energy spectrum qualitatively changed, and first high, then low standard states have been observed. In correlation with the spectral changes the character of fast variability have changed dramatically also. Initially the power density spectrum was formed by...

  16. Radio lobes and X-ray hot spots in the microquasar S26

    CERN Document Server

    Soria, Roberto; Broderick, Jess W; Corbel, Stephane; Motch, Christian

    2010-01-01

    We have studied the structure and energetics of the powerful microquasar/shock-ionized nebula S26 in NGC 7793, with particular focus on its radio and X-ray properties. Using the Australia Telescope Compact Array, we have resolved for the first time the radio lobe structure and mapped the spectral index of the radio cocoon. The steep spectral index of the radio lobes is consistent with optically-thin synchrotron emission; outside the lobes, the spectral index is flatter, suggesting an additional contribution from free-free emission, and perhaps ongoing ejections near the core. The radio core is not detected, while the X-ray core has a 0.3-8 keV luminosity ~6 x 10^{36} erg/s. The size of the radio cocoon matches that seen in the optical emission lines and diffuse soft X-ray emission. The total 5.5-GHz flux of cocoon and lobes is ~2.1 mJy, which at the assumed distance of 3.9 Mpc corresponds to about 3 times the luminosity of Cas A. The total 9.0-GHz flux is ~1.6 mJy. The X-ray hot spots (combined 0.3-8 keV lumi...

  17. A Resonantly-Excited Disk-Oscillation Model of High-Frequency QPOs of Microquasars

    CERN Document Server

    Kato, Shoji

    2012-01-01

    A possible model of twin high-frequency QPOs (HF QPOs) of microquasars is examined. The disk is assumed to have global magnetic fields and to be deformed with a two-armed pattern. In this deformed disk, set of a two-armed ($m=2$) vertical p-mode oscillation and an axisymmetric ($m=0$) g-mode oscillation are considered. They resonantly interact through the disk deformation when their frequencies are the same. This resonant interaction amplifies the set of the above oscillations in the case where these two oscillations have wave energies of opposite signs. These oscillations are assumed to be excited most efficiently in the case where the radial group velocities of these two waves vanish at the same place. The above set of oscillations is not unique, depending on the node number, $n$, of oscillations in the vertical direction. We consider that the basic two sets of oscillations correspond to the twin QPOs. The frequencies of these oscillations depend on disk parameters such as strength of magnetic fields. For o...

  18. A Time Dependent Leptonic Model for Microquasar Jets: Application to LSI 61 303

    CERN Document Server

    Gupta, S; Gupta, Swati; Boettcher, Markus

    2006-01-01

    he Galactic high-mass X-ray binary and jet source (microquasar) LSI +61 303 has recently been detected at TeV gamma-ray energies by the MAGIC telescope. We have applied a time-dependent leptonic jet model to the broadband spectral energy distribution and orbital modulation of the very high energy gamma-ray emission of this source. Our model takes into account time dependent electron injection and acceleration, and the adiabatic and radiative cooling of non-thermal electrons. It includes synchrotron, inverse Compton (with seed photons from the companion star and the accretion disk), and synchrotron self-Compton emission, as well as gamma-gamma absorption of gamma-rays by starlight photons. The model can successfully reproduce the available multiwavelength observational data. Our best fit to the SED indicates that a magnetic field of B_0 ~ 5 X 10^3 G at ~ 10^3 R_g is required, and electrons need to be accelerated out to TeV energies (gamma_2 = 10^6) with a nonthermal injection spectrum with a spectral index of ...

  19. The 2006 Radio Outburst of a Microquasar Cyg X-3: Observation and Data

    CERN Document Server

    Tsuboi, M; Kuno, N; Nakanishi, K; Sawada, T; Umemoto, T; Trushkin, S A; Kotani, T; Kawai, N; Kurono, Y; Handa, T; Kohno, K; Tsukagoshi, T; Kameya, O; Kobayashi, H; Fujisawa, K; Doi, A; Omodaka, T; Takaba, H; Sudou, H; Wakamatsu, K; Koyama, Y; Kawai, E; Mochizuki, N; Murata, Y

    2007-01-01

    We present the results of the multi-frequency observations of radio outburst of the microquasar Cyg X-3 in February and March 2006 with the Nobeyama 45-m telescope, the Nobeyama Millimeter Array, and the Yamaguchi 32-m telescope. Since the prediction of a flare by RATAN-600, the source has been monitored from Jan 27 (UT) with these radio telescopes. At the eighteenth day after the quench of the activity, successive flares exceeding 1 Jy were observed successfully. The time scale of the variability in the active phase is presumably shorter in higher frequency bands. We also present the result of a follow-up VLBI observation at 8.4 GHz with the Japanese VLBI Network (JVN) 2.6 days after the first rise. The VLBI image exhibits a single core with a size of <8 mas (80 AU). The observed image was almost stable, although the core showed rapid variation in flux density. No jet structure was seen at a sensitivity of $T_b = 7.5\\times 10^5$ K.

  20. Multifrequency Observations of the Galactic Microquasars GRS1915+105 and GROJ1655-40

    CERN Document Server

    Remillard, R A; McClintock, J E; Bailyn, C D; Orosz, J A; Greiner, J; Remillard, Ronald A.; Morgan, Edward H.; Clintock, Jeffrey E. Mc; Bailyn, Charles D.; Orosz, Jerome A.; Greiner, Jochen

    1998-01-01

    The two galactic `microquasars' with superluminal radio jets have been quite active during 1996, generatinga variety of studies involving both NASA and ground-based observatories. GRS~1915+105 has displayed dramatic accretion instability in observations with RXTE, revealing X-ray light curves and emission states unlike anything previously seen. Variable QPOs in the range of 0.07--10 Hz have been monitored with the capability to track the individual oscillations. The QPO amplitude is as high as 40% of the mean flux, while both amplitude and phase lag increase with photon energy. The results imply a direct link between the QPO mechanism and the origin of the energetic electrons believed to radiate the X-ray power-law component. GRS1915+105 also displays a transient yet stationary QPO at 67 Hz. The other source, GRO J1655-40, is an optically established black hole binary. Recent optical reports include an excellent model for the binary inclination and masses, while an optical precursor to the April 1996 X-ray ou...

  1. NuSTAR and INTEGRAL observations of a low/hard state of 1E1740.7-2942

    DEFF Research Database (Denmark)

    Natalucci, Lorenzo; Tomsick, John A.; Bazzano, Angela

    2014-01-01

    The microquasar 1E1740.7-2942, also known as the "Great Annihilator", was observed by NuSTAR in the Summer of 2012. We have analyzed in detail two observations taken ~2 weeks apart, for which we measure hard and smooth spectra typical of the low/hard state. A few weeks later the source flux......STAR, with the measurements being compatible with a change in flux with no spectral variability. We present a detailed analysis of the NuSTAR spectral and timing data and upper limits for reflection of the high energy emission. We show that the high energy spectrum of this X-ray binary is well described by thermal...

  2. HESS upper limits on very high energy gamma-ray emission from the microquasar GRS 1915+105

    Science.gov (United States)

    H.E.S.S. Collaboration; Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Barres de Almeida, U.; Bazer-Bachi, A. R.; Becherini, Y.; Behera, B.; Bernlöhr, K.; Bochow, A.; Boisson, C.; Bolmont, J.; Borrel, V.; Brucker, J.; Brun, F.; Brun, P.; Bulik, T.; Büsching, I.; Boutelier, T.; Chadwick, P. M.; Charbonnier, A.; Chaves, R. C. G.; Cheesebrough, A.; Conrad, J.; Chounet, L.-M.; Clapson, A. C.; Coignet, G.; Dalton, M.; Daniel, M. K.; Davids, I. D.; Degrange, B.; Deil, C.; Dickinson, H. J.; Djannati-Ataï, A.; Domainko, W.; Drury, L. O'c.; Dubois, F.; Dubus, G.; Dyks, J.; Dyrda, M.; Egberts, K.; Eger, P.; Espigat, P.; Fallon, L.; Farnier, C.; Fegan, S.; Feinstein, F.; Fiasson, A.; Förster, A.; Fontaine, G.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Gérard, L.; Gerbig, D.; Giebels, B.; Glicenstein, J. F.; Glück, B.; Goret, P.; Göring, D.; Hauser, M.; Heinz, S.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hoffmann, A.; Hofmann, W.; Hofverberg, P.; Holleran, M.; Hoppe, S.; Horns, D.; Jacholkowska, A.; de Jager, O. C.; Jahn, C.; Jung, I.; Katarzyński, K.; Katz, U.; Kaufmann, S.; Kerschhaggl, M.; Khangulyan, D.; Khélifi, B.; Keogh, D.; Klochkov, D.; Kluźniak, W.; Kneiske, T.; Komin, Nu.; Kosack, K.; Kossakowski, R.; Lamanna, G.; Lenain, J.-P.; Lohse, T.; Marandon, V.; Marcowith, A.; Masbou, J.; Maurin, D.; McComb, T. J. L.; Medina, M. C.; Méhault, J.; Moderski, R.; Moulin, E.; Naumann-Godo, M.; de Naurois, M.; Nedbal, D.; Nekrassov, D.; Nicholas, B.; Niemiec, J.; Nolan, S. J.; Ohm, S.; Olive, J.-F.; de Oña Wilhelmi, E.; Orford, K. J.; Ostrowski, M.; Panter, M.; Paz Arribas, M.; Pedaletti, G.; Pelletier, G.; Petrucci, P.-O.; Pita, S.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raubenheimer, B. C.; Raue, M.; Rayner, S. M.; Reimer, O.; Renaud, M.; de Los Reyes, R.; Rieger, F.; Ripken, J.; Rob, L.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Ruppel, J.; Ryde, F.; Sahakian, V.; Santangelo, A.; Schlickeiser, R.; Schöck, F. M.; Schönwald, A.; Schwanke, U.; Schwarzburg, S.; Schwemmer, S.; Shalchi, A.; Sushch, I.; Sikora, M.; Skilton, J. L.; Sol, H.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Superina, G.; Szostek, A.; Tam, P. H.; Tavernet, J.-P.; Terrier, R.; Tibolla, O.; Tluczykont, M.; van Eldik, C.; Vasileiadis, G.; Venter, C.; Venter, L.; Vialle, J. P.; Vincent, P.; Vivier, M.; Völk, H. J.; Volpe, F.; Vorobiov, S.; Wagner, S. J.; Ward, M.; Zdziarski, A. A.; Zech, A.

    2009-12-01

    Context: High energy particles reside in the relativistic jets of microquasars, making them possible sources of very high energy radiation (VHE, >100 GeV). Detecting this emission would provide a new handle on jet physics. Aims: Observations of the microquasar GRS 1915+105 with the HESS telescope array were undertaken in 2004-2008 to search for VHE emission. Methods: Stereoscopic imaging of Cherenkov radiation from extensive air showers is used to reconstruct the energy and direction of the incident gamma rays. Results: There is no evidence for a VHE gamma-ray signal either from the direction of the microquasar or its vicinity. An upper limit of 6.1× 10-13 ph cm-2 s-1 (99.9% confidence level) is set on the photon flux above 410 GeV, equivalent to a VHE luminosity of ˜ 1034 erg s-1 at 11 kpc. Conclusions: The VHE to X-ray luminosity ratio in GRS 1915+105 is at least four orders of magnitude lower than the ratio observed in gamma-ray binaries. The VHE radiative efficiency of the compact jet is less than 0.01% based on its estimated total power of 1038 erg s-1. Particle acceleration in GRS 1915+105 is not efficient at high energies and/or the magnetic field is too strong. It is also possible that VHE gamma-rays are produced by GRS 1915+105, but the emission is highly time-dependent. Supported by CAPES Foundation, Ministry of Education of Brazil.

  3. High Frequency Quasi-Periodic Oscillations in the 2000 Outburst of the Galactic Microquasar XTE J1550-564

    CERN Document Server

    Miller, J M; Homan, J; Belloni, T; Pooley, D; Corbel, S; Kouveliotou, C; Van der Klis, M; Lewin, W H G

    2001-01-01

    We present an analysis of the high frequency timing properties of the April-May 2000 outburst of the black hole candidate and Galactic microquasar XTE J1550-564, measured with the Rossi X-ray Timing Explorer. The rapid X-ray variability we measure is consistent with the source being in either the ``very high'' or ``intermediate'' black hole state. Strong (5-8% rms) quasi-periodic oscillations (QPOs) are found between 249-278 Hz; this represents the first detection of the same high frequency QPO in subsequent outbursts of a transient black hole candidate. We also present evidence for lower-frequency QPOs at approximately 187 Hz, also reported previously and likely present simultaneously with the higher-frequency QPOs. We discuss these findings within the context of the 1998 outburst of XTE J1550-564, and comment on implications for models of QPOs, accretion flows, and black hole spin.

  4. XMM-Newton Spectroscopy of the Galactic Microquasar GRS 1758-258 in the Peculiar Off/Soft State

    Science.gov (United States)

    Miller, J. M.; Wunands, R.; Rodriguez-Pascual, P. M.; Ferrando, P.; Gaensler, B. M.; Goldwurm, A.; Lewin, W. H. G.; Pooley, D.

    2002-01-01

    We report on an XMM-Newton Reflection Grating Spectrometer observation of the black hole candidate and Galactic microquasar GRS 1758-258. The source entered a peculiar "off/soft" state in 2001 late February in which the spectrum softened while the X-ray flux-and the inferred mass accretion rate-steadily decreased. We find no clear evidence for emission or absorption lines in the dispersed spectra, indicating that most of the observed soft flux is likely from an accretion disk and not from a cool plasma. The accretion disk strongly dominates the spectrum in this lower luminosity state and is only mildly recessed from the marginally stable orbit. These findings may be di8licult to explain in terms of advection-dominated accretion flow (ADAF) models. We discuss these results within the context of ADAF models, simultaneous two-flow models, and observed correlations between hard X-ray flux and jet production.

  5. The effects of the stellar wind and orbital motion on the jets of high-mass microquasars

    Science.gov (United States)

    Bosch-Ramon, V.; Barkov, M. V.

    2016-05-01

    Context. High-mass microquasar jets propagate under the effect of the wind from the companion star, and the orbital motion of the binary system. The stellar wind and the orbit may be dominant factors determining the jet properties beyond the binary scales. Aims: This is an analytical study, performed to characterise the effects of the stellar wind and the orbital motion on the jet properties. Methods: Accounting for the wind thrust transferred to the jet, we derive analytical estimates to characterise the jet evolution under the impact of the stellar wind. We include the Coriolis force effect, induced by orbital motion and enhanced by the wind's presence. Large-scale evolution of the jet is sketched, accounting for wind-to-jet thrust transfer, total energy conservation, and wind-jet flow mixing. Results: If the angle of the wind-induced jet bending is larger than its half-opening angle, the following is expected: (i) a strong recollimation shock; (ii) bending against orbital motion, caused by Coriolis forces and enhanced by the wind presence; and (iii) non-ballistic helical propagation further away. Even if disrupted, the jet can re-accelerate due to ambient pressure gradients, but wind entrainment can weaken this acceleration. On large scales, the opening angle of the helical structure is determined by the wind-jet thrust relation, and the wind-loaded jet flow can be rather slow. Conclusions: The impact of stellar winds on high-mass microquasar jets can yield non-ballistic helical jet trajectories, jet partial disruption and wind mixing, shocks, and possibly non-thermal emission. Among other observational diagnostics, such as radiation variability at any band, the radio morphology on milliarcsecond scales can be informative on the wind-jet interaction.

  6. A search for very high-energy flares from the microquasars GRS 1915+105, Circinus X-1, and V4641 Sgr using contemporaneous H.E.S.S. and \\textit{RXTE} observations

    CERN Document Server

    Abdalla, H; Aharonian, F; Benkhali, F Ait; Akhperjanian, A G; Angüner, E O; Arrieta, M; Aubert, P; Backes, M; Balzer, A; Barnard, M; Becherini, Y; Tjus, J Becker; Berge, D; Bernhard, S; Bernlöhr, K; Birsin, E; Blackwell, R; Böttcher, M; Boisson, C; Bolmont, J; Bordas, P; Bregeon, J; Brun, F; Brun, P; Bryan, M; Bulik, T; Capasso, M; Carr, J; Casanova, S; Chadwick, P M; Chakraborty, N; Chalme-Calvet, R; Chaves, R C G; Chen, A; Chevalier, J; Chrétien, M; Colafrancesco, S; Cologna, G; Condon, B; Conrad, J; Couturier, C; Cui, Y; Davids, I D; Degrange, B; Deil, C; deWilt, P; Dickinson, H J; Djannati-Ataï, A; Domainko, W; Donath, A; Drury, L O'C; Dubus, G; Dutson, K; Dyks, J; Dyrda, M; Edwards, T; Egberts, K; Eger, P; Ernenwein, J -P; Eschbach, S; Farnier, C; Fegan, S; Fernandes, M V; Fiasson, A; Fontaine, G; Förster, A; Funk, S; Füßling, M; Gabici, S; Gajdus, M; Gallant, Y A; Garrigoux, T; Giavitto, G; Giebels, B; Glicenstein, J F; Gottschall, D; Goyal, A; Grondin, M -H; Grudzińska, M; Hadasch, D; Hahn, J; Hawkes, J; Heinzelmann, G; Henri, G; Hermann, G; Hervet, O; Hillert, A; Hinton, J A; Hofmann, W; Hoischen, C; Holler, M; Horns, D; Ivascenko, A; Jacholkowska, A; Jamrozy, M; Janiak, M; Jankowsky, D; Jankowsky, F; Jingo, M; Jogler, T; Jouvin, L; Jung-Richardt, I; Kastendieck, M A; Katarzyński, K; Katz, U; Kerszberg, D; Khélifi, B; Kieffer, M; King, J; Klepser, S; Klochkov, D; Kluźniak, W; Kolitzus, D; Komin, Nu; Kosack, K; Krakau, S; Kraus, M; Krayzel, F; Krüger, P P; Laffon, H; Lamanna, G; Lau, J; -P., J; Lefaucheur, J; Lefranc, V; Lemière, A; Lemoine-Goumard, M; Lenain, J -P; Leser, E; Lohse, T; Lorentz, M; Liu, R; Lypova, I; Marandon, V; Marcowith, A; Mariaud, C; Marx, R; Maurin, G; Maxted, N; Mayer, M; Meintjes, P J; Menzler, U; Meyer, M; Mitchell, A M W; Moderski, R; Mohamed, M; Morå, K; Moulin, E; Murach, T; de Naurois, M; Niederwanger, F; Niemiec, J; Oakes, L; Odaka, H; Öttl, S; Ohm, S; Ostrowski, M; Oya, I; Padovani, M; Panter, M; Parsons, R D; Arribas, M Paz; Pekeur, N W; Pelletier, G; Petrucci, P -O; Peyaud, B; Pita, S; Poon, H; Prokhorov, D; Prokoph, H; Pühlhofer, G; Punch, M; Quirrenbach, A; Raab, S; Reimer, A; Reimer, O; Renaud, M; Reyes, R de los; Rieger, F; Romoli, C; Rosier-Lees, S; Rowell, G; Rudak, B; Rulten, C B; Sahakian, V; Salek, D; Sanchez, D A; Santangelo, A; Sasaki, M; Schlickeiser, R; Schüssler, F; Schulz, A; Schwanke, U; Schwemmer, S; Seyffert, A S; Shafi, N; Shilon, I; Simoni, R; Sol, H; Spanier, F; Spengler, G; Spies, F; Stawarz, Ł; Steenkamp, R; Stegmann, C; Stinzing, F; Stycz, K; Sushch, I; Tavernet, J -P; Tavernier, T; Taylor, A M; Terrier, R; Tluczykont, M; Trichard, C; Tuffs, R; van der Walt, J; van Eldik, C; van Soelen, B; Vasileiadis, G; Veh, J; Venter, C; Viana, A; Vincent, P; Vink, J; Voisin, F; Völk, H J; Vuillaume, T; Wadiasingh, Z; Wagner, S J; Wagner, P; Wagner, R M; White, R; Wierzcholska, A; Willmann, P; Wörnlein, A; Wouters, D; Yang, R; Zabalza, V; Zaborov, D; Zacharias, M; Zdziarski, A A; Zech, A; Zefi, F; Ziegler, A; Żywucka, N

    2016-01-01

    Microquasars are potential $\\gamma$-ray emitters. Indications of transient episodes of $\\gamma$-ray emission were recently reported in at least two systems: Cyg X-1 and Cyg X-3. The identification of additional $\\gamma$-ray-emitting microquasars is required to better understand how $\\gamma$-ray emission can be produced in these systems. Theoretical models have predicted very high-energy (VHE) $\\gamma$-ray emission from microquasars during periods of transient outburst. Observations reported herein were undertaken with the objective of observing a broadband flaring event in the $\\gamma$-ray and X-ray bands. Contemporaneous observations of three microquasars, GRS 1915+105, Circinus X-1, and V4641 Sgr, were obtained using the High Energy Spectroscopic System (H.E.S.S.) telescope array and the Rossi X-ray Timing Explorer (RXTE) satellite. X-ray analyses for each microquasar were performed and VHE $\\gamma$-ray upper limits from contemporaneous H.E.S.S. observations were derived. No significant $\\gamma$-ray signal ...

  7. Infrared study of H1743-322 in outburst: a radio-quiet and NIR-dim microquasar

    CERN Document Server

    Chaty, S; Dubus, G

    2015-01-01

    The X-ray binary, black hole candidate, and microquasar H1743-322 exhibited a series of X-ray outbursts between 2003 and 2008. We took optical/infrared (OIR) observations with the ESO/NTT telescope during 3 of these outbursts (2003, 2004, and 2008), to study its spectral energy distribution (SED). We detect rapid flares of duration ~5 mn in the high time-resolution IR lightcurve. We identify H and He emission lines in the IR spectra, coming from the accretion disk. The IR SED exhibits the spectral index typically associated with the X-ray high, soft state in our observations taken during the 2003 and 2004 outbursts, while the index changes to one that is typical of the X-ray low, hard state during the 2008 outburst. During this last outburst, we detected a change of slope in the NIR spectrum between the J and Ks bands, where the JH part is characteristic of an optically thick disk emission, while the HKs part is typical of optically thin synchrotron emission. Furthermore, the comparison of our IR data with ra...

  8. The effects of the stellar wind and orbital motion on the jets of high-mass microquasars

    CERN Document Server

    Bosch-Ramon, V

    2016-01-01

    High-mass microquasar jets propagate under the effect of the wind from the companion star, and the orbital motion of the binary system. The stellar wind and the orbit may be dominant factors determining the jet properties beyond the binary scales.} An analytical study is performed to characterize the effects of the stellar wind and the orbital motion on the jet properties. Accounting for the wind thrust transferred to the jet, we derive analytical estimates to characterize the jet evolution under the impact of the stellar wind. We include the Coriolis force effect, induced by orbital motion and enhanced by the wind presence. Large-scale evolution of the jet is sketched accounting for wind-to-jet thrust transfer, total energy conservation, and wind-jet flow mixing. If the angle of the wind-induced jet bending is larger than its half-opening angle, the following is expected: (i) a strong recollimation shock; (ii) bending against orbital motion, caused by Coriolis forces and enhanced by the wind presence; and (i...

  9. Broad-band spectral changes of the microquasars Cygnus X-1 and SWIFT J1753.5-0127

    CERN Document Server

    Bel, M C; Rodríguez, J; Chaty, S; Corbel, S; Goldwurm, A; Bel, Marion Cadolle; Ribo, Marc; Rodriguez, Jerome; Chaty, Sylvain; Corbel, Stephane; Goldwurm, Andrea

    2006-01-01

    We report high-energy results obtained with INTEGRAL and Rossi-XTE on two microquasars: the persistent high-mass system Cygnus X-1 and the transient low-mass binary SWIFT J1753.5-0127. INTEGRAL observed Cygnus X-1 from 2002 to 2004: the spectral (5-1000 keV) properties of the source, seen at least in three distinct spectral states, show disc and corona changes. In 2003 June, a high-energy tail at several hundred keV in excess of the thermal Comptonization model was observed, suggesting the presence of an additional non-thermal component. At that time, we detected an unusual correlation between radio data and high-energy hardness. We also report and compare the results obtained with simultaneous observations of the transient source SWIFT J1753.5-0127 performed with Rossi-XTE, INTEGRAL, VLA, REM and NTT on 2005 August 10-12 near its hard X-ray outburst. Broad-band spectra and fast time-variability properties are derived on this source (probably located in the galactic halo) together with radio, IR and optical d...

  10. The Physical Parameters of the Micro-quasar S26 in the Sculptor Group Galaxy NGC 7793

    CERN Document Server

    Dopita, M A; Filipović, M D; Pannuti, T G

    2012-01-01

    NGC 7793 - S26 is an extended source (350 pc $\\times$ 185 pc) previously studied in the radio, optical and x-ray domains. It has been identified as a micro-quasar which has inflated a super bubble. We used Integral Field Spectra from the Wide Field Spectrograph on the ANU 2.3 m telescope to analyse spectra between 3600--7000 \\AA. This allowed us to derive fluxes and line ratios for selected nebular lines. Applying radiative shock model diagnostics, we estimate shock velocities, densities, radiative ages and pressures across the object. We show that S26 is just entering its radiative phase, and that the northern and western regions are dominated by partially-radiative shocks due to a lower density ISM in these directions. We determine a velocity of expansion along the jet of 330 km s$^{-1}$, and a velocity of expansion of the bubble in the minor axis direction of 132 km s$^{-1}$. We determine the age of the structure to be $4.1\\times10^5$ yr, and the jet energy flux to be $ (4-10)\\times10^{40}$ erg s$^{-1}$ Th...

  11. Testing modified gravity and no-hair relations for the Kerr-Newman metric through quasi-periodic oscillations of galactic microquasars

    CERN Document Server

    Suvorov, Arthur George

    2016-01-01

    We construct multipole moments for stationary, asymptotically flat, spacetime solutions to higher-order curvature theories of gravity. The moments are defined using $3+1$ techniques involving timelike Killing vector constructions as in the classic papers by Geroch and Hansen. Using the fact that the Kerr-Newman metric is a vacuum solution to a particular class of $f(R)$ theories of gravity, we compute all its moments, and find that they admit recurrence relations similar to those for the Kerr solution in general relativity. It has been proposed previously that modelling the measured frequencies of quasi-periodic oscillations from galactic microquasars enables experimental tests of the no-hair theorem. We explore the possibility that, even if the no-hair relation is found to break down in the context of general relativity, there may be an $f(R)$ counterpart that is preserved. We apply the results to the microquasars GRS $1915$+$105$ and GRO J$1655$-$40$ using the diskoseismology and kinematic resonance models,...

  12. Chandra Discovers the X-ray Signature of a Powerful Wind from a Galactic Microquasar

    Science.gov (United States)

    2000-11-01

    Wide Web, along with other information about the discovery, at http://www.astro.psu.edu/users/niel/cirx1/cirx1.html. A binary-star system 20,000 light years from Earth in the constellation of Circinus. Animation showing the strong variability over time of one of the P Cygni spectral lines seen by Chandra from Circinus X-1 (Click Image to View Animation) Credit: Niel Brandt and Norbert Schulz (Note: This animation is the same as the one referred to in the above paragraph) Atoms irradiated with energetic X-rays can emit as well as absorb them at specific wavelengths. Whether astronomers observe emission or absorption depends on the state and environment of the irradiated atoms, so these processes carry vital information about the emitting and absorbing material. Regarding the time-lapse movie, Schulz commented "You can see this profile flipping up and down between a strong emission line on the red side and a strong absorption line on the blue side. We don't yet fully understand what this means, but it does indicate the dynamic nature of this system. We see indications that sometimes either the emitting or the absorbing region gets obscured by matter so thick that not even X rays can penetrate it." The researchers say one reason their discovery that Circinus X-1 has a high-velocity wind is important is that this small two-star system now has striking similarities with a type of luminous active galaxy known as a broad-absorption-line quasar. Broad-absorption-line quasars are galaxies containing a violent centers powered by supermassive black holes. "This type of galaxy has an accretion disk circling its black hole plus very powerful winds created when radiation pushes material off of the disk and out into space," Brandt says. "The disk winds from broad-absorption-line quasars create P Cygni lines in the spectra of these objects. Circinus X-1, with the newly detected X-ray P Cygni profiles, appears in many ways to be a microscopic version of a broad-absorption-line quasar

  13. Class 1E digital systems studies

    Energy Technology Data Exchange (ETDEWEB)

    Hecht, H.; Tai, A.T.; Tso, K.S. [SoHaR, Inc., Beverly Hills, CA (United States)

    1993-10-01

    This document is furnished as part of the effort to develop NRC Class 1E Digital Computer Systems Guidelines which is Task 8 of USAF Rome Laboratories Contract F30602-89-D-0100. The report addresses four major topics, namely, computer programming languages, software design and development, software testing and fault tolerance and fault avoidance. The topics are intended as stepping stones leading to a Draft Regulatory Guide document. As part of this task a small scale survey of software fault avoidance and fault tolerance practices was conducted among vendors of nuclear safety related systems and among agencies that develop software for other applications demanding very high reliability. The findings of the present report are in part based on the survey and in part on review of software literature relating to nuclear and other critical installations, as well as on the authors` experience in these areas.

  14. Discovery of an unusual new radio source in the star-forming galaxy M82: Faint supernova, supermassive blackhole, or an extra-galactic microquasar?

    CERN Document Server

    Muxlow, T W B; Garrington, S T; Pedlar, A; Fenech, D M; Argo, M K; van Eymeren, J; Ward, M; Zezas, A; Brunthaler, A

    2010-01-01

    A faint new radio source has been detected in the nuclear region of the starburst galaxy M82 using MERLIN radio observations designed to monitor the flux density evolution of the recent bright supernova SN2008iz. This new source was initially identified in observations made between 1-5th May 2009 but had not been present in observations made one week earlier, or in any previous observations of M82. In this paper we report the discovery of this new source and monitoring of its evolution over its first 9 months of existence. The true nature of this new source remains unclear, and we discuss whether this source may be an unusual and faint supernova, a supermassive blackhole associated with the nucleus of M82, or intriguingly the first detection of radio emission from an extragalactic microquasar.

  15. Main: 1E4N [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E4N トウモロコシ Corn Zea mays L. Beta-Glucosidase, Chloroplast Precursor Name=Glu1; Zea...EVNGPDGKPIGPPMGNPWIYMYPEGLKDLLMIMKNKYGNPPIYITENGIGDVDTKETPLPMEAALNDYKRLDYIQRHIATLKESIDLGSNVQGYFAWSLLDNFEWFAGFTERYGIVYVDRNNNCTRYMKESAKWLKEFNTAKKPSKKILTPA corn_1E4N.jpg ...

  16. Main: 1E1F [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1F トウモロコシ Corn Zea mays L. Beta-Glucosidase, Chloroplast Precursor Name=Glu1; Zea...QRHIATLKESIDLGSNVQGYFAWSLLDNFEWFAGFTERYGIVYVDRNNNCTRYMKESAKWLKEFNTAKKPSKKILTPA corn_1E1F.jpg ...

  17. Main: 1E4L [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E4L トウモロコシ Corn Zea mays L. Beta-Glucosidase, Chloroplast Precursor Name=Glu1; Zea...MKNKYGNPPIYITENGIGDVDTKETPLPMEAALNDYKRLDYIQRHIATLKESIDLGSNVQGYFAWSLLDNFEWFAGFTERYGIVYVDRNNNCTRYMKESAKWLKEFNTAKKPSKKILTPA corn_1E4L.jpg ...

  18. A Relativistic Fe K-alpha Emission Line in the Intermediate Luminosity BeppoSAX Spectrum of the Galactic Microquasar V4641 Sgr

    CERN Document Server

    Miller, J M; in 't Zand, J J M; Reynolds, C S; Wijnands, R; Nowak, M A; Lewin, W H G

    2002-01-01

    Broad Fe K-alpha emission lines have recently been reported in a number of Galactic black holes. Such lines are useful accretion flow diagnostics because they may be produced at the inner accretion disk and shaped by relativistic effects, but in general they have only been observed at luminosities of L_X = 10^(37-38) erg/s in soft X-rays. The Galactic microquasar V4641 Sgr -- widely known for its 12.2 Crab (1.5-12 keV) outburst in 1999 September -- displayed low-level activity in 1999 March. BeppoSAX observed the source in this state and Fe K-alpha line emission was found (in 't Zand et al. 2000). In re-analyzing these data, we find strong evidence that the Fe K-alpha line profile is broadened. For the most likely values of the source distance and black hole mass measured by Orosz et al. (2001), our fits to the total spectrum indicate that the source was observed at a luminosity of L_X = 1.9 (+1.0, -0.8) * 10^(36) erg/s (2-10 keV), or L_(2-10)/L_(Eddington) = 1.8 (+0.9, -0.8) * 10^(-3). Advection-dominated ac...

  19. Purification and Structural Analysis of Plectin and BPAG1e.

    Science.gov (United States)

    Manso, José A; García Rubio, Inés; Gómez-Hernández, María; Ortega, Esther; Buey, Rubén M; Carballido, Ana M; Carabias, Arturo; Alonso-García, Noelia; de Pereda, José M

    2016-01-01

    Plectin and BPAG1e belong to the plakin family of high-molecular-weight proteins that interconnect the cytoskeletal systems and anchor them to junctional complexes. Plectin and BPAG1e are prototypical plakins with a similar tripartite modular structure. The N- and C-terminal regions are built of multiple discrete structural domains, while the central rod domain mediates dimerization by coiled-coil interactions. Owing to the mosaic organization of plakins, the structure of their constituent individual domains or small multi-domain segments can be analyzed isolated. Yet, understanding the integrated function of large regions, oligomers, and heterocomplexes of plakins is difficult due to the large and segmented structure. Here, we describe methods for the production of plectin and BPAG1e samples suitable for structural and biophysical analysis. In addition, we discuss the combination of hybrid methods that yield information at several resolution levels to study the complex, multi-domain, and flexible structure of plakins.

  20. Data of evolutionary structure change: 1E4XH-1JGUH [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E4XH-1JGUH 1E4X 1JGU H H QVQLQQPGAELVKPGASVKLSCKASGFTFTNYWMHWVKQ...EE EEE EEE EEEEEEEEEEE EEEEEEE EEEEEE --- 0... 1E4X H 1E4XHPHE CA 185 ARG CA 224 ILE CA 296 1E4X... H 1E4XH IGEILPSNGRT

  1. Data of evolutionary structure change: 1E4XI-1CF8H [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E4XI-1CF8H 1E4X 1CF8 I H QVQLQQPGAELVKPGPSVKLSCKASGFTFT-NYWMHWVK...EEE EEEEEEEEEE EEEEEEE EEEEEE - 0 1E4X... I 1E4XI...A 262 ASP CA 228 THR CA 300 ARG CA 287 1E4X... I 1E4XI

  2. Data of evolutionary structure change: 1E4XI-1LO3H [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E4XI-1LO3H 1E4X 1LO3 I H QVQLQQPGAELVKPGPSVKLSCKASGFTFTNYWMHWVKQ...EEEEEEEEEEHHHH EEEEEEE EEEEE - 0 1E4X... I 1E4XI ...6 LEU CA 230 ILE CA 298 TYR CA 288 1E4X... I 1E4XI GEILPSNGRTN

  3. Security 1E10 anti-idiotypic vaccine in patients with tumors of different locations

    Directory of Open Access Journals (Sweden)

    Carmen Viada

    2016-02-01

    Full Text Available Cancer is a leading cause of death in Cuba and the world. Lung cancer is the leading cause of death, breast cancer is the second leading cause of death and colorectal cancer is the third leading cause of death. The 1E10 anti-idiotype vaccine is a new immunotherapeutic agent, registered for lung cancer by the Center for Molecular Immunology (CIM. You want to evaluate the safety of this vaccine in the treatment of various cancer sites. To determine the safety adverse events occurred in six clinical trials (one stage I lung, 3 phase II in breast, colon and lung, 1 phase II-III and program expanded use, both in lung were evaluated. 656 patients were studied. Demographic variables, the characteristics of the disease and adverse events were measured. The studies were balanced with respect to baseline characteristics. The most common adverse events were local reactions associated with 1E10 anti-idiotype vaccine and systemic reactions of mild or moderate intensity that were not related to the administration of the vaccine under study. The 1E10 anti-idiotype vaccine is safe for the low frequency and intensity of adverse events reported.

  4. HST and VLT observations of the neutron star 1E 1207.4-5209

    CERN Document Server

    De Luca, A; Sartori, A; Hummel, W; Caraveo, P A; Mereghetti, S; Bignami, G F

    2010-01-01

    1E 1207.4-5209, the peculiar Central Compact object in the G296.5+10.0 supernova remnant, has been proposed to be an "anti-magnetar" - a young neutron star born with a weak dipole field. Accretion, possibly of supernova fallback material, has also been invoked to explain a large surface temperature anisotropy as well as the generation of peculiar cyclotron absorption features superimposed to its thermal spectrum. Interestingly enough, a faint optical/infrared source was proposed as a possible counterpart to 1E 1207.4-5209, but later questioned, based on coarse positional coincidence. Considering the large offset of 1E 1207.4-5209 with respect to the center of its host supernova remnant, the source should move at ~70 mas/yr. Thus, we tested the association by measuring the proper motion of the proposed optical counterpart. Using HST observations spanning 3.75 years, we computed a 3 sigma upper limit of 7 mas/yr. Absolute astrometry on the same HST data set also places the optical source significantly off the 9...

  5. DOE-2, BDL summary. Version 2.1E

    Energy Technology Data Exchange (ETDEWEB)

    Winkelmann, F.C.; Birdsall, B.E.; Buhl, W.F.; Ellington, K.L.; Erdem, A.E. [Lawrence Berkeley Lab., CA (United States); Hirsch, J.J.; Gates, S. [Hirsch & Associates, Camarillo, CA (United States)

    1993-11-01

    This document contains summary information on all commands and keywords in the DOE-2 Building Description Language (BDL). It also contains supplementary tables and maps. The fundamentals of BDL are discussed in Chapter II of the Reference Manual (2.1A); detailed descriptions of the commands and keywords summarized here can be found in the Reference Manual (2.1A) and in the Supplement (2.1E).

  6. X-1E Loaded in B-29 Mothership on Ramp

    Science.gov (United States)

    1955-01-01

    The Bell Aircraft Corporation X-1E airplane being loaded under the mothership, Boeing B-29. The X-planes had originally been lowered into a loading pit and the launch aircraft towed over the pit, where the rocket plane was hoisted by belly straps into the bomb bay. By the early 1950s a hydraulic lift had been installed on the ramp at the NACA High-Speed Flight Station to elevate the launch aircraft and then lower it over the rocket plane for mating.

  7. Aging evaluation of class 1E batteries: Seismic testing

    Energy Technology Data Exchange (ETDEWEB)

    Edson, J.L. (EG and G Idaho, Inc., Idaho Falls, ID (USA))

    1990-08-01

    This report presents the results of a seismic testing program on naturally aged class 1E batteries obtained from a nuclear plant. The testing program is a Phase 2 activity resulting from a Phase 1 aging evaluation of class 1E batteries in safety systems of nuclear power plants, performed previously as a part of the US Nuclear Regulatory Commission's Nuclear Plant Aging Research Program and reported in NUREG/CR-4457. The primary purpose of the program was to evaluate the seismic ruggedness of naturally aged batteries to determine if aged batteries could have adequate electrical capacity, as determined by tests recommended by IEEE Standards, and yet have inadequate seismic ruggedness to provide needed electrical power during and after a safe shutdown earthquake (SSE) event. A secondary purpose of the program was to evaluate selected advanced surveillance methods to determine if they were likely to be more sensitive to the aging degradation that reduces seismic ruggedness. The program used twelve batteries naturally aged to about 14 years of age in a nuclear facility and tested them at four different seismic levels representative of the levels of possible earthquakes specified for nuclear plants in the United States. Seismic testing of the batteries did not cause any loss of electrical capacity. 19 refs., 29 figs., 7 tabs.

  8. Data of evolutionary structure change: 1E1QA-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1QA-2HLDT 1E1Q 2HLD A T DLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGM...VDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDN...bID> T 2HLDT ALKQVAGS

  9. Data of evolutionary structure change: 1E1RC-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1RC-2HLDT 1E1R 2HLD C T ADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSS...VQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASI... 2HLD T 2HLDT AAFAQ--

  10. Data of evolutionary structure change: 1E1RA-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1RA-2HLDT 1E1R 2HLD A T DLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGM...VDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDN...bChain>T 2HLDT ALKQVAGSLKLFL

  11. BEST sensitivity to O(1) eV sterile neutrino

    CERN Document Server

    Barinov, Vladislav; Gorbunov, Dmitry; Ibragimova, Tatiana

    2016-01-01

    Numerous anomalous results in neutrino oscillation experiments can be attributed to interference of ~1 eV sterile neutrino. The specially designed to fully explore the Gallium anomaly Baksan Experiment on Sterile Transitions (BEST) starts next year. We investigate the sensitivity of BEST in searches for sterile neutrino mixed with electron neutrino. Then, performing the combined analysis of all the Gallium experiments (SAGE, GALLEX, BEST) we find the regions in model parameter space (sterile neutrino mass and mixing angle), which will be excluded if BEST agrees with no sterile neutrino hypothesis. For the opposite case, if BEST observes the signal as it follows from the sterile neutrino explanation of the Gallium (SAGE and GALLEX) anomaly, we show how BEST will improve upon the present estimates of the model parameters.

  12. DOE-2 supplement: Version 2.1E

    Energy Technology Data Exchange (ETDEWEB)

    Winkelmann, F.C.; Birdsall, B.E.; Buhl, W.F.; Ellington, K.L.; Erdem, A.E. [Lawrence Berkeley Lab., CA (United States); Hirsch, J.J.; Gates, S. [Hirsch (James J.) and Associates, Camarillo, CA (United States)

    1993-11-01

    This publication updates the DOE-2 Supplement form version 2.1D to version to 2.1E. It contains detailed discussions and instructions for using the features and enhancements introduced into the 2.1B, 2.1C, 2.1D, and 2.1E versions of the program. The building description section contains information on input functions in loads and systems, hourly report frequencies, saving files of hourly output for post processing, sharing hourly report data among program modules, the metric option, and input macros and general library features. The loads section contains information on sunspaces, sunspace modeling, window management and solar radiation, daylighting, trombe walls, fixed shades, fins and overhangs, shade schedules, self shades, heat distribution from lights, the Sherman-Grimsrud infiltrations method. terrain and height modification to wind speed, floor multipliers and interior wall types, improved exterior infrared radiation loss calculation, improved outside air film conductance calculation, window library, window frames, and switchable glazing. The systems section contains information on energy end use and meters, powered induction units, a packaged variable volume -- variable temperature system, a residential variable volume -- variable temperature system, air source heat pump enhancements, water loop heat pump enhancements, variable speed electric heat pump, gas heat pumps, hot water heaters, evaporative cooling, total gas solid-desiccant systems, add on desiccant cooling, water cooled condensers, evaporative precoolers outside air economizer control, optimum fan start, heat recovery from refrigerated case work, night ventilation, baseboard heating, moisture balance calculations, a residential natural ventilation algorithm, improved cooling coil model, system sizing and independent cooling and heating sizing ratios. The plant section contains information on energy meters, gas fired absorption chillers, engine driven compressor chillers, and ice energy storage.

  13. Excel Center

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Citigroup,one of the World top 500 companies,has now settled in Excel Center,Financial Street. The opening ceremony of Excel Center and the entry ceremony of Citigroup in the center were held on March 31.Government leaders of Xicheng District,the Excel CEO and the heads of Asia-Pacific Region leaders of Citibank all participated in the ceremony.

  14. Data of evolutionary structure change: 1E1QC-2HLDA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1QC-2HLDA 1E1Q 2HLD C A ADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSS...ELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKIT...RPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQS--DLDASTKQTLVRGERLTQLLKQNQYSPLATEEQV...> 0 2HLD A 2HLDA AFAQS--DLDA...ain> 1E1Q C 1E1QC AFAQFGSDLDA

  15. Estrogen sulfotransferase/SULT1E1 promotes human adipogenesis.

    Science.gov (United States)

    Ihunnah, Chibueze A; Wada, Taira; Philips, Brian J; Ravuri, Sudheer K; Gibbs, Robert B; Kirisci, Levent; Rubin, J Peter; Marra, Kacey G; Xie, Wen

    2014-05-01

    Estrogen sulfotransferase (EST/SULT1E1) is known to catalyze the sulfoconjugation and deactivation of estrogens. The goal of this study is to determine whether and how EST plays a role in human adipogenesis. By using human primary adipose-derived stem cells (ASCs) and whole-fat tissues from the abdominal subcutaneous fat of obese and nonobese subjects, we showed that the expression of EST was low in preadipocytes but increased upon differentiation. Overexpression and knockdown of EST in ASCs promoted and inhibited differentiation, respectively. The proadipogenic activity of EST in humans was opposite to the antiadipogenic effect of the same enzyme in rodents. Mechanistically, EST promoted adipogenesis by deactivating estrogens. The proadipogenic effect of EST can be recapitulated by using an estrogen receptor (ER) antagonist or ERα knockdown. In contrast, activation of ER in ASCs inhibited adipogenesis by decreasing the recruitment of the adipogenic peroxisome proliferator-activated receptor γ (PPARγ) onto its target gene promoters, whereas ER antagonism increased the recruitment of PPARγ to its target gene promoters. Linear regression analysis revealed a positive correlation between the expression of EST and body mass index (BMI), as well as a negative correlation between ERα expression and BMI. We conclude that EST is a proadipogenic factor which may serve as a druggable target to inhibit the turnover and accumulation of adipocytes in obese patients.

  16. Proper Motions and Origins of AXP 1E 2259+586 and AXP 4U 0142+61

    Science.gov (United States)

    Tendulkar, Shriharsh P.; Cameron, P. Brian; Kulkarni, Shrinivas R.

    2013-07-01

    Using high-resolution NIR images supported by laser guide star adaptive optics from the Keck II telescope from 2005 to 2012, we have measured the proper motions of two anomalous X-ray pulsars, AXP 1E 2259+586 and AXP 4U 0142+61. The proper motion of AXP 1E 2259+586 in the sky frame is (μα, μδ) = (- 6.4 ± 0.6, -2.3 ± 0.6) mas yr-1 and that of AXP 4U 0142+61 is (μα, μδ) = (- 4.1 ± 1, 1.9 ± 1) mas yr-1. After correcting for the velocity of the progenitors, we calculate the tangential ejection velocities of the magnetars to be 157 ± 17 km s-1 and 102 ± 26 km s-1 respectively. The proper motion vector of AXP 1E 2259+586 is directed away from the putative center of the supernova remnant CTB 109 that has long been proposed to be associated with AXP 1E 2259+586. This is significant evidence for linking the pulsar with CTB 109. We comment on the possible movement of CTB 109 after the explosion. We narrow the search cone for the birthsite or remnant of AXP 4U 0142+61 to an opening angle of 24°. However, we are unable to find any suitable association.

  17. Distribution center

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    Distribution center is a logistics link fulfill physical distribution as its main functionGenerally speaking, it's a large and hiahly automated center destined to receive goods from various plants and suppliers,take orders,fill them efficiently,and deliver goods to customers as quickly as possible.

  18. Simultaneous Chandra and RXTE Spectroscopy of the Microquasar H~1743-322: Clues to Disk Wind and Jet Formation from a Variable Ionized Outflow

    CERN Document Server

    Miller, J M; Homan, J; Fabian, A C; Steeghs, D; Wijnands, R; Rupen, M; Charles, P; Van der Klis, M; Lewin, W H G

    2004-01-01

    We observed the bright phase of the 2003 outburst of the Galactic black hole candidate H 1743-322 in X-rays simultaneously with Chandra and RXTE on four occasions. The Chandra/HETGS spectra reveal narrow, variable (He-like) Fe XXV and (H-like) Fe XXVI resonance absorption lines. In the first observation, the Fe XXVI line has a FWHM of 1800 +/- 400 km/s and a blue-shift of 700 +/- 200 km/s, suggesting that the highly ionized medium is an outflow. Moreover, the Fe XXV line is observed to vary significantly on a timescale of a few hundred seconds in the first observation, which corresponds to the Keplerian orbital period at approximately 1 E+4 gravitational radii. Our models for the absorption geometry suggest that a combination of geometric effects and changing ionizing flux are required to account for the large changes in line flux observed between observations, and that the absorption likely occurs at a radius less than 1 E+4 radii for a 10 Msun black hole. Viable models for the absorption geometry include cy...

  19. Data of evolutionary structure change: 1E1QC-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1QC-2HLDT 1E1Q 2HLD C T ADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSS...VQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASI...yChain> 2HLD T 2HLDT VAAFA---QDLD

  20. Data of evolutionary structure change: 1E1QB-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1QB-2HLDT 1E1Q 2HLD B T DLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGM...SDRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDT...dbChain> 2HLDT ALKQVAGSLKLFL 2HLD T 2HLDT VAAFAQDLDAST

  1. Data of evolutionary structure change: 1E1RB-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1RB-2HLDT 1E1R 2HLD B T DLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGM...SDRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDT...T 2HLDT ALKQVAGSLKLFL2HLD T 2HLDT VAAFAQDLDAST

  2. Data of evolutionary structure change: 1E0UC-3G2GD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E0UC-3G2GD 1E0U 3G2G C D ----------------------------MKKTKIVCTIG...PKTESEEMLAKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKT------GKTAAILLDTKGPEIRTMKLEGGNDVSLKAGQTFTFTTDKSVI--GNSEMVAVTYE...GFTTDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVLNNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVIEIREHLKAHGGENIHIIS...KIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRALKVVITATMMLDSMIKNPRPTRAEAGDVAN...TAHQLVLSKGVVPQLV--KEITSTDDFYR----LGKELALQSGLAHKGDVVVMVSGALVPSGTTNTASVHVL- QTQQLHAAMADTFLEHMCRLD

  3. Data of evolutionary structure change: 1ANTI-1E04L [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1ANTI-1E04L 1ANT 1E04 I L ---------RDIPMNPMCIYRSPEKKATNRRVWELSKANSRFATTFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKFDTISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQDISE... 1ANT I 1ANTI AASTA--...4> 1ANT I 1ANTI ...line>VAL CA 395 1ANT I 1ANTI

  4. Data of evolutionary structure change: 1E1RC-2HLDA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1RC-2HLDA 1E1R 2HLD C A ADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSS...ELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKIT...RPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQS--DLDASTKQTLVRGERLTQLLKQNQYSPLATEEQV...fEVID> 0 2HLD A 2HLDA AFAQS--DLDAS GGG -- HH

  5. Lysosomal-associated transmembrane protein 5 (LAPTM5 is a molecular partner of CD1e.

    Directory of Open Access Journals (Sweden)

    Catherine Angénieux

    Full Text Available The CD1e protein participates in the presentation of lipid antigens in dendritic cells. Its transmembrane precursor is transported to lysosomes where it is cleaved into an active soluble form. In the presence of bafilomycin, which inhibits vacuolar ATPase and consequently the acidification of endosomal compartments, CD1e associates with a 27 kD protein. In this work, we identified this molecular partner as LAPTM5. The latter protein and CD1e colocalize in trans-Golgi and late endosomal compartments. The quantity of LAPTM5/CD1e complexes increases when the cells are treated with bafilomycin, probably due to the protection of LAPTM5 from lysosomal proteases. Moreover, we could demonstrate that LAPTM5/CD1e association occurs under physiological conditions. Although LAPTM5 was previously shown to act as a platform recruiting ubiquitin ligases and facilitating the transport of receptors to lysosomes, we found no evidence that LATPM5 controls either CD1e ubiquitination or the generation of soluble lysosomal CD1e proteins. Notwithstanding these last observations, the interaction of LAPTM5 with CD1e and their colocalization in antigen processing compartments both suggest that LAPTM5 might influence the role of CD1e in the presentation of lipid antigens.

  6. Data of evolutionary structure change: 1AIJL-1E14M [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AIJL-1E14M 1AIJ 1E14 L M -------------------ALLSFERKYRVPGGTLV--G...ment> 0 1AIJ L 1AIJ...2218189239502 8.040038108825684 1 1AIJ... L 1AIJL YGLGG-A... 333 GLU CA 294 ARG CA 276 1AIJ

  7. Physicochemical and biological characterization of 1E10 Anti-Idiotype vaccine

    Directory of Open Access Journals (Sweden)

    Machado Yoan J

    2011-11-01

    Full Text Available Abstract Background 1E10 monoclonal antibody is a murine anti-idiotypic antibody that mimics N-glycolyl-GM3 gangliosides. This antibody has been tested as an anti-idiotypic cancer vaccine, adjuvated in Al(OH3, in several clinical trials for melanoma, breast, and lung cancer. During early clinical development this mAb was obtained in vivo from mice ascites fluid. Currently, the production process of 1E10 is being transferred from the in vivo to a bioreactor-based method. Results Here, we present a comprehensive molecular and immunological characterization of 1E10 produced by the two different production processes in order to determine the impact of the manufacturing process in vaccine performance. We observed differences in glycosylation pattern, charge heterogeneity and structural stability between in vivo-produced 1E10 and bioreactor-obtained 1E10. Interestingly, these modifications had no significant impact on the immune responses elicited in two different animal models. Conclusions Changes in 1E10 primary structure like glycosylation; asparagine deamidation and oxidation affected 1E10 structural stability but did not affect the immune response elicited in mice and chickens when compared to 1E10 produced in mice.

  8. Data of evolutionary structure change: 1E4WL-1MCEA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E4WL-1MCEA 1E4W 1MCE L A DIQMTQTPSSLSASLGDRVTISCRASQ---DISHYLNWF...DINVKWKIDGSERQNGVLDSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC- PSALTQ-PPSASGSLGQSVTI...ain>A 1MCEA CSSYEGSDNFV EE...263 ALA CA 289 1MCE A 1MCEA...in>A 1MCEA SKQSN-NKYAA -

  9. Data of evolutionary structure change: 1E4XL-1MCEA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E4XL-1MCEA 1E4X 1MCE L A DIQMTQTPSSLSASLGDRVTISCRASQ---DISHYLNWF...DINVKWKIDGSERQNGVLDSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC- PSALTQ-PPSASGSLGQSVTI...hain>A 1MCEA YYCSSYEGSDN E...line> ALA CA 288 1MCE A 1MCEA...onfEVID> 3 1MCE A 1MCEA

  10. Data of evolutionary structure change: 1E6OL-1MCEA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E6OL-1MCEA 1E6O 1MCE L A EIVLTQSPAITAASLGQKVTITCSAS----SSVSYMHWY...DINVKWKIDGSERQNGVLNSWTDQDS-KDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN--- PSALTQ-PPSASGSLGQSVT...82 1MCE A 1MCEA...in> 1MCE A 1MCEA...2 1MCE A 1MCEA

  11. Data of evolutionary structure change: 1E52A-4OTAI [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAI 1E52 4OTA A I LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA... 0 4OTA I 4OTAI 21.018999099731445 -8.57699966430664 97.70899963378906 tion> 0.95...999752044678 0.28600001335144043 tion> 1.992616057395935 2.8046770095825195 ...

  12. Data of evolutionary structure change: 1E52A-4OTAR [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAR 1E52 4OTA A R LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA... 0 4OTA R 4OTAR 26.631000518798828 -29.371999740600586 72.0260009765625 ...74316 -0.878000020980835 -0.3100000023841858 tion> 1.9946750402450562 2.806180953979492 ...

  13. Data of evolutionary structure change: 1E52A-4OTAG [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAG 1E52 4OTA A G LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...>0 4OTA G 4OTAG -7.752999782562256 -21.667999267578125 97.37799835205078 tion> ... -0.6010000109672546 0.1940000057220459 tion> 1.9995390176773071 2.805448055267334 ...

  14. Data of evolutionary structure change: 1E52B-4OTAM [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAM 1E52 4OTA B M LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...EVID> 0 4OTA M 4OTA... -21.030000686645508 -2.2130000591278076 40.415000915527344 ...-0.5630000233650208 -0.19499999284744263 -0.8029999732971191 tion> 1.9910509586334229 2.7949159145355225 ...

  15. Data of evolutionary structure change: 1E52A-4OTAD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAD 1E52 4OTA A D LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...>0 4OTA D 4OTAD -19.621000289916992 33.64500045776367 tion> 0.58799999...60437 -0.2669999897480011 tion> 2.00280499458313 2.825521945953369 ...

  16. Data of evolutionary structure change: 1E52A-4OTAJ [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAJ 1E52 4OTA A J LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...fEVID> 0 4OTA J 4OTA...rallel> 16.440000534057617 -7.355000019073486 113.11000061035156 tion>....4909999966621399 -0.23899999260902405 tion> 1.9981789588928223 2.8151841163635254 ...

  17. Data of evolutionary structure change: 1E52A-4OTAH [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAH 1E52 4OTA A H LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...fEVID> 0 4OTA H 4OTA...23486328 tion> -0.4189999997615814 -0.828000009059906 -0.3720000088214...6055 -0.8370000123977661 0.5109999775886536 -0.1940000057220459 tion> 1.9984849691390991 2.812535047531128 ...

  18. Data of evolutionary structure change: 1E52B-4OTAJ [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAJ 1E52 4OTA B J LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...fEVID> 0 4OTA J 4OTA...llel> 3.2679998874664307 16.643999099731445 95.48200225830078 tion> 0.8259999752044678 tion> 1.9976840019226074 2.8146679401397705 ...

  19. Data of evolutionary structure change: 1E52B-4OTAQ [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAQ 1E52 4OTA B Q LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...> 0 4OTA... Q 4OTAQ KETLI-REVSE 38.95899963378906 tion> 0.08500000089406967 0.9610000252723694 0.4729999899864197 -0.27300000190734863 -0.8379999995231628

  20. Data of evolutionary structure change: 1E52B-4OTAH [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAH 1E52 4OTA B H LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...fEVID> 0 4OTA H 4OTA...> -0.5889999866485596 -0.09799999743700027 0.8019999861717224 tion> 1.9979859590530396 2.8120179176330566 ... ... -20.273000717163086 -4.440999984741211 94.379997253...41797 tion> 0.39899998903274536 0.828000009059906 0.39399999380111694<

  1. Data of evolutionary structure change: 1E52B-4OTAB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAB 1E52 4OTA B B LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...fEVID> 0 4OTA B 4OTA...3.15999984741211 20.631000518798828 17.600000381469727 tion> 0.9430000...04632568 0.8389999866485596 tion> 1.9927129745483398 2.7974250316619873 ...

  2. Data of evolutionary structure change: 1E52B-4OTAK [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAK 1E52 4OTA B K LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...>0 4OTA K 4OTAK -16.0939998626709 77.69400024414062 tion> 0.4510000050...1858 -0.847000002861023 tion> 1.994042992591858 2.79762601852417 ...

  3. Data of evolutionary structure change: 1E52A-4OTAB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAB 1E52 4OTA A B LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...fEVID> 0 4OTA B 4OTA...0.013000000268220901 -3.368000030517578 35.22800064086914 tion> -0.947...000171661377 -0.1899999976158142 tion> 1.993204951286316 2.797945976257324 ...

  4. Data of evolutionary structure change: 1E52B-4OTAA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAA 1E52 4OTA B A LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...t> 0 4OTA A 4OTA...allel> -8.633999824523926 23.224000930786133 2.4660000801086426 tion> ...y>0.6079999804496765 -0.7549999952316284 tion> 2.0007169246673584 2.8046839237213135 ...

  5. Data of evolutionary structure change: 1E52A-4OTAQ [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAQ 1E52 4OTA A Q LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...> 0 4OTA... Q 4OTAQ KETLI-REVSE -32.874000549316406 56.58599853515625 tion> -0.06800000369548798 -0....21400000154972076 tion> 1.9998979568481445 2.8079090118408203 ...

  6. Data of evolutionary structure change: 1E52A-4OTAP [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAP 1E52 4OTA A P LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA... 0 4OTA P 4OTAP -3.50600004196167 74.552001953125 tion> -0.80599999427...3 -0.17900000512599945 tion> 1.997607946395874 2.8045730590820312 ...

  7. Data of evolutionary structure change: 1E52A-4OTAO [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAO 1E52 4OTA A O LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...>0 4OTA O 4OTAO -2.740999937057495 59.154998779296875 tion> 0.8669999837875366 0.3...949999809265137 -0.4779999852180481 0.8199999928474426 0.3149999976158142

  8. Data of evolutionary structure change: 1E52A-4OTAE [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAE 1E52 4OTA A E LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...>0 4OTA E 4OTAE -5.197999954223633 -31.14299964904785 19.062000274658203 tion> -0.972000002861023 0.22200000286102295 tion> 1.9988939762115479 2.805737018585205 ...

  9. Data of evolutionary structure change: 1E52B-4OTAL [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAL 1E52 4OTA B L LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...>0 4OTA L 4OTAL 9.65999984741211 -14.574000358581543 92.75199890136719 tion> -0.....5839999914169312 0.734000027179718 1.9978070259094238 2.8073511123657227 ...

  10. Data of evolutionary structure change: 1E52B-4OTAN [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAN 1E52 4OTA B N LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...x>0 4OTA N 4OTAN -17.95800018310547 -8.309000015258789 55.1609992980957 tion> -0.3370000123977661 0.7979999780654907 tion> 1.993736982345581 2.7896270751953125 ...

  11. Data of evolutionary structure change: 1E52A-4OTAM [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAM 1E52 4OTA A M LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...EVID> 0 4OTA M 4OTA...> -7.85699987411499 -26.211999893188477 58.04199981689453 ...x>-0.4690000116825104 -0.8650000095367432 0.18000000715255737 tion> 1.9915380477905273 2.7954370975494385 ...

  12. Data of evolutionary structure change: 1E52B-4OTAE [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAE 1E52 4OTA B E LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...>0 4OTA E 4OTAE -18.371000289916992 -7.144000053405762 1.434999942779541 tion> 0...>-0.4449999928474426 -0.7960000038146973 tion> 1.9984110593795776 2.8052260875701904 ...

  13. Data of evolutionary structure change: 1E52A-4OTAC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAC 1E52 4OTA A C LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...>0 4OTA C 4OTAC -24.429000854492188 18.4689998626709 tion> 0.3219999...62260437 0.2590000033378601 tion> 1.9993360042572021 2.7992570400238037 ...

  14. Data of evolutionary structure change: 1E52A-4OTAA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAA 1E52 4OTA A A LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...t> 0 4OTA A 4OTA...arallel> 4.539000034332275 -0.7739999890327454 20.0939998626709 tion> ...639038 0.3109999895095825 tion> 2.001197099685669 2.8052051067352295 ...

  15. Data of evolutionary structure change: 1E52B-4OTAO [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAO 1E52 4OTA B O LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...>0 4OTA O 4OTAO 21.257999420166016 41.527000427246094 tion> -0.8690000176429749 -0.3...0000023841858 0.019999999552965164 0.652999997138977 -0.7570000290870667

  16. Data of evolutionary structure change: 1E2TE-2PFRB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E2TE-2PFRB 1E2T 2PFR E B HMTSFLHAYFTRLHCQPLGVPTVEALRTLHLAHNCAIPF...ine>ARG CA 540 2PFR B 2PFR...U CA 192 GLN CA 212 VAL CA 235 2PFR... B 2PFRB RKFNYKDNTDLVEFK 2.9440479278564453 2 2PFR

  17. Data of evolutionary structure change: 1E2TG-2PFRB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E2TG-2PFRB 1E2T 2PFR G B HMTSFLHAYFTRLHCQPLGVPTVEALRTLHLAHNCAIPF...ine> ARG CA 539 2PFR B 2PFR...CA 191 GLN CA 212 VAL CA 236 2PFR B 2PFRB RKFNYKDNTDLVEFK 2.972101926803589 2 2PFR<

  18. Data of evolutionary structure change: 1E43A-2DIEA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E43A-2DIEA 1E43 2DIE A A VNGTLMQYFEWYTPNDGQHWKRLQNDAEHLSDIGITAVW...WTKFDFPGRGNTHSNFKWRWYHFDGTDWDQSRQLQNKIYKFRGTGKAWDWEVDIENGNYDYLMYADIDMDHPEVINELRNWGVWYTNTLNLDGFRIDAVKHIKYSYTR...ine> PHE CA 463 2DIE A 2DIE...613037109375 1 2DIE... A 2DIEA GIPTH---GVPSM

  19. Data of evolutionary structure change: 1CTMA-1E2ZC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available M A 1CTMA IVDASNERQVI ...1CTMA-1E2ZC 1CTM 1E2Z A C YPIFAQQNYENPREATGRIVCANCHLASKPVDIEVPQAV...EEEEEE EEEEEEE - EEEEEEE EEE EEEEEEEEEE 0 1CT...M A 1CTMA KILRK--EKGGY ure>EEEEE-- EEure>

  20. Data of evolutionary structure change: 1CTMA-1E2WA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CTMA-1E2WA 1CTM 1E2W A A YPIFAQQNYENPREATGRIVCANCHLASKPVDIEVPQAV...index> 1CTM A 1CTM...A ILRKE--KGGYE ure>EEEE -- EEEure> ITALSEKKGGFE ure>EE EEEure> IEKAN-GEVVV ure>EEE - EEEEure> <

  1. Data of evolutionary structure change: 1CTMA-1E2ZA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CTMA-1E2ZA 1CTM 1E2Z A A YPIFAQQNYENPREATGRIVCANCHLASKPVDIEVPQAV...EEEEEEEE EEEEEEEE - EEEEEEE EEE EEEEEEEEEE 0 1CTM A 1CTMA ILRKE--KGGYE ure>EEEE -- EEEure> ITALSEKKGGFE EEEE EEEure>

  2. Centering research

    DEFF Research Database (Denmark)

    Katan, Lina Hauge; Baarts, Charlotte

    and collected 24 portfolios in which students reflect auto-ethnographically on their educational practices. Analyzing this qualitative material, we explore how researchers and students respectively read and write to develop and advance their thinking in those learning processes that the two groups fundamentally...... share as the common aim of both research and education. Despite some similarities, we find that how the two groups engage in and benefit from reading and writing diverges significantly. Thus we have even more reason to believe that centering practice-based teaching on these aspects of research is a good...

  3. Sulfation of fulvestrant by human liver cytosols and recombinant SULT1A1 and SULT1E1

    Directory of Open Access Journals (Sweden)

    Edavana VK

    2011-11-01

    Full Text Available Vineetha Koroth Edavana1, Xinfeng Yu1, Ishwori B Dhakal1, Suzanne Williams1, Baitang Ning2, Ian T Cook3, David Caldwell1, Charles N Falany3, Susan Kadlubar11Division of Medical Genetics, College of Medicine, University of Arkansas for Medical Sciences, Little Rock, AR, USA; 2Division of Personalized Nutrition and Medicine, National Center for Toxicological Research, Food and Drug Administration, Jefferson, AR, USA; 3Department of Pharmacology, University of Alabama, Birmingham, AL, USAAbstract: Fulvestrant (Faslodex™ is a pure antiestrogen that is approved to treat hormone receptor-positive metastatic breast cancer in postmenopausal women. Previous studies have demonstrated that fulvestrant metabolism in humans involves cytochromes P450 and UDP-glucuronosyltransferases (UGTs. To date, fulvestrant sulfation has not been characterized. This study examined fulvestrant sulfation with nine recombinant sulfotransferases and found that only SULT1A1 and SULT1E1 displayed catalytic activity toward this substrate, with Km of 4.2 ± 0.99 and 0.2 ± 0.16 µM, respectively. In vitro assays of 104 human liver cytosols revealed marked individual variability that was highly correlated with β-naphthol sulfation (SULT1A1 diagnostic substrate; r = 0.98, P < 0.0001, but not with 17ß-estradiol sulfation (SULT1E1 diagnostic substrate; r = 0.16, P = 0.10. Fulvestrant sulfation was correlated with both SULT1A1*1/2 genotype (P value = 0.023 and copy number (P < 0.0001. These studies suggest that factors influencing SULT1A1/1E1 tissue expression and/or enzymatic activity could influence the efficacy of fulvestrant therapy.Keywords: fulvestrant, sulfotransferase, genotype, copy number

  4. Construction of a recombinant adenovirus Vector of human papillomavirus type 16 L1_E7c

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    Human papillomaviruses are closely associated with human cervical cancer, especially HPV types 16 and 18. At present, HPV can not be produced in large quantity; it also has tumorgenicity and these properties of HPV have seriously hampered the development of HPV vaccine. HPV type 16 L1 proteins can assembled into virus-like particles (VLP), which are morphologically identical to the nature virion. In order to develop the recombinant adenovirus vectors of HPV, we constructed a recombinant adenovirus shuttle plasmid pCA14 L1-E7c. Methods: Human papillomavirus type 16 L1 open reading frame without terminator codon (TAA) (5559- 7152) and E7c (682- 855) were amplified using PCR. The L1 and E7c fragments were inserted into pGEM-T easy vectors by T- A strategy, named pTAL1 and pTAE7c. pTAL1 was cut with Hind III and BglII, the pTAE7c with BamHI and ClaI. The L1 DNA fragment, E7c and pBluesscript SK were ligated together using T4 DNA ligase. pBSL1-E7c and pBSL1-E7c was digested with Hind III and Xhol. The L1-E7c fragment was inserted into adenovirus shuttle plasmids pCAl4, named pCAl4L1-E7c. DNA sequence results indicated that The L1-E7c DNA fragment can encode the HPV16L1-E7 fusion protein correctly. Results: The L1 and E7c DNA fragments were amplified by PCR and recombinant plasmid pTAL1, pTAE7c, pBSL1-E7c and pCA14L1-E7c were constructed correctly. The pCAl4L1-E7c can be used in the further research work, cotransfected the 293 cell with the parent adenovirus pBHG10. Conclusion: Our results indicated that we have constructed a HPV16L1-E7 fusion DNA fragments and the adenovirus shuttle plasmids pCALl-E7c for the further research.

  5. Oncogenic AKT1(E17K) mutation induces mammary hyperplasia but prevents HER2-driven tumorigenesis.

    Science.gov (United States)

    Mancini, Maria L; Lien, Evan C; Toker, Alex

    2016-04-05

    One of the most frequently deregulated signaling pathways in breast cancer is the PI 3-K/Akt cascade. Genetic lesions are commonly found in PIK3CA, PTEN, and AKT, which lead to excessive and constitutive activation of Akt and downstream signaling that results in uncontrolled proliferation and increased cellular survival. One such genetic lesion is the somatic AKT1(E17K) mutation, which has been identified in 4-8% of breast cancer patients. To determine how this mutation contributes to mammary tumorigenesis, we constructed a genetically engineered mouse model that conditionally expresses human AKT1(E17K) in the mammary epithelium. Although AKT1(E17K) is only weakly constitutively active and does not promote proliferation in vitro, it is capable of escaping negative feedback inhibition to exhibit sustained signaling dynamics in vitro. Consistently, both virgin and multiparous AKT1(E17K) mice develop mammary gland hyperplasia that do not progress to carcinoma. This hyperplasia is accompanied by increased estrogen receptor expression, although exposure of the mice to estrogen does not promote tumor development. Moreover, AKT1(E17K) prevents HER2-driven mammary tumor formation, in part through negative feedback inhibition of RTK signaling. Analysis of TCGA breast cancer data revealed that the mRNA expression, total protein levels, and phosphorylation of various RTKs are decreased in human tumors harboring AKT1(E17K).

  6. Insulin-secreting INS-1E cells express functional TRPV1 channels.

    Science.gov (United States)

    Fågelskiöld, Amanda Jabin; Kannisto, Kristina; Boström, Anna; Hadrovic, Banina; Farre, Cecilia; Eweida, Mohamed; Wester, Kenneth; Islam, Md Shahidul

    2012-01-01

    We have studied whether functional TRPV1 channels exist in the INS-1E cells, a cell type used as a model for β-cells, and in primary β-cells from rat and human. The effects of the TRPV1 agonists capsaicin and AM404 on the intracellular free Ca (2+) concentration ([Ca (2+)]i) in the INS-1E cells were studied by fura-2 based microfluorometry. Capsaicin increased [Ca (2+)]i in a concentration-dependent manner, and the [Ca (2+)]i increase was dependent on extracellular Ca (2+). AM404 also increased [Ca (2+)]i in the INS-1E cells. Capsazepine, a specific antagonist of TRPV1, completely blocked the capsaicin- and AM404-induced [Ca (2+)]i increases. Capsaicin did not increase [Ca (2+)]i in the primary β-cells from rat and human. Whole cell patch clamp configuration was used to record currents across the plasma membrane in the INS-1E cells. Capsaicin elicited inward currents that were inhibited by capsazepine. Western blot analysis detected TRPV1 proteins in the INS-1E cells and the human islets. Immunohistochemistry was used to study the expression of TRPV1, but no TRPV1 protein immunoreactivity was detected in the human islet cells and the human insulinoma cells. We conclude that the INS-1E cells, but not the primary β-cells, express functional TRPV1 channels.

  7. Expression of Estrogen Sulfotransferase 1E1 and Steroid Sulfatase in Breast Cancer: A Immunohistochemical Study

    Directory of Open Access Journals (Sweden)

    D. Poisson Paré

    2009-01-01

    Full Text Available It is known that the steroid sulfatase (STS and the estrogen sulfotransferase (EST1E1 are commonly expressed in human breast carcinomas. STS and EST1E1 combined action could maintain the equilibrium between sulfated (inactive and unconjugated (active estrogens, which might have effects on development of hormone dependent breast cancer. We studied the expression of the STS and EST1E1 in 88 breast carcinomas and 57 adjacent non-malignant tissues by immunohistochemistry. The results were correlated with the tumor expression of estrogen receptor α (ER-α and β (ER-β, progesterone receptor A (PR-A and B (PR-B and the proliferation marker CDC47, the tumoral type and stage and the age at surgery. STS expression was higher in carcinoma specimens than in adjacent normal tissues, although not to a significant level (p = 0.064 and it was positively associated with CDC47 expression (p 0.05. These observations support the hypothesis that STS is overexpressed in breast cancer and associated with a worse prognosis. EST1E1 was observed for the first time in the nuclei of epithelial and tumoral cells. Tumor expression of EST1E1 was positively correlated with ER-β (p 0.01 and PR-B (p 0.05, two steroid receptors already associated with an improve prognosis for breast cancer. Controlling the STS overexpression in carcinomas could be a way to inhibit cancer growth. The significance of the association between EST1E1 and ER-β or PR-B should be further studied since these two receptors are transcription activators and may regulate the expression of protective enzymes like EST1E1.

  8. Mississippi Technology Transfer Center

    Science.gov (United States)

    1987-01-01

    The Mississippi Technology Transfer Center at the John C. Stennis Space Center in Hancock County, Miss., was officially dedicated in 1987. The center is home to several state agencies as well as the Center For Higher Learning.

  9. Herschel Observations of a Potential Core Forming Clump: Perseus B1-E

    CERN Document Server

    Sadavoy, S I; Andre, Ph; Pezzuto, S; Bernard, J -P; Bontemps, S; Bressert, E; Chitsazzadeh, S; Fallscheer, C; Hennemann, M; Hill, T; Martin, P; Motte, F; Luong, Q Nguyen; Peretto, N; Reid, M; Schneider, N; Testi, L; White, G J; Wilson, C

    2011-01-01

    We present continuum observations of the Perseus B1-E region from the Herschel Gould Belt Survey. These Herschel data reveal a loose grouping of substructures at 160 - 500 micron not seen in previous submillimetre observations. We measure temperature and column density from these data and select the nine densest and coolest substructures for follow-up spectral line observations with the Green Bank Telescope. We find that the B1-E clump has a mass of ~ 100 solar masses and appears to be gravitationally bound. Furthermore, of the nine substructures examined here, one substructure (B1-E2) appears to be itself bound. The substructures are typically less than a Jeans length from their nearest neighbour and thus, may interact on a timescale of ~ 1 Myr. We propose that B1-E may be forming a first generation of dense cores, which could provide important constraints on the initial conditions of prestellar core formation. Our results suggest that B1-E may be influenced by a strong, localized magnetic field, but further...

  10. Herschel observations of a potential core-forming clump: Perseus B1-E

    Science.gov (United States)

    Sadavoy, S. I.; di Francesco, J.; André, Ph.; Pezzuto, S.; Bernard, J.-P.; Bontemps, S.; Bressert, E.; Chitsazzadeh, S.; Fallscheer, C.; Hennemann, M.; Hill, T.; Martin, P.; Motte, F.; Nguyen Luong, Q.; Peretto, N.; Reid, M.; Schneider, N.; Testi, L.; White, G. J.; Wilson, C.

    2012-04-01

    We present continuum observations of the Perseus B1-E region from the Herschel Gould Belt Survey. These Herschel data reveal a loose grouping of substructures at 160-500 μm not seen in previous submillimetre observations. We measure temperature and column density from these data and select the nine densest and coolest substructures for follow-up spectral line observations with the Green Bank Telescope. We find that the B1-E clump has a mass of ~100 M⊙ and appears to be gravitationally bound. Furthermore, of the nine substructures examined here, one substructure (B1-E2) appears to be itself bound. The substructures are typically less than a Jeans length from their nearest neighbour and thus, may interact on a timescale of ~1 Myr. We propose that B1-E may be forming a first generation of dense cores, which could provide important constraints on the initial conditions of prestellar core formation. Our results suggest that B1-E may be influenced by a strong, localized magnetic field, but further observations are still required.

  11. STUDYING MICROQUASARS AT HIGH-ENERGIES

    Directory of Open Access Journals (Sweden)

    M. Orellana

    2011-01-01

    Full Text Available El estudio de la radiación gamma en fuentes galácticas ha experimentado un progreso radical durante los últimos años gracias a los resultados obtenidos por los telescopios Cherenkov y los aportes de misiones como Fermi. Entre tales fuentes, los sistemas binarios que se han detectado a energías mayores que 100 GeV albergan potentes aceleradores de partículas inmersos en regiones donde pueden operar múltiples procesos no térmicos de emisión y donde la propagación de los fotones energéticos da lugar al desarrollo de cascadas electromagnéticas. A su vez, desde un punto de vista hidrodinámico, también muestran un comportamiento fascinante, y cuya descripción aún no hemos alcanzado. Este tipo de ambiente, con condiciones regularmente variables, provee un excelente laboratorio de comparación para el desarrollo de modelos teóricos. Como último resultado de la combinación entre la acreción y la eyección de materia sobre un objeto compacto, los microcuasares, binarias de rayos X con radio jets, se manifiestan a lo largo de todo el espectro electromagnético. Esta charla presenta una breve puesta al día sobre nuestro conocimiento de estos sistemas, con énfasis en su emisión a muy altas energías.

  12. X-ray spectral states of microquasars

    CERN Document Server

    Malzac, Julien

    2008-01-01

    We discuss the origin of the dramatically different X-ray spectral shapes observed in the Low Hard State (LHS: dominated by thermal comptonisation) and the High Soft State (HSS: dominated by the accretion disc thermal emission and non-thermal comptonisation in the corona). We present numerical simulations using a new code accounting for the so-called synchrotron boiler effect. These numerical simulations when compared to the data allow us to constrain the magnetic field and temperature of the hot protons in the corona. For the hard state of Cygnus X-1 we find a magnetic field below equipartition with radiation, suggesting that the corona is not powered through magnetic field dissipation (as assumed in most accretion disc corona models). On the other hand, our results also point toward proton temperatures that are substantially lower than typical temperatures of the ADAF models. Finally, we show that in both spectral states Comptonising plasma could be powered essentially through power-law acceleration of non-...

  13. Observations of microquasars with the MAGIC telescope

    CERN Document Server

    Rico, J; Bordas, P; Bosch-Ramon, V; Cortina, J; Paredes, J M; Ribó, M; Torres, D F; Zanin, R

    2007-01-01

    We report on the results from the observations in very high energy band (VHE, E_gamma > 100GeV) of the black hole X-ray binary (BHXB) Cygnus X-1. The observations were performed with the MAGIC telescope, for a total of 40 hours during 26 nights, spanning the period between June and November 2006. We report on the results of the searches for steady and variable gamma-ray signals, including the first experimental evidence for an intense flare, of duration between 1.5 and 24 hours.

  14. A multi-flow model for microquasars

    CERN Document Server

    Petrucci, P O; Henri, G; Sauge, L; Pelletier, G

    2005-01-01

    We present a new picture for the central regions of Black Hole X-ray Binaries. In our view, these central regions have a multi-flow configuration which consists in (1) an outer standard accretion disc down to a transition radius r_J, (2) an inner magnetized accretion disc below r_J driving (3) a non relativistic self-collimated electron-proton jet surrounding, when adequate conditions for pair creation are met, (4) a ultra relativistic electron-positron beam. This accretion-ejection paradigm provides a simple explanation to the canonical spectral states, from radio to X/gamma-rays, by varying the transition radius r_J and disc accretion rate independently. Large values of r_J and low accretion rate correspond to Quiescent and Hard states. These states are characterized by the presence of a steady electron-proton MHD jet emitted by the disc below r_J. The hard X-ray component is expect to form at the jet basis. When r_J becomes smaller than the marginally stable orbit r_i, the whole disc resembles a standard a...

  15. Microquasars and ulxs: fossils of grb sources

    Directory of Open Access Journals (Sweden)

    I. F. Mirabel

    2004-01-01

    Full Text Available Las fuentes de destellos gamma de larga duraci on probablemente resultan del colapso de estrellas masivas en sistemas binarios. Despu es del colapso de la estrella primaria el sistema binario puede permanecer ligado gravitacionalmente dejando como remanente un microcu asar o una fuente Ultraluminosa en rayos X (ULX. En este contexto, los microcu asares y las ULXs son f osiles de las fuentes de destellos gamma y contienen claves sobre la f sica y astrof sica de las fuentes de destellos gamma progenitoras. Aqu muestro que la identi caci on del lugar de nacimiento de los microcu asares acota las propiedades de las estrellas progenitoras de objetos compactos, y que la velocidad con que es disparado el microcu asar puede ser usada para acotar la energ a de la explosi on de las estrellas masivas que son progenitoras de estrellas de neutrones y agujeros negros. Las observaciones muestran que los sistemas binarios con estrellas de neutrones LS 5039, LSI +61 303 y el agujero negro de baja masa en GRO J1655-40 se formaron en explosiones energ eticas, mientras que los agujeros negros de masas mayores (M 10 M en Cygnus X-1 y GRS 1915+105 se formaron por colapso directo en oscuridad completa o en supernovas de baja luminosidad. La asociaci on con c umulos de estrellas masivas de las estrellas de neutrones en LSI +61 303 y de los magnetares SGR 1806-20 and SGR 1900+14, sugiere que estrellas muy masivas (M 50 M pueden bajo ciertas circunstancias, terminar como estrellas de neutrones y no como agujeros negros. Lss fuentes de destellos gamma de larga duraci on contienen los mismos ingredientes b asicos que los microcu asares y las ULXs, objetos compactos con discos de acreci on y chorros relativistas en sistemas binarios, y las analogias fenomenol ogicas encontradas entre los microcu asares y N ucleos Activos de Galaxias podr an ser extendidas a las fuentes de destellos gamma.

  16. SS433: The microquasar link with ulxs?

    Directory of Open Access Journals (Sweden)

    P. A. Charles

    2004-01-01

    Full Text Available SS433 es el microcuasar prototipo de la Galaxia y posiblemente incluso an alogo a las fuentes ULX si se tiene en cuenta la energ a cin etica de los \\jets". Sin embargo y a pesar de 20 a~nos de estudio, nuestras restricciones sobre la naturaleza del sistema binario son extremadamente grandes debido a la di cultad de localizar rasgos espectrales capaces de revelar la naturaleza y el movimiento del donador de la masa. Los espectros azules de alta resoluci on recientemente obtenidos cuando el disco (en precesi on se encuentra de per l, sugieren que la binaria se halla cerca de la fase de envolvente com un, lo cual hace extremadamente dif cil obtener las restricciones cin eticas. Sin embargo, encontramos evidencia de un donador masivo como era de esperar para la muy alta tasa de transferencia de masa inferida y comparamos las propiedades de SS433 con las de Cyg X3.

  17. Monitoring and modeling radio flares from microquasars

    CERN Document Server

    Trushkin, S A; Bursov, N N

    2000-01-01

    We present results of long-term daily monitoring of a sample of Galactic radio-emitting X-ray binaries showing relativistic jets (RJXRB): SS433, Cyg X-3, and GRS 1915+105, with the RATAN-600 radio telescope in the 0.6-22 GHz range. We carried out the modeling calculations to understand the temporal (1--100 days) and spectral (1-22 GHz) dependence. We tested the finite jet segment models and we found that the geometry of the conical hollow jets is responsible for either a power law or an exponential decay of the flares. SS433 was monitored for 100 days in 1997 and 120 days in 1999. From the quiescent radio light curves, we obtained clear evidence of a 6.04-day 10-15% modulation. Three powerful flares (up to 13 Jy) from Cyg X-3 were detected in April 2000.

  18. Effects of E2 and E1-E2 Interference on Coulomb Dissociation of 19C

    Institute of Scientific and Technical Information of China (English)

    Rajesh Kharab; Pardeep Singh; Ravinder Kumar

    2007-01-01

    We investigate the effects of higher order multipole transitions, in particular electric quadrupole (E2) and E1-E2interference, on the Coulomb dissociation of 19 C within the framework of the first order eikonal approximation.The sensitivity of the total Coulomb breakup cross section and the longitudinal momentum distribution of the core fragment to these effects are checked. The breakup occurs predominately through the dipole transition and the contribution of E2 transition to the total cross section is found to be within the range from 1 to 3% of that of E1. It is further observed that the E1-E2 interference term contributes nothing to the integrated cross section.On the other hand, the longitudinal momentum distribution is observed to be insensitive to the E2 transition while the E1-E2 interference introduces a small asymmetry in its shape.

  19. A Note on the Discovery of Absorption Features in 1E 1207.4-5209

    Institute of Scientific and Technical Information of China (English)

    徐仁新; 王洪光; 乔国俊

    2003-01-01

    Sanwal et al. [Astrophys. J. 574 (2002) L61] supposed that it is very difficult to interpret the absorption features in terms of cyclotron lines. However, we would like to address here that the possibility of the absorption being cyclotron resonance cannot be ruled out. We propose that the isolate neutron star, 1E 1207.4-5209 in the centre of supernova remnant PKS 1209-51/52, has a debris disc and is in a propeller phase, with an accretion rate ~ 6 × 10-11M⊙/year. In this scenario, 1E 1207.4-5209 could also be a bare strange star.

  20. Birc1e/Naip5 rapidly antagonizes modulation of phagosome maturation by Legionella pneumophila.

    Science.gov (United States)

    Fortier, Anne; de Chastellier, Chantal; Balor, Stéphanie; Gros, Philippe

    2007-04-01

    Legionella survives intracellularly by preventing fusion with lysosomes, due to phagosome escape from the endocytic pathway at an early stage of phagosome maturation, and by creating a replicative organelle that acquires endoplasmic reticulum (ER) characteristics through sustained interactions and fusion with the ER. Intracellular replication of Legionella pneumophila in mouse macrophages is controlled by the Lgn1 locus. Functional complementation in vivo has identified the Birc1e/Naip5 gene as being responsible for the Lgn1 effect. To understand the function and temporal site of action of Birc1e/Naip5 in susceptibility to L. pneumophila, we examined the biogenesis of Legionella-containing vacuoles (LCVs) formed in permissive A/J macrophages and in their Birc1e/Naip5 transgenic non-permissive counterpart. Birc1e/Naip5 effects on acquisition of lysosomal and ER markers were evident within 1-2 h following infection. A significantly higher proportion of LCVs formed in Birc1e/Naip5 transgenic macrophages had acquired the lysosomal markers cathepsin D and Lamp1 by 2 h post infection, whereas a significantly higher proportion of LCVs formed in permissive macrophages were positively stained for the ER markers BAP31 and calnexin, 6 h post infection. Likewise, studies by electron microscopy showed acquisition of lysosomal contents (horseradish peroxidase), within the first hour following phagocytic uptake, by LCVs formed in Birc1e/Naip5 transgenic macrophages and delivery of the ER marker glucose 6-phosphatase (G6Pase) only to the lumen of LCVs formed in A/J macrophages. Finally, a larger proportion of LCVs formed in A/J macrophages were studded with ribosomes 24 h post infection, compared with LCVs formed in Birc1e/Naip5 transgenic macrophages. These results suggest that sensing of L. pneumophila products by Birc1e/Naip5 in macrophages occurs rapidly following phagocytosis, a process that antagonizes the ability of L. pneumophila to remodel its phagosome into a specialized

  1. Complete Genome Sequences of Legionella pneumophila subsp. fraseri Strains Detroit-1 and Dallas 1E

    Science.gov (United States)

    Raphael, Brian H.; Kozak-Muiznieks, Natalia A.; Morrison, Shatavia S.; Mercante, Jeffrey W.

    2017-01-01

    ABSTRACT We report here the complete genome sequences of two of the earliest known strains of Legionella pneumophila subsp. fraseri. Detroit-1 is serogroup 1 and was isolated from a lung biopsy specimen in 1977. Dallas 1E is serogroup 5 and was isolated in 1978 from a cooling tower. PMID:28153889

  2. Exceptional flaring activity of the anomalous X-ray pulsar 1E 1547.0-5408

    CERN Document Server

    Savchenko, V; Beckmann, V; Produit, N; Walter, R

    2009-01-01

    (Abridged) We studied an exceptional period of activity of the anomalous X-ray pulsar 1E 1547.0-5408 in January 2009, during which about 200 bursts were detected by INTEGRAL. The major activity episode happened when the source was outside the field of view of all the INTEGRAL instruments. But we were still able to study the properties of 84 bursts detected simultaneously by the anti-coincidence shield of the spectrometer SPI and by the detector of the imager ISGRI. We find that the luminosity of the 22 January 2009 bursts of 1E 1547.0-5408 was > 1e42 erg/s. This luminosity is comparable to that of the bursts of soft gamma repeaters (SGR) and is at least two orders of magnitude larger than the luminosity of the previously reported bursts from AXPs. Similarly to the SGR bursts, the brightest bursts of 1E 1547.0-5408 consist of a short spike of ~100 ms duration with a hard spectrum, followed by a softer extended tail of 1-10 s duration, which occasionally exhibits pulsations with the source spin period of ~2 s. ...

  3. NuSTAR Observations of the Magnetar 1E 2259+586

    DEFF Research Database (Denmark)

    Vogel, Julia K.; Hascoet, Romain; Kaspi, Victoria M.;

    2014-01-01

    We report on new broad band spectral and temporal observations of the magnetar 1E 2259+586, which is located in the supernova remnant CTB 109. Our data were obtained simultaneously with the Nuclear Spectroscopic Telescope Array (NuSTAR) and Swift, and cover the energy range from 0.5-79 keV. We pr...

  4. The spectrum and pulses of 1E 2259+586 from ASCA and BBXRT observations

    Science.gov (United States)

    Corbet, R. H. D.; Smale, A. P.; Ozaki, M.; Koyama, K.; Iwasawa, K.

    1995-01-01

    The 7 s X-ray pulsator 1E 2259+586 was observed for approximately 1 day in 1993 with the Advanced Satellite for Cosmology and Astrophysics (ASCA). Observations were also obtained with Broad Band X-ray Telescope (BBXRT) in 1990 a few months after Ginga had observed 1E 2259+586 to be brighter than normal and the BBXRT data show 1E 2259+586 to be at an intermediate brightness level. By contrast, the ASCA data appear to have been obtained during a more common lower luminosity state. The pulse profiles we obtain are consistent with a connection between flux and pulse shape reported from Ginga data, and the pulsator continues to spin down. We use our high spectral resolution data to search for cyclotron lines in the spectrum that were claimed from observations made with other satellites. We find that the ASCA spectra of 1E 2259+586 cannot be satisfactorily fitted with either a single power law or a combination of two power laws, and that significant residuals occur around 1.5 and 5 keV. However, a combination of a power law and blackbody gives a good fit over the entire ASCA energy band with no evidence of spectral features. We have reanalyzed a Ginga LAC spectrum and find that this is also significantly better fitted by this two-component spectrum than a single power law. A possible explanation for such a two-component spectrum is that the blackbody emission comes from a neutron star and that the power-law component comes, at least in part, from a surrounding nebula. As there has, so far, no direct evidence that 1E 2259+586 is a binary system we consider whether there are other plausible mechanisms that might power the observed X-ray emission.

  5. Transplant Center Search Form

    Science.gov (United States)

    ... Share Your Story Give Us Feedback - A + A Transplant Center Search Form Welcome to the Blood & Marrow ... transplant centers for patients with a particular disease. Transplant Center login Username: * Password: * Request new password Join ...

  6. Children's cancer centers

    Science.gov (United States)

    Pediatric cancer center; Pediatric oncology center; Comprehensive cancer center ... Treating childhood cancer is not the same as treating adult cancer. The cancers are different. So are the treatments and the ...

  7. Models of pair annihilation in 1E 1740.7-2942 and the HEAO 1 A-4 annihilation source

    Science.gov (United States)

    Maciolek-Niedzwiecki, Andrzej; Zdziarski, Andrzej

    1994-01-01

    We study possible models of two Galactic sources of transient pair annihilation radiation, 1E 1740.7-2942 and a source observed by High Energy Astronomy Observatory (HEAO) 1 A-4. We fit the observed spectral features by thermal annihilation spectra and find that the redshifts obtained by us are much larger than those obtained from fitting Caussian lines centered on 511 keV. This effect, which is due to the net blueshift (with respect to 511 keV) of the annihilation spectrum due to the thermal energies of pairs, puts strong constraints on models of sources. We consider those constraints first without considering the mechanism of positron production. From the shape of the observed spectra, we are able to rule out both spherical clouds and layers above cold matter as possible source geometries. The observed spectra are compatible with two source geometries: (1) a nearly face-on disk in the Kerr metric and (2) a jet close to a black hole. We consider, then, the origin of the pairs. Theories of both thermal and nonthermal pair equilibria predict that photon-pair production is unable to produce annihilation features that contain as much as half of the bolometric luminosity, which is observed. A possible solution to this problem is obscuration of a nonthermal source (in which pairs are produced by photon-photon collisions) and an outflow of pairs to an unobscured region. This makes annihilation in a jet the most likely model of the considered sources.

  8. Southern California Particle Center

    Data.gov (United States)

    Federal Laboratory Consortium — At the Southern California Particle Center, center researchers will investigate the underlying mechanisms that produce the health effects associated with exposure to...

  9. Womens Business Center

    Data.gov (United States)

    Small Business Administration — Women's Business Centers (WBCs) represent a national network of nearly 100 educational centers throughout the United States and its territories, which are designed...

  10. Suzaku Studies of the Supernova Remnant CTB~109 Hosting the Magnetar 1E~2259+586

    CERN Document Server

    Nakano, Toshio; Hiraga, Junoko S; Uchiyama, Hideki; Kaneda, Hidehiro; Enoto, Teruaki

    2015-01-01

    Ages of the magnetar 1E 2259+586 and the associated supernova remnant CTB~109 were studied. Analyzing the Suzaku data of CTB~109, its age was estimated to be $\\sim$14~kyr, which is much shorter than the measured characteristic age of 1E 2259+586, 230 kyr. This reconfirms the previously reported age discrepancy of this magnetar/remnant association, and suggests that the characteristic ages of magnetars are generally over-estimated as compared to their true ages. This discrepancy is thought to arise because the former are calculated without considering decay of the magnetic fields. This novel view is supported independently by much stronger Galactic-plane concentration of magnetars than other pulsars. The process of magnetic field decay in magnetars is mathematically modeled. It is implied that magnetars are much younger objects than previously considered, and can dominate new-born neutron stars.

  11. Possible NIR counterpart to the AXP 1E 1547.0-5408

    Science.gov (United States)

    Mignani, R. P.; Rea, N.; Israel, G. L.; Testa, V.; Esposito, P.

    2008-10-01

    On 2008 October 3rd, Swift-BAT triggered on several short bursts from the direction of the Anomalous X-ray Pulsar (AXP) 1E1547.0-5408 (Krimm et al. GCN 8311, 8312; Rea et al. Atel #1756). This is the second known transient radio AXP discovered to date (Gelfand & Gaensler 2007; Camilo et al. 2007), and it showed the previous X-ray outburst around June 2007 (Halpern et al. 2008). During the decay of the 2007 X-ray outburst we observed 1E 1547.0-5408 in the Ks band (on 2007 July 8th, 12th, and August 17th) with the NAOS -CONICA (NACO) instrument mounted at the ESO- VLT (Mignani, Rea, Testa, et al., 2008 submitted).

  12. "5M1E"法在生产管理中的运用

    Institute of Scientific and Technical Information of China (English)

    刘秋香

    2010-01-01

    人(man)、机械(machine)、材料(material)、方法(method)、环境(enviroment)、管理(manage)这几个主要环节实行全面质量管理,称为"5M1E"法.在生产管理中应用该法,可以达到提升人品质、提升产品品质,提高员工士气.

  13. Phenotypic diversity of toxigenic Vibrio cholerae O1 E1 Tor strains identified in China

    Institute of Scientific and Technical Information of China (English)

    赵璇

    2014-01-01

    Objective To understand the phenotypic diversity of toxigenic Vibrio cholerae O1 E1 Tor strains isolated from different provinces in China during the last 50 years.Methods Traditional biotyping testings including susceptibility to polymyxin B,sensitivity to groupⅣphage,Voges-Proskauer test and haemolysis of sheep erythrocytes were conducted.Results Data from Biotype-specific phenotype analysis revealed that only 133 isolates carried the typical E1 Tor phenotypes while the other 251

  14. Evidence for the magnetar nature of 1E 161348-5055 in RCW 103

    Science.gov (United States)

    D'Aì, A.; Evans, P. A.; Burrows, D. N.; Kuin, N. P. M.; Kann, D. A.; Campana, S.; Maselli, A.; Romano, P.; Cusumano, G.; La Parola, V.; Barthelmy, S. D.; Beardmore, A. P.; Cenko, S. B.; De Pasquale, M.; Gehrels, N.; Greiner, J.; Kennea, J. A.; Klose, S.; Melandri, A.; Nousek, J. A.; Osborne, J. P.; Palmer, D. M.; Sbarufatti, B.; Schady, P.; Siegel, M. H.; Tagliaferri, G.; Yates, R.; Zane, S.

    2016-12-01

    We report on the detection of a bright, short, structured X-ray burst coming from the supernova remnant RCW 103 on 2016 June 22 caught by the Swift/Burst Alert Telescope (BAT) monitor, and on the follow-up campaign made with Swift/X-ray Telescope, Swift/UV/Optical Telescope, and the optical/near-infrared (NIR) Gamma-Ray burst Optical and Near-infrared Detector. The characteristics of this flash, such as duration and spectral shape, are consistent with typical short bursts observed from soft gamma repeaters. The BAT error circle at 68 per cent confidence range encloses the point-like X-ray source at the centre of the nebula, 1E 161348-5055. Its nature has been long debated due to a periodicity of 6.67 h in X-rays, which could indicate either an extremely slow pulsating neutron star, or the orbital period of a very compact X-ray binary system. We found that 20 min before the BAT trigger, the soft X-ray emission of 1E 161348-5055 was a factor of ˜100 higher than measured 2 yr earlier, indicating that an outburst had already started. By comparing the spectral and timing characteristics of the source in the 2 yr before the outburst and after the BAT event, we find that, besides a change in luminosity and spectral shape, also the 6.67 h pulsed profile has significantly changed with a clear phase shift with respect to its low-flux profile. The UV/optical/NIR observations did not reveal any counterpart at the position of 1E 161348-5055. Based on these findings, we associate the BAT burst with 1E 161348-5055, we classify it as a magnetar, and pinpoint the 6.67 h periodicity as the magnetar spin period.

  15. A Mid-Infrared Counterpart to the Magnetar 1E 2259+586

    CERN Document Server

    Kaplan, David L; Wang, Zhongxiang; Wachter, Stefanie

    2009-01-01

    We report the discovery of a 4.5 um counterpart to the anomalous X-ray pulsar (magnetar) 1E 2259+586 with the Spitzer Space Telescope. The mid-infrared flux density is 6.3+/-1.0 uJy at 4.5 um and <20 uJy (at 95% confidence) at 8 um, or 0.02% of the 2-10 keV X-ray flux (corrected for extinction). Combining our Spitzer measurements with previously published near-infrared data, we show that the overall infrared emission from 1E 2259+586 is qualitatively similar to that from the magnetar 4U 0142+61. Therefore the passive X-ray-heated dust disk model originally developed for 4U 0142+61 might also apply to 1E 2259+586. However, the IR data from this source can also be fitted by a simple power-law spectrum as might be expected from magnetospheric emission.

  16. Neutronic analysis of the 1D and 1E banks reflux detection system

    Energy Technology Data Exchange (ETDEWEB)

    Blanchard, A.

    1999-12-21

    Two H Canyon neutron monitoring systems for early detection of postulated abnormal reflux conditions in the Second Uranium Cycle 1E and 1D Mixer-Settle Banks have been designed and built. Monte Carlo neutron transport simulations using the general purpose, general geometry, n-particle MCNP code have been performed to model expected response of the monitoring systems to varying conditions.The confirmatory studies documented herein conclude that the 1E and 1D neutron monitoring systems are able to achieve adequate neutron count rates for various neutron source and detector configurations, thereby eliminating excessive integration count time. Neutron count rate sensitivity studies are also performed. Conversely, the transport studies concluded that the neutron count rates are statistically insensitive to nitric acid content in the aqueous region and to the transition region length. These studies conclude that the 1E and 1D neutron monitoring systems are able to predict the postulated reflux conditions for all examined perturbations in the neutron source and detector configurations. In the cases examined, the relative change in the neutron count rates due to postulated transitions from normal {sup 235}U concentration levels to reflux levels remain satisfactory detectable.

  17. Student Success Center Toolkit

    Science.gov (United States)

    Jobs For the Future, 2014

    2014-01-01

    "Student Success Center Toolkit" is a compilation of materials organized to assist Student Success Center directors as they staff, launch, operate, and sustain Centers. The toolkit features materials created and used by existing Centers, such as staffing and budgeting templates, launch materials, sample meeting agendas, and fundraising…

  18. Taiyuan Satellite Launch Center

    Institute of Scientific and Technical Information of China (English)

    LiuJie

    2004-01-01

    There are three major space launch bases in China, the Jiuquan Satellite Launch Center,the Taiyuan Satellite Launch Center and the Xichang Satellite Launch Center. All the three launch centers are located in sparsely populated areas where the terrain is even and the field of vision is broad. Security, transport conditions and the influence of the axial rotation

  19. Automation of The Guiding Center Expansion

    CERN Document Server

    Burby, J W; Qin, H

    2013-01-01

    We report on the use of the recently-developed Mathematica package \\emph{VEST} (Vector Einstein Summation Tools) to automatically derive the guiding center transformation. Our Mathematica code employs a recursive procedure to derive the transformation order-by-order. This procedure has several novel features. (1) It is designed to allow the user to easily explore the guiding center transformation's numerous non-unique forms or representations. (2) The procedure proceeds entirely in cartesian position and velocity coordinates, thereby producing manifestly gyrogauge invariant results; the commonly-used perpendicular unit vector fields $e_1,e_2$ are never even introduced. (3) It is easy to apply in the derivation of higher-order contributions to the guiding center transformation without fear of human error. Our code therefore stands as a useful tool for exploring subtle issues related to the physics of toroidal momentum conservation in tokamaks.

  20. Automation of The Guiding Center Expansion

    Energy Technology Data Exchange (ETDEWEB)

    J. W. Burby, J. Squire and H. Qin

    2013-03-19

    We report on the use of the recently-developed Mathematica package VEST (Vector Einstein Summation Tools) to automatically derive the guiding center transformation. Our Mathematica code employs a recursive procedure to derive the transformation order-by-order. This procedure has several novel features. (1) It is designed to allow the user to easily explore the guiding center transformation's numerous nonunique forms or representations. (2) The procedure proceeds entirely in cartesian position and velocity coordinates, thereby producing manifestly gyrogauge invariant results; the commonly-used perpendicular unit vector fields e1, e2 are never even introduced. (3) It is easy to apply in the derivation of higher-order contributions to the guiding center transformation without fear of human error. Our code therefore stands as a useful tool for exploring subtle issues related to the physics of toroidal momentum conservation in tokamaks

  1. Automation of the guiding center expansion

    Energy Technology Data Exchange (ETDEWEB)

    Burby, J. W.; Squire, J. [Princeton Plasma Physics Laboratory, Princeton, New Jersey 08543 (United States); Qin, H. [Princeton Plasma Physics Laboratory, Princeton, New Jersey 08543 (United States); Department of Modern Physics, University of Science and Technology of China, Hefei, Anhui 230026 (China)

    2013-07-15

    We report on the use of the recently developed Mathematica package VEST (Vector Einstein Summation Tools) to automatically derive the guiding center transformation. Our Mathematica code employs a recursive procedure to derive the transformation order-by-order. This procedure has several novel features. (1) It is designed to allow the user to easily explore the guiding center transformation's numerous non-unique forms or representations. (2) The procedure proceeds entirely in cartesian position and velocity coordinates, thereby producing manifestly gyrogauge invariant results; the commonly used perpendicular unit vector fields e{sub 1},e{sub 2} are never even introduced. (3) It is easy to apply in the derivation of higher-order contributions to the guiding center transformation without fear of human error. Our code therefore stands as a useful tool for exploring subtle issues related to the physics of toroidal momentum conservation in tokamaks.

  2. PRELIMINARY STUDY OF A NOVEL HUMAN PAPILLOMAVIRUS TYPE 16 L1/E6-E7 CHIMERIC RECOMBINANT DNA VACCINE

    Institute of Scientific and Technical Information of China (English)

    郑瑾; 马军; 张福萍; 杨筱凤; 董小平; 司履生; 王一理

    2004-01-01

    Objective Preparations of HPV16 L1/E6 and L1/E7 prophylactic and therapeutic DNA vaccines. Methods The nucleotides within HPV16 E6 and E7 genes, which are responsible for viral transforming activity, were mutated by mage primer site-directed mutagenesis method. The correctly mutated E6 and E7 fragments were separately cloned into an eukaryotic expression vector pVAX1, together with HPV16 L1 gene, generating chimeric recombinants plasmids 1MpVAX1-L1E6, 2MpVAX1-L1E6, 1MpVAX1-L1E7, 2MpVAX1-L1E7 and 3MpVAX1-L1E7. CHO cells were transiently transfected with the individual DNA vaccines by calcium phosphate method. Target protein expressions in the extracts of the transfected cell lines were measured by ELISA and immunohistochemistry, with HPV16 L1 and E6 specific monoclonal antibodies. Results ELISA assays showed the P/N ratios in the cell extracts transfected with L1E6 and L1E7 plasmids were more than 2.1. Immunohistochemistry revealed brownish precipitant signal in cytoplasm and nuclei of the transfected cells. Conclusion Successful constructions of prophylactic and therapeutic DNA vaccine plasmids lay solid foundation for future animal experiment and clinical trial.

  3. Deep NuSTAR and Swift monitoring observations of the magnetar 1E 1841-045

    DEFF Research Database (Denmark)

    An, Hongjun; Archibald, Robert F.; Hascoët, Romain;

    2015-01-01

    We report on a 350 ks NuSTAR observation of the magnetar 1E 1841-045 taken in 2013 September. During the observation, NuSTAR detected six bursts of short duration, with T90 ≲ 1 s. An elevated level of emission tail is detected after the brightest burst, persisting for ~1 ks. The emission showed a...... consistent with the footprint of the twisted magnetic field lines on the star. We also report on the 3 yr Swift monitoring observations obtained since 2011 July. The soft-X-ray spectrum remained stable during this period, and the timing behavior was noisy, with large timing residuals....

  4. The new SGR 1550-5418 is the old AXP 1E1547.0-5408

    Science.gov (United States)

    Rea, N.; Esposito, P.; Krimm, H. A.; Palmer, D. M.; Mereghetti, S.; Tiengo, A.; Israel, G. L.

    2008-10-01

    N. Rea (U. Amsterdam), P. Esposito (INAF-IASF, Milan), H. A. Krimm (CRESST/GSFC/USRA), D. M. Palmer (LANL), S. Mereghetti, A. Tiengo (INAF-IASF, Milan), G.L. Israel (INAF-OAR) Swift-BAT triggered today on several Galactic short bursts (Krimm et al. GCN 8311, 8312), which were claimed to come from a new Soft Gamma Repeater SGR 1550-5418. However, given the positional coincidence of this new putative SGR 1550-5418 with the Anomalous X-ray Pulsar (AXP) 1E1547.0-5408 (Gelfand & Gaensler 2007; Camilo et al.

  5. Analysis of trapped gas in 1E34 detonators by gas chromatography

    Energy Technology Data Exchange (ETDEWEB)

    Warner, D.K.; Back, P.S.; Barnhart, B.V.

    1980-05-14

    A method was developed to extract and then analyze gas trapped in thermally aged 1E34 detonators. This gas was extracted into an evacuated volume and injected into a gas chromatograph for separation and quantitative analysis. To effect this gas extraction, a device was designed for puncturing the detonator cup and capturing the effused gas. Limited testing of five detonators in this device shows amounts of gas ranging from about 0.5 X 10 {sup -7} to 12 X 10 {sup - 7} moles.

  6. AKAP 18 alpha and gamma have opposing effects on insulin release in INS-1E cells

    DEFF Research Database (Denmark)

    Josefsen, Knud; Lee, Ying C; Thams, Peter;

    2010-01-01

    A-kinase anchoring proteins (AKAPs) are known to compartmentalise protein kinase(s) to discrete cellular locations. Here we show that silencing of AKAP 18 alpha or gamma expression results in decreased or increased glucose-stimulated insulin secretion in INS-1E cells. Glucose stimulates AKAP 18...... alpha and inhibits AKAP 18 gamma mRNA expressions while palmitate markedly reduces AKAP 18 alpha expression. Human growth hormone (GH) stimulates AKAP 18 alpha expression and attenuates palmitate-induced suppression of AKAP 18 alpha mRNA level. The roles of AKAP 18 alpha and gamma in mediating insulin...

  7. SNR 1E0102.2-7219 after Six Years with Chandra

    Science.gov (United States)

    Rutkowski, M. J.; Schlegel, E. M.; Keohane, J.

    2005-12-01

    We present Chandra X-ray Observatory archived observations of the supernova remnant 1E0102.2-7219 in the Small Magellanic Cloud. Combining 22 ACIS-I observations for 230 ks of total exposure time, we present ACIS images with an unprecedented signal to noise ratio for this remnant. We present three upper limits on the X-ray flux for the remnant's elusive central compact object, which are consistent with current neutron star cooling models, based on a Cas A-like blackbody spectrum. Additionally, we discuss the elliptical structure of the remnant and the relative positions of the blast wave, the reverse shock, and the extent of 1E0102.2-7219's rim. This research was supported by the NSF REU Program at SAO under Eric Schlegel, whose research was supported by contract number NAS8-39073 from NASA to SAO for operation of the Chandra X-Ray Observatory. Jonathan Keohane's research was supported by Chandra award GO3-4070C.

  8. Mutant AKT1-E17K is oncogenic in lung epithelial cells

    Science.gov (United States)

    De Marco, Carmela; Malanga, Donatella; Rinaldo, Nicola; De Vita, Fernanda; Scrima, Marianna; Lovisa, Sara; Fabris, Linda; Carriero, Maria Vincenza; Franco, Renato; Rizzuto, Antonia; Baldassarre, Gustavo; Viglietto, Giuseppe

    2015-01-01

    The hotspot E17K mutation in the pleckstrin homology domain of AKT1 occurs in approximately 0.6–2% of human lung cancers. In this manuscript, we sought to determine whether this AKT1 variant is a bona-fide activating mutation and plays a role in the development of lung cancer. Here we report that in immortalized human bronchial epithelial cells (BEAS-2B cells) mutant AKT1-E17K promotes anchorage-dependent and -independent proliferation, increases the ability to migrate, invade as well as to survive and duplicate in stressful conditions, leading to the emergency of cells endowed with the capability to form aggressive tumours at high efficiency. We provide also evidence that the molecular mechanism whereby AKT1-E17K is oncogenic in lung epithelial cells involves phosphorylation and consequent cytoplasmic delocalization of the cyclin-dependent kinase (cdk) inhibitor p27. In agreement with these results, cytoplasmic p27 is preferentially observed in primary NSCLCs with activated AKT and predicts poor survival. PMID:26053093

  9. The anti-glitch of magnetar 1E 2259+586 in the wind braking scenario

    Energy Technology Data Exchange (ETDEWEB)

    Tong, H., E-mail: tonghao@xao.ac.cn [Xinjiang Astronomical Observatory, Chinese Academy of Sciences, Urumqi, Xinjiang (China)

    2014-04-01

    The anti-glitch of magnetar 1E 2259+586 is analyzed theoretically. An enhanced particle wind during the observational interval takes away additional rotational energy of the neutron star, which will result in a net spin-down of the magnetar, i.e., an anti-glitch. In the wind braking scenario of the anti-glitch, there are several predictions: (1) a radiative event will always accompany the anti-glitch, (2) there will be a decrease/variation of the braking index after the anti-glitch, and (3) the anti-glitch is just a period of enhanced spin-down. If there are enough timing observations, a period of enhanced spin-down is expected instead of an anti-glitch. Applications to previous timing events of SGR 1900+14 and PSR J1846–0258 are also included. It is shown that current timing events of 1E 2259+586, SGR 1900+14, and PSR J1846–0258 can be understood safely in the wind braking model. The enhanced spin-down and absence of an anti-glitch before the giant flare of SGR 1806–20 is consistent with the wind braking scenario.

  10. Mutagenic Potential ofBos taurus Papillomavirus Type 1 E6 Recombinant Protein: First Description

    Directory of Open Access Journals (Sweden)

    Rodrigo Pinheiro Araldi

    2015-01-01

    Full Text Available Bovine papillomavirus (BPV is considered a useful model to study HPV oncogenic process. BPV interacts with the host chromatin, resulting in DNA damage, which is attributed to E5, E6, and E7 viral oncoproteins activity. However, the oncogenic mechanisms of BPV E6 oncoprotein per se remain unknown. This study aimed to evaluate the mutagenic potential of Bos taurus papillomavirus type 1 (BPV-1 E6 recombinant oncoprotein by the cytokinesis-block micronucleus assay (CBMNA and comet assay (CA. Peripheral blood samples of five calves were collected. Samples were subjected to molecular diagnosis, which did not reveal presence of BPV sequences. Samples were treated with 1 μg/mL of BPV-1 E6 oncoprotein and 50 μg/mL of cyclophosphamide (positive control. Negative controls were not submitted to any treatment. The samples were submitted to the CBMNA and CA. The results showed that BPV E6 oncoprotein induces clastogenesis per se, which is indicative of genomic instability. These results allowed better understanding the mechanism of cancer promotion associated with the BPV E6 oncoprotein and revealed that this oncoprotein can induce carcinogenesis per se. E6 recombinant oncoprotein has been suggested as a possible vaccine candidate. Results pointed out that BPV E6 recombinant oncoprotein modifications are required to use it as vaccine.

  11. Evidence for the magnetar nature of 1E 161348-5055 in RCW 103

    CERN Document Server

    D'Aì, A; Burrows, D N; Lien, A Y; Kann, D A; Campana, S; Maselli, A; Romano, P; Cusumano, G; La Parola, V; Beardmore, A P; Cenko, B; De Pasquale, M; Gehrels, N; Greiner, J; Kennea, J A; Klose, S; Melandri, A; Nousek, J A; Osborne, J P; Sbarufatti, B; Siegel, M H; Schady, P; Tagliaferri, G; Yates, R; Zane, S

    2016-01-01

    We report on the detection of a bright, short, hard X-ray burst coming from the supernova remnant RCW 103 on 2016 June 22 caught by the \\emph{Swift}/BAT monitor, and on a follow-up campaign made with \\emph{Swift}/XRT and the optical/NIR GROND detector. The characteristics of the flash, such as duration and spectral shape, are consistent with typical bursts observed from soft gamma repeaters. The BAT error circle at 68\\% confidence range encloses the point-like X-ray source at the centre of the nebula, 1E 161348-5055. Its nature has been long debated because of a periodicity of 6.67 hr in X-rays, that could indicate either an extremely slow pulsating neutron star, or an orbital period of a very compact X-ray binary system. We found that the soft X-ray emission of 1E 161348-5055, 20 minutes earlier than the BAT detected burst, was already a factor $\\sim$ 100 higher with respect to the past two years, indicating that an outburst had started. By comparing the spectral and timing characteristics of the source in t...

  12. Proposal to Search for Magnetically Charged Particles with Magnetic Charge 1e

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, Michael K. [SLAC National Accelerator Lab., Menlo Park, CA (United States); Fryberger, David [SLAC National Accelerator Lab., Menlo Park, CA (United States)

    2015-11-02

    A model for composite elementary Standard Model (SM) particles based upon magnetically bound vorton pairs, we briefly introduce here, predicts the existence of a complete family of magnetically charged particles, as well as their neutral isotopic partners (all counterparts to the SM elementary particles), in which the lowest mass (charged) particle would be an electrically neutral stable lepton, but which carries a magnetic charge equivalent to 1e. This new particle, which we call a magneticon (a counterpart to the electron) would be pair produced at all e+e- colliders at an Ecm above twice its mass. In addition, PP and PPbar colliders should also be able to produce these new particles through the Drell-Yan process. To our knowledge, no monopole search experiment has been sensitive to such a low-charged magnetic monopole above a particle mass of about 5 GeV/c2. Hence, we propose that a search for such a stable particle of magnetic charge 1e should be undertaken. We have taken the ATLAS detector at the LHC as an example in which this search might be done. To this end, we modeled the magnetic fields and muon trigger chambers of this detector. We show results from a simple Monte Carlo simulation program to indicate how these particles might look in the detector and describe how one might search for these new particles in the ATLAS data stream.

  13. Hydrologic Engineering Center

    Data.gov (United States)

    Federal Laboratory Consortium — The Hydrologic Engineering Center (HEC), an organization within the Institute for Water Resources, is the designated Center of Expertise for the U.S. Army Corps of...

  14. NIH Clinical Centers

    Data.gov (United States)

    Federal Laboratory Consortium — The NIH Clinical Center consists of two main facilities: The Mark O. Hatfield Clinical Research Center, which opened in 2005, houses inpatient units, day hospitals,...

  15. Center for Women Veterans

    Science.gov (United States)

    ... Aid & Attendance & Housebound Caregivers Community Living Centers (CLC) Community Nursing Homes Domiciliaries (Please contact your local VA Medical Center) Homemaker & Home Health Aid Care Hospice and Palliative Care State Veterans ...

  16. BKG Data Center

    Science.gov (United States)

    Thorandt, Volkmar; Wojdziak, Reiner

    2013-01-01

    This report summarizes the activities and background information of the IVS Data Center for the year 2012. Included is information about functions, structure, technical equipment, and staff members of the BKG Data Center.

  17. Day Care Centers

    Data.gov (United States)

    Department of Homeland Security — This database contains locations of day care centers for 50 states and Washington D.C. and Puerto Rico. The dataset only includes center based day care locations...

  18. Poison Control Centers

    Science.gov (United States)

    ... 1222 immediately. Name State American Association of Poison Control Centers Address AAPCC Central Office NOT A POISON ... not for emergency use. Arkansas ASPCA Animal Poison Control Center Address 1717 S. Philo Road, Suite 36 Urbana, ...

  19. Center of Attention.

    Science.gov (United States)

    Coffey, J. Steven; Wood-Steed, Ruth

    2001-01-01

    Illustrates how college and university student centers are becoming the institution's marketing tools. Explores how the Millennium Center at the University of Missouri in St. Louis exemplifies this new trend. (GR)

  20. RSW Cell Centered Grids

    Data.gov (United States)

    National Aeronautics and Space Administration — New cell centered grids are generated to complement the node-centered ones uploaded. Six tarballs containing the coarse, medium, and fine mixed-element and pure tet....

  1. MARYLAND ROBOTICS CENTER

    Data.gov (United States)

    Federal Laboratory Consortium — The Maryland Robotics Center is an interdisciplinary research center housed in the Institute for Systems Research (link is external)within the A. James Clark School...

  2. National Rehabilitation Information Center

    Science.gov (United States)

    ... including News and Notes) Welcome to the National Rehabilitation Information Center! We are conducting improvements to the ... experience. We apologize for any inconvenience The National Rehabilitation Information Center ( NARIC ) is the library of the ...

  3. MARYLAND ROBOTICS CENTER

    Data.gov (United States)

    Federal Laboratory Consortium — The Maryland Robotics Center is an interdisciplinary research center housed in the Institute for Systems Research (link is external) within the A. James Clark School...

  4. Automating the Media Center.

    Science.gov (United States)

    Holloway, Mary A.

    1988-01-01

    Discusses the need to develop more efficient information retrieval skills by the use of new technology. Lists four stages used in automating the media center. Describes North Carolina's pilot programs. Proposes benefits and looks at the media center's future. (MVL)

  5. Center for Functional Nanomaterials

    Data.gov (United States)

    Federal Laboratory Consortium — The Center for Functional Nanomaterials (CFN) explores the unique properties of materials and processes at the nanoscale. The CFN is a user-oriented research center...

  6. Exposing the Data Center

    OpenAIRE

    Sergejev, Ivan

    2014-01-01

    Given the rapid growth in the importance of the Internet, data centers - the buildings that store information on the web - are quickly becoming the most critical infrastructural objects in the world. However, so far they have received very little, if any, architectural attention. This thesis proclaims data centers to be the 'churches' of the digital society and proposes a new type of a publicly accessible data center. The thesis starts with a brief overview of the history of data centers ...

  7. Data center cooling method

    Energy Technology Data Exchange (ETDEWEB)

    Chainer, Timothy J.; Dang, Hien P.; Parida, Pritish R.; Schultz, Mark D.; Sharma, Arun

    2015-08-11

    A method aspect for removing heat from a data center may use liquid coolant cooled without vapor compression refrigeration on a liquid cooled information technology equipment rack. The method may also include regulating liquid coolant flow to the data center through a range of liquid coolant flow values with a controller-apparatus based upon information technology equipment temperature threshold of the data center.

  8. NuSTAR observations of magnetar 1e 1841-045

    DEFF Research Database (Denmark)

    An, Hongjun; Hascoet, Romain; Kaspi, Victoria M.;

    2013-01-01

    We report new spectral and temporal observations of the magnetar 1E 1841-045 in the Kes 73 supernova remnant obtained with the Nuclear Spectroscopic Telescope Array. Combined with new Swift and archival XMM-Newton and Chandra observations, the phase-averaged spectrum is well characterized...... by a blackbody plus double power law, in agreement with previous multimission X-ray results. However, we are unable to reproduce the spectral results reported based on Suzaku observations. The pulsed fraction of the source is found to increase with photon energy. The measured rms pulsed fractions are similar...... the rotation axis and line of sight of similar to 50 degrees. In this model, the soft X-ray component is inconsistent with a single blackbody; adding a second blackbody or a power-law component fits the data. The two-blackbody interpretation suggests a hot spot of temperature kT approximate to 0.9 ke...

  9. Robinson-Schensted-Knuth Correspondence and Weak Polynomial Identities of M1,1(E)

    Institute of Scientific and Technical Information of China (English)

    Onofrio Mario Di Vincenzo; Roberto La Scala

    2005-01-01

    In this paper, it is proved that the ideal Iω of the weak polynomial identities of the superalgebra M1,1(E) is generated by the p roper polynomials [x1,x2, x3] and [x2,x1][xa,x1][x4, x1]. This is proved for any infinite field F of characteristic different a basis and the dimension of any multihomogeneous component of the quotient algebra B/(B ∩ Iw). We also compute the Hilbert series of this algebra. One of the main tools of this paper is a variant we found of the Robinson-Schensted-Knuth correspondence defined for single semistandard tableaux of double shape.

  10. E1, M1, E2 transition energies and probabilities of W$^{54+}$ ions

    CERN Document Server

    Ding, Xiao-bin; Liu, Jia-xin; Koike, Fumihiro; Murakami, Izumi; Kato, Daiji; Sakaue, Hiroyuki A; Nakamura, Nobuyuki; Dong, Chen-zhong

    2016-01-01

    A comprehensive theoretical study of the E1, M1, E2 transitions of Ca-like tungsten ions is presented. Using multi-configuration Dirac-Fock (MCDF) method with a restricted active space treatment, the wavelengths and probabilities of the M1 and E2 transitions between the multiplets of the ground state configuration ([Ne]3s$^{2}$3p$^{6}$3d$^{2}$) and of the E1 transitions between [Ne]3s$^{2}$3p$^{5}$3d$^{3}$ and [Ne]3s$^{2}$3p$^{6}$3d$^{2}$ have been calculated. The results are in reasonable agreement with available experimental data. The present E1 and M1 calculations are compared with previous theoretical values. For E2 transitions, the importance of electron correlation from 3s and 3p orbitals is pointed out. Several strong E1 transitions are predicted, which have potential advantage for plasma diagnostics.

  11. Notch1-Snail1-E-cadherin pathway in metastatic hepatocellular carcinoma.

    Science.gov (United States)

    Wang, Xiao Qi; Zhang, Wu; Lui, Eric L H; Zhu, Yongqiang; Lu, Ping; Yu, Xiaoming; Sun, Jisan; Yang, Sitian; Poon, Ronnie T P; Fan, Sheung Tat

    2012-08-01

    Notch signaling, a critical pathway for tissue development, also contributes to tumorigenesis in many cancers, but its pathological function in liver cancer is not well defined. In our study, Notch1 expression and its clinicopathological parameters were evaluated in 82 human hepatocellular carcinoma (HCC) patients. Plasmid-based siNotch1 shRNA was transiently or stably transfected into metastatic HCC cells and subsequently evaluated for the effects on orthotopic liver tumor metastasis in a mouse model as well as the effects on downstream pathways. Aberrant high expression of Notch1 was significantly associated with metastatic disease parameters in HCC patients, such as tumor-node-metastasis Stages III-IV and tumor venous invasion. Knocking-down Notch1 reduced cell motility in vitro and orthotopic tumor metastasis from the liver to the lung in vivo in a mouse model. In metastatic HCC cells, abnormal expression of Notch1 was associated with increased expression of Snail1 and repressed expression of E-cadherin; the Notch1-Snail1-E-cadherin association can also be found in HCC patient tumors. Inhibition of Notch1 by shRNA abolished Snail1 expression, which further resulted in the re-establishment of repressed E-cadherin in metastatic HCC cells. Thus, abnormal Notch1 expression was strongly associated with HCC metastatic disease, which might be mediated through the Notch1-Snail1-E-cadherin pathway. Knock-down of Notch1 reversed HCC tumor metastasis in a mouse model. Therefore, these data suggest that effective targeting of Notch signaling might also inhibit tumor metastasis.

  12. The dust-scattering X-ray rings of the anomalous X-ray pulsar 1E 1547.0-5408

    CERN Document Server

    Tiengo, A; Esposito, P; Mereghetti, S; Giuliani, A; Costantini, E; Israel, G L; Stella, L; Turolla, R; Zane, S; Rea, N; Götz, D; Bernardini, F; Moretti, A; Romano, P; Ehle, M; Gehrels, N

    2009-01-01

    On 2009 January 22 numerous strong bursts were detected from the anomalous X-ray pulsar 1E 1547.0-5408. Swift/XRT and XMM-Newton/EPIC observations carried out in the following two weeks led to the discovery of three X-ray rings centered on this source. The ring radii increased with time following the expansion law expected for a short impulse of X-rays scattered by three dust clouds. Assuming different models for the dust composition and grain size distribution, we fit the intensity decay of each ring as a function of time at different energies, obtaining tight constrains on the distance of the X-ray source. Although the distance strongly depends on the adopted dust model, we find that some models are incompatible with our X-ray data, restricting to 4-8 kpc the range of possible distances for 1E 1547.0-5408. The best-fitting dust model provides a source distance of 3.91 +/- 0.07 kpc, which is compatible with the proposed association with the supernova remnant G 327.24-0.13, and implies distances of 2.2 kpc, 2...

  13. Cryoelectron Microscopic Structures of Eukaryotic Translation Termination Complexes Containing eRF1-eRF3 or eRF1-ABCE1

    Directory of Open Access Journals (Sweden)

    Anne Preis

    2014-07-01

    Full Text Available Termination and ribosome recycling are essential processes in translation. In eukaryotes, a stop codon in the ribosomal A site is decoded by a ternary complex consisting of release factors eRF1 and guanosine triphosphate (GTP-bound eRF3. After GTP hydrolysis, eRF3 dissociates, and ABCE1 can bind to eRF1-loaded ribosomes to stimulate peptide release and ribosomal subunit dissociation. Here, we present cryoelectron microscopic (cryo-EM structures of a pretermination complex containing eRF1-eRF3 and a termination/prerecycling complex containing eRF1-ABCE1. eRF1 undergoes drastic conformational changes: its central domain harboring the catalytically important GGQ loop is either packed against eRF3 or swung toward the peptidyl transferase center when bound to ABCE1. Additionally, in complex with eRF3, the N-terminal domain of eRF1 positions the conserved NIKS motif proximal to the stop codon, supporting its suggested role in decoding, yet it appears to be delocalized in the presence of ABCE1. These results suggest that stop codon decoding and peptide release can be uncoupled during termination.

  14. NuSTAR and XMM-Newton observations of 1e1743.1-2843: indications of a neutron star LMXB nature of the compact object

    DEFF Research Database (Denmark)

    Lotti, Simone; Natalucci, Lorenzo; Mori, Kaya;

    2016-01-01

    We report on the results of NuSTAR and XMM-Newton observations of the persistent X-ray source 1E1743.1-2843, located in the Galactic Center region. The source was observed between 2012 September and October by NuSTAR and XMM-Newton, providing almost simultaneous observations in the hard and soft X......-ray bands. The high X-ray luminosity points to the presence of an accreting compact object. We analyze the possibilities of this accreting compact object being either a neutron star (NS) or a black hole, and conclude that the joint XMM-Newton and NuSTAR spectrum from 0.3 to 40 keV fits a blackbody spectrum...

  15. NuSTAR and XMM-Newton Observations of 1E1743.1-2843: Indications of a Neutron Star LMXB Nature of the Compact Object

    Science.gov (United States)

    Lotti, Simone; Natalucci, Lorenzo; Mori, Kaya; Baganoff, Frederick K.; Boggs, Steven E.; Christensen, Finn E.; Craig, William W.; Hailey, Charles J.; Harrison, Fiona A.; Hong, Jaesub; Krivonos, Roman A.; Rahoui, Farid; Stern, Daniel; Tomsick, John A.; Zhang, Shuo; Zhang, William W.

    2016-05-01

    We report on the results of NuSTAR and XMM-Newton observations of the persistent X-ray source 1E1743.1-2843, located in the Galactic Center region. The source was observed between 2012 September and October by NuSTAR and XMM-Newton, providing almost simultaneous observations in the hard and soft X-ray bands. The high X-ray luminosity points to the presence of an accreting compact object. We analyze the possibilities of this accreting compact object being either a neutron star (NS) or a black hole, and conclude that the joint XMM-Newton and NuSTAR spectrum from 0.3 to 40 keV fits a blackbody spectrum with {kT}˜ 1.8 {keV} emitted from a hot spot or an equatorial strip on an NS surface. This spectrum is thermally Comptonized by electrons with {{kT}}e˜ 4.6 {keV}. Accepting this NS hypothesis, we probe the low-mass X-ray binary (LMXB) or high-mass X-ray binary (HMXB) nature of the source. While the lack of Type-I bursts can be explained in the LMXB scenario, the absence of pulsations in the 2 mHz-49 Hz frequency range, the lack of eclipses and of an IR companion, and the lack of a {K}α line from neutral or moderately ionized iron strongly disfavor interpreting this source as a HMXB. We therefore conclude that 1E1743.1-2843 is most likely an NS-LMXB located beyond the Galactic Center. There is weak statistical evidence for a soft X-ray excess which may indicate thermal emission from an accretion disk. However, the disk normalization remains unconstrained due to the high hydrogen column density ({N}{{H}}˜ 1.6× {10}23 {{cm}}-2).

  16. Test Control Center exhibit

    Science.gov (United States)

    2000-01-01

    Have you ever wondered how the engineers at John C. Stennis Space Center in Hancock County, Miss., test fire a Space Shuttle Main Engine? The Test Control Center exhibit at StenniSphere can answer your questions by simulating the test firing of a Space Shuttle Main Engine. A recreation of one of NASA's test control centers, the exhibit explains and portrays the 'shake, rattle and roar' that happens during a real test firing.

  17. Relativistic Guiding Center Equations

    Energy Technology Data Exchange (ETDEWEB)

    White, R. B. [PPPL; Gobbin, M. [Euratom-ENEA Association

    2014-10-01

    In toroidal fusion devices it is relatively easy that electrons achieve relativistic velocities, so to simulate runaway electrons and other high energy phenomena a nonrelativistic guiding center formalism is not sufficient. Relativistic guiding center equations including flute mode time dependent field perturbations are derived. The same variables as used in a previous nonrelativistic guiding center code are adopted, so that a straightforward modifications of those equations can produce a relativistic version.

  18. 1-eV GaInNAs solar cells for ultrahigh-frequency multijunction devices

    Energy Technology Data Exchange (ETDEWEB)

    Friedman, D.J.; Geisz, J.F.; Kurtz, S.R.; Olson, J.M. [National Renewable Energy Lab., Golden, CO (United States)

    1998-09-01

    The authors demonstrate working prototypes of a GaInNAs-based solar cell lattice-matched to GaAs with photoresponse down to 1 eV. This device is intended for use as the third junction of future-generation ultrahigh-efficiency three- and four-junction devices. Under the AM1.5 direct spectrum with all the light higher in energy than the GaAs band gap filtered out, the prototypes have open-circuit voltages ranging from 0.35 to 0.44 V, short-circuit currents of 1.8 mA/cm{sup 2}, and fill factors from 61--66%. The short-circuit currents are of principal concern: the internal quantum efficiencies rise only to about 0.2. The authors discuss the short diffusion lengths which are the reason for this low photocurrent. As a partial workaround for the poor diffusion lengths, they demonstrate a depletion-width-enhanced variation of one of the prototype devices that grades off decreased voltage for increased photocurrent, with a short-circuit current of 6.5 mA/cm{sup 2} and an open-circuit voltage of 0.29 V.

  19. NuSTAR OBSERVATIONS OF THE MAGNETAR 1E 2259+586

    Energy Technology Data Exchange (ETDEWEB)

    Vogel, Julia K. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Hascoët, Romain [Columbia Univ., New York, NY (United States); Kaspi, Victoria M. [Univ. of Montreal, Quebec (Canada); An, Hongjun [Univ. of Montreal, Quebec (Canada); Archibald, Robert [Univ. of Montreal, Quebec (Canada); Beloborodov, Andrei M. [Columbia Univ., New York, NY (United States); Boggs, Steven E. [Univ. of California, Berkeley, CA (United States); Christensen, Finn E. [Technical Univ. of Denmark, Lyngby (Denmark); Craig, William W. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Gotthelf, Eric V. [Columbia Univ., New York, NY (United States); Grefenstette, Brian W. [California Inst. of Technology (CalTech), Pasadena, CA (United States); Hailey, Charles J. [Columbia Univ., New York, NY (United States); Harrison, Fiona A. [California Inst. of Technology (CalTech), Pasadena, CA (United States); Kennea, Jamie A. [Pennsylvania State Univ., State College, PA (United States); Madsen, Kristin K. [California Inst. of Technology (CalTech), Pasadena, CA (United States); Pivovaroff, Michael J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Stern, Daniel [California Inst. of Technology (CalTech), Pasadena, CA (United States); Zhang, William W. [NASA Goddard Space Flight Center (GSFC), Greenbelt, MD (United States)

    2014-07-01

    We report on new broad band spectral and temporal observations of the magnetar 1E 2259+586, which is located in the supernova remnant CTB 109. Our data were obtained simultaneously with the Nuclear Spectroscopic Telescope Array (NuSTAR) and Swift, and cover the energy range from 0.5-79 keV. We present pulse profiles in various energy bands and compare them to previous RXTE results. The NuSTAR data show pulsations above 20 keV for the first time and we report evidence that one of the pulses in the double-peaked pulse profile shifts position with energy. The pulsed fraction of the magnetar is shown to increase strongly with energy. Our spectral analysis reveals that the soft X-ray spectrum is well characterized by an absorbed double blackbody or blackbody plus power-law model in agreement with previous reports. Our new hard X-ray data, however, suggest that an additional component, such as a power law, is needed to describe the NuSTAR and Swift spectrum. We also fit the data with the recently developed coronal outflow model by Beloborodov for hard X-ray emission from magnetars. The outflow from a ring on the magnetar surface is statistically preferred over outflow from a polar cap.

  20. NuSTAR Observations of the Magnetar 1E 2259+586

    CERN Document Server

    Vogel, Julia K; Kaspi, Victoria M; An, Hongjun; Archibald, Robert; Beloborodov, Andrei M; Boggs, Steven E; Christensen, Finn E; Craig, William W; Gotthelf, Eric V; Grefenstette, Brian W; Hailey, Charles J; Harrison, Fiona A; Kennea, Jamie A; Madsen, Kristin K; Pivovaroff, Michael J; Stern, Daniel; Zhang, William W

    2014-01-01

    We report on new broad band spectral and temporal observations of the magnetar 1E 2259+586, which is located in the supernova remnant CTB 109. Our data were obtained simultaneously with the Nuclear Spectroscopic Telescope Array (NuSTAR) and Swift, and cover the energy range from 0.5-79 keV. We present pulse profiles in various energy bands and compare them to previous RXTE results. The NuSTAR data show pulsations above 20 keV for the first time and we report evidence that one of the pulses in the double-peaked pulse profile shifts position with energy. The pulsed fraction of the magnetar is shown to increase strongly with energy. Our spectral analysis reveals that the soft X-ray spectrum is well characterized by an absorbed double-blackbody or blackbody plus power-law model in agreement with previous reports. Our new hard X-ray data, however, suggests that an additional component, such as a power-law, is needed to describe the NuSTAR and Swift spectrum. We also fit the data with the recently developed coronal...

  1. Ghosts of Milky Way's past: the globular cluster ESO 37-1 (E 3)

    CERN Document Server

    Marcos, R de la Fuente; Bidin, C Moni; Ortolani, S; Carraro, G

    2015-01-01

    Context. In the Milky Way, most globular clusters are highly conspicuous objects that were found centuries ago. However, a few dozen of them are faint, sparsely populated systems identified largely during the second half of the past century. One of the faintest is ESO 37-1 (E 3) and as such it remains poorly studied, with no spectroscopic observations published so far, although it was discovered in 1976. Aims. We investigate the globular cluster E 3 in an attempt to better constrain its fundamental parameters. Spectroscopy of stars in the field of E 3 is shown here for the first time. Methods. Deep, precise VI CCD photometry of E 3 down to V=26 mag is presented and analyzed. Low resolution, medium signal-to-noise ratio spectra of 9 candidate members are studied to derive radial velocity and metallicity. Proper motions from the UCAC4 catalogue are used to explore the kinematics of the bright members of E 3. Results. Isochrone fitting indicates that E 3 is probably very old, with an age of about 13 Gyr; its dis...

  2. Leak testing of IR sensor dewars to 1E-15 std He/s

    Science.gov (United States)

    Sasaki, Y. Tito; Bergquist, Lyle E.

    1990-09-01

    The results of tests for leakage performed on ten IR sensor dewars are presented, and the design principles of the new testing devices are discussed. The ultrasensitive leak detector used for testing is compared to conventional detectors. The superfine leak calibrator consisting of a tracer gas supply, an aliquot volume, a pressure transducer, temperature gage, and valves was used to measure leak rates in the E-4 to E-12 std cc He/s range. The testing method is explained, including the gases used, the quadrupole mass analyzer, the reference leak calibration, and the temperature coefficient of the reference leak. The test results of the IR sensor dewars are shown: seven showed leak rates in the E-15 std cc He/s range, two had no detectable leaks, and one had a mid-range E-14 leak. The shelf lives of the dewars are calculated based on the results. The vacuum integrity of small IR sensor dewars can be reliably tested to the range of 1E-15 std cc He/s using the ultrasensitive leak detector and the superfine leak calibrator.

  3. Cosmology based on $f(R)$ gravity with ${\\cal O}(1)$ eV sterile neutrino

    CERN Document Server

    Chudaykin, A S; Starobinsky, A A; Burenin, R A

    2015-01-01

    We address the cosmological role of ${\\cal O}(1)$ eV sterile neutrino in modified gravity models. We confront the present cosmological data with the predictions of FLRW cosmological model based on a variant of $f(R)$ modified gravity proposed by one of the authors previously. This viable cosmological model which deviation from general relativity with an induced effective cosmological constant decreases as $R^{-2n}$ for large, but not too large values of the Ricci scalar $R$ provides an alternative to the bare cosmological constant explanation of the present dark energy and accelerated expansion of the Universe ($n=2$ is adopted). We used various up-to-date cosmological data sets including Planck CMB anisotropy, CMB lensing potential, BAO, cluster mass function and Hubble constant measurements. Using the low-z measurements of linear perturbation amplitude from galaxy cluster mass function data we find that sum of neutrino masses constrained by CMB+BAO data is not sufficient to compensate for the extra linear p...

  4. Deep NuSTAR and Swift Monitoring Observations of the Magnetar 1E 1841-045

    CERN Document Server

    An, Hongjun; Hascoet, Romain; Archibald, Anne M; Beardmore, Andy; Boggs, Steven E; Christensen, Finn E; Craig, William W; Gehrels, Niel; Hailey, Charles J; Harrison, Fiona A; Kennea, Jamie; Kouveliotou, Chryssa; Stern, Daniel; Younes, George; Zhang, William W

    2015-01-01

    We report on a 350-ks NuSTAR observation of the magnetar 1E 1841-045 taken in 2013 September. During the observation, NuSTAR detected six bursts of short duration, with $T_{90}<1$ s. An elevated level of emission tail is detected after the brightest burst, persisting for $\\sim$1 ks. The emission showed a power-law decay with a temporal index of 0.5 before returning to the persistent emission level. The long observation also provided detailed phase-resolved spectra of the persistent X-ray emission of the source. By comparing the persistent spectrum with that previously reported, we find that the source hard-band emission has been stable over approximately 10 years. The persistent hard X-ray emission is well fitted by a coronal outflow model, where $e^{+/-}$ pairs in the magnetosphere upscatter thermal X-rays. Our fit of phase-resolved spectra allowed us to estimate the angle between the rotational and magnetic dipole axes of the magnetar, $\\alpha_{mag}=0.25$, the twisted magnetic flux, $2.5\\times10^{26}\\rm ...

  5. NuSTAR observations of the magnetar 1E 2259+586

    Energy Technology Data Exchange (ETDEWEB)

    Vogel, Julia K.; Craig, William W.; Pivovaroff, Michael J. [Physics Division, Physical and Life Sciences Directorate, Lawrence Livermore National Laboratory, Livermore, CA 94550 (United States); Hascoët, Romain; Beloborodov, Andrei M.; Gotthelf, Eric V.; Hailey, Charles J. [Physics Department and Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Kaspi, Victoria M.; An, Hongjun; Archibald, Robert [Department of Physics, McGill University, Montreal, Quebec H3A 2T8 (Canada); Boggs, Steven E. [Space Sciences Laboratory, University of California, Berkeley, CA 94720 (United States); Christensen, Finn E. [DTU Space, National Space Institute, Technical University of Denmark, Elektrovej 327, DK-2800 Lyngby (Denmark); Grefenstette, Brian W.; Harrison, Fiona A.; Madsen, Kristin K. [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Kennea, Jamie A. [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States); Stern, Daniel [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Zhang, William W. [Goddard Space Flight Center, Greenbelt, MD 20771 (United States)

    2014-07-01

    We report on new broad band spectral and temporal observations of the magnetar 1E 2259+586, which is located in the supernova remnant CTB 109. Our data were obtained simultaneously with the Nuclear Spectroscopic Telescope Array (NuSTAR) and Swift, and cover the energy range from 0.5-79 keV. We present pulse profiles in various energy bands and compare them to previous RXTE results. The NuSTAR data show pulsations above 20 keV for the first time and we report evidence that one of the pulses in the double-peaked pulse profile shifts position with energy. The pulsed fraction of the magnetar is shown to increase strongly with energy. Our spectral analysis reveals that the soft X-ray spectrum is well characterized by an absorbed double blackbody or blackbody plus power-law model in agreement with previous reports. Our new hard X-ray data, however, suggest that an additional component, such as a power law, is needed to describe the NuSTAR and Swift spectrum. We also fit the data with the recently developed coronal outflow model by Beloborodov for hard X-ray emission from magnetars. The outflow from a ring on the magnetar surface is statistically preferred over outflow from a polar cap.

  6. NuSTAR Observations of the Magnetar 1E 2259+586

    Science.gov (United States)

    Vogel, Julia K.; Hascoet, Romain; Kaspi, Victoria M.; An, Hongjun; Archibald, Robert; Beloborodov, Andrei M.; Boggs, Steven E.; Christensen, Finn E.; Craig, William W.; Gotthelf, Eric V.; Grefenstette, Brian W.; Hailey, Charles J.; Harrison, Fiona A.; Kennea, Jamie A.; Madsen, Kristin K.; Pivovaroff, Michael J.; Stern, Daniel; Zhang, William W.

    2014-01-01

    We report on new broad band spectral and temporal observations of the magnetar 1E 2259+586, which is located in the supernova remnant CTB 109. Our data were obtained simultaneously with the Nuclear Spectroscopic Telescope Array (NuSTAR) and Swift, and cover the energy range from 0.5-79 keV. We present pulse profiles in various energy bands and compare them to previous RXTE results. The NuSTAR data show pulsations above 20 keV for the first time and we report evidence that one of the pulses in the double-peaked pulse profile shifts position with energy. The pulsed fraction of the magnetar is shown to increase strongly with energy. Our spectral analysis reveals that the soft X-ray spectrum is well characterized by an absorbed double blackbody or blackbody plus power-law model in agreement with previous reports. Our new hard X-ray data, however, suggest that an additional component, such as a power law, is needed to describe the NuSTAR and Swift spectrum. We also fit the data with the recently developed coronal outflow model by Beloborodov for hard X-ray emission from magnetars. The outflow from a ring on the magnetar surface is statistically preferred over outflow from a polar cap.

  7. Structural analysis and evolution of specificity of the SUMO UFD E1-E2 interactions

    Science.gov (United States)

    Liu, Bing; Lois, L. Maria; Reverter, David

    2017-01-01

    SUMO belongs to the ubiquitin-like family (UbL) of protein modifiers. SUMO is conserved among eukaryotes and is essential for the regulation of processes such as DNA damage repair, transcription, DNA replication and mitosis. UbL modification of proteins occurs via a specific enzymatic cascade formed by the crosstalk between the E1-activating enzyme, the E2-conjugating enzyme and the E3-ligase. An essential discrimination step in all UbL modifiers corresponds to the interaction between E1 and E2 enzymes, which is mediated by the recruitment of the E2 to the UFD domain (Ubiquitin-Fold Domain) of the E1 enzyme. To gain insights in the properties of this interface, we have compared the structures of the complexes between E1 UFD domain and E2 in human and yeast, revealing two alternative UFD platforms that interact with a conserved E2. Comparative sequence analysis of the E1 UFD domain indicates that the E2 binding region has been conserved across phylogenetic closely related species, in which higher sequence conservation can be found in the E2 binding region than in the entire UFD domain. These distinctive strategies for E1-E2 interactions through the UFD domain might be the consequence of a high selective pressure to ensure specificity of each modifier conjugation system. PMID:28165030

  8. SPAK and OSR1 Sensitive Cell Membrane Protein Abundance and Activity of KCNQ1/E1 K+ Channels

    Directory of Open Access Journals (Sweden)

    Bernat Elvira

    2015-11-01

    Full Text Available Background/Aims: KCNQ1/E1 channels are expressed in diverse tissues and serve a variety of functions including endolymph secretion in the inner ear, cardiac repolarization, epithelial transport and cell volume regulation. Kinases involved in regulation of epithelial transport and cell volume include SPAK (SPS1-related proline/alanine-rich kinase and OSR1 (oxidative stress-responsive kinase 1, which are under control of WNK (with-no-K[Lys] kinases. The present study explored whether KCNQ1/E1 channels are regulated by SPAK and/or OSR1. Methods: cRNA encoding KCNQ1/E1 was injected into Xenopus oocytes with or without additional injection of cRNA encoding wild-type SPAK, constitutively active T233ESPAK, WNK insensitive T233ASPAK, catalytically inactive D212ASPAK, wild-type OSR1, constitutively active T185EOSR1, WNK insensitive T185AOSR1 and catalytically inactive D164AOSR1. Voltage gated K+ channel activity was quantified utilizing dual electrode voltage clamp and KCNQ1/E1 channel protein abundance in the cell membrane utilizing chemiluminescence of KCNQ1/E1 containing an extracellular Flag tag epitope (KCNQ1-Flag/E1. Results: KCNQ1/E1 activity and KCNQ1-Flag/E1 protein abundance were significantly enhanced by wild-type SPAK and T233ESPAK, but not by T233ASPAK and D212ASPAK. Similarly, KCNQ1/E1 activity and KCNQ1-Flag/E1 protein abundance were significantly increased by wild-type OSR1 and T185EOSR1, but not by T185AOSR1 and D164AOSR1. Conclusions: SPAK and OSR1 participate in the regulation of KCNQ1/E1 protein abundance and activity.

  9. Great Lakes Science Center

    Data.gov (United States)

    Federal Laboratory Consortium — Since 1927, Great Lakes Science Center (GLSC) research has provided critical information for the sound management of Great Lakes fish populations and other important...

  10. Small Business Development Center

    Data.gov (United States)

    Small Business Administration — Small Business Development Centers (SBDCs) provide assistance to small businesses and aspiring entrepreneurs throughout the United States and its territories. SBDCs...

  11. Advanced Simulation Center

    Data.gov (United States)

    Federal Laboratory Consortium — The Advanced Simulation Center consists of 10 individual facilities which provide missile and submunition hardware-in-the-loop simulation capabilities. The following...

  12. Environmental Modeling Center

    Data.gov (United States)

    Federal Laboratory Consortium — The Environmental Modeling Center provides the computational tools to perform geostatistical analysis, to model ground water and atmospheric releases for comparison...

  13. Surgery center joint ventures.

    Science.gov (United States)

    Zasa, R J

    1999-01-01

    Surgery centers have been accepted as a cost effective, patient friendly vehicle for delivery of quality ambulatory care. Hospitals and physician groups also have made them the vehicles for coming together. Surgery centers allow hospitals and physicians to align incentives and share benefits. It is one of the few types of health care businesses physicians can own without anti-fraud and abuse violation. As a result, many surgery center ventures are now jointly owned by hospitals and physician groups. This article outlines common structures that have been used successfully to allow both to own and govern surgery centers.

  14. Test Control Center (TCC)

    Data.gov (United States)

    Federal Laboratory Consortium — The Test Control Center (TCC) provides a consolidated facility for planning, coordinating, controlling, monitoring, and analyzing distributed test events. ,The TCC...

  15. Data Center at NICT

    Science.gov (United States)

    Ichikawa, Ryuichi; Sekido, Mamoru

    2013-01-01

    The Data Center at the National Institute of Information and Communications Technology (NICT) archives and releases the databases and analysis results processed at the Correlator and the Analysis Center at NICT. Regular VLBI sessions of the Key Stone Project VLBI Network were the primary objective of the Data Center. These regular sessions continued until the end of November 2001. In addition to the Key Stone Project VLBI sessions, NICT has been conducting geodetic VLBI sessions for various purposes, and these data are also archived and released by the Data Center.

  16. Chemical Security Analysis Center

    Data.gov (United States)

    Federal Laboratory Consortium — In 2006, by Presidential Directive, DHS established the Chemical Security Analysis Center (CSAC) to identify and assess chemical threats and vulnerabilities in the...

  17. Airline Operation Center Workstation

    Data.gov (United States)

    Department of Transportation — The Airline Operation Center Workstation (AOC Workstation) represents equipment available to users of the National Airspace system, outside of the FAA, that enables...

  18. Center for Deployment Psychology

    Data.gov (United States)

    Federal Laboratory Consortium — The Center for Deployment Psychology was developed to promote the education of psychologists and other behavioral health specialists about issues pertaining to the...

  19. Electron Microscopy Center (EMC)

    Data.gov (United States)

    Federal Laboratory Consortium — The Electron Microscopy Center (EMC) at Argonne National Laboratory develops and maintains unique capabilities for electron beam characterization and applies those...

  20. Audio Visual Center

    Data.gov (United States)

    Federal Laboratory Consortium — The Audiovisual Services Center provides still photographic documentation with laboratory support, video documentation, video editing, video duplication, photo/video...

  1. In Silico Prediction of Human Sulfotransferase 1E1 Activity Guided by Pharmacophores from Molecular Dynamics Simulations.

    Science.gov (United States)

    Rakers, Christin; Schumacher, Fabian; Meinl, Walter; Glatt, Hansruedi; Kleuser, Burkhard; Wolber, Gerhard

    2016-01-01

    Acting during phase II metabolism, sulfotransferases (SULTs) serve detoxification by transforming a broad spectrum of compounds from pharmaceutical, nutritional, or environmental sources into more easily excretable metabolites. However, SULT activity has also been shown to promote formation of reactive metabolites that may have genotoxic effects. SULT subtype 1E1 (SULT1E1) was identified as a key player in estrogen homeostasis, which is involved in many physiological processes and the pathogenesis of breast and endometrial cancer. The development of an in silico prediction model for SULT1E1 ligands would therefore support the development of metabolically inert drugs and help to assess health risks related to hormonal imbalances. Here, we report on a novel approach to develop a model that enables prediction of substrates and inhibitors of SULT1E1. Molecular dynamics simulations were performed to investigate enzyme flexibility and sample protein conformations. Pharmacophores were developed that served as a cornerstone of the model, and machine learning techniques were applied for prediction refinement. The prediction model was used to screen the DrugBank (a database of experimental and approved drugs): 28% of the predicted hits were reported in literature as ligands of SULT1E1. From the remaining hits, a selection of nine molecules was subjected to biochemical assay validation and experimental results were in accordance with the in silico prediction of SULT1E1 inhibitors and substrates, thus affirming our prediction hypotheses.

  2. AKT1E17K Is Oncogenic in Mouse Lung and Cooperates with Chemical Carcinogens in Inducing Lung Cancer

    Science.gov (United States)

    Malanga, Donatella; Belmonte, Stefania; Colelli, Fabiana; Scarfò, Marzia; De Marco, Carmela; Oliveira, Duarte Mendes; Mirante, Teresa; Camastra, Caterina; Gagliardi, Monica; Rizzuto, Antonia; Mignogna, Chiara; Paciello, Orlando; Papparella, Serenella; Fagman, Henrik; Viglietto, Giuseppe

    2016-01-01

    The hotspot AKT1E17K mutation in the pleckstrin homology domain of AKT1 occurs in approximately 0.6–2% of human lung cancers. Recently, we have demonstrated that AKT1E17K transforms immortalized human bronchial cells. Here by use of a transgenic Cre-inducible murine strain in the wild type Rosa26 (R26) locus (R26-AKT1E17K mice) we demonstrate that AKT1E17K is a bona-fide oncogene and plays a role in the development of lung cancer in vivo. In fact, we report that mutant AKT1E17K induces bronchial and/or bronchiolar hyperplastic lesions in murine lung epithelium, which progress to frank carcinoma at very low frequency, and accelerates tumor formation induced by chemical carcinogens. In conclusion, AKT1E17K induces hyperplasia of mouse lung epithelium in vivo and cooperates with urethane to induce the fully malignant phenotype. PMID:26859676

  3. Funding Opportunity: Genomic Data Centers

    Science.gov (United States)

    Funding Opportunity CCG, Funding Opportunity Center for Cancer Genomics, CCG, Center for Cancer Genomics, CCG RFA, Center for cancer genomics rfa, genomic data analysis network, genomic data analysis network centers,

  4. Information Centers at NAL.

    Science.gov (United States)

    Frank, Robyn C.

    1989-01-01

    Descriptions of the 12 specialized information centers of the National Agricultural Library (NAL) include subject coverage, information services provided, information technologies used, and staffing. The development of the Rural Information Center, a joint venture between the Extension Service and NAL to provide information services to local…

  5. Assessing the Assessment Center.

    Science.gov (United States)

    LaRue, James

    1989-01-01

    Describes the historical use of assessment centers as staff development and promotional tools and their current use in personnel selection. The elements that constitute a true assessment center are outlined, and a discussion of the advantages and disadvantages for employers and applicants focuses on positions in library administration. (10…

  6. Handbook for Learning Centers.

    Science.gov (United States)

    Norwalk Board of Education, CT.

    The handbook for learning centers contains guidelines, forms, and supplementary information to be used with all children identified as having a learning disability, mild retardation, or sensory deprivation in the Norwalk, Connecticut public schools. It is stressed that the learning center should provide supportive services for at least 35 minutes…

  7. NuSTAR observations of magnetar 1E 1841–045

    Energy Technology Data Exchange (ETDEWEB)

    An, Hongjun; Kaspi, Victoria M.; Dufour, François; Archibald, Robert [Department of Physics, McGill University, Montreal, Quebec H3A 2T8 (Canada); Hascoët, Romain; Beloborodov, Andrei M.; Gotthelf, Eric V.; Hailey, Charles J. [Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Bachetti, Matteo [Université de Toulouse, UPS-OMP, IRAP, Toulouse (France); Boggs, Steven E.; Craig, William W. [Space Sciences Laboratory, University of California, Berkeley, CA 94720 (United States); Christensen, Finn E. [DTU Space, National Space Institute, Technical University of Denmark, Elektrovej 327, DK-2800 Lyngby (Denmark); Greffenstette, Brian W.; Harrison, Fiona A.; Madsen, Kristin K. [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Kitaguchi, Takao [RIKEN, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Kouveliotou, Chryssa [Space Science Office, ZP12, NASA Marshall Space Flight Center, Huntsville, AL 35812 (United States); Markwardt, Craig B. [Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Stern, Daniel [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Vogel, Julia K. [Lawrence Livermore National Laboratory, Livermore, CA 94550 (United States); and others

    2013-12-20

    We report new spectral and temporal observations of the magnetar 1E 1841–045 in the Kes 73 supernova remnant obtained with the Nuclear Spectroscopic Telescope Array. Combined with new Swift and archival XMM-Newton and Chandra observations, the phase-averaged spectrum is well characterized by a blackbody plus double power law, in agreement with previous multimission X-ray results. However, we are unable to reproduce the spectral results reported based on Suzaku observations. The pulsed fraction of the source is found to increase with photon energy. The measured rms pulsed fractions are ∼12% and ∼17% at ∼20 and ∼50 keV, respectively. We detect a new feature in the 24-35 keV band pulse profile that is uniquely double peaked. This feature may be associated with a possible absorption or emission feature in the phase-resolved spectrum. We fit the X-ray data using the recently developed electron-positron outflow model by Beloborodov for the hard X-ray emission from magnetars. This produces a satisfactory fit, allowing a constraint on the angle between the rotation and magnetic axes of the neutron star of ∼20° and on the angle between the rotation axis and line of sight of ∼50°. In this model, the soft X-ray component is inconsistent with a single blackbody; adding a second blackbody or a power-law component fits the data. The two-blackbody interpretation suggests a hot spot of temperature kT ≈ 0.9 keV occupying ∼1% of the stellar surface.

  8. Relative Lyapunov Center Bifurcations

    DEFF Research Database (Denmark)

    Wulff, Claudia; Schilder, Frank

    2014-01-01

    Relative equilibria (REs) and relative periodic orbits (RPOs) are ubiquitous in symmetric Hamiltonian systems and occur, for example, in celestial mechanics, molecular dynamics, and rigid body motion. REs are equilibria, and RPOs are periodic orbits of the symmetry reduced system. Relative Lyapunov...... center bifurcations are bifurcations of RPOs from REs corresponding to Lyapunov center bifurcations of the symmetry reduced dynamics. In this paper we first prove a relative Lyapunov center theorem by combining recent results on the persistence of RPOs in Hamiltonian systems with a symmetric Lyapunov...... center theorem of Montaldi, Roberts, and Stewart. We then develop numerical methods for the detection of relative Lyapunov center bifurcations along branches of RPOs and for their computation. We apply our methods to Lagrangian REs of the N-body problem....

  9. CSNK1E/CTNNB1 Are Synthetic Lethal To TP53 in Colorectal Cancer and Are Markers for Prognosis

    Directory of Open Access Journals (Sweden)

    Khong-Loon Tiong

    2014-05-01

    Full Text Available Two genes are called synthetic lethal (SL if their simultaneous mutations lead to cell death, but each individual mutation does not. Targeting SL partners of mutated cancer genes can kill cancer cells specifically, but leave normal cells intact. We present an integrated approach to uncovering SL pairs in colorectal cancer (CRC. Screening verified SL pairs using microarray gene expression data of cancerous and normal tissues, we first identified potential functionally relevant (simultaneously differentially expressed gene pairs. From the top-ranked pairs, ~20 genes were chosen for immunohistochemistry (IHC staining in 171 CRC patients. To find novel SL pairs, all 169 combined pairs from the individual IHC were synergistically correlated to five clinicopathological features, e.g. overall survival. Of the 11 predicted SL pairs, MSH2-POLB and CSNK1E-MYC were consistent with literature, and we validated the top two pairs, CSNK1E-TP53 and CTNNB1-TP53 using RNAi knockdown and small molecule inhibitors of CSNK1E in isogenic HCT-116 and RKO cells. Furthermore, synthetic lethality of CSNK1E and TP53 was verified in mouse model. Importantly, multivariate analysis revealed that CSNK1E-P53, CTNNB1-P53, MSH2-RB1, and BRCA1-WNT5A were independent prognosis markers from stage, with CSNK1E-P53 applicable to early-stage and the remaining three throughout all stages. Our findings suggest that CSNK1E is a promising target for TP53-mutant CRC patients which constitute ~40% to 50% of patients, while to date safety regarding inhibition of TP53 is controversial. Thus the integrated approach is useful in finding novel SL pairs for cancer therapeutics, and it is readily accessible and applicable to other cancers.

  10. Energy efficient data centers

    Energy Technology Data Exchange (ETDEWEB)

    Tschudi, William; Xu, Tengfang; Sartor, Dale; Koomey, Jon; Nordman, Bruce; Sezgen, Osman

    2004-03-30

    Data Center facilities, prevalent in many industries and institutions are essential to California's economy. Energy intensive data centers are crucial to California's industries, and many other institutions (such as universities) in the state, and they play an important role in the constantly evolving communications industry. To better understand the impact of the energy requirements and energy efficiency improvement potential in these facilities, the California Energy Commission's PIER Industrial Program initiated this project with two primary focus areas: First, to characterize current data center electricity use; and secondly, to develop a research ''roadmap'' defining and prioritizing possible future public interest research and deployment efforts that would improve energy efficiency. Although there are many opinions concerning the energy intensity of data centers and the aggregate effect on California's electrical power systems, there is very little publicly available information. Through this project, actual energy consumption at its end use was measured in a number of data centers. This benchmark data was documented in case study reports, along with site-specific energy efficiency recommendations. Additionally, other data center energy benchmarks were obtained through synergistic projects, prior PG&E studies, and industry contacts. In total, energy benchmarks for sixteen data centers were obtained. For this project, a broad definition of ''data center'' was adopted which included internet hosting, corporate, institutional, governmental, educational and other miscellaneous data centers. Typically these facilities require specialized infrastructure to provide high quality power and cooling for IT equipment. All of these data center types were considered in the development of an estimate of the total power consumption in California. Finally, a research ''roadmap'' was developed

  11. Garlic extract diallyl sulfide (DAS activates nuclear receptor CAR to induce the Sult1e1 gene in mouse liver.

    Directory of Open Access Journals (Sweden)

    Tatsuya Sueyoshi

    Full Text Available Constituent chemicals in garlic extract are known to induce phase I and phase II enzymes in rodent livers. Here we have utilized Car(+/+ and Car(-/- mice to demonstrate that the nuclear xenobiotic receptor CAR regulated the induction of the estrogen sulfotransferase Sult1e1 gene by diallyl sulfide (DAS treatment in mouse liver. DAS treatment caused CAR accumulation in the nucleus, resulting in a remarkable increase of SULT1E1 mRNA (3,200 fold and protein in the livers of Car(+/+ females but not of Car(-/- female mice. DAS also induced other CAR-regulated genes such as Cyp2b10, Cyp3a11 and Gadd45β. Compared with the rapid increase of these mRNA levels, which began as early as 6 hours after DAS treatment, the levels of SULT1E1 mRNA began increasing after 24 hours. This slow response to DAS suggested that CAR required an additional factor to activate the Sult1e1 gene or that this activation was indirect. Despite the remarkable induction of SULT1E1, there was no decrease in the serum levels of endogenous E2 or increase of estrone sulfate while the clearance of exogenously administrated E2 was accelerated in DAS treated mice.

  12. National Automotive Center - NAC

    Data.gov (United States)

    Federal Laboratory Consortium — Encouraged by the advantages of collaboration, the U.S. Army Tank Automotive Research, Development and Engineering Center (TARDEC) worked with the Secretary of the...

  13. Test Control Center

    Science.gov (United States)

    2000-01-01

    At the test observation periscope in the Test Control Center exhibit in StenniSphere at the John C. Stennis Space Center in Hancock County, Miss., visitors can observe a test of a Space Shuttle Main Engine exactly as test engineers might see it during a real engine test. The Test Control Center exhibit exactly simulates not only the test control environment, but also the procedure of testing a rocket engine. Designed to entertain while educating, StenniSphere includes informative dispays and exhibits from NASA's lead center for rocket propulsion and remote sensing applications. StenniSphere is open free of charge from 9 a.m. to 5 p.m. daily.

  14. Cooperative Tagging Center (CTC)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Cooperative Tagging Center (CTC) began as the Cooperative Game Fish Tagging Program (GTP) at Woods Hole Oceanographic Institute (WHOI) in 1954. The GTP was...

  15. NMA Analysis Center

    Science.gov (United States)

    Kierulf, Halfdan Pascal; Andersen, Per Helge

    2013-01-01

    The Norwegian Mapping Authority (NMA) has during the last few years had a close cooperation with Norwegian Defence Research Establishment (FFI) in the analysis of space geodetic data using the GEOSAT software. In 2012 NMA has taken over the full responsibility for the GEOSAT software. This implies that FFI stopped being an IVS Associate Analysis Center in 2012. NMA has been an IVS Associate Analysis Center since 28 October 2010. NMA's contributions to the IVS as an Analysis Centers focus primarily on routine production of session-by-session unconstrained and consistent normal equations by GEOSAT as input to the IVS combined solution. After the recent improvements, we expect that VLBI results produced with GEOSAT will be consistent with results from the other VLBI Analysis Centers to a satisfactory level.

  16. Center for Contaminated Sediments

    Data.gov (United States)

    Federal Laboratory Consortium — The U.S. Army Corps of Engineers Center for Contaminated Sediments serves as a clearinghouse for technology and expertise concerned with contaminated sediments. The...

  17. Reliability Centered Maintenance - Methodologies

    Science.gov (United States)

    Kammerer, Catherine C.

    2009-01-01

    Journal article about Reliability Centered Maintenance (RCM) methodologies used by United Space Alliance, LLC (USA) in support of the Space Shuttle Program at Kennedy Space Center. The USA Reliability Centered Maintenance program differs from traditional RCM programs because various methodologies are utilized to take advantage of their respective strengths for each application. Based on operational experience, USA has customized the traditional RCM methodology into a streamlined lean logic path and has implemented the use of statistical tools to drive the process. USA RCM has integrated many of the L6S tools into both RCM methodologies. The tools utilized in the Measure, Analyze, and Improve phases of a Lean Six Sigma project lend themselves to application in the RCM process. All USA RCM methodologies meet the requirements defined in SAE JA 1011, Evaluation Criteria for Reliability-Centered Maintenance (RCM) Processes. The proposed article explores these methodologies.

  18. The ORFEUS Data Center

    Directory of Open Access Journals (Sweden)

    B. Dost

    1994-06-01

    Full Text Available 1993 the ORFEUS Data Center (ODC; Dost, 1991 changed hosting organisation. It moved within the Netherlands from the University of Utrecht to the Royal Netherlands Meteorological Institute (KNM1 in de Bilt. This change in hosting organisation was necessary to ensure a longer term stability in the operation of the ODC. Key issues for the ODC are the rapid on-line data access and quality controlled, complete and efficient off-line data access. During 1992 the ODC became the European node in the international SPYDER system which provides near real-time access to digital broadband data from selected high quality stations. Electronic messages trigger soveral centers well distributed over the globe. These centers then collect the data by modem from selected stations in their region. Finally, data are distributed between data centers over internet.

  19. Advanced data center economy

    OpenAIRE

    Sukhov, R.; Amzarakov, M.; E. Isaev

    2013-01-01

    The article addresses basic Data Centers (DC) drivers of price and engineering, which specify rules and price evaluation for creation and further operation. DC energy efficiency concept, its influence on DC initial price, operation costs and Total Cost of Ownership.

  20. Center Innovation Fund Program

    Data.gov (United States)

    National Aeronautics and Space Administration — To stimulate and encourage creativity and innovation within the NASA Centers. The activities are envisioned to fall within the scope of NASA Space Technology or...

  1. Global Hydrology Research Center

    Data.gov (United States)

    National Aeronautics and Space Administration — The GHRC is the data management and user services arm of the Global Hydrology and Climate Center. It encompasses the data and information management, supporting...

  2. National Farm Medicine Center

    Science.gov (United States)

    Research Areas Applied Sciences Biomedical Informatics Clinical Research Epidemiology Farm Medicine Human Genetics Oral-Systemic Health Clinical ... Consulting Agritourism Farm MAPPER Lyme Disease ROPS Rebate Zika Virus National Farm Medicine Center The National Farm ...

  3. Hazardous Waste Research Center

    Data.gov (United States)

    Federal Laboratory Consortium — A full-service research and evaluation center equipped with safety equipment, a high-bay pilot studies area, and a large-scale pilot studies facility The U.S. Army...

  4. Carbon Monoxide Information Center

    Medline Plus

    Full Text Available ... Community Outreach Resource Center Toy Recall Statistics CO Poster Contest Pool Safely Business & Manufacturing Business & Manufacturing Business ... Featured Resources CPSC announces winners of carbon monoxide poster contest Video View the blog Clues You Can ...

  5. World Trade Center

    Index Scriptorium Estoniae

    2006-01-01

    Esilinastus katastroofifilm "World Trade Center" : stsenarist Andrea Berloff : režissöör Oliver Stone : kunstnik Jan Roelfs : osades Nicholas Cage, Michael Pena, Stephen Dorff jpt : Ameerika Ühendriigid 2006. Ka filmi prototüüpidest

  6. Health Center Controlled Network

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Health Center Controlled Network (HCCN) tool is a locator tool designed to make data and information concerning HCCN resources more easily available to our...

  7. USU Patient Simulation Center

    Data.gov (United States)

    Federal Laboratory Consortium — he National Capital Area (NCA) Medical Simulation Center is a state-of-the-art training facility located near the main USU campus. It uses simulated patients (i.e.,...

  8. HUD Homeownership Centers

    Data.gov (United States)

    Department of Housing and Urban Development — HUD Homeownership Centers (HOCs) insure single family Federal Housing Administration (FHA) mortgages and oversee the selling of HUD homes. FHA has four Homeownership...

  9. Mental Health Screening Center

    Science.gov (United States)

    ... Releases & Announcements Public Service Announcements Partnering with DBSA Mental Health Screening Center These online screening tools are not ... you have any concerns, see your doctor or mental health professional. Depression This screening form was developed from ...

  10. FEMA Disaster Recovery Centers

    Data.gov (United States)

    Department of Homeland Security — This is a search site for FEMA's Disaster Recovery Centers (DRC). A DRC is a readily accessible facility or mobile office set up by FEMA where applicants may go for...

  11. Centering in Japanese Discourse

    CERN Document Server

    Walker, M; Côté, S; Walker, Marilyn; Iida, Masayo; Cote, Sharon

    1996-01-01

    In this paper we propose a computational treatment of the resolution of zero pronouns in Japanese discourse, using an adaptation of the centering algorithm. We are able to factor language-specific dependencies into one parameter of the centering algorithm. Previous analyses have stipulated that a zero pronoun and its cospecifier must share a grammatical function property such as {\\sc Subject} or {\\sc NonSubject}. We show that this property-sharing stipulation is unneeded. In addition we propose the notion of {\\sc topic ambiguity} within the centering framework, which predicts some ambiguities that occur in Japanese discourse. This analysis has implications for the design of language-independent discourse modules for Natural Language systems. The centering algorithm has been implemented in an HPSG Natural Language system with both English and Japanese grammars.

  12. Accredited Birth Centers

    Science.gov (United States)

    ... 9743 Accredited since January 2016 98 Bright Eyes Midwifery and Wild Rivers Women's Health Accredited 29135 Ellensburg ... Accredited since November 2015 96 Footprints in Time Midwifery Services and Birth Center Accredited 351 N. Water ...

  13. Advanced Missile Signature Center

    Data.gov (United States)

    Federal Laboratory Consortium — The Advanced Missile Signature Center (AMSC) is a national facility supporting the Missile Defense Agency (MDA) and other DoD programs and customers with analysis,...

  14. Oil Reserve Center Established

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Like other countries,China has started to grow its strategic oil reserve in case oil supplies are cut On December 18,2007,the National Development and Reform Commission(NDRC),China’s top economic planner,announced that the national oil reserve center has been officially launched.The supervisory system over the oil reserves has three levels: the energy department of the NDRC,the oil reserve center,and the reserve bases.

  15. Data center cooling system

    Energy Technology Data Exchange (ETDEWEB)

    Chainer, Timothy J; Dang, Hien P; Parida, Pritish R; Schultz, Mark D; Sharma, Arun

    2015-03-17

    A data center cooling system may include heat transfer equipment to cool a liquid coolant without vapor compression refrigeration, and the liquid coolant is used on a liquid cooled information technology equipment rack housed in the data center. The system may also include a controller-apparatus to regulate the liquid coolant flow to the liquid cooled information technology equipment rack through a range of liquid coolant flow values based upon information technology equipment temperature thresholds.

  16. National Biocontainment Training Center

    Science.gov (United States)

    2015-08-01

    than ever before as scientists push to understand the pathology and develop diagnostics, vaccines and therapeutics for deadly diseases like Ebola...Hardcastle, Vickie Jones, Sheri Leavitt, and Belinda Rivera. Gulf Coast Consortium Postdoctoral Veterinary Training Program - A clinical veterinarian from...the Center for Comparative Medicine at Baylor College of Medicine in Houston and a veterinarian from the University of Texas Health Science Center

  17. OS EFEITOS DO EXERCÍCIO AERÓBICO NO TRATAMENTO DO DIABETES MELLITUS TIPOS 1 E 2

    OpenAIRE

    da Silva Neto, João Henrique; Ex-aluno do Centro Universitário La Salle; Marques Toigo, Adriana

    2013-01-01

    O objetivo desse estudo foi revisar na literatura os efeitos do exercício aeróbico (especialmente na modalidade de dança) no tratamento do diabetes mellitus tipo 1 e tipo 2, apresentando resultados obtidos em pesquisa nacionais e internacionais. Inicialmente foram abordados aspectos conceituais sobre o diabetes mellitus tipos 1 e 2. Em seguida, verificou-se como o exercício aeróbico vem sendo utilizado como tratamento do diabetes e quais são seus benefícios em relação aos índices glicêmicos e...

  18. $Suzaku$ and $XMM-Newton$ observations of a newly-discovered early-stage cluster merger 1E2216.0-0401 and 1E2215.7-0404

    CERN Document Server

    Akamatsu, H; Shimwell, T W; Mernier, F; Mao, J; Urdampilleta, I; de Plaa, J; Röttgering, H J A; Kaastra, J S

    2016-01-01

    We present the results of $Suzaku$ and $XMM-Newton$ X-ray observations of the cluster pair 1E2216.0-0401 and 1E2215.7-0404. We discover an X-ray bridge between the clusters. $Suzaku$ and $XMM-Newton$ observations revealed that each cluster hosts gas with moderate temperature of $kT_{1E2216.0-0401}=$4.8$\\pm$0.1 keV and $kT_{1E2215.7-0404}=$5.8$\\pm$0.2 keV, respectively. On the other hand, the bridge region shows a remarkably high temperature ({\\it kT}=6.6$\\pm$0.5 keV). Furthermore, at the position of the bridge, we detected an enhancement in the wavelet-decomposed soft-band (0.5-4.0 keV) $XMM-Newton$ image at 3 sigma significance, this is most likely due to a compression of the intracluster medium (ICM) as a consequence of the merging activity. This X-ray intensity and temperature enhancement are not consistent with those expected from a late phase, but are in agreement with the predictions by numerical simulations of an early phase merger. From the temperature jump at the location of the bridge, the Mach numb...

  19. Engineer Research and Development Center's Materials Testing Center (MTC)

    Data.gov (United States)

    Federal Laboratory Consortium — The Engineer Research and Development Center's Materials Testing Center (MTC) is committed to quality testing and inspection services that are delivered on time and...

  20. Discovery of a pulsar wind nebula around the Magnetar Candidate AXP 1E1547.0-5408

    NARCIS (Netherlands)

    Vink, J.; Bamba, A.

    2009-01-01

    We report the detection of extended emission around the anomalous X-ray pulsar 1E1547.0-5408 using archival data of the Chandra X-ray satellite. The extended emission consists of an inner part, with an extent of 45 , and an outer part with an outer radius of 2. 9, which coincides with a supernova re

  1. The Relationship between Eating Disorders and ICAM-1, E-selection and Ghrelin Resting Level in Overweight People

    Directory of Open Access Journals (Sweden)

    Gholamreza Sharifi

    2014-11-01

    Full Text Available Introduction There is an agreement that eating disorder is related to psychological characteristics and on the other hand, level of ghrelin hormone, Intercellular adhesion molecule-1 (ICAM-1 and E-selection also change during eating disorders. We aimed to study the relationship between eating disorders and rest levels, ICAM-1, E-selection, and ghrelin hormone in obese people. Materials and Methods  In this quasi-experimental study, 120 obese men (25-30 years old were purposefully selected. Then the data about their eating disorders gathered with eating attitudes test (EAT-26 questionnaire. In the next phase in the rest condition and after overnight fasting, blood samples are collected for measurement of rest levels, ICAM-1, E-selection, and ghrelin hormone. Finally the data were analyzed with appropriate statistical tests in SPSS version 18. Results Mean and deviation of rest levels, ICAM-1, E-selection, and ghrelin hormone were respectively 3064.19, 61.5±19.7, and 2.5±1.5 and there was not any statistical significance relationship between eating disorders ICAM-1, E-selection, and ghrelin hormone in obese men (P

  2. Polymorphisms in CACNA1E and Camk2d are associated with seizure susceptibility of Sprague-Dawley rats.

    NARCIS (Netherlands)

    Rijkers, K.; Mescheriakova, J.; Majoie, M.; Lemmens, E.; Wijk, X.M.R. van; Philippens, M.; Kranen-Mastenbroek, V.H. van; Schijns, O.; Vles, J.; Hoogland, G.

    2010-01-01

    Seizures are associated with high intracellular calcium levels. However, conditions characterized by high intracellular calcium levels, such as stroke or traumatic brain injury, do not always evoke epilepsy. We hypothesized that polymorphisms in calcium-related genes CACNA1E and Camk2d contribute to

  3. "Infotonics Technology Center"

    Energy Technology Data Exchange (ETDEWEB)

    Fritzemeier, L. [Infotonics Technology Center Inc., Canandaigua, NY (United States); Boysel, M. B. [Infotonics Technology Center Inc., Canandaigua, NY (United States); Smith, D. R. [Infotonics Technology Center Inc., Canandaigua, NY (United States)

    2004-09-30

    During this grant period July 15, 2002 thru September 30, 2004, the Infotonics Technology Center developed the critical infrastructure and technical expertise necessary to accelerate the development of sensors, alternative lighting and power sources, and other specific subtopics of interest to Department of Energy. Infotonics fosters collaboration among industry, universities and government and operates as a national center of excellence to drive photonics and microsystems development and commercialization. A main goal of the Center is to establish a unique, world-class research and development facility. A state-of-the-art microsystems prototype and pilot fabrication facility was established to enable rapid commercialization of new products of particular interest to DOE. The Center has three primary areas of photonics and microsystems competency: device research and engineering, packaging and assembly, and prototype and pilot-scale fabrication. Center activities focused on next generation optical communication networks, advanced imaging and information sensors and systems, micro-fluidic systems, assembly and packaging technologies, and biochemical sensors. With targeted research programs guided by the wealth of expertise of Infotonics business and scientific staff, the fabrication and packaging facility supports and accelerates innovative technology development of special interest to DOE in support of its mission and strategic defense, energy, and science goals.

  4. Molecular Cloning and Expression of MaNPR1E Gene from Banana (Musa acuminata L. AAA group, cv. Cavendish)%香蕉NPR 1E 基因的克隆及表达分析

    Institute of Scientific and Technical Information of China (English)

    王卓; 徐碧玉; 贾彩红; 李健平; 刘菊华; 张建斌; 苗红霞; 金志强

    2015-01-01

    NPR1基因可参与调节植物对病原菌的广谱抗性,在植物系统抗性中起着关键的调控作用。通过RACE (rapid-amplification of cDNA ends)方法从香蕉根系中获得NPR1E基因,命名为MaNPR1E(GenBank登录号分别为: KF582550)。 MaNPR1E是香蕉NPR1基因编码框全长cDNA,包含一个1755 bp的最大开放阅读框,编码一个含584个氨基酸的蛋白质。经蛋白质序列同源比对发现,其含有完整的BTB/POZ结构域、锚蛋白重复ANK序列和NPR1-like-C结构域,属于典型的NPR1蛋白。系统进化树比对分析表明, MaNPR1E与海枣PdNPR3(XP_008808341.1)和油棕EgNPR3(XP_010914123.1)的亲缘关系较近。组织特异性研究表明,该基因组成型表达于香蕉各组织。实时荧光定量PCR分析表明,接种枯萎病菌后MaNPR1E的表达在感病品种中被抑制,而在抗病品种中被激活; MaNPR1E的表达受乙烯利和水杨酸的诱导。上述结果表明, MaNPR1E可能在香蕉抗枯萎病过程中扮演重要的调控角色。%NPR1(nonexpressor of PR gene 1), involved in regulating plant broad-spectrum resistance, plays important roles in plant system resistance. In this study, we report the molecular characteristics of NPR1E gene cloned from banana(Musa acuminate L. AAA group, cv. Cavendish)using a RACE-PCR-based strategy. MaNPR1E(accession number: KF582550) contained an open reading frame of 1 755 bp which encoded a polypeptide of 584 amino acids. Protein alignment showed that they contain the complete typical conserved BTB/POZ (BR-C, ttk and bab/Pox virus and Zinc finger)domain, ankyrin repeats and NPR1/NIM1 like defence protein C terminal, which belongs to a typical NPR1 protein. Phylogenetic analysis showed that the deduced amino acid sequences of MaNPR1E also have high similarity to PdNPR3 (XP_008808341.1) and EgNPR3 (XP_010914123.1) from Phoenix dactylifera and Elaeis guineensis, respectively. Tissue-specific studies showed that the expression of MaNPR1E was constitutive

  5. Hospitals report on cancer centers.

    Science.gov (United States)

    Rees, T

    2001-01-01

    Woman's Hospital, Baton Rouge, La., is first-place winner among cancer centers. Holy Cross Hospital's Michael and Dianne Bienes Comprehensive Cancer Center, Ft. Lauderdale, Fla., is named second; and, Cardinal Health System's Ball Cancer Center, Muncie, Ind., third.

  6. Caveolin-1, E-cadherin and β-catenin in Gastric Carcinoma, Precancerous Tissues and Chronic Non-atrophic Gastritis

    Institute of Scientific and Technical Information of China (English)

    Guo-yang Sun; Jun-xia Wu; Jian-sheng Wu; Yu-ting Pan; Rong Jin

    2012-01-01

    Objective:To investigate the expressions of caveolin-1,E-cadherin and β-catenin in gastric carcinoma,precancerous gastric and chronic non-atrophic gastritis tissues,and evaluate the correlation of these expressions with the development of gastric cancer.Methods:The expressions of caveolin-1,E-cadherin and β-catenin were detected by biotin-streptavidinperoxidase (SP) immunohistochemistry on 58 gastric cancer tissues,40 precancerous gastric tissues and 42 chronic non-atrophic gastritis tissues.The correlation between the expressions of caveolin-1,E-cadherin and β-catenin,and the clinicopathologic parameters of gastric cancer was analyzed retrospectively.Results:The positive rates of caveolin-1 and E-cadherin expressions in gastric carcinoma were significantly lower than precancerous gastric and chronic non-atrophic gastritis tissues (P<0.01).An abnormal rate of β-catenin expression in gastric carcinoma was higher than precancerous gastric and chronic non-atrophic gastritis tissues (P<0.01).Moreover,low expressions of caveolin-1,E-cadherin and β-catenin correlated with tumor size,depth of invasion,lymph node metastasis and TNM stage (P<0.05).The positive rates of caveolin-1 and E-cadherin expressions decreased (P<0.01),while an abnormal rate of β-catenin expression increased inversely,with the degree of atypical hyperplasia (P<0.01).Caveolin-1 expression correlated positively with E-cadherin (r=0.41,P<0.05).Caveolin-1 (r=-0.36,P<0.05) and E-cadherin (r=-0.45,P<0.05) expressions negatively correlated with abnormal β-catenin expression.Conclusion:These results suggested that dysregulated expressions of caveolin-1,E-cadherin and β-catenin correlated with the development of gastric cancer and its biological behavior.

  7. International Water Center

    Science.gov (United States)

    The urban district of Nancy and the Town of Nancy, France, have taken the initiative of creating an International Center of Water (Centre International de l'Eau à Nancy—NAN.C.I.E.) in association with two universities, six engineering colleges, the Research Centers of Nancy, the Rhine-Meuse Basin Agency, and the Chamber of Commerce and Industry. The aim of this center is to promote research and technology transfer in the areas of water and sanitation. In 1985 it will initiate a research program drawing on the experience of 350 researchers and engineers of various disciplines who have already been assigned to research in these fields. The research themes, the majority of which will be multidisciplinary, concern aspects of hygiene and health, the engineering of industrial processes, water resources, and the environment and agriculture. A specialist training program offering five types of training aimed at university graduates, graduates of engineering colleges, or experts, will start in October 1984.

  8. Lied Transplant Center

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-02-01

    The Department of Energy has prepared an Environmental Assessment (DOE/EA-1143) evaluating the construction, equipping and operation of the proposed Lied Transplant Center at the University of Nebraska Medical Center in Omaha, Nebraska. Based on the analysis in the EA, the DOE has determined that the proposed action does not constitute a major federal action significantly affecting the quality of the human environment within the meaning of the National Environmental Policy Act of 1969 (NEPA). Therefore, the preparation of an Environmental Statement in not required.

  9. Data Center Energy Retrofits

    OpenAIRE

    PervilÀ, Mikko

    2013-01-01

    Within the field of computer science, data centers (DCs) are a major consumer of energy. A large part of that energy is used for cooling down the exhaust heat of the servers contained in the DCs. This thesis describes both the aggregate numbers of DCs and key flagship installations in detail. We then introduce the concept of Data Center Energy Retrofits, a set of low cost, easy to install techniques that may be used by the majority of DCs for reducing their energy consumption. The main c...

  10. User Centered Design

    DEFF Research Database (Denmark)

    Egbert, Maria; Matthews, Ben

    2012-01-01

    The interdisciplinary approach of User Centered Design is presented here with a focus on innovation in the design and use of hearing technologies as well as on the potential of innovation in interaction. This approach is geared towards developing new products, systems, technologies and practices...... based on an understanding of why so few persons with hearing loss use the highly advanced hearing technologies. In integrating Conversation Analysis (“CA”), audiology and User Centered Design, three disciplines which are collaborating together for the first time, we are addressing the following...

  11. QUAD FAMILY CENTERING.

    Energy Technology Data Exchange (ETDEWEB)

    PINAYEV, I.

    2005-11-01

    It is well known that beam position monitors (BPM) utilizing signals from pickup electrodes (PUE) provide good resolution and relative accuracy. The absolute accuracy (i.e. position of the orbit in the vacuum chamber) is not very good due to the various reasons. To overcome the limitation it was suggested to use magnetic centers of quadrupoles for the calibration of the BPM [1]. The proposed method provides accuracy better then 200 microns for centering of the beam position monitors using modulation of the whole quadrupole family.

  12. Xichang Satellite Launch Center

    Institute of Scientific and Technical Information of China (English)

    LiuJie

    2004-01-01

    Xichang Satellite Launch Center(XSLC) is mainly for geosynchronous orbit launches. The main purpose of XSLC is to launch spacecraft, such as broadcasting,communications and meteorological satellites, into geo-stationary orbit.Most of the commercial satellite launches of Long March vehicles have been from Xichang Satellite Launch Center. With 20 years' development,XSLC can launch 5 kinds of launch vehicles and send satellites into geostationary orbit and polar orbit. In the future, moon exploration satellites will also be launched from XSLC.

  13. Center for Botanical Interaction Studies

    Data.gov (United States)

    Federal Laboratory Consortium — Research Area: Dietary Supplements, Herbs, Antioxidants Program:Centers for Dietary Supplements Research: Botanicals Description:This center will look at safety and...

  14. Data Analysis and Assessment Center

    Data.gov (United States)

    Federal Laboratory Consortium — The DoD Supercomputing Resource Center (DSRC) Data Analysis and Assessment Center (DAAC) provides classified facilities to enhance customer interactions with the ARL...

  15. The Competitive Relationships of SN2, SN1, E2, E1 Reactions in Organic Chemistry%有机化学中SN2,SN1,E2,E1反应的相互竞争关系

    Institute of Scientific and Technical Information of China (English)

    颜志明; 潘英明

    2014-01-01

    有机化学中的SN2,SN1,E2,E1反应在学习中有着重要的作用,同时也是学习中易混淆的知识点.通过总结它们的反应机理、反应影响因素和反应相互竞争关系图,并利用竞争关系图解答了一些典型考研真题,方便读者理解和掌握SN2,SN1,E2,E1反应的相互竞争关系.

  16. Qualification of electric motors class 1E for supply of motors and its repair; Calificacion de motores electricos clase 1E para el suministro de motores alternativos a los orginales y su reparacion

    Energy Technology Data Exchange (ETDEWEB)

    Perez, E.; Gonzalez, J. J.; Fernandez, A.; Garcia, D.

    2005-07-01

    Different original suppliers of nuclear grade equipment have either disappeared or discontinued the manufacture of this kind equipment. Under this situation nuclear plants are experiencing difficulties when dealing with the substitution or maintenance of these equipment. Tecnatom and Cantarey have developed a new line of Class 1E qualified electric low voltage motors which can be used as an alternative to originally installed safety-related motors or for its repair and maintenance. (Author)

  17. User-Centered Design through Learner-Centered Instruction

    Science.gov (United States)

    Altay, Burçak

    2014-01-01

    This article initially demonstrates the parallels between the learner-centered approach in education and the user-centered approach in design disciplines. Afterward, a course on human factors that applies learner-centered methods to teach user-centered design is introduced. The focus is on three tasks to identify the application of theoretical and…

  18. Economics of data center optics

    Science.gov (United States)

    Huff, Lisa

    2016-03-01

    Traffic to and from data centers is now reaching Zettabytes/year. Even the smallest of businesses now rely on data centers for revenue generation. And, the largest data centers today are orders of magnitude larger than the supercomputing centers of a few years ago. Until quite recently, for most data center managers, optical data centers were nice to dream about, but not really essential. Today, the all-optical data center - perhaps even an all-single mode fiber (SMF) data center is something that even managers of medium-sized data centers should be considering. Economical transceivers are the key to increased adoption of data center optics. An analysis of current and near future data center optics economics will be discussed in this paper.

  19. vCenter troubleshooting

    CERN Document Server

    Mills, Chuck

    2015-01-01

    The book is designed for the competent vCenter administrator or anyone who is responsible for the vSphere environment. It can be used as a guide by vSphere architects and VMware consultants for a successful vSphere solution. You should have good knowledge and an understanding of core elements and applications of the vSphere environment.

  20. Mobile PET Center Project

    Science.gov (United States)

    Ryzhikova, O.; Naumov, N.; Sergienko, V.; Kostylev, V.

    2017-01-01

    Positron emission tomography is the most promising technology to monitor cancer and heart disease treatment. Stationary PET center requires substantial financial resources and time for construction and equipping. The developed mobile solution will allow introducing PET technology quickly without major investments.

  1. Data Center Site Redundancy

    OpenAIRE

    Brotherton, H M; Dietz, J. Eric

    2014-01-01

    Commonly, disaster contingency calls for separation of location for redundant locations to maintain the needed redundancy. This document addresses issues for the data center redundancy, including limits to the distribution, distance and location that may impact on the efficiency or energy.

  2. Alternative Fuels Data Center

    Energy Technology Data Exchange (ETDEWEB)

    None

    2013-06-01

    Fact sheet describes the Alternative Fuels Data Center, which provides information, data, and tools to help fleets and other transportation decision makers find ways to reduce petroleum consumption through the use of alternative and renewable fuels, advanced vehicles, and other fuel-saving measures.

  3. School Based Health Centers

    Science.gov (United States)

    Children's Aid Society, 2012

    2012-01-01

    School Based Health Centers (SBHC) are considered by experts as one of the most effective and efficient ways to provide preventive health care to children. Few programs are as successful in delivering health care to children at no cost to the patient, and where they are: in school. For many underserved children, The Children's Aid Society's…

  4. Carolinas Energy Career Center

    Energy Technology Data Exchange (ETDEWEB)

    Classens, Anver; Hooper, Dick; Johnson, Bruce

    2013-03-31

    Central Piedmont Community College (CPCC), located in Charlotte, North Carolina, established the Carolinas Energy Career Center (Center) - a comprehensive training entity to meet the dynamic needs of the Charlotte region's energy workforce. The Center provides training for high-demand careers in both conventional energy (fossil) and renewable energy (nuclear and solar technologies/energy efficiency). CPCC completed four tasks that will position the Center as a leading resource for energy career training in the Southeast: • Development and Pilot of a New Advanced Welding Curriculum, • Program Enhancement of Non-Destructive Examination (NDE) Technology, • Student Support through implementation of a model targeted toward Energy and STEM Careers to support student learning, • Project Management and Reporting. As a result of DOE funding support, CPCC achieved the following outcomes: • Increased capacity to serve and train students in emerging energy industry careers; • Developed new courses and curricula to support emerging energy industry careers; • Established new training/laboratory resources; • Generated a pool of highly qualified, technically skilled workers to support the growing energy industry sector.

  5. Starting a sleep center.

    Science.gov (United States)

    Epstein, Lawrence J; Valentine, Paul S

    2010-05-01

    The demand for sleep medicine services has grown tremendously during the last decade and will likely continue. To date, growth in demand has been met by growth in the number of new sleep centers. The need for more new centers will be dependent on market drivers that include increasing regulatory requirements, personnel shortages, integration of home sleep testing, changes in reimbursement, a shift in emphasis from diagnostics to treatment, and an increased consumer focus on sleep. The decision to open a new center should be based on understanding the market dynamics, completing a market analysis, and developing a business plan. The business plan should include an overview of the facility, a personnel and organizational structure, an evaluation of the business environment, a financial plan, a description of services provided, and a strategy for obtaining, managing, and extending a referral base. Implementation of the business plan and successful operation require ongoing planning and monitoring of operational parameters. The need for new sleep centers will likely continue, but the shifting market dynamics indicate a greater need for understanding the marketplace and careful planning.

  6. Memorial Alexander Center

    Directory of Open Access Journals (Sweden)

    AECK Associates, Arquitectos

    1958-05-01

    Full Text Available En Atlanta, el Instituto Tecnológico de Georgia acaba de ampliar sus instalaciones deportivas, construyendo el Alexander Memorial Center. Consta este nuevo Centro de dos edificios: una pista de baloncesto cubierta y un edificio anejo con vestuarios, duchas, una pista de entrenamiento, equipos técnicos y la emisora de radio Georgia Tech W. G. S. T.

  7. NuSTAR and XMM-Newton observations of 1E1743.1-2843: indications of a neutron star LMXB nature of the compact object

    CERN Document Server

    Lotti, Simone; Mori, Kaya; Baganoff, Frederick K; Boggs, Steven E; Christensen, Finn E; Craig, William W; Hailey, Charles J; Harrison, Fiona A; Hong, Jaesub; Krivonos, Roman A; Rahoui, Farid; Stern, Daniel; Tomsick, John A; Zhang, Shuo; Zhang, William W

    2016-01-01

    We report on the results of NuSTAR and XMM-Newton observations of the persistent X-ray source \\object{1E1743.1-2843}, located in the Galactic Center region. The source was observed between September and October 2012 by NuSTAR and XMM-Newton, providing almost simultaneous observations in the hard and soft X-ray bands. The high X-ray luminosity points to the presence of an accreting compact object. We analyze the possibilities of this accreting compact object being either a neutron star (NS) or a black hole, and conclude that the joint XMM-Newton and NuSTAR spectrum from 0.3 to 40 $\\mathrm{keV}$ fits to a black body spectrum with $kT\\sim1.8~\\mathrm{keV}$ emitted from a hot spot or an equatorial strip on a neutron star surface. This spectrum is thermally Comptonized by electrons with $kT_{e}\\sim4.6~\\mathrm{keV}$. Accepting this neutron star hypothesis, we probe the Low Mass (LMXB) or High Mass (HMXB) X-ray Binary nature of the source. While the lack of Type-I bursts can be explained in the LMXB scenario, the abs...

  8. Effects of zinc supplementation and zinc chelation on in vitro β-cell function in INS-1E cells

    DEFF Research Database (Denmark)

    Nygaard, Sanne Bjørn; Larsen, Agnete; Knuhtsen, Astrid;

    2014-01-01

    BACKGROUND: Zinc is essential for the activities of pancreatic β-cells, especially insulin storage and secretion. Insulin secretion leads to co-release of zinc which contributes to the paracrine communication in the pancreatic islets. Zinc-transporting proteins (zinc-regulated transporter, iron......-regulated transporter-like proteins [ZIPs] and zinc transporters [ZnTs]) and metal-buffering proteins (metallothioneins, MTs) tightly regulate intracellular zinc homeostasis. The present study investigated how modulation of cellular zinc availability affects β-cell function using INS-1E cells. RESULTS: Using INS-1E...... cells, we found that zinc supplementation and zinc chelation had significant effects on insulin content and insulin secretion. Supplemental zinc within the physiological concentration range induced insulin secretion. Insulin content was reduced by zinc chelation with N,N,N',N-tektrakis(2-pyridylmethyl...

  9. Gamma-Rays and E0 and M1+E0 Transitions in $^{152}Tb \\to ^{152}$Gd Decay

    CERN Document Server

    Adam, J; Honusek, M; Kalinnikov, V G; Mrazek, J; Pronskikh, V S; Caloun, P; Lebedev, N A; Stegailov, V I; Tsoupko-Sitnikov, V M

    2001-01-01

    The decay of ^{152}Tb has been investigated by means of measurements of single gamma-spectra. The 704 transitions were observed, of which 347 were identified to the decay of ^{152}Tb for the first time. Using the more precise and full data about intensities of gamma-transitions and previously reported conversion electron intensities the E0 or M1+E0 multipolarities were established for several transitions.

  10. Effect of substrate rigidity in tissue culture on the function of insulin-secreting INS-1E cells.

    Science.gov (United States)

    Naujok, O; Bandou, Y; Shikama, Y; Funaki, M; Lenzen, S

    2017-01-01

    Insulin-secreting INS-1E cells are a useful tool in diabetes research. However, during permanent culture the cells tend to lose their β cell phenotype, with resultant loss of insulin-secretory responsiveness. This can be at least partially attributed to inappropriate cell culture conditions. One of the important causative factors is the rigidity of the extracellular matrix. We have therefore systematically studied the performance of INS-1E insulin-secreting cells cultured on polyacrylamide gels of different stiffnesses and analysed changes in insulin content and secretion, glucokinase enzyme activity, gene expression of β cell transcription factors and cell death and proliferation rates. INS-1E cells were cultured on polyacrylamide gels with a wide range of rigidities, including the one that simulates the stiffness of the pancreas. We detected changes in insulin content and the insulin-secretory response to glucose stimulation in parallel to the increasing stiffness of the polyacrylamide gels in the range 1700-111 000 Pa. On substrates with the highest and lowest rigidities, 322 and 111 000 Pa, the cells mainly formed pseudo-islets, while at rigidities of 1700-64800 Pa, including the rigidity of native pancreas tissue (3100 Pa), cells grew as a monolayer attached to the polyacrylamide gel surface. These observations provide evidence for an apparent mechanosensitivity of insulin-secreting INS-1E cells affecting morphology and cellular functions. The results can also provide practical advice regarding a selection of the materials appropriate for successful cell culture of insulin-secreting cells. Copyright © 2014 John Wiley & Sons, Ltd.

  11. High-dose clevudine impairs mitochondrial function and glucose-stimulated insulin secretion in INS-1E cells

    Directory of Open Access Journals (Sweden)

    Jang Yoon-Ok

    2012-01-01

    Full Text Available Abstract Background Clevudine is a nucleoside analog reverse transcriptase inhibitor that exhibits potent antiviral activity against hepatitis B virus (HBV without serious side effects. However, mitochondrial myopathy has been observed in patients with chronic HBV infection taking clevudine. Moreover, the development of diabetes was recently reported in patients receiving long-term treatment with clevudine. In this study, we investigated the effects of clevudine on mitochondrial function and insulin release in a rat clonal β-cell line, INS-1E. Methods The mitochondrial DNA (mtDNA copy number and the mRNA levels were measured by using quantitative PCR. MTT analysis, ATP/lactate measurements, and insulin assay were performed. Results Both INS-1E cells and HepG2 cells, which originated from human hepatoma, showed dose-dependent decreases in mtDNA copy number and cytochrome c oxidase-1 (Cox-1 mRNA level following culture with clevudine (10 μM-1 mM for 4 weeks. INS-1E cells treated with clevudine had reduced total mitochondrial activities, lower cytosolic ATP contents, enhanced lactate production, and more lipid accumulation. Insulin release in response to glucose application was markedly decreased in clevudine-treated INS-1E cells, which might be a consequence of mitochondrial dysfunction. Conclusions Our data suggest that high-dose treatment with clevudine induces mitochondrial defects associated with mtDNA depletion and impairs glucose-stimulated insulin secretion in insulin-releasing cells. These findings partly explain the development of diabetes in patients receiving clevudine who might have a high susceptibility to mitochondrial toxicity.

  12. Metronomic Cyclophosphamide and Methotrexate Chemotherapy Combined with 1E10 Anti-Idiotype Vaccine in Metastatic Breast Cancer

    Directory of Open Access Journals (Sweden)

    Jorge L. Soriano

    2011-01-01

    Full Text Available The use of low doses of cytotoxic agents continuously for prolonged periods is an alternative for the treatment of patients with metastatic breast cancer who have developed resistance to conventional chemotherapy. The combination of metronomic chemotherapy with therapeutic vaccines might increase the efficacy of the treatment. Twenty one patients with metastatic breast cancer in progression and a Karnosky index ≥60%, were treated with metronomic chemotherapy (50 mg of cyclophospamide orally daily and 2.5 mg of methotrexate orally bi-daily, in combination with five bi-weekly subcutaneous injections of 1 mg of aluminum hydroxide-precipitated 1E10 anti-idiotype MAb (1E10-Alum, followed by reimmunizations every 28 days. Five patients achieved objective response, eight showed stable disease and eight had disease progression. Median time to progression was 9,8 months, while median overall survival time was 12,93 months. The median duration of the response (CR+PR+SD was 18,43 months (12,20–24,10 months, being higher than 12 months in 76,9% of the patients. Overall toxicity was generally mild. Metronomic chemotherapy combined with 1E10-Alum vaccine immunotherapy might be a useful therapeutic option for the treatment of metastatic breast cancer due to its potential impact on survival and patient quality of live, low toxicity and advantages of the administration.

  13. Optical and X-ray Spectroscopy of 1E 0449.4-1823 Demise of the original type 2 QSO

    CERN Document Server

    Halpern, J P; Forster, K; Halpern, Jules P.; Eracleous, Michael; Forster, Karl

    1998-01-01

    New optical spectra of the original narrow-line quasar 1E 0449.4-1823 show that it now has broad emission lines of considerable strength, eliminating it as a "type 2 QSO" candidate. We suggest that the behavior of 1E 0449.4-1823 is the same as that of some Seyfert 1.8 and 1.9 galaxies, in which Goodrich attributed long-term variations of their broad Balmer lines to dynamical motions of obscuring material located in or around the broad-line region. The optical continuum and broad emission-line regions of 1E 0449.4-1823 may still be partly covered in our line of sight, which would explain its large forbidden-line equivalent widths and flat alpha_ox relative to other low-redshift QSOs. Also present are apparent absorption features in the broad Balmer lines and in Mg II, which may be related to the past obscuration and current emergence of the broad-line region. However, it is difficult to distinguish absorption from broad emission-line peaks that are displaced in velocity; we consider the latter a plausible comp...

  14. 1E 1547.0-5408: a radio-emitting magnetar with a rotation period of 2 seconds

    CERN Document Server

    Camilo, F; Halpern, J P; Reynolds, J

    2007-01-01

    The variable X-ray source 1E 1547.0-5408 was identified by Gelfand & Gaensler (2007) as a likely magnetar in G327.24-0.13, an apparent supernova remnant. No X-ray pulsations have been detected from it. Using the Parkes radio telescope, we discovered pulsations with period P = 2.069 s. Using the Australia Telescope Compact Array, we localized these to 1E 1547.0-5408. We measure dP/dt = (2.318+-0.005)e-11, which for a magnetic dipole rotating in vacuo gives a surface field strength of 2.2e14 G, a characteristic age of 1.4 kyr, and a spin-down luminosity of 1.0e35 ergs/s. Together with its X-ray characteristics, these rotational parameters of 1E 1547.0-5408 prove that it is a magnetar, only the second known to emit radio waves. The distance is ~9 kpc, derived from the dispersion measure of 830 pc/cc. The pulse profile at a frequency of 1.4 GHz is extremely broad and asymmetric due to multipath propagation in the ISM, as a result of which only approximately 75% of the total flux at 1.4 GHz is pulsed. At highe...

  15. Observations of the magnetars 4U 0142+61 and 1E 2259+586 with the MAGIC telescopes

    CERN Document Server

    Aleksić, J; Antoranz, P; Asensio, M; de Almeida, U Barres; Barrio, J A; Bednarek, W; Berger, K; Bernardini, E; Biland, A; Blanch, O; Bock, R K; Boller, A; Bonnefoy, S; Bonnoli, G; Tridon, D Borla; Bretz, T; Carmona, E; Carosi, A; Fidalgo, D Carreto; Colin, P; Colombo, E; Contreras, J L; Cortina, J; Cossio, L; Covino, S; Da Vela, P; Dazzi, F; De Angelis, A; De Caneva, G; De Lotto, B; Mendez, C Delgado; Doert, M; Domínguez, A; Prester, D Dominis; Dorner, D; Doro, M; Eisenacher, D; Elsaesser, D; Ferenc, D; Fonseca, M V; Font, L; Fruck, C; López, R J García; Garczarczyk, M; Terrats, D Garrido; Gaug, M; Giavitto, G; Godinović, N; Muñoz, A González; Gozzini, S R; Hadamek, A; Hadasch, D; Herrero, A; Hose, J; Hrupec, D; Jankowski, F; Kadenius, V; Klepser, S; Knoetig, M L; Krähenbühl, T; Krause, J; Kushida, J; La Barbera, A; Lelas, D; Leonardo, E; Lewandowska, N; Lindfors, E; Lombardi, S; López, M; López-Coto, R; López-Oramas, A; Lorenz, E; Lozano, I; Makariev, M; Mallot, K; Maneva, G; Mankuzhiyil, N; Mannheim, K; Maraschi, L; Marcote, B; Mariotti, M; Martínez, M; Masbou, J; Mazin, D; Meucci, M; Miranda, J M; Mirzoyan, R; Moldón, J; Moralejo, A; Munar-Adrover, P; Nakajima, D; Niedzwiecki, A; Nieto, D; Nilsson, K; Nowak, N; Orito, R; Paiano, S; Palatiello, M; Paneque, D; Paoletti, R; Paredes, J M; Partini, S; Persic, M; Pilia, M; Prada, F; Moroni, P G Prada; Prandini, E; Puljak, I; Reichardt, I; Reinthal, R; Rhode, W; Ribó, M; Rico, J; Rügamer, S; Saggion, A; Saito, K; Saito, T Y; Salvati, M; Satalecka, K; Scalzotto, V; Scapin, V; Schultz, C; Schweizer, T; Shore, S N; Sillanpää, A; Sitarek, J; Snidaric, I; Sobczynska, D; Spanier, F; Spiro, S; Stamatescu, V; Stamerra, A; Steinke, B; Storz, J; Sun, S; Surić, T; Takalo, L; Takami, H; Tavecchio, F; Temnikov, P; Terzić, T; Tescaro, D; Teshima, M; Tibolla, O; Torres, D F; Toyama, T; Treves, A; Uellenbeck, M; Vogler, P; Wagner, R M; Weitzel, Q; Zandanel, F; Zanin, R; Rea, N

    2012-01-01

    Magnetars are an extreme, highly magnetized class of isolated neutron stars whose large X-ray luminosity is believed to be driven by their high magnetic field. In this work we study for the first time the possible very high energy gamma-ray emission above 100 GeV from magnetars, observing the sources 4U 0142+61 and 1E 2259+586. We observed the two sources with atmospheric Cherenkov telescopes in the very high energy range (E > 100 GeV). 4U 0142+61 was observed with the MAGIC I telescope in 2008 for ~25 h and 1E 2259+586 was observed with the MAGIC stereoscopic system in 2010 for ~14 h. The data were analyzed with the standard MAGIC analysis software. Neither magnetar was detected. Upper limits to the differential and integral flux above 200 GeV were computed using the Rolke algorithm. We obtain integral upper limits to the flux of 1.52*10^-12cm^-2 s^-1 and 2.7*10^-12cm^-2 s^-1 with a confidence level of 95% for 4U 0142+61 and 1E 2259+586, respectively. The resulting differential upper limits are presented tog...

  16. A glitch and an anti-glitch in the anomalous X-ray pulsar 1E 1841-045

    CERN Document Server

    Mus, Sinem Sasmaz; Gogus, Ersin

    2014-01-01

    We investigated the long-term spin properties of the anomalous X-ray pulsar (AXP) 1E 1841-045 by performing a temporal analysis of archival RXTE observations spanning about 5.2 yr from 2006 September to 2011 December. We identified two peculiar timing anomalies within ~1 yr of each other: a glitch with Delta(nu)/nu ~ 4.8 x 10^{-6} near MJD 54303; and an anti-glitch with Delta(nu)/nu ~ -5.8 x 10^{-7} near MJD 54656. The glitch that we identified, which is the fourth glitch seen in this source in the 13 yr of RXTE monitoring, is similar to the last two detected glitches. The anti-glitch from 1E 1841-045, however, is the first to be identified. The amplitude of the anti-glitch was comparable with that recently observed in AXP 1E 2259+586. We found no significant variations in the pulsed X-ray output of the source during either the glitch or the anti-glitch. We discuss our results in relation to the standard pulsar glitch mechanisms for the glitch, and to plausible magnetospheric scenarios for the anti-glitch.

  17. Suppression of the Nuclear Factor Eny2 Increases Insulin Secretion in Poorly Functioning INS-1E Insulinoma Cells

    Directory of Open Access Journals (Sweden)

    P. Dames

    2012-01-01

    Full Text Available Eny2, the mammalian ortholog of yeast Sus1 and drosophila E(y2, is a nuclear factor that participates in several steps of gene transcription and in mRNA export. We had previously found that Eny2 expression changes in mouse pancreatic islets during the metabolic adaptation to pregnancy. We therefore hypothesized that the protein contributes to the regulation of islet endocrine cell function and tested this hypothesis in rat INS-1E insulinoma cells. Overexpression of Eny2 had no effect but siRNA-mediated knockdown of Eny2 resulted in markedly increased glucose and exendin-4-induced insulin secretion from otherwise poorly glucose-responsive INS-1E cells. Insulin content, cellular viability, and the expression levels of several key components of glucose sensing remained unchanged; however glucose-dependent cellular metabolism was higher after Eny2 knockdown. Suppression of Eny2 enhanced the intracellular incretin signal downstream of cAMP. The use of specific cAMP analogues and pathway inhibitors primarily implicated the PKA and to a lesser extent the EPAC pathway. In summary, we identified a potential link between the nuclear protein Eny2 and insulin secretion. Suppression of Eny2 resulted in increased glucose and incretin-induced insulin release from a poorly glucose-responsive INS-1E subline. Whether these findings extend to other experimental conditions or to in vivo physiology needs to be determined in further studies.

  18. Entanglement with Centers

    CERN Document Server

    Ma, Chen-Te

    2015-01-01

    Entanglement is a physical phenomenon that each state cannot be described individually. Entanglement entropy gives quantitative understanding to the entanglement. We use decomposition of the Hilbert space to discuss properties of the entanglement. Therefore, partial trace operator becomes important to define the reduced density matrix from different centers, which commutes with all elements in the Hilbert space, corresponding to different entanglement choices or different observations on entangling surface. Entanglement entropy is expected to satisfy the strong subadditivity. We discuss decomposition of the Hilbert space for the strong subadditivity and other related inequalities. The entanglement entropy with centers can be computed from the Hamitonian formulations systematically, provided that we know wavefunctional. In the Hamitonian formulation, it is easier to obtain symmetry structure. We consider massless $p$-form theory as an example. The massless $p$-form theory in ($2p+2)$-dimensions has global symm...

  19. THE HUMORAL AND CELLULAR IMMUNE RESPONSES INDUCED BY HPV18L1-E6/E7 DNA VACCINES IN MICE

    Institute of Scientific and Technical Information of China (English)

    Yang Jin; Li Xu; Li Ang; Wang Yili; Si Lüsheng

    2006-01-01

    Objective To construct eukaryotic expression vector of HPV18 L1- E6, E7 chimeric gene and examine the humoral and cellular immune responses induced by this DNA vaccines in mice. Methods The C-terminal of major capsid protein L1 gene and mutant zinc finger domains of early E6/7 oncogenes in HPV18 were integrated and inserted into eukaryotic expression vector pVAX1 to generate vaccines pVAX1-L1E6Mxx, E7Mxx. CHO cells were transiently transfected with the individual construct. Target protein expressions in the lysate of the transfected cells were measured by ELISA and immunocytochemistry. After BALB/c mice were vaccinated with various recombinant plasmids(pVAX1-L1-E6M3 or pVAX1-L1-E7M3) and immunie adjuvants (pLXHDmB7-2 or LTB) through different administration routes (intramuscular or intranasal) , the great cellular immune responses were produced as revealed by delayed-type hypersensitivity (DTH) and lymphocyte proliferation, and the expression of IL-4 and IFN- γ cells in CD4+ and CD8+subpopulations. Results The highly efficient expression of pVAX1-L1E6Mxx, E7Mxx vector in host eukaryotic cells were demonstrated both by ELISA and immunocytochemistry. The level of specific serum IgG against HPV in experiment groups mice was much higher than that of control group, and intranuscular immunization group had the highest antibody level. Intramuscular immunization groups were superior to intranasal immunization groups in DTH response, splenocyte proliferation and CD8+ IFN-γ + cells number, but CD4+ IL4+ cell number was higher in intranasal immunization groups. The immunization groups using pLXHDmB7-2 as adjuvant were superior to other groups in immunoresponse. Conclusion These DNA vaccines produce remarkable cellular and humoral immuneresponses in the mouse and may provide as prophylatic and therapeutic candidates for HPV induced cancer treatment.

  20. Home media center

    OpenAIRE

    Valverde Martinez, Juan Miguel

    2014-01-01

    One of the most popular indoor entertainment systems nowadays is related to playing multimedia files, not only at home but also in public events such as watching movies in cinemas or playing music in nightclubs or pubs. Developers are responsible for making this easier and innovating in the development of these systems in different ways. This project's goal was to develop a home media center which allows the user to play multimedia files easily. In addition, the development was intended t...

  1. COMPUTATIONAL SCIENCE CENTER

    Energy Technology Data Exchange (ETDEWEB)

    DAVENPORT,J.

    2004-11-01

    The Brookhaven Computational Science Center brings together researchers in biology, chemistry, physics, and medicine with applied mathematicians and computer scientists to exploit the remarkable opportunities for scientific discovery which have been enabled by modern computers. These opportunities are especially great in computational biology and nanoscience, but extend throughout science and technology and include for example, nuclear and high energy physics, astrophysics, materials and chemical science, sustainable energy, environment, and homeland security.

  2. Suzaku and XMM-Newton observations of the newly discovered early-stage cluster merger of 1E2216.0-0401 and 1E2215.7-0404

    Science.gov (United States)

    Akamatsu, H.; Gu, L.; Shimwell, T. W.; Mernier, F.; Mao, J.; Urdampilleta, I.; de Plaa, J.; Röttgering, H. J. A.; Kaastra, J. S.

    2016-09-01

    We present the results of Suzaku and XMM-Newton X-ray observations of the cluster pair 1E2216.0-0401 and 1E2215.7-0404. We discover an X-ray bridge between the clusters. Suzaku and XMM-Newton observations revealed that each cluster hosts gas with moderate temperature of kT0401 = 4.8 ± 0.1 keV and kT0404 = 5.8 ± 0.2 keV, respectively. On the other hand, the bridge region shows a remarkably high temperature (kT = 6.6 ± 0.5 keV). Furthermore, at the position of the bridge, we detected an enhancement in the wavelet-decomposed soft-band (0.5-4.0 keV) XMM-Newton image at 3 sigma significance, this is most likely due to a compression of the intracluster medium (ICM) as a consequence of the merging activity. This X-ray intensity and temperature enhancement are not consistent with those expected from a late phase, but are in agreement with the predictions by numerical simulations of an early phase merger. From the temperature jump at the location of the bridge, the Mach number is estimated to be ℳ = 1.4 ± 0.1, which corresponds to a shock propagation velocity of about 1570 km s-1. From the shock properties, we estimate that core-passage will occur in 0.3-0.6 Gyr and that the age of the shock structure is 50-100 Myr. Based on the measured properties of the ICM at the bridge and estimation of timescales, we find indications for non-equilibrium ionization. We also discover possible diffuse radio emission located between the merging clusters. Combining the radio, X-ray, and optical image data, we speculate that the detected radio sources are most likely related to the merger event. Thus, 1E2216.0-0401 and 1E2215.7-0404 is a new example of an early phase cluster merger with remarkable characteristics.

  3. Changes in the X-Ray Emission from the Magnetar Candidate 1E 2259+586 During its 2002 Outburst

    Science.gov (United States)

    Woods, P. M.; Kaspi, V. M.; Thompson, C.; Gavrill, F. P.; Marshall, H. L.; Chakrabarty, D.; Flanagan, K.; Heyl, J.; Hernquist, L.

    2004-01-01

    An outburst of more than 80 individual bursts, similar to those seen from Soft Gamma Repeaters (SGRs), was detected from the anomalous X-ray pulsar (AXP) 1E 2259+586 in 2002 June. Coincident with this burst activity were gross changes in the pulsed flux, persistent flux, energy spectrum, pulse profile, and spin-down of the underlying X-ray source. We present Rossi X-Ray Timing Explorer and X-Ray Multi-Mirror Mission observations of 1E 2259+586 that show the evolution of the aforementioned source parameters during and following this episode and identify recovery timescales for each. Specifically, we observe an X-ray flux increase (pulsed and phase-averaged) by more than an order of magnitude having two distinct components. The first component is linked to the burst activity and decays within approx. 2 days, during which the energy spectrum is considerably harder than during the quiescent state of the source. The second component decays over the year following the glitch according to a power law in time with an exponent -0.22 +/- 0.01. The pulsed fraction decreased initially to approx. 15% rms but recovered rapidly to the preoutburst level of approx. 23% within the first 3 days. The pulse profile changed significantly during the outburst and recovered almost fully within 2 months of the outburst. A glitch of size Delta(sib (nu)max) = (4.24 +/- 0.11) x 10(exp -6) was observed in 1E 2259+586, which preceded the observed burst activity. The glitch could not be well fitted with a simple partial exponential recovery. An exponential rise of approx. 20% of the frequency jump with a timescale of approx. 14 days results in a significantly better fit to the data; however, contamination from a systematic drift in the phase of the pulse profile cannot be excluded. A fraction of the glitch (approx. 19%) was recovered in a quasi-exponential manner having a recovery timescale of approx. 16 days. The long-term postglitch spin-down rate decreased in magnitude relative to the

  4. A Burst and Simultaneous Short-term Pulsed Flux Enhancement fom the Magnetar Candidate 1E 1048.1-5937

    Science.gov (United States)

    Gavriil, Fotis P.; Kaspi, Victoria M.; Woods, Peter M.; Lyutikov, Maxim

    2005-01-01

    We report on the latest X-ray burst detected from the direction of the Anomalous X-ray Pulsar (AXP) 1E 1048.1-5937 using the Rossi X-ray Timing Explorer (RXTE). Following the burst the AXP was observed further with RXTE, XMM-Newton and Chandra. We find a simultaneous increase of approx. 3.7 times the quiescent value (approx. 5 sigma) in the pulsed component of the pulsar's flux during the tail of the burst which identifies the AXP as the burst's origin. The burst was overall very similar to the two others reported from this source in 2001. The unambiguous identification of 1E 1048.1-5937 as the burster here suggests it was in 2001 as well. Pre- and post-burst observations revealed no change in the total flux or spectrum of the quiescent emission. Comparing all three bursts detected thus far from this source we find that this event was the most fluent (170+/-42 x 10(exp -10) erg cm-2), had the highest peak flux (71+/-16 x 10(exp -10) erg/s/sq cm), the longest duration (approx. 411 s). The epoch of the burst peak was consistent with the arrival time of 1E 1048.1-5937's pulse peak. The burst exhibited significant spectral evolution with the trend going from hard to soft. Although the average spectrum of the burst was comparable in hardness (Gamma approx. 1) to those of the 2001 bursts, the peak of this burst was much harder (Gamma approx. 0.5).

  5. Crystal Structure of UBA2[superscript ufd]-Ubc9: Insights into E1-E2 Interactions in Sumo Pathways

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Jing; Taherbhoy, Asad M.; Hunt, Harold W.; Seyedin, Steven N.; Miller, David W.; Miller, Darcie J.; Huang, Danny T.; Schulman, Brenda A. (SJCH)

    2012-04-30

    Canonical ubiquitin-like proteins (UBLs) such as ubiquitin, Sumo, NEDD8, and ISG15 are ligated to targets by E1-E2-E3 multienzyme cascades. The Sumo cascade, conserved among all eukaryotes, regulates numerous biological processes including protein localization, transcription, DNA replication, and mitosis. Sumo conjugation is initiated by the heterodimeric Aos1-Uba2 E1 enzyme (in humans called Sae1-Uba2), which activates Sumo's C-terminus, binds the dedicated E2 enzyme Ubc9, and promotes Sumo C-terminal transfer between the Uba2 and Ubc9 catalytic cysteines. To gain insights into details of E1-E2 interactions in the Sumo pathway, we determined crystal structures of the C-terminal ubiquitin fold domain (ufd) from yeast Uba2 (Uba2{sup ufd}), alone and in complex with Ubc9. The overall structures of both yeast Uba2{sup ufd} and Ubc9 superimpose well on their individual human counterparts, suggesting conservation of fundamental features of Sumo conjugation. Docking the Uba2{sup ufd}-Ubc9 and prior full-length human Uba2 structures allows generation of models for steps in Sumo transfer from Uba2 to Ubc9, and supports the notion that Uba2 undergoes remarkable conformational changes during the reaction. Comparisons to previous structures from the NEDD8 cascade demonstrate that UBL cascades generally utilize some parallel E1-E2 interaction surfaces. In addition, the structure of the Uba2{sup ufd}-Ubc9 complex reveals interactions unique to Sumo E1 and E2. Comparison with a previous Ubc9-E3 complex structure demonstrates overlap between Uba2 and E3 binding sites on Ubc9, indicating that loading with Sumo and E3-catalyzed transfer to substrates are strictly separate steps. The results suggest mechanisms establishing specificity and order in Sumo conjugation cascades.

  6. Memorial Center - Milwaukee

    Directory of Open Access Journals (Sweden)

    Saarinen, Eero

    1959-12-01

    Full Text Available El Memorial Center de Milwaukee ha sido erigido en la parte más alta de la ciudad, coronando una enorme colina que domina ampliamente el conjunto urbano y un hermoso lago. Su emplazamiento, al final de un puente de grandes dimensiones, exigía que fuese tratado en armonía con éste, habiéndose adoptado por ello el sistema de colocar la edificación reposando sobre una planta totalmente diáfana que deja vista la estructura, cuyos esbeltos soportes dan sensación de monumentalidad.

  7. COMPUTATIONAL SCIENCE CENTER

    Energy Technology Data Exchange (ETDEWEB)

    DAVENPORT, J.

    2005-11-01

    The Brookhaven Computational Science Center brings together researchers in biology, chemistry, physics, and medicine with applied mathematicians and computer scientists to exploit the remarkable opportunities for scientific discovery which have been enabled by modern computers. These opportunities are especially great in computational biology and nanoscience, but extend throughout science and technology and include, for example, nuclear and high energy physics, astrophysics, materials and chemical science, sustainable energy, environment, and homeland security. To achieve our goals we have established a close alliance with applied mathematicians and computer scientists at Stony Brook and Columbia Universities.

  8. A Burst and Simultaneous Short-Term Pulsed Flux Enhancement From The Magnetar Candidate 1E 1048.1-5937

    Science.gov (United States)

    Gavriil, Fotis P.; Kaspi, Victoria M.; Woods, Peter M.

    2006-01-01

    We report on the 2004 June 29 X-ray burst detected from the direction of the AXP 1E 1048.1-5937 using the RXTE. We find a simultaneous increase of approx. 3.5 times the quiescent value in the 2-10 keV pulsed flux of 1E 1048.1-5937 during the tail of the burst, which identifies the AXP as the burst s origin. The burst was overall very similar to the two others reported from the direction of this source in 2001. The unambiguous identification of 1E 1048.1-5937 as the burster here confirms that it was the origin of the 2001 bursts as well. The epoch of the burst peak was very close to the arrival time of 1E 1048.1-5937 s pulse peak. The burst exhibited significant spectral evolution, with the trend going from hard to soft. Although the average spectrum of the burst was comparable in hardness (Lambda approx. 1.6) to those,of the 2001 bursts, the peak of this burst was much harder (Lambda approx. 0.3). During the 11 days following the burst, the AXP was observed further with RXTE, XMM-Newton, and Chandra. Pre- and post-burst observations revealed no change in the total flux or spectrum of the quiescent emission. Comparing all three bursts detected thus far from this source, we find that this event was the most fluent (>3.3 x 10(exp-8 ergs/sq cm) in the 2-20 keV band), had the highest peak flux (59+/-9 x 10(exp -10)ergs/s/sq cm) in the 2-20 keV band), and had the longest duration (>699 s). The long duration of the burst difFerentiates it from SGR bursts, which have typical durations of approx.0.1 s. Bursts that occur preferentially at pulse maximum, have fast rises, and long X-tails containing the majority of the total burst energy have been seen uniquely from AXPs. The marked differences between AXP and SGRs bursts may provide new clues to help understand the physical differences between these objects.

  9. Raman E sub 1 , E sub 1 + DELTA sub 1 resonance in nonstressed quantum dots of germanium

    CERN Document Server

    Talochkin, A B; Efanov, A V; Kozhemyako, I G; Shumskij, V N

    2001-01-01

    The Raman light scattering on the optical phonons in the nonstressed Ge quantum dots, obtained in the GaAs/ZnSe/Ge/ZnSe structures is studied through the molecular-beam epitaxy. The E sub 1 , E sub 1 + DELTA sub 1 resonance energy shift, connected with quantization of the electron and hole states spectrum in the quantum dots is observed. Application of the simplest localization model with an account of the Ge electron states spectrum made it possible to explain the observed peculiarities

  10. "4M1E"法在工程安全管理中的运用

    Institute of Scientific and Technical Information of China (English)

    高新; 步晓斌

    2005-01-01

    抓住人(man)、机械(machine)、材料(material)、方法(method)、环境(enviroment)这几个主要环节实行全面质量管理,称为"4M1E"法.在施工安全管理上应用该法不但能收到较好的效果,而且使安全管理更加有序.文中以航道驳岸施工安全管理的实践加以阐述.

  11. Sustainable Biofuels Development Center

    Energy Technology Data Exchange (ETDEWEB)

    Reardon, Kenneth F. [Colorado State Univ., Fort Collins, CO (United States)

    2015-03-01

    The mission of the Sustainable Bioenergy Development Center (SBDC) is to enhance the capability of America’s bioenergy industry to produce transportation fuels and chemical feedstocks on a large scale, with significant energy yields, at competitive cost, through sustainable production techniques. Research within the SBDC is organized in five areas: (1) Development of Sustainable Crops and Agricultural Strategies, (2) Improvement of Biomass Processing Technologies, (3) Biofuel Characterization and Engine Adaptation, (4) Production of Byproducts for Sustainable Biorefining, and (5) Sustainability Assessment, including evaluation of the ecosystem/climate change implication of center research and evaluation of the policy implications of widespread production and utilization of bioenergy. The overall goal of this project is to develop new sustainable bioenergy-related technologies. To achieve that goal, three specific activities were supported with DOE funds: bioenergy-related research initiation projects, bioenergy research and education via support of undergraduate and graduate students, and Research Support Activities (equipment purchases, travel to attend bioenergy conferences, and seminars). Numerous research findings in diverse fields related to bioenergy were produced from these activities and are summarized in this report.

  12. Data center coolant switch

    Energy Technology Data Exchange (ETDEWEB)

    Iyengar, Madhusudan K.; Parida, Pritish R.; Schultz, Mark D.

    2015-10-06

    A data center cooling system is operated in a first mode; it has an indoor portion wherein heat is absorbed from components in the data center, and an outdoor heat exchanger portion wherein outside air is used to cool a first heat transfer fluid (e.g., water) present in at least the outdoor heat exchanger portion of the cooling system during the first mode. The first heat transfer fluid is a relatively high performance heat transfer fluid (as compared to the second fluid), and has a first heat transfer fluid freezing point. A determination is made that an appropriate time has been reached to switch from the first mode to a second mode. Based on this determination, the outdoor heat exchanger portion of the data cooling system is switched to a second heat transfer fluid, which is a relatively low performance heat transfer fluid, as compared to the first heat transfer fluid. It has a second heat transfer fluid freezing point lower than the first heat transfer fluid freezing point, and the second heat transfer fluid freezing point is sufficiently low to operate without freezing when the outdoor air temperature drops below a first predetermined relationship with the first heat transfer fluid freezing point.

  13. National Center for Biotechnology Information

    Science.gov (United States)

    ... to NCBI Sign Out NCBI National Center for Biotechnology Information Search database All Databases Assembly BioProject BioSample ... Search Welcome to NCBI The National Center for Biotechnology Information advances science and health by providing access ...

  14. Center for Beam Physics, 1992

    Energy Technology Data Exchange (ETDEWEB)

    1993-06-01

    This report contains the following information on the center for beam physics: Facilities; Organizational Chart; Roster; Profiles of Staff; Affiliates; Center Publications (1991--1993); and 1992 Summary of Activities.

  15. Daugherty Memorial Assessment Center (DMAC)

    Data.gov (United States)

    Federal Laboratory Consortium — Daugherty Memorial Assessment Center (DMAC) is a 39,000-square-foot facility that doubles the warfare center's high-secured performance assessment capabilities. DMAC...

  16. Italy INAF Data Center Report

    Science.gov (United States)

    Negusini, M.; Sarti, P.

    2013-01-01

    This report summarizes the activities of the Italian INAF VLBI Data Center. Our Data Center is located in Bologna, Italy and belongs to the Institute of Radioastronomy, which is part of the National Institute of Astrophysics.

  17. VT Designated Village Centers Boundary

    Data.gov (United States)

    Vermont Center for Geographic Information — This community revitalization program helps maintain or evolve small to medium-sized historic centers with existing civic and commercial buildings. The designation...

  18. Center for Veterinary Medicine (CVM)

    Data.gov (United States)

    Federal Laboratory Consortium — As seen on the center's logo, the mission statement for FDA's Center for Veterinary Medicine (CVM) reads: "Protecting Human and Animal Health." To achieve this broad...

  19. Center for Prostate Disease Research

    Data.gov (United States)

    Federal Laboratory Consortium — The Center for Prostate Disease Research is the only free-standing prostate cancer research center in the U.S. This 20,000 square foot state-of-the-art basic science...

  20. Contact Center Manager Administration (CCMA)

    Data.gov (United States)

    Social Security Administration — CCMA is the server that provides a browser-based tool for contact center administrators and supervisors. It is used to manage and configure contact center resources...

  1. National Center on Family Homelessness

    Science.gov (United States)

    ... You are here Home National Center on Family Homelessness Center A staggering 2.5 million children are ... raise awareness of the current state of child homelessness in the United States, documents the number of ...

  2. Placental-Specific sFLT-1 e15a Protein Is Increased in Preeclampsia, Antagonizes Vascular Endothelial Growth Factor Signaling, and Has Antiangiogenic Activity.

    Science.gov (United States)

    Palmer, Kirsten R; Kaitu'u-Lino, Tu'uhevaha J; Hastie, Roxanne; Hannan, Natalie J; Ye, Louie; Binder, Natalie; Cannon, Ping; Tuohey, Laura; Johns, Terrance G; Shub, Alexis; Tong, Stephen

    2015-12-01

    In preeclampsia, the antiangiogenic factor soluble fms-like tyrosine kinase-1 (sFLT-1) is released from placenta into the maternal circulation, causing endothelial dysfunction and organ injury. A recently described splice variant, sFLT-1 e15a, is primate specific and the most abundant placentally derived sFLT-1. Therefore, it may be the major sFLT-1 isoform contributing to the pathophysiology of preeclampsia. sFLT-1 e15a protein remains poorly characterized: its bioactivity has not been comprehensively examined, and serum levels in normal and preeclamptic pregnancy have not been reported. We generated and validated an sFLT-1 e15a-specific ELISA to further characterize serum levels during pregnancy, and in the presence of preeclampsia. Furthermore, we performed assays to examine the bioactivity and antiangiogenic properties of sFLT-1 e15a protein. sFLT-1 e15a was expressed in the syncytiotrophoblast, and serum levels rose across pregnancy. Strikingly, serum levels were increased 10-fold in preterm preeclampsia compared with normotensive controls. We confirmed sFLT-1 e15a is bioactive and is able to inhibit vascular endothelial growth factor signaling of vascular endothelial growth factor receptor 2 and block downstream Akt phosphorylation. Furthermore, sFLT-1 e15a has antiangiogenic properties. sFLT-1 e15a decreased endothelial cell migration, invasion, and inhibited endothelial cell tube formation. Administering sFLT-1 e15a blocked vascular endothelial growth factor induced sprouts from mouse aortic rings ex vivo. We have demonstrated that sFLT-1 e15a is increased in preeclampsia, antagonizes vascular endothelial growth factor signaling, and has antiangiogenic activity. Future development of diagnostics and therapeutics for preeclampsia should consider targeting placentally derived sFLT-1 e15a.

  3. Palmitate activates autophagy in INS-1E β-cells and in isolated rat and human pancreatic islets.

    Directory of Open Access Journals (Sweden)

    Luisa Martino

    Full Text Available We have investigated the in vitro effects of increased levels of glucose and free fatty acids on autophagy activation in pancreatic beta cells. INS-1E cells and isolated rat and human pancreatic islets were incubated for various times (from 2 to 24 h at different concentrations of glucose and/or palmitic acid. Then, cell survival was evaluated and autophagy activation was explored by using various biochemical and morphological techniques. In INS-1E cells as well as in rat and human islets, 0.5 and 1.0 mM palmitate markedly increased autophagic vacuole formation, whereas high glucose was ineffective alone and caused little additional change when combined with palmitate. Furthermore, LC3-II immunofluorescence co-localized with that of cathepsin D, a lysosomal marker, showing that the autophagic flux was not hampered in PA-treated cells. These effects were maintained up to 18-24 h incubation and were associated with a significant decline of cell survival correlated with both palmitate concentration and incubation time. Ultrastructural analysis showed that autophagy activation, as evidenced by the occurrence of many autophagic vacuoles in the cytoplasm of beta cells, was associated with a diffuse and remarkable swelling of the endoplasmic reticulum. Our results indicate that among the metabolic alterations typically associated with type 2 diabetes, high free fatty acids levels could play a role in the activation of autophagy in beta cells, through a mechanism that might involve the induction of endoplasmic reticulum stress.

  4. Influence of the neutron star 1E 161348-5055 in RCW 103 on the surrounding medium

    CERN Document Server

    Reynoso, E M; Johnston, S; Goss, W M; Dubner, G M; Giacani, E B

    2003-01-01

    We have carried out a study of the neutral hydrogen in the direction of the X-ray source 1E 161348-5055, a compact central object (CCO) located in the interior of the supernova remnant (SNR) RCW 103. The HI 21 cm line observations were carried out using the Australia Telescope Compact Array, complemented with single dish data from the Parkes radio telescope to recover information at all spatial scales. We derive a distance to RCW 103 of 3.3 kpc, in agreement with previous distance measurements. We have also detected a small hole in the HI emission which is positionally and kinematically coincident with the location of the CCO which confirms the association between the SNR and the CCO. This is the third case of a depression in HI emission seemingly associated with CCOs in SNRs. The characteristic parameters of the holes such as their size, eccentricity and evacuated mass are similar in all three cases. We estimate the absorbing HI column density towards 1E 161348-5055 to be ~6 x 10^{21} cm^{-2}, a value compat...

  5. Long-Term X-ray Monitoring of 1E 1740.7-2942 and GRS 1758-258

    CERN Document Server

    Main, D S; Heindl, W A; Swank, J H; Leventhal, M; Mirabel, I F; Rodríguez, L F

    1999-01-01

    We report on long-term observations of the Galactic-bulge black hole candidates 1E 1740.7-2942 and GRS 1758-258 with the Rossi X-Ray Timing Explorer. 1E 1740.7-2942 has been observed 77 times and GRS 1758-258 has been observed 82 times over the past 1000 days. The flux of each object has varied by no more than a factor of 2.5 during this period, and the indices of the energy spectra have varied by no more than 0.4. The power spectra are similar to other black-hole candidates: flat-topped noise, breaking to a power law. Each object has exhibited a brightening that lasted for several months, and we have a found a time lag between the photon power-law index and the count rate. In both sources, the spectrum is softest during the decline from the brightening. This behavior can be understood in the context of thin-disk and advection-dominated accretion flows coexisting over a wide range of radii, with the implication that both sources have low-mass companions and accrete via Roche-lobe overflow.

  6. The Infrared Absorption Band and Vibronic Structure of the Nitrogen-Vacancy Center in Diamond

    CERN Document Server

    Kehayias, P; English, D; Fischer, R; Jarmola, A; Jensen, K; Leefer, N; Hemmer, P; Manson, N B; Budker, D

    2013-01-01

    The negatively charged nitrogen-vacancy (NV$^-$) color center in diamond has generated much interest for use in quantum technology. Despite the progress made in developing their applications, several questions about the basic properties of NV$^-$ centers remain unresolved. In particular, knowledge of the phonon modes of the $^1A_1$ electronic state is key for understanding the optical pumping process. Using pump-probe spectroscopy, we measured the phonon sideband of the ${^1}E\\rightarrow{^1}A_1$ electronic transition in the NV$^-$ center. From this we calculated the ${^1}E\\rightarrow{^1}A_1$ one-phonon absorption spectrum and found it to differ from that of the ${^3}E\\rightarrow{^3}A_2$ transition.

  7. On chains of centered valuations

    Directory of Open Access Journals (Sweden)

    Rachid Chibloun

    2003-01-01

    Full Text Available We study chains of centered valuations of a domain A and chains of centered valuations of A [X1,…,Xn] corresponding to valuations of A. Finally, we make some applications to chains of valuations centered on the same ideal of A [X1,…,Xn] and extending the same valuation of A.

  8. CURRICULUM GUIDE, CHILD CARE CENTERS.

    Science.gov (United States)

    California State Dept. of Education, Sacramento.

    CALIFORNIA CHILD CARE CENTERS WERE ESTABLISHED IN 1943 TO SUPPLY SERVICES TO CHILDREN OF WORKING MOTHERS. THE CHILD CARE PROGRAM PROVIDES, WITHIN NURSERY AND SCHOOLAGE CENTERS, CARE AND EDUCATIONAL SUPERVISION FOR PRESCHOOL AND ELEMENTARY SCHOOL AGE CHILDREN. THE PHILOSOPHY OF THE CHILD CENTER PROGRAM IS BASED UPON THE BELIEF THAT EACH CHILD…

  9. COMPUTATIONAL SCIENCE CENTER

    Energy Technology Data Exchange (ETDEWEB)

    DAVENPORT, J.

    2006-11-01

    Computational Science is an integral component of Brookhaven's multi science mission, and is a reflection of the increased role of computation across all of science. Brookhaven currently has major efforts in data storage and analysis for the Relativistic Heavy Ion Collider (RHIC) and the ATLAS detector at CERN, and in quantum chromodynamics. The Laboratory is host for the QCDOC machines (quantum chromodynamics on a chip), 10 teraflop/s computers which boast 12,288 processors each. There are two here, one for the Riken/BNL Research Center and the other supported by DOE for the US Lattice Gauge Community and other scientific users. A 100 teraflop/s supercomputer will be installed at Brookhaven in the coming year, managed jointly by Brookhaven and Stony Brook, and funded by a grant from New York State. This machine will be used for computational science across Brookhaven's entire research program, and also by researchers at Stony Brook and across New York State. With Stony Brook, Brookhaven has formed the New York Center for Computational Science (NYCCS) as a focal point for interdisciplinary computational science, which is closely linked to Brookhaven's Computational Science Center (CSC). The CSC has established a strong program in computational science, with an emphasis on nanoscale electronic structure and molecular dynamics, accelerator design, computational fluid dynamics, medical imaging, parallel computing and numerical algorithms. We have been an active participant in DOES SciDAC program (Scientific Discovery through Advanced Computing). We are also planning a major expansion in computational biology in keeping with Laboratory initiatives. Additional laboratory initiatives with a dependence on a high level of computation include the development of hydrodynamics models for the interpretation of RHIC data, computational models for the atmospheric transport of aerosols, and models for combustion and for energy utilization. The CSC was formed to

  10. The Rice Dynamin-Related Protein OsDRP1E Negatively Regulates Programmed Cell Death by Controlling the Release of Cytochrome c from Mitochondria

    Science.gov (United States)

    Zhou, Xueping

    2017-01-01

    Programmed cell death (PCD) mediated by mitochondrial processes has emerged as an important mechanism for plant development and responses to abiotic and biotic stresses. However, the role of translocation of cytochrome c from the mitochondria to the cytosol during PCD remains unclear. Here, we demonstrate that the rice dynamin-related protein 1E (OsDRP1E) negatively regulates PCD by controlling mitochondrial structure and cytochrome c release. We used a map-based cloning strategy to isolate OsDRP1E from the lesion mimic mutant dj-lm and confirmed that the E409V mutation in OsDRP1E causes spontaneous cell death in rice. Pathogen inoculation showed that dj-lm significantly enhances resistance to fungal and bacterial pathogens. Functional analysis of the E409V mutation showed that the mutant protein impairs OsDRP1E self-association and formation of a higher-order complex; this in turn reduces the GTPase activity of OsDRP1E. Furthermore, confocal microscopy showed that the E409V mutation impairs localization of OsDRP1E to the mitochondria. The E409V mutation significantly affects the morphogenesis of cristae in mitochondria and causes the abnormal release of cytochrome c from mitochondria into cytoplasm. Taken together, our results demonstrate that the mitochondria-localized protein OsDRP1E functions as a negative regulator of cytochrome c release and PCD in plants. PMID:28081268

  11. Citizen centered design

    Directory of Open Access Journals (Sweden)

    Ingrid Mulder

    2015-11-01

    Full Text Available Today architecture has to design for rapidly changing futures, in a citizen-centered way. That is, architecture needs to embrace meaningful design. Societal challenges ask for a new paradigm in city-making, which combines top-down public management with bottom-up social innovation to reach meaningful design. The biggest challenge is indeed to embrace a new collaborative attitude, a participatory approach, and to have the proper infrastructure that supports this social fabric. Participatory design and transition management are future-oriented, address people and institutions. Only through understanding people in context and the corresponding dynamics, one is able to design for liveable and sustainable urban environments, embracing the human scale.

  12. Mi Pueblo Food Center

    Directory of Open Access Journals (Sweden)

    Alexis A. Babb

    2016-04-01

    Full Text Available This case describes a current growth opportunity for Mi Pueblo Food Center, a Hispanic grocery chain with locations throughout the Bay Area, California. The CEO of Mi Pueblo is contemplating opening a new store location in East Palo Alto, CA, which has been without a local, full-service grocery store for over 20 years. Case objectives are for students to develop an understanding of how the grocery industry operates, the risks and opportunities associated with opening a new grocery store location, and the impact on social, environmental, and economic sustainability. The SWOT (Strengths, Weaknesses, Opportunities, Threats framework is used to analyze whether or not it is feasible for Mi Pueblo to open a new location in East Palo Alto. This case may be used with students in graduate and advanced undergraduate courses.

  13. Supernova Science Center

    Energy Technology Data Exchange (ETDEWEB)

    S. E. Woosley

    2008-05-05

    The Supernova Science Center (SNSC) was founded in 2001 to carry out theoretical and computational research leading to a better understanding of supernovae and related transients. The SNSC, a four-institutional collaboration, included scientists from LANL, LLNL, the University of Arizona (UA), and the University of California at Santa Cruz (UCSC). Intitially, the SNSC was funded for three years of operation, but in 2004 an opportunity was provided to submit a renewal proposal for two years. That proposal was funded and subsequently, at UCSC, a one year no-cost extension was granted. The total operational time of the SNSC was thus July 15, 2001 - July 15, 2007. This document summarizes the research and findings of the SNSC and provides a cummulative publication list.

  14. Industrial Assessment Center Program

    Energy Technology Data Exchange (ETDEWEB)

    Dr. Dereje Agonafer

    2007-11-30

    The work described in this report was performed under the direction of the Industrial Assessment Center (IAC) at University of Texas at Arlington. The IAC at The University of Texas at Arlington is managed by Rutgers University under agreement with the United States Department of Energy Office of Industrial Technology, which financially supports the program. The objective of the IAC is to identify, evaluate, and recommend, through analysis of an industrial plant’s operations, opportunities to conserve energy and prevent pollution, thereby reducing the associated costs. IAC team members visit and survey the plant. Based upon observations made in the plant, preventive/corrective actions are recommended. At all times we try to offer specific and quantitative recommendations of cost savings, energy conservation, and pollution prevention to the plants we serve.

  15. Concurrent engineering research center

    Science.gov (United States)

    Callahan, John R.

    1995-01-01

    The projects undertaken by The Concurrent Engineering Research Center (CERC) at West Virginia University are reported and summarized. CERC's participation in the Department of Defense's Defense Advanced Research Project relating to technology needed to improve the product development process is described, particularly in the area of advanced weapon systems. The efforts committed to improving collaboration among the diverse and distributed health care providers are reported, along with the research activities for NASA in Independent Software Verification and Validation. CERC also takes part in the electronic respirator certification initiated by The National Institute for Occupational Safety and Health, as well as in the efforts to find a solution to the problem of producing environment-friendly end-products for product developers worldwide. The 3M Fiber Metal Matrix Composite Model Factory Program is discussed. CERC technologies, facilities,and personnel-related issues are described, along with its library and technical services and recent publications.

  16. The Center is Everywhere

    CERN Document Server

    Weinberg, David H

    2012-01-01

    "The Center is Everywhere" is a sculpture by Josiah McElheny, currently (through October 14, 2012) on exhibit at the Institute of Contemporary Art, Boston. The sculpture is based on data from the Sloan Digital Sky Survey (SDSS), using hundreds of glass crystals and lamps suspended from brass rods to represent the three-dimensional structure mapped by the SDSS through one of its 2000+ spectroscopic plugplates. This article describes the scientific ideas behind this sculpture, emphasizing the principle of the statistical homogeneity of cosmic structure in the presence of local complexity. The title of the sculpture is inspired by the work of the French revolutionary Louis Auguste Blanqui, whose 1872 book "Eternity Through The Stars: An Astronomical Hypothesis" was the first to raise the spectre of the infinite replicas expected in an infinite, statistically homogeneous universe. Puzzles of infinities, probabilities, and replicas continue to haunt modern fiction and contemporary discussions of inflationary cosmo...

  17. Regional Warning Center Sweden

    Science.gov (United States)

    Lundstedt, Henrik

    RWC-Sweden is operated by the Lund division of the Swedish Institute of Space Physics located at IDEON, a Science Research Technology Park. The Institute of Technology of Lund and Lund University are just adjacent to IDEON. This creates a lot of synergy effects. Copenhagen, with the Danish National Space Center DNSC), and Atmosphere Space Research Division of Danish Meteorological Institute (DMI), is 45 min away via the bridge. The new LOIS Space Centre is located two hours away by car, north of Lund and just outside V¨xj¨. The IRF Lund a o division is aiming at becoming a "Solar and Space Weather Center". We focus on solar magnetic activity, its influence on climate and on space weather effects such the effect of geomagnetically induced currents (GIC). Basic research: A PostDoc position on "Solar Magnetic Activity: Topology and Predictions has recently been created. Research is carried on to improve predictions of solar magnetic activity. Preparations for using upcoming SDO vector magnetic fields are ongoing. Predictions: RWC-Sweden offers real-time forecasts of space weather and space weather effects based on neural networks. We participated in the NASA/NOAA Cycle 24 Prediction Panel. We have also participated in several ESA/EU solar-climate projects New observation facilities: Distributed, wide-area radio facility (LOIS) for solar (and other space physics) observations and a guest prof: Radio facility about 200 km distant, outside V¨xj¨ (Sm˚ a o aland), in Ronneby (Blekinge) and Lund (Sk˚ ane) is planned to be used for tracking of CMEs and basic solar physics studies of the corona. The LOIS station outside V¨xj¨ has a o been up and running for the past three years. Bo Thidé has joined the Lund division e as a guest prof. A new magnetometer at Risinge LOIS station has been installed an calibrated and expected to be operational in March, 2008.

  18. Optical results of the black hole microquasar SS 433

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    We present optical spectroscopic observations of SS 433 during different precessional and orbital phases.Our 2004,2007 and 2008 data provide us a good chance to study the variability of the Hα line at different orbital phases for nearly the same disk inclination.The data show that the Hα of SS 433 usually had a symmetric profile between orbital phases 0.25-0.75,while an asymmetric structure with a strong red peak was observed for other orbital phases.We suggest that the orbital variability of Hα emission is connected with accretion flow from the donor star to the accretion disk.In addition,we attribute the dramatic increase of Hα emission during our 2007 observational run,which had a time scale of one day,to the emergence of strong jets.

  19. Simultaneous multi-wavelength observations of Microquasars (the mine collaboration

    Directory of Open Access Journals (Sweden)

    Y. Fuchs

    2004-01-01

    Full Text Available Presentamos la colaboraci on internacional MINE (Multi- INTEGRAL NEtwork cuya meta es llevar a cabo observaciones en m ultiples longitudes de onda de microcuasares de forma simult anea al sat elite INTEGRAL. Los primeros resultados con GRS 1915+105 son muy esperanzadores y junto con los que se obtendr an en el futuro nos ayudar an a comprender la f sica de los fen omenos de acreci on y eyecci on relacionados con los sistemas binarios compactos.

  20. Relativistic Jets in Active Galactic Nuclei und Microquasars

    CERN Document Server

    Romero, Gustavo; Markoff, Sera; Tavecchio, Fabrizio

    2016-01-01

    Collimated outflows (jets) appear to be a ubiquitous phenomenon associated with the accretion of material onto a compact object. Despite this ubiquity, many fundamental physics aspects of jets are still poorly understood and constrained. These include the mechanism of launching and accelerating jets, the connection between these processes and the nature of the accretion flow, and the role of magnetic fields; the physics responsible for the collimation of jets over tens of thousands to even millions of gravitational radii of the central accreting object; the matter content of jets; the location of the region(s) accelerating particles to TeV (possibly even PeV and EeV) energies (as evidenced by gamma-ray emission observed from many jet sources) and the physical processes responsible for this particle acceleration; the radiative processes giving rise to the observed multi-wavelength emission; and the topology of magnetic fields and their role in the jet collimation and particle acceleration processes. This chapt...

  1. Hadronic gamma-ray production in microquasars with equatorial winds

    Directory of Open Access Journals (Sweden)

    Mariana Orellana

    2006-01-01

    Full Text Available Los microcuas ares son sistemas binarios con emisi on en rayos X vinculada a acreci on, en los cuales se han detectado chorros de part culas relativistas (jets a trav es de su emisi on en bandas de radio. La transferencia de masa al objeto compacto puede darse a trav es del viento ecuatorial de la primaria, cuando esta es de tipo espectral temprano, como es el caso del microcu asar LSI +61 303. En estos casos se dar a inevitablemente una interacci on entre el viento estelar y los jets, que puede resultar en la emisi on de fotones con muy alta energ a. El inter es por este escenario resurge a partir de la con rmaci on de los microcu asares como fuentes detectadas a energ as en el rango TeV. Presentamos un modelo para la emisi on de rayos gamma que se origina en la interacci on de protones relativistas del jet, con los protones fr os de un viento con nado en un disco circunestelar. Se calcul o tambi en, en forma simpli cada, la emisi on de los leptones secundarios. Teniendo en cuenta efectos de opacidad en la fost osfera, hemos podido estimar una curva de luz y un espectro que pueden ser contrastados con las mediciones de observatorios en altas energ as como MAGIC o HESS.

  2. Thermal balance of the jet in the microquasar SS433

    CERN Document Server

    Bisnovatyi-Kogan, Gennady S

    2012-01-01

    Thermal balance of the jet in the source SS433 is considered with account of radiative and adiabatic cooling, and different heating mechanisms. We consider jet heating by the inverse Compton effect of coronal hard X-ray quanta on jet electrons, the influence of shock wave propagation along the jet, and jet kinetic energy transformation into heat via Coulomb collisions of jet and corona protons. The most important heating mechanism for the source SS433 turns out to be Coulomb collisions of jet particles with the surrounding medium.

  3. Results of a search for new microquasars in the galaxy

    Directory of Open Access Journals (Sweden)

    M. Ribó

    2004-01-01

    Full Text Available Presentamos los resultados de una b usqueda de nuevos microcuasares en bajas latitudes gal acticas con base en una identi caci on cruzada entre el ROSAT Bright Source Catalogue (RBSC de todo el cielo y NRAO VLA Sky Survey (NVSS y las observaciones de seguimiento. Los resultados obtenidos hasta ahora sugieren que los microcuasares persistentes/silenciosos tales como LS-5039 son objetos raros en nuestra Galaxia e indican que exploraciones futuras a mayores profundidades y en rayos X m as duros que los del RBSC jugar an un papel fundamental en su descubrimiento.

  4. CDH1/E-cadherin and solid tumors. An updated gene-disease association analysis using bioinformatics tools.

    Science.gov (United States)

    Abascal, María Florencia; Besso, María José; Rosso, Marina; Mencucci, María Victoria; Aparicio, Evangelina; Szapiro, Gala; Furlong, Laura Inés; Vazquez-Levin, Mónica Hebe

    2016-02-01

    Cancer is a group of diseases that causes millions of deaths worldwide. Among cancers, Solid Tumors (ST) stand-out due to their high incidence and mortality rates. Disruption of cell-cell adhesion is highly relevant during tumor progression. Epithelial-cadherin (protein: E-cadherin, gene: CDH1) is a key molecule in cell-cell adhesion and an abnormal expression or/and function(s) contributes to tumor progression and is altered in ST. A systematic study was carried out to gather and summarize current knowledge on CDH1/E-cadherin and ST using bioinformatics resources. The DisGeNET database was exploited to survey CDH1-associated diseases. Reported mutations in specific ST were obtained by interrogating COSMIC and IntOGen tools. CDH1 Single Nucleotide Polymorphisms (SNP) were retrieved from the dbSNP database. DisGeNET analysis identified 609 genes annotated to ST, among which CDH1 was listed. Using CDH1 as query term, 26 disease concepts were found, 21 of which were neoplasms-related terms. Using DisGeNET ALL Databases, 172 disease concepts were identified. Of those, 80 ST disease-related terms were subjected to manual curation and 75/80 (93.75%) associations were validated. On selected ST, 489 CDH1 somatic mutations were listed in COSMIC and IntOGen databases. Breast neoplasms had the highest CDH1-mutation rate. CDH1 was positioned among the 20 genes with highest mutation frequency and was confirmed as driver gene in breast cancer. Over 14,000 SNP for CDH1 were found in the dbSNP database. This report used DisGeNET to gather/compile current knowledge on gene-disease association for CDH1/E-cadherin and ST; data curation expanded the number of terms that relate them. An updated list of CDH1 somatic mutations was obtained with COSMIC and IntOGen databases and of SNP from dbSNP. This information can be used to further understand the role of CDH1/E-cadherin in health and disease.

  5. Thermal, Electrical, and Optical Properties of Synthesized (1E, 2E-(4-bromophenyl(hydroxyiminoacetaldehyde Oxime Complexes

    Directory of Open Access Journals (Sweden)

    Emin Karapinar

    2013-01-01

    Full Text Available The (1E, 2E-(4-bromophenyl(hydroxyiminoacetaldehyde oxime complexes, [ML2], M = Co(II, Cu(II, and Ni(II, were synthesized and characterized by elemental analysis, magnetic susceptibility, FT-IR spectra, and thermal analysis techniques. The optical band gap of this ligand and its complexes were determined by UV-vis spectrophotometer in the wavelength range 300–800 nm. A decrease in the energy band gap of the [CoL2], [NiL2], and [CuL2] complexes has been observed compared with LH ligand. Temperature-dependent conductivity measurements showed that all samples behave like semiconductor. Activation energies calculated from Arrhenius plots showed that the conduction occurs via both intramolecular and the intermolecular processes.

  6. Improved energy of the 21.5 keV M1 + E2 nuclear transition in {sup 151}Eu

    Energy Technology Data Exchange (ETDEWEB)

    Inoyatov, A.Kh. [JINR, Laboratory of Nuclear Problems, Dubna, Moscow Region (Russian Federation); National University, Institute of Applied Physics, Tashkent (Uzbekistan); Kovalik, A. [JINR, Laboratory of Nuclear Problems, Dubna, Moscow Region (Russian Federation); Nuclear Physics Institute of the ASCR, Rez near Prague (Czech Republic); Filosofov, D.V.; Perevoshchikov, L.L. [JINR, Laboratory of Nuclear Problems, Dubna, Moscow Region (Russian Federation); Rysavy, M. [Nuclear Physics Institute of the ASCR, Rez near Prague (Czech Republic); Baimukhanova, A. [JINR, Laboratory of Nuclear Problems, Dubna, Moscow Region (Russian Federation); Institute of Nuclear Physics, Almaty (Kazakhstan)

    2016-05-15

    Using internal conversion electron spectroscopy, improved energy 21 541.5±0.5 eV was determined for the 21.5 keV M1+E2 nuclear transition in {sup 151}Eu populated in the electron capture decay of {sup 151}Gd. This value was found to agree well with the present adopted value but is much more accurate. A value of 0.0305±0.0011 derived for the E2 admixture parameter vertical stroke δ(E2/M1) vertical stroke from the measured conversion electron line intensities corresponds to the present adopted value. A possible effect of nuclear structure on the multipolarity of the 21.5 keV transition was also investigated. (orig.)

  7. Total neutron cross-sections of /sup 151/Eu, /sup 153/Eu and Eu below 1 eV

    Energy Technology Data Exchange (ETDEWEB)

    Adib, M.; Maayouf, R.M.A.; Abdel-Kawy, A.; Ashry, A.; Hamouda, I.

    1981-01-01

    Total neutron cross-section measurements have been carried out for natural Eu and its stable isotopes in the energy range from 3 meV to 1 eV. The measurements were performed using two time-of-flight spectrometers installed in front of two of the horizontal channels of the ET-RR-1 reactor. The following results have been obtained: sigmasub(a) (/sup 151/Eu) = (9180 +- 150) b at 0.0253 eV, sigmasub(s) (/sup 153/Eu) = (375 +- 20) b at 0.0253 eV, sigmasub(d) (Eu) = (4600 +- 120) b at 0.0253 eV. The contribution of the resonance to the total neutron cross-sections, in the thermal region, was calculated using the single-level Breit-Wigner formula.

  8. Optical Fiber Link with 1E-19 frequency stability using a Planar-Waveguide External Cavity Laser Diode

    CERN Document Server

    Clivati, Cecilia; Calonico, Davide; Levi, Filippo; Costanzo, Giovanni A; Calosso, Claudio E; Godone, Aldo

    2011-01-01

    We compare the performances of a compact planar-waveguide external cavity laser (ECL) and a traditional fiber laser (FL) frequency locked to a Fabry-P\\'erot cavity and demonstrate the possibility to use such ECL in an optical link for ultra stable frequency dissemination. A relative stability of the ECL of 1E-14 is obtained and an optical link of 100 km based on fiber spools has been realized, that reaches 2E-19 relative stability, limited by the system noise floor. The performances of ECL and FL are shown to be comparable. Thus, ECLs could be a better choice than FLs in longer optical links with amplification and regenerating stations, thanks to their cost-effectiveness, robustness and small size.

  9. Verification of Safety Margins of Battery Banks Capacity of Class 1E DC System in a Nuclear Power Plant

    Energy Technology Data Exchange (ETDEWEB)

    Lukman, Abdulrauf [Korea Advanced Institute of Science and Technology, Daejeon (Korea, Republic of); Zhu, Oon-Pyo [Korea Institute of Nuclear Safety, Daejeon (Korea, Republic of)

    2015-10-15

    According to Ref 'Station blackout (SBO) is generally a plant condition with complete loss of all alternating current (AC) power from off-site sources, from the main generator and from standby AC power sources important to safety to the essential and nonessential switchgear buses. Direct current (DC) power supplies and uninterruptible AC power supplies may be available as long as batteries can supply the loads, alternate AC power supplies are available'. The above IAEA document indicated the importance of batteries during SBO. Prior to the Fukushima accident, most batteries might be designed with coping capability of four hours. However, the accident showed the need for the coping capability to be increased to at least eight hours. The purpose of this research is to verify the safety capacity margin of the nuclear qualified battery banks of class 1E DC system and test the response to SBO using the load profile of a Korean design nuclear power plant (NPP). The capacity margins of class 1E batteries of DC power system batteries in a nuclear power plant were determined using the load profile of the plant. It was observed that if appropriate manufacturer Kt data are not available, the accuracy of the battery capacity might not be accurately calculated. The result obtained shows that the batteries have the coping capability of two hours for channel A and B, and eight hours for channel C and D. Also capacity margin as show in figure show a reasonable margin for each batteries of the DC system.

  10. Metaloproteinases 1 e 7 e câncer colorretal Metalloproteinases 1 and 7 and colorectal cancer

    Directory of Open Access Journals (Sweden)

    Mário Jucá

    2008-09-01

    Full Text Available A metaloproteinase-1 (MMP-1 e a metaloproteinase-7 (MMP-7 são proteinases da matriz extracelular (MEC, zinco-dependentes, envolvidas no processo inicial da carcinogênese por permitirem a invasão tumoral na célula e promover o processo de metastatização. O polimorfismo dessas proteinases tem sido estudado recentemente com o objetivo de validar susa expressão e/ou atividade como marcador prognóstico. Evidências cumulativas revelam importante papel das MMP's 1 e 7 em diferentes fases da carcinogênese. A MMP-1 tem ação direta sobre a principal proteína da MEC, que é o colágeno do tecido intersticial conectivo. Sua expressão aumentada neste tecido pode indicar alto potencial de disseminação tumoral em diferentes tipos de câncer, incluindo o colorretal. A associação deste aumento da expressão também parece ser verdadeira para a MMP-7.The metalloproteinase-1 (MMP-1 and metalloproteinase-7 (MMP-7 are proteinases of the extracellular matrix (MEC, zinc-dependent, involved in the initial process of carcinogenesis, allowing the invasion by the tumor cell and promoting the process of metastasis. The polymorphism of these proteinases has been studied recently in order to validate its expression and / or activity as a marker prognosis. Evidence shows cumulative important role of MMPs 1 and 7 in different stages of carcinogenesis. The MMP-1 is direct action on the main protein of the MEC, which is the collagen of interstitial connective tissue. Its increased expression in this tissue may indicate high potential for spread in different tumor types of cancer, including colorectal. The association of this increase of expression also appears to be true for MMP-7.

  11. [6]-Shogaol Induces Ca2+ Signals by Activating the TRPV1 Channels in the Rat Insulinoma INS-1E Cells

    Directory of Open Access Journals (Sweden)

    Paola Rebellato

    2014-01-01

    Full Text Available Context [6]-shogaol is a vanilloid compound present in steamed ginger (Zingiber officinale, a commonly used spice. Pancreatic beta-cells respond to nutrients like glucose, amino acids and fatty acids, by an increase in the cytoplasmic free Ca2+ concentration ([Ca2+]i, which mediates diverse cellular processes in these cells. Some vanilloid compounds activate the transient receptor potential vanilloid receptor type 1 (TRPV1 channel. Objective We investigated whether [6]-shogaol could trigger Ca2+ signals in the beta-cell. Methods [Ca2+]i was measured from single INS-1E cells by microscope-based fluorometry using fura-2 as the Ca2+ indicator. Results In fura-2 loaded single rat insulinoma INS-1E cells, a widely used model of beta-cell, [6]-shogaol increased [Ca2+]i in a concentration-dependent manner. [Ca2+]i increase by [6]-shogaol was completely blocked when Ca2+ was omitted from the extracellular medium. Capsazepine, an inhibitor of the TRPV1 ion channel completely inhibited the [6]-shogaol-induced [Ca2+]i increase. [Ca2+]i increase obtained by 1 μM [6]-shogaol was greater than that obtained by 10 mM glucose. Moreover, a sub-stimulatory concentration of [6]-shogaol (300 nM, significantly enhanced the glucose-induced [Ca2+]i increase in these cells. Conclusion We conclude that [6]-shogaol induces Ca2+ signals in the beta-cell by activating the TRPV1 channels, and it sensitizes the beta-cells to stimulation by glucose.

  12. The Heterodimeric TWIST1-E12 Complex Drives the Oncogenic Potential of TWIST1 in Human Mammary Epithelial Cells

    Directory of Open Access Journals (Sweden)

    Laurent Jacqueroud

    2016-05-01

    Full Text Available The TWIST1 embryonic transcription factor displays biphasic functions during the course of carcinogenesis. It facilitates the escape of cells from oncogene-induced fail-safe programs (senescence, apoptosis and their consequent neoplastic transformation. Additionally, it promotes the epithelial-to-mesenchymal transition and the initiation of the metastatic spread of cancer cells. Interestingly, cancer cells recurrently remain dependent on TWIST1 for their survival and/or proliferation, making TWIST1 their Achilles’ heel. TWIST1 has been reported to form either homodimeric or heterodimeric complexes mainly in association with the E bHLH class I proteins. These complexes display distinct, sometimes even antagonistic, functions during development and unequal prometastatic functions in prostate cancer cells. Using a tethered dimer strategy, we successively assessed the ability of TWIST1 dimers to cooperate with an activated version of RAS in human mammary epithelial cell transformation, to provide mice with the ability to spontaneously develop breast tumors, and lastly to maintain a senescence program at a latent state in several breast cancer cell lines. We demonstrate that the TWIST1-E12 complex, unlike the homodimer, is an oncogenic form of TWIST1 in mammary epithelial cells and that efficient binding of both partners is a prerequisite for its activity. The detection of the heterodimer in human premalignant lesions by a proximity ligation assay, at a stage preceding the initiation of the metastatic cascade, is coherent with such an oncogenic function. TWIST1-E protein heterodimeric complexes may thus constitute the main active forms of TWIST1 with regard to senescence inhibition over the time course of breast tumorigenesis.

  13. Study of thermal behavior of the adobe with the simulator DOE 2.1E; Estudio de comportamiento termico del adobe con el simulador DOE 2.1E

    Energy Technology Data Exchange (ETDEWEB)

    Luna, Anibal; Gallegos, Ricardo; Bojorquez, Gonzalo [Universidad Autonoma de Baja California, Mexicali, Baja California (Mexico)

    2000-07-01

    A thermal analysis of the envelope of one of the most used housing models for low income groups, as those offered by the Mexican Government is presented in this report. The building's thermal gain in walls was determined, using: concrete block, brick and adobe; and considering concrete of roofing, concrete floors, windows and doors equal in all the cases. The objective of this study is to know the contribution to the building's thermal load of each one of the materials applied. The calculation was conducted using the Doe 2.1E thermal simulator software, using meteorological data for the city of El Centro, California, USA. This was so, because there is no reliable weather data for the city of Mexicali, B.C., where the housing units are. Because of geographical proximity between of these cities the same data was used. The properties for each one of the three building materials were taken from specialized bibliography. It was determined that the housing built with adobe walls has thermal advantages over the units built with concrete block and brick. The adobe unit has a lower thermal load of 13% over the concrete block, and of 3.44% over the clay brick unit. [Spanish] Se presenta el analisis termico de la envolvente de uno de los modelos de casas mas utilizados en la construccion de viviendas de interes social en Mexico. Se determino la ganancia, termica del edificio por muros, aplicando: bloque de concreto, ladrillo de barro y adobe. Se considero techo, piso, ventanas y puertas iguales en todos los casos. El objetivo del estudio es conocer la distribucion de la carga termica segun los materiales aplicados. El calculo se realizo con el simulador termico DOE 2.1E con datos meteorologicos de la ciudad de El Centro, California, E. U., por no contar con datos de Mexicali, B. C.: debido a la proximidad y similitud topografica entre ambas ciudades se uso la misma informacion. Las propiedades aplicadas para cada uno de los tres materiales fueron tomadas de

  14. Satellite medical centers project

    Science.gov (United States)

    Aggarwal, Arvind

    2002-08-01

    World class health care for common man at low affordable cost: anywhere, anytime The project envisages to set up a national network of satellite Medical centers. Each SMC would be manned by doctors, nurses and technicians, six doctors, six nurses, six technicians would be required to provide 24 hour cover, each SMC would operate 24 hours x 7 days. It would be equipped with the Digital telemedicine devices for capturing clinical patient information and investigations in the form of voice, images and data and create an audiovisual text file - a virtual Digital patient. Through the broad band connectivity the virtual patient can be sent to the central hub, manned by specialists, specialists from several specialists sitting together can view the virtual patient and provide a specialized opinion, they can see the virtual patient, see the examination on line through video conference or even PCs, talk to the patient and the doctor at the SMC and controlle capturing of information during examination and investigations of the patient at the SMC - thus creating a virtual Digital consultant at the SMC. Central hub shall be connected to the doctors and consultants in remote locations or tertiary care hospitals any where in the world, thus creating a virtual hub the hierarchical system shall provide upgradation of knowledge to thedoctors in central hub and smc and thus continued medical education and benefit the patient thru the world class treatment in the smc located at his door step. SMC shall be set up by franchisee who shall get safe business opportunity with high returns, patients shall get Low cost user friendly worldclass health care anywhere anytime, Doctors can get better meaningful selfemplyment with better earnings, flexibility of working time and place. SMC shall provide a wide variety of services from primary care to world class Global consultation for difficult patients.

  15. Center for Rehabilitation Sciences Research

    Data.gov (United States)

    Federal Laboratory Consortium — The Center for Rehabilitation Sciences Research (CRSR) was established as a research organization to promote successful return to duty and community reintegration of...

  16. Energetics Manufacturing Technology Center (EMTC)

    Data.gov (United States)

    Federal Laboratory Consortium — The Energetics Manufacturing Technology Center (EMTC), established in 1994 by the Office of Naval Research (ONR) Manufacturing Technology (ManTech) Program, is Navy...

  17. Center for Environmental Health Sciences

    Data.gov (United States)

    Federal Laboratory Consortium — The primary research objective of the Center for Environmental Health Sciences (CEHS) at the University of Montana is to advance knowledge of environmental impacts...

  18. Consolidated Copayment Processing Center (CCPC)

    Data.gov (United States)

    Department of Veterans Affairs — The Consolidated Copayment Processing Center (CCPC) database contains Veteran patient contact and billing information in order to support the printing and mailing of...

  19. Center for Neuroscience & Regenerative Medicine

    Data.gov (United States)

    Federal Laboratory Consortium — The Center for Neuroscience and Regenerative Medicine (CNRM) was established as a collaborative intramural federal program involving the U.S. Department of Defense...

  20. Interstellar HOCN in the Galactic center region

    CERN Document Server

    Bruenken, S; Martin, S; Verheyen, L; Menten, K M

    2010-01-01

    Aims. Our aim is to confirm the interstellar detection of cyanic acid, HOCN, in the Galactic center clouds. It has previously been tentatively detected only in Sgr B2(OH). Methods. We used a complete line survey of the hot cores Sgr B2(N) and (M) in the 3 mm range, complemented by additional observations carried out with the IRAM 30 m telescope at selected frequencies in the 2 mm band and towards four additional positions in the Sgr B2 cloud complex in the 2 and 3 mm bands. The spectral survey was analysed in the local thermodynamical equilibrium approximation (LTE) by modeling the emission of all identified molecules simultaneously. This allowed us to distinguish weak features of HOCN from the rich line spectrum observed in Sgr B2(N) and (M). Lines of the more stable (by 1.1 eV) isomer isocyanic acid, HNCO, in these sources, as well as those of HOCN and HNCO towards the other positions, were analysed in the LTE approximation as well. Results. Four transitions of HOCN were detected in a quiescent molecular cl...

  1. Neurovirulência e neuroinvasividade de herpesvírus bovinos tipos 1 e 5 em coelhos

    Directory of Open Access Journals (Sweden)

    Spilki Fernando R.

    2002-01-01

    Full Text Available Com o objetivo de avaliar a capacidade dos herpesvírus bovinos tipos 1 e 5 (BHV-1 e BHV-5 de invadir e replicar no sistema nervoso central (SNC (neuroinvasividade, bem como sua capacidade de induzir doença neurológica (neurovirulência, coelhos com 30 a 35 dias de idade foram inoculados com uma amostra do Herpesvírus da Encefalite Bovina (BHV-5; amostra EVI 88/95 ou com amostras de BHV-1 (Los Angeles ou Cooper, pelas vias intratecal (IT e intranasal (IN. A inoculação da amostra de BHV-5, tanto pela via IT como IN, induziu sinais clínicos neurológicos em 100% (12/12 dos coelhos inoculados. Os exames histopatológicos revelaram um quadro de meningoencefalite não-purulenta multifocal, caracterizada por gliose multifocal e infiltrados perivasculares. O vírus foi isolado de várias áreas do SNC desses animais. As amostras de BHV-1, quando inoculadas pela via IT, não foram neurovirulentas. A amostra Los Angeles de BHV-1, quando administrada pela via IN, induziu sinais respiratórios severos, além de sinais neurológicos em 57% (4/7 dos animais inoculados. Entretanto, o exame histopatológico destes quatro animais revelou vasculite e trombose no pulmão e cérebro, este último apresentando focos de necrose neuronal, porém sem lesões indicativas de encefalite. Isso sugere que os sinais neurológicos foram, provavelmente, conseqüentes a prejuízos no fluxo sangüíneo encefálico, e não a danos neuronais provocados pela inoculação desse vírus. A amostra Cooper de BHV-1, quando inoculada pela via IN, induziu apenas sinais leves de infecção respiratória. Estes resultados indicam que apenas a amostra de BHV-5 foi capaz de invadir e replicar no encéfalo dos coelhos quando inoculada tanto por via IN como IT, apresentando neuroinvasividade e neurovirulência. É possível que estas observações tenham relação com o fato de amostras de BHV-5 freqüentemente causarem encefalites, em contraposição a infecções pelo BHV-1, onde

  2. EBV-1 and HCMV in aggressive periodontitis in Brazilian patients EBV-1 e HCMV na periodontite agressiva em pacientes brasileiros

    Directory of Open Access Journals (Sweden)

    Soraia Almeida Watanabe

    2007-12-01

    Full Text Available The purpose of the present investigation was to compare the presence of Epstein-Barr virus type 1 (EBV-1 and of Human Cytomegalovirus (HCMV in crevicular fluid samples from deep and shallow periodontal pocket sites of Brazilian patients with aggressive periodontitis. A total of 30 systemically healthy patients with aggressive periodontitis participated in the study. Paper points were inserted into 2 gingivitis sites ( 5 mm in each patient. PCR assay was used to identify genomic copies of HCMV and EBV-1. Twenty-three patients (77% were positive for EBV-1, while only 2 patients (6% were positive for HCMV. The McNemar test revealed a positive association between EBV-1 and periodontal lesions (p = 0.043. Thirty-four (57% out of 60 periodontitis sites were positive for EBV-1, whereas 18 (30% gingivitis sites were positive (p = 0.01. Only two sites (6.7% were positive for HCMV. No positive association was found between HCMV and periodontitis or gingivitis (p = 0.479. The elevated occurrence of EBV-1 DNA in periodontal pockets of patients with aggressive periodontitis supports a possible periodontopathic role of this virus.O objetivo do presente estudo foi comparar a presença do vírus Epstein-Barr tipo 1 (EBV-1 e do Citomegalovírus Humano (HCMV em amostras de fluido crevicular de bolsas periodontais rasas e profundas de pacientes brasileiros com periodontite agressiva. Trinta pacientes sistemicamente saudáveis com periodontite agressiva participaram deste estudo. Cones de papel foram inseridos em 2 sítios de gengivite ( 5 mm de cada paciente. Reações de PCR foram usadas para identificar cópias de DNA genômico de HCMV e EBV-1. Em 23 pacientes (77%, os testes foram positivos para EBV-1, enquanto apenas 2 pacientes (6% foram positivos para HCMV. O teste de McNemar apontou associação positiva entre EBV-1 e lesões periodontais (p = 0,043. Trinta e quatro (57% dos 60 sítios de periodontites foram positivos para o EBV-1, enquanto 18 (30% dos s

  3. NASA New England Outreach Center

    Science.gov (United States)

    2002-01-01

    The NASA New England Outreach Center in Nashua, New Hampshire was established to serve as a catalyst for heightening regional business awareness of NASA procurement, technology and commercialization opportunities. Emphasis is placed on small business participation, with the highest priority given to small disadvantaged businesses, women-owned businesses, HUBZone businesses, service disabled veteran owned businesses, and historically black colleges and universities and minority institutions. The Center assists firms and organizations to understand NASA requirements and to develop strategies to capture NASA related procurement and technology opportunities. The establishment of the NASA Outreach Center serves to stimulate business in a historically underserved area. NASA direct business awards have traditionally been highly present in the West, Midwest, South, and Southeast areas of the United States. The Center guides and assists businesses and organizations in the northeast to target opportunities within NASA and its prime contractors and capture business and technology opportunities. The Center employs an array of technology access, one-on-one meetings, seminars, site visits, and targeted conferences to acquaint Northeast firms and organizations with representatives from NASA and its prime contractors to learn about and discuss opportunities to do business and access the inventory of NASA technology. This stimulus of interaction also provides firms and organizations the opportunity to propose the use of their developed technology and ideas for current and future requirements at NASA. The Center provides a complement to the NASA Northeast Regional Technology Transfer Center in developing prospects for commercialization of NASA technology. In addition, the Center responds to local requests for assistance and NASA material and documents, and is available to address immediate concerns and needs in assessing opportunities, timely support to interact with NASA Centers on

  4. Clean Energy Application Center

    Energy Technology Data Exchange (ETDEWEB)

    Freihaut, Jim

    2013-09-30

    The Mid Atlantic Clean Energy Application Center (MACEAC), managed by The Penn State College of Engineering, serves the six states in the Mid-Atlantic region (Pennsylvania, New Jersey, Delaware, Maryland, Virginia and West Virginia) plus the District of Columbia. The goals of the Mid-Atlantic CEAC are to promote the adoption of Combined Heat and Power (CHP), Waste Heat Recovery (WHR) and District Energy Systems (DES) in the Mid Atlantic area through education and technical support to more than 1,200 regional industry and government representatives in the region. The successful promotion of these technologies by the MACEAC was accomplished through the following efforts; (1)The MACEAC developed a series of technology transfer networks with State energy and environmental offices, Association of Energy Engineers local chapters, local community development organizations, utilities and, Penn State Department of Architectural Engineering alumni and their firms to effectively educate local practitioners about the energy utilization, environmental and economic advantages of CHP, WHR and DES; (2) Completed assessments of the regional technical and market potential for CHP, WHR and DE technologies application in the context of state specific energy prices, state energy and efficiency portfolio development. The studies were completed for Pennsylvania, New Jersey and Maryland and included a set of incentive adoption probability models used as a to guide during implementation discussions with State energy policy makers; (3) Using the technical and market assessments and adoption incentive models, the Mid Atlantic CEAC developed regional strategic action plans for the promotion of CHP Application technology for Pennsylvania, New Jersey and Maryland; (4) The CHP market assessment and incentive adoption model information was discussed, on a continuing basis, with relevant state agencies, policy makers and Public Utility Commission organizations resulting in CHP favorable incentive

  5. Stennis Visitors Center and Administrative Complex

    Science.gov (United States)

    1990-01-01

    This aerial view shows the John C. Stennis Space Center Visitors Center and main Administrative complex. The Stennis Space Center in Hancock County, Mississippi is NASA's lead center for rocket propulsion testing and for commercial remote sensing.

  6. Allegheny County Kane Regional Center Census

    Data.gov (United States)

    Allegheny County / City of Pittsburgh / Western PA Regional Data Center — Total number of residents in each Kane Regional Center facility by race and gender. The Kane Regional Centers are skilled nursing and rehabilitation centers run by...

  7. Schmidt. Sinfonie Nr. 1 E-Dur; Strauss. Vier sinfonische Zwischenspiele aus Intermezzo. Detroit Symphony Orchestra, Neeme Järvi / Helge Grünewald

    Index Scriptorium Estoniae

    Grünewald, Helge

    1996-01-01

    Uuest heliplaadist "Schmidt. Sinfonie Nr. 1 E-Dur; Strauss. Vier sinfonische Zwischenspiele aus Intermezzo. Detroit Symphony Orchestra, Neeme Järvi. Chandos/Koch CD 9357 (WD: 68'20") DDD (WD:114'36")

  8. ANTI-GLITCH INDUCED BY COLLISION OF A SOLID BODY WITH THE MAGNETAR 1E 2259+586

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Y. F.; Geng, J. J., E-mail: hyf@nju.edu.cn [Also at Key Laboratory of Modern Astronomy and Astrophysics (Nanjing University), Ministry of Education, Nanjing 210093, China. (China)

    2014-02-20

    Glitches have been frequently observed in neutron stars. Previously, these glitches have unexceptionally manifested as sudden spin-ups that can be explained as being due to impulsive transfer of angular momentum from the interior superfluid component to the outer solid crust. Alternatively, they may also be due to large-scale crust-cracking events. However, an unprecedented anti-glitch was recently reported for the magnetar 1E 2259+586, which clearly exhibited a sudden spin-down, strongly challenging previous glitch theories. Here we show that the anti-glitch can be well explained by the collision of a small solid body with the magnetar. The intruder has a mass of about 1.1 × 10{sup 21} g. Its orbital angular momentum is assumed to be antiparallel to that of the spinning magnetar, so that the sudden spin-down can be naturally accounted for. The observed hard X-ray burst and decaying softer X-ray emission associated with the anti-glitch can also be reasonably explained. Our study indicates that a completely different type of glitch due to collisions between small bodies and neutron stars should exist and may have already been observed previously. It also hints at a new way of studying capture events by neutron stars: through accurate timing observations of pulsars.

  9. Sunyaev-Zel'dovich Effect Observations of the Bullet Cluster (1E 0657-56) with APEX-SZ

    CERN Document Server

    Halverson, N W; Ade, P A R; Basu, K; Bender, A N; Benson, B A; Bertoldi, F; Cho, H -M; Chon, G; Clarke, J; Dobbs, M; Ferrusca, D; Guesten, R; Holzapfel, W L; Kovács, A; Kennedy, J; Kermish, Z; Kneissl, R; Lee, A T; Lueker, M; Mehl, J; Menten, K M; Muders, D; Nord, M; Pacaud, F; Plagge, T; Reichardt, C; Richards, P L; Schaaf, R; Schilke, P; Schuller, F; Schwan, D; Spieler, H; Tucker, C; Weiss, A; Zahn, O

    2008-01-01

    We present observations of the Sunyaev-Zel'dovich effect (SZE) in the Bullet cluster (1E 0657-56) using the APEX-SZ instrument at 150 GHz with a resolution of 1 arcmin. The main results are maps of the SZE in this massive, merging galaxy cluster. The cluster is detected with 23 sigma significance within the central 1 arcmin radius of the source position. The SZE map has a broadly similar morphology to that in existing X-ray maps of this system, and we find no evidence for significant contamination of the SZE emission by radio or IR sources. In order to make simple quantitative comparisons with cluster gas models derived from X-ray observations, we fit our data to an isothermal elliptical beta model, despite the inadequacy of such a model for this complex merging system. With an X-ray derived prior on the power-law index, beta = 1.04 +0.16/-0.10, we find a core radius r_c =144 +/- 19 arcsec, an axial ratio of 0.881 +/- 0.086, and a central temperature decrement of -880 +/- 80 micro-K_CMB, including a +/- 6% fl...

  10. Sequence-based Association Analysis Reveals an MGST1 eQTL with Pleiotropic Effects on Bovine Milk Composition

    Science.gov (United States)

    Littlejohn, Mathew D.; Tiplady, Kathryn; Fink, Tania A.; Lehnert, Klaus; Lopdell, Thomas; Johnson, Thomas; Couldrey, Christine; Keehan, Mike; Sherlock, Richard G.; Harland, Chad; Scott, Andrew; Snell, Russell G.; Davis, Stephen R.; Spelman, Richard J.

    2016-01-01

    The mammary gland is a prolific lipogenic organ, synthesising copious amounts of triglycerides for secretion into milk. The fat content of milk varies widely both between and within species, and recent independent genome-wide association studies have highlighted a milk fat percentage quantitative trait locus (QTL) of large effect on bovine chromosome 5. Although both EPS8 and MGST1 have been proposed to underlie these signals, the causative status of these genes has not been functionally confirmed. To investigate this QTL in detail, we report genome sequence-based imputation and association mapping in a population of 64,244 taurine cattle. This analysis reveals a cluster of 17 non-coding variants spanning MGST1 that are highly associated with milk fat percentage, and a range of other milk composition traits. Further, we exploit a high-depth mammary RNA sequence dataset to conduct expression QTL (eQTL) mapping in 375 lactating cows, revealing a strong MGST1 eQTL underpinning these effects. These data demonstrate the utility of DNA and RNA sequence-based association mapping, and implicate MGST1, a gene with no obvious mechanistic relationship to milk composition regulation, as causally involved in these processes. PMID:27146958

  11. Prunella vulgaris Suppresses HG-Induced Vascular Inflammation via Nrf2/HO-1/eNOS Activation

    Directory of Open Access Journals (Sweden)

    Ho Sub Lee

    2012-01-01

    Full Text Available Vascular inflammation is an important factor which can promote diabetic complications. In this study, the inhibitory effects of aqueous extract from Prunella vulgaris (APV on high glucose (HG-induced expression of cell adhesion molecules in human umbilical vein endothelial cells (HUVEC are reported. APV decreased HG-induced expression of intercellular adhesion molecule-1 (ICAM-1, vascular cell adhesion molecule-1 (VCAM-1, and E-selectin. APV also dose-dependently inhibited HG-induced adhesion of HL-60 monocytic cells. APV suppressed p65 NF-κB activation in HG-treated cells. APV significantly inhibited the formation of intracellular reactive oxygen species (ROS. HG-stimulated HUVEC secreted gelatinases, however, APV inhibited it. APV induced Akt phosphorylation as well as activation of heme oxygenase-1 (HO-1, eNOS, and nuclear factor E2-related factor 2 (Nrf2, which may protect vascular inflammation caused by HG. In conclusion, APV exerts anti-inflammatory effect via inhibition of ROS/NF-κB pathway by inducing HO-1 and eNOS expression mediated by Nrf2, thereby suggesting that Prunella vulgaris may be a possible therapeutic approach to the inhibition of diabetic vascular diseases.

  12. NuSTAR observations of X-ray bursts from the magnetar 1E 1048.1–5937

    Energy Technology Data Exchange (ETDEWEB)

    An, Hongjun; Kaspi, Victoria M.; Archibald, Robert F. [Department of Physics, McGill University, Montreal, Quebec, H3A 2T8 (Canada); Beloborodov, Andrei M.; Gotthelf, Eric V.; Hailey, Charles J.; Mori, Kaya [Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Kouveliotou, Chryssa [Space Science Office, ZP12, NASA Marshall Space Flight Center, Huntsville, AL 35812 (United States); Boggs, Steven E.; Craig, William W. [Space Sciences Laboratory, University of California, Berkeley, CA 94720 (United States); Christensen, Finn E. [DTU Space, National Space Institute, Technical University of Denmark, Elektrovej 327, DK-2800 Lyngby (Denmark); Grefenstette, Brian W.; Harrison, Fiona A.; Madsen, Kristin K. [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Stern, Daniel [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Zhang, William W. [Goddard Space Flight Center, Greenbelt, MD 20771 (United States)

    2014-07-20

    We report the detection of eight bright X-ray bursts from the 6.5 s magnetar 1E 1048.1–5937, during a 2013 July observation campaign with the Nuclear Spectroscopic Telescope Array. We study the morphological and spectral properties of these bursts and their evolution with time. The bursts resulted in count rate increases by orders of magnitude, sometimes limited by the detector dead time, and showed blackbody spectra with kT ∼ 6-8 keV in the T{sub 90} duration of 1-4 s, similar to earlier bursts detected from the source. We find that the spectra during the tail of the bursts can be modeled with an absorbed blackbody with temperature decreasing with flux. The burst flux decays followed a power law of index 0.8-0.9. In the burst tail spectra, we detect a ∼13 keV emission feature, similar to those reported in previous bursts from this source as well as from other magnetars observed with the Rossi X-ray Timing Explorer. We explore possible origins of the spectral feature such as proton cyclotron emission, which implies a magnetic field strength of B ∼ 2 × 10{sup 15} G in the emission region. However, the consistency of the energy of the feature in different objects requires further explanation.

  13. NuSTAR Observations of X-Ray Bursts from the Magnetar 1E 1048.1-5937

    Science.gov (United States)

    An, Hongjun; Kaspi, Victoria M.; Beloborodov, Andrei M.; Kouveliotou, Chryssa; Archibald, Robert T.; Boggs, Steven E.; Christensen, Finn E.; Craig, William W.; Gotthelf, Eric V.; Stern, Daniel; Zhang, William W.

    2014-01-01

    We report the detection of eight bright X-ray bursts from the 6.5 s magnetar 1E 1048.1-5937, during a 2013 July observation campaign with the Nuclear Spectroscopic Telescope Array. We study the morphological and spectral properties of these bursts and their evolution with time. The bursts resulted in count rate increases by orders of magnitude, sometimes limited by the detector dead time, and showed blackbody spectra with kT is approx. 6-8 keV in the T90 duration of 1-4 s, similar to earlier bursts detected from the source. We find that the spectra during the tail of the bursts can be modeled with an absorbed blackbody with temperature decreasing with flux. The burst flux decays followed a power law of index 0.8-0.9. In the burst tail spectra, we detect a is approx. 13 keV emission feature, similar to those reported in previous bursts from this source as well as from other magnetars observed with the Rossi X-ray Timing Explorer.We explore possible origins of the spectral feature such as proton cyclotron emission, which implies a magnetic field strength of B is approx. 2×10(exp15) G in the emission region. However, the consistency of the energy of the feature in different objects requires further explanation.

  14. The generation of germinal centers

    NARCIS (Netherlands)

    Kroese, Fransciscus Gerardus Maria

    1987-01-01

    Germinal centers are clusters of B lymphoblastoid cells that develop after antigenic stimulation in follicles of peripheral lymphoid organs. These structures are thought to play a major role in the generation of B memory cells. This thesis is dealing with several aspects of these germinal centers. I

  15. Learning Centers: Development and Operation.

    Science.gov (United States)

    Bennie, Frances

    There has been in recent years a growing acceptance of individualized learning concepts. Learning Centers have come to be viewed as an economical and viable strategy for accommodating diverse learning styles and needs. This book provides the educator with an understanding of the learning center concept, its origins, present manifestations, and…

  16. Danish Chinese Center for Nanometals

    DEFF Research Database (Denmark)

    Winther, Grethe

    The Danish-Chinese Center for Nanometals is funded by the Danish National Research Foundation and the National Natural Science Foundation of China. The Chinese partners in the Center are Institute of Metal Research in Shenyang, Tsinghua University and Chongqing University. The Danish part...

  17. Acoustic Center or Time Origin?

    DEFF Research Database (Denmark)

    Staffeldt, Henrik

    1999-01-01

    The paper discusses the acoustic center in relation to measurements of loudspeaker polar data. Also, it presents the related concept time origin and discusses the deviation that appears between positions of the acoustic center found by wavefront based and time based measuring methods....

  18. PTSD: National Center for PTSD

    Medline Plus

    Full Text Available ... Section Home PTSD Overview PTSD Basics Return from War Specific to Women Types of Trauma War Terrorism Violence and Abuse Disasters Is it PTSD? ... Combat Veterans & their Families Readjustment Counseling (Vet Centers) War Related Illness & Injury Study Center Homeless Veterans Returning ...

  19. User-Centered Design Gymkhana

    OpenAIRE

    Garreta Domingo, Muriel; Almirall Hill, Magí; Mor Pera, Enric

    2007-01-01

    The User-centered design (UCD) Gymkhana is a tool for human-computer interaction practitioners to demonstrate through a game the key user-centered design methods and how they interrelate in the design process.The target audiences are other organizational departments unfamiliar with UCD but whose work is related to the definition, cretaion, and update of a product service.

  20. Information Sciences: Information Centers and Special Libraries.

    Science.gov (United States)

    BIBLIOGRAPHIES, *LIBRARIES, *TECHNICAL INFORMATION CENTERS, DATA PROCESSING, AUTOMATION, INFORMATION SYSTEMS, DOCUMENTS, INFORMATION CENTERS, INFORMATION RETRIEVAL, SUBJECT INDEXING, INFORMATION SCIENCES .

  1. Pengembangan Model Manajemen ICT Center

    Directory of Open Access Journals (Sweden)

    Hakkun Elmunsyah

    2013-01-01

    Full Text Available Abstrak: Pengembangan Model Manajemen ICT Center. Kemendiknas telah melakukan investasi  cukup besar berupa pembangunan Jejaring komputer pendidikan nasional yang disebut Jaringan Pendidikan Nasional (Jardiknas, pada sekolah menengah kejuruan (SMK di seluruh Indonesia yang dikenal dengan nama ICT center. Penelitian ini bertujuan untuk menemukan model manajemen ICT center sesuai karakteristik SMK sehingga dapat memberikan kontribusi mutu pada SMK tersebut. Penelitian ini merupakan penelitian pengembangan atau Research and Development yang dikembangkan oleh Borg and Gall. Hasil secara keseluruhan penelitian menunjukkan berdasarkan uji coba keefektivan kinerja manajemen pada skala terbatas dan lebih luas menunjukkan bahwa model manajemen ICT center memenuhi kriteria sangat efektif. Kata-kata kunci: Jardiknas, SMK, model manajemen ICT center, kontribusi mutu

  2. Affinity Maturation of Monoclonal Antibody 1E11 by Targeted Randomization in CDR3 Regions Optimizes Therapeutic Antibody Targeting of HER2-Positive Gastric Cancer.

    Science.gov (United States)

    Ko, Bong-Kook; Choi, Soyoung; Cui, Lei Guang; Lee, Young-Ha; Hwang, In-Sik; Kim, Kyu-Tae; Shim, Hyunbo; Lee, Jong-Seo

    2015-01-01

    Anti-HER2 murine monoclonal antibody 1E11 has strong and synergistic anti-tumor activity in HER2-overexpressing gastric cancer cells when used in combination with trastuzumab. We presently optimized this antibody for human therapeutics. First, the complementarity determining regions (CDRs) of the murine antibody were grafted onto human germline immunoglobulin variable genes. No difference in affinity and biological activity was observed between chimeric 1E11 (ch1E11) and humanized 1E11 (hz1E11). Next, affinity maturation of hz1E11 was performed by the randomization of CDR-L3 and H3 residues followed by stringent biopanning selection. Milder selection pressure favored the selection of more diverse clones, whereas higher selection stringency resulted in the convergence of the panning output to a smaller number of clones with improved affinity. Clone 1A12 had four amino acid substitutions in CDR-L3, and showed a 10-fold increase in affinity compared to the parental clone and increased potency in an in vitro anti-proliferative activity assay with HER2-overepxressing gastric cancer cells. Clone 1A12 inhibited tumor growth of NCI-N87 xenograft model with similar efficacy to trastuzumab alone, and the combination treatment of 1A12 and trastuzumab completely removed the established tumors. These results suggest that humanized and affinity matured monoclonal antibody 1A12 is a highly optimized molecule for future therapeutic development against HER2-positive tumors.

  3. Sunyaev-Zel'Dovich effect observations of the bullet cluster (1E 0657-56) with APEX-SZ

    Energy Technology Data Exchange (ETDEWEB)

    Halverson, N.W.; Lanting, T.; Ade, P.A.R.; Basu, K.; Bender, A.N.; Benson, B.A.; Bertoldi, F.; Cho, H.-M.; Chon, G.; Clarke, J.; Dobbs, M.; Ferrusca, D.; Gusten, R.; Holzapfel, W.L.; Kovacs, A.; Kennedy, J.; Kermish, Z.; Kneissl, R.; Lee, A.T.; Lueker, M.; Mehl, J.; Menten, K.M.; Muders, D.; Nord, M.; Pacaud, F.; Plagge, T.; Reichardt, C.; Richards, P.L.; Schaaf, R.; Schilke, P.; Schuller, F.; Schwan, D.; Spieler, H.; Tucker, C.; Weiss, A.; Zahn, O.

    2008-07-25

    We present observations of the Sunyaev-Zel'dovich effect (SZE) in the Bullet cluster (1E 0657-56) using the APEX-SZ instrument at 150 GHz with a resolution of 1'. The main results are maps of the SZE in this massive, merging galaxy cluster. The cluster is detected with 23 sigma significance within the central 1' radius of the source position. The SZE map has a broadly similar morphology to that in existing X-ray maps of this system, and we find no evidence for significant contamination of the SZE emission by radio or IR sources. In order to make simple quantitative comparisons with cluster gas models derived from X-ray observations, we fit our data to an isothermal elliptical beta model, despite the inadequacy of such a model for this complex merging system. With an X-ray derived prior on the power-law index, beta = 1.04+0.16-0.10, we find a core radius rc = 142" +- 18", an axial ratio of 0.889 +- 0.072, and a central temperature decrement of -771 +- 71 muKCMB, including a +-5.5percent flux calibration uncertainty. Combining the APEX-SZ map with a map of projected electron surface density from Chandra X-ray observations, we determine the mass-weighted temperature of the cluster gas to be Tmg = 10.8 +- 0.9 keV, significantly lower than some previously reported X-ray spectroscopic temperatures. Under the assumption of an isothermal cluster gas distribution in hydrostatic equilibrium, we compute the gas mass fraction for prolate and oblate spheroidal geometries and find it to be consistent with previous results from X-ray and weak-lensing observations. This work is the first result from the APEX-SZ experiment and represents the first reported scientific result from observations with a large array of multiplexed superconducting transition-edge sensor bolometers.

  4. MARCH1 E3 Ubiquitin Ligase Dampens the Innate Inflammatory Response by Modulating Monocyte Functions in Mice.

    Science.gov (United States)

    Galbas, Tristan; Raymond, Maxime; Sabourin, Antoine; Bourgeois-Daigneault, Marie-Claude; Guimont-Desrochers, Fanny; Yun, Tae Jin; Cailhier, Jean-François; Ishido, Satoshi; Lesage, Sylvie; Cheong, Cheolho; Thibodeau, Jacques

    2017-01-15

    Ubiquitination was recently identified as a central process in the pathogenesis and development of numerous inflammatory diseases, such as obesity, atherosclerosis, and asthma. Treatment with proteasomal inhibitors led to severe side effects because ubiquitination is heavily involved in a plethora of cellular functions. Thus, new players regulating ubiquitination processes must be identified to improve therapies for inflammatory diseases. In addition to their role in adaptive immunity, endosomal MHC class II (MHCII) molecules were shown to modulate innate immune responses by fine tuning the TLR4 signaling pathway. However, the role of MHCII ubiquitination by membrane associated ring-CH-type finger 1 (MARCH1) E3 ubiquitin ligase in this process remains to be assessed. In this article, we demonstrate that MARCH1 is a key inhibitor of innate inflammation in response to bacterial endotoxins. The higher mortality of March1(-/-) mice challenged with a lethal dose of LPS was associated with significantly stronger systemic production of proinflammatory cytokines and splenic NK cell activation; however, we did not find evidence that MARCH1 modulates LPS or IL-10 signaling pathways. Instead, the mechanism by which MARCH1 protects against endotoxic shock rests on its capacity to promote the transition of monocytes from Ly6C(Hi) to Ly6C(+/-) Moreover, in competitive bone marrow chimeras, March1(-/-) monocytes and polymorphonuclear neutrophils outcompeted wild-type cells with regard to bone marrow egress and homing to peripheral organs. We conclude that MARCH1 exerts MHCII-independent effects that regulate the innate arm of immunity. Thus, MARCH1 might represent a potential new target for emerging therapies based on ubiquitination reactions in inflammatory diseases.

  5. A Crosslinking Analysis of GAP-43 Interactions with Other Proteins in Differentiated N1E-115 Cells

    Directory of Open Access Journals (Sweden)

    John B. Denny

    2008-09-01

    Full Text Available It has been suggested that GAP-43 (growth-associated protein binds to various proteins in growing neurons as part of its mechanism of action. To test this hypothesis in vivo, differentiated N1E-115 neuroblastoma cells were labeled with [35S]-amino acids and were treated with a cleavable crosslinking reagent. The cells were lysed in detergent and the lysates were centrifuged at 100,000 x g to isolate crosslinked complexes. Following cleavage of the crosslinks and analysis by two-dimensional gel electrophoresis, it was found that the crosslinker increased the level of various proteins, and particularly actin, in this pellet fraction. However, GAP-43 was not present, suggesting that GAP-43 was not extensively crosslinked to proteins of the cytoskeleton and membrane skeleton and did not sediment with them. GAP-43 also did not sediment with the membrane skeleton following nonionic detergent lysis. Calmodulin, but not actin or other proposed interaction partners, co-immunoprecipitated with GAP-43 from the 100,000 x g supernatant following crosslinker addition to cells or cell lysates. Faint spots at 34 kDa and 60 kDa were also present. Additional GAP-43 was recovered from GAP-43 immunoprecipitation supernatants with anti-calmodulin but not with anti-actin. The results suggest that GAP-43 is not present in complexes with actin or other membrane skeletal or cytoskeletal proteins in these cells, but it is nevertheless possible that a small fraction of the total GAP-43 may interact with other proteins.

  6. Omega-3 fatty acids control productions of superoxide and nitrogen oxide and insulin content in INS-1E cells.

    Science.gov (United States)

    Graciano, M F; Leonelli, M; Curi, R; R Carpinelli, A

    2016-12-01

    Omega-3 fatty acids have multiple effects in peripheral tissues and pancreatic beta cell function. Dietary depletion of omega-3 fatty acids is associated with pancreatic islet dysfunction and insulin resistance in rats. Herein, the effects of eicosapentaenoic acid (EPA) and docosahexaenoic acid (DHA) on pancreatic beta cell redox state and function were investigated. INS-1E insulin-secreting cells were incubated with EPA and DHA in combination with palmitic acid, and productions of reactive oxygen species (ROS), nitric oxide (NO) and insulin were measured. The involvement of the NADPH oxidase complex in ROS production and expression of the antioxidant enzymes was also investigated. After incubation for 1 or 48 h, productions of superoxide (by hydroethidine method), nitric oxide (by 4,5-diaminofluorescein diacetate-DAF-2DA assay), insulin (by radioimmunoassay), and expressions (by western blot analysis) of glutathione peroxidase (GPx-1) and gp91(PHOX) were measured. EPA and DHA reduced superoxide production after 1-h incubation. After 48 h, palmitic acid reduced superoxide production that was normalized by EPA treatment. Palmitic acid increased NO production that was reverted by EPA and DHA. Palmitic acid increased insulin secretion after 48 h, whereas both omega-3 fatty acids increased intracellular insulin content. EPA and DHA enhanced GPx-1 expression as well as gp91(PHOX) glycosylated form. In conclusion, EPA and DHA increased intracellular insulin content and antioxidant enzymatic defense capacity and decreased pro-oxidant generating activities that are associated with maintenance of pancreatic beta cell redox state in response to palmitic acid.

  7. Effect of prostaglandins E1, E2, and F2 alpha on osteoclast formation in mouse bone marrow cultures

    Energy Technology Data Exchange (ETDEWEB)

    Collins, D.A.; Chambers, T.J. (St. George' s Hospital Medical School, London (United Kingdom))

    1991-02-01

    Prostaglandins (PG) act as direct inhibitors of mature osteoclasts, but although resorption-inhibition is also observed initially PG increase bone resorption in organ culture. This suggests that PG influence bone resorption in organ culture through actions on cell types other than mature osteoclasts. We have therefore tested the effects of PG E1, E2, and F2 alpha on the differentiation of osteoclastic phenotype in mouse bone marrow cultures using bone resorption and calcitonin receptors (CTR) as markers of osteoclastic differentiation. We found that PGE2 (10{sup {minus} 6}-10{sup {minus} 9} M) and PGE1 (10{sup {minus} 6} - 10{sup {minus} 7} M) induced a significant increase in CTR-positive cell numbers, to levels five to eight times those seen in controls and similar to the number induced by 1,25-dihydroxyvitamin D3 (1,25-(OH)2D3). Bone resorption was increased (10{sup {minus} 7} M PGE2 and 10{sup {minus} 6} M PGE1) in association with the increased CTR-positive cell numbers, suggesting that the PG also induced resorptive function. 1,25-(OH)2D3 increased both the number of CTR-positive cells and the extent of resorption per cell; the additional presence of PG did not affect the number of CTR-positive cells but did reduce bone resorption compared with 1,25-(OH)2D3 alone. PGF2 alpha had no significant effect on CTR-positive cell induction or bone resorption. The results suggest that PGE1 and E2 induce osteoclastic differentiation in mouse bone marrow cultures and inhibit the function of the osteoclasts thus formed.

  8. Effects of inorganic lead on voltage-sensitive calcium channels in N1E-115 neuroblastoma cells.

    Science.gov (United States)

    Audesirk, G; Audesirk, T

    1991-01-01

    N1E-115 mouse neuroblastoma cells have been reported to possess two types of voltage-sensitive calcium channels: Low voltage activated, rapidly inactivating T-type (type I) and high voltage activated, slowly inactivating L-type (type II). We studied the effects of acute in vitro exposure to inorganic lead on these calcium channels, using the whole-cell variant of patch clamping. Using salines with a high lead-buffering capacity, we found that both T-type and L-type channels are reversibly inhibited in a dose-dependent manner at free Pb2+ concentrations ranging from 20 nM to 14 microM. L-type channels are somewhat more sensitive to Pb2+ than T-type channels are (L-type: IC50 approx. 0.7 microM; T-type: IC50 approx. 1.3 microM). Both channels show small but significant inhibition (approx. 10%) at 20 nM free Pb2+. Pb2+ affects neither activation nor inactivation of T-type channels, but enhances inactivation of L-type channels at holding potentials around -60 to -40 mV. A peculiar phenomenon was observed in cells exposed to 2.3 microM free Pb2+. T-type channels were inhibited in all 20 cells studied. In 15 cells, L-type channels were also inhibited, but in the remaining 5 cells, current flow through L-type channels was enhanced by Pb2+ exposure.

  9. Emergency Operations Center ribbon cutting

    Science.gov (United States)

    2009-01-01

    Center Director Gene Goldman and special guests celebrate the opening of the site's new Emergency Operations Center on June 2. Participants included (l t r): Steven Cooper, deputy director of the National Weather Service Southern Region; Tom Luedtke, NASA associate administrator for institutions and management; Charles Scales, NASA associate deputy administrator; Mississippi Gov. Haley Barbour; Gene Goldman, director of Stennis Space Center; Jack Forsythe, NASA assistant administrator for the Office of Security and Program Protection; Dr. Richard Williams, NASA chief health and medical officer; and Weldon Starks, president of Starks Contracting Company Inc. of Biloxi.

  10. Non-invasive imaging of ferucarbotran labeled INS-1E cells and rodent islets in vitro and in transplanted diabetic rats.

    Science.gov (United States)

    Auer, Veronika J; Bucher, Julian; Schremmer-Danninger, Elisabeth; Paulmurugan, Ramasamy; Maechler, Pierre; Reiser, Maximilian F; Stangl, Manfred J; Berger, Frank

    2011-04-01

    Transplantation of pancreatic islets is a promising strategy for restoring insulin secretion in diabetes mellitus. To monitor transplanted islets, a method to evaluate the distribution in a non-invasive manner in vivo is needed. INS-1E, a stable differentiated insulin secreting cell line, and rodent islets were used to monitor cell transplantation by MRI. For labeling INS-1E cells in vitro, increasing concentrations of Resovist in culture medium were tested. For MR imaging in a clinical 3T scanner, we placed a layer of labeled INS-1E cells between two layers of 4% gelatin. Viability assay was performed. Cell function was evaluated by static incubation assay to assess insulin secretion. For in vivo imaging, iron labeled rodent islets were transplanted into the liver of streptozotocin induced diabetic rats and visualized by MRI. Blood sugar values were controlled and liver tissue was removed for histological analysis. SPIO labeled INS-1E cells did not show altered viability or reduced glucose stimulated insulin secretion in vitro. Double staining of labeled and unlabeled INS-1E cells showed no difference in the staining pattern. Labeling of rodent islets with SPIOs does not reduce their secretory activity or alter their viability. We visualized SPIO-labeled INS-1E cells and rat islets in vitro using a clinical 3T scanner. Diabetic rats transplanted with SPIO-labeled islets became normoglycemic. MR imaging successfully verified the distribution of labeled transplanted cells in vivo. Labeling INS-1E cells and rat islets with SPIOs does not alter their viability, while enabling MR imaging of labeled cells in vitro and within the living organism.

  11. (1E,2E-1,2-Bis(2,3-dihydro-1H-inden-1-ylidenehydrazine

    Directory of Open Access Journals (Sweden)

    Wolfgang Imhof

    2012-09-01

    Full Text Available In the title compound, C18H16N2, there are two independent half-molecules (A and B in the asymmetric unit, each molecule being completed by an inversion center situated in the mid-point of the central N—N bond. The molecules themselves therefore are essentially planar with r.m.s. deviations of 0.015 (1 and 0.020 (1 Å, respectively. In the crystal, molecules are connected via C—H...π interactions in which only type B molecules are donors, while both A and B molecules act as acceptors. As a result, type B molecules are linked into infinite chains along b, which are interconnected by molecules of type A.

  12. Center for Beam Physics, 1993

    Energy Technology Data Exchange (ETDEWEB)

    1994-05-01

    The Center for Beam Physics is a multi-disciplinary research and development unit in the Accelerator and Fusion Research Division at Lawrence Berkeley Laboratory. At the heart of the Center`s mission is the fundamental quest for mechanisms of acceleration, radiation and focusing of energy. Dedicated to exploring the frontiers of the physics of (and with) particle and photon beams, its primary mission is to promote the science and technology of the production, manipulation, storage and control systems of charged particles and photons. The Center serves this mission via conceptual studies, theoretical and experimental research, design and development, institutional project involvement, external collaborations, association with industry and technology transfer. This roster provides a glimpse at the scientists, engineers, technical support, students, and administrative staff that make up this team and a flavor of their multifaceted activities during 1993.

  13. Shopping Malls - ShoppingCenters

    Data.gov (United States)

    NSGIC GIS Inventory (aka Ramona) — Collected from a variety of sources both commercial and internal, this layer represents shopping center locations within Volusia County and is maintained by the...

  14. Clean Energy Solutions Center Services

    Energy Technology Data Exchange (ETDEWEB)

    2016-03-01

    The Solutions Center offers no-cost expert policy assistance, webinars and training forums, clean energy policy reports, data, and tools provided in partnership with more than 35 leading international and regional clean energy organizations.

  15. Student-Centered Reading Activities.

    Science.gov (United States)

    Moffett, James; Wagner, Betty Jane

    1991-01-01

    Offers student-centered reading activities designed to bring students to reading maturity and involvement in literature. Discusses partner reading, dramatizing and performing texts, transforming texts, journal writing, discussion, and writing. (PRA)

  16. Center for Creative Studies, Detroit

    Science.gov (United States)

    AIA Journal, 1976

    1976-01-01

    One of the ten buildings chosen to receive 1976 AIA honor awards, the arts center houses the departments of sculpture, painting, graphics, advertising art, photography, and industrial design. (Author/MLF)

  17. Electricity Infrastructure Operations Center (EIOC)

    Data.gov (United States)

    Federal Laboratory Consortium — The Electricity Infrastructure Operations Center (EIOC) at PNNL brings together industry-leading software, real-time grid data, and advanced computation into a fully...

  18. Aim to International Shipping Center

    Institute of Scientific and Technical Information of China (English)

    Hu Wenxiu

    2009-01-01

    @@ Since 1990s,various countries in the world have been focusing on the construction of the key ports,leading to a fiercer competition between ports.For example,in East Asia,South Korea and Japan are rivaling for the international shipping center in Northeast Asia.Taking Busan Port and Gwangyang Port as the central ports,South Korea is boosting the ports expansion plans,to construct a"logistic center in Northeast Asia".Meanwhile.Japan is projecting the optimizmg and integration of port resources,to regain the international shipping center in Asia.The central government of China made plans for constructing Shanghai Shipping Center as early in 1996.and after 13 years'construction,now Shanghai Port has the largest cargo throughput and the second largest container throughput in the world.

  19. Poison control center - emergency number

    Science.gov (United States)

    For a POISON EMERGENCY call: 1-800-222-1222 ANYWHERE IN THE UNITED STATES This national hotline number will let you ... is a free and confidential service. All local poison control centers in the United States use this ...

  20. CENTER FOR CYBER SECURITY STUDIES

    Data.gov (United States)

    Federal Laboratory Consortium — The mission of the Center for Cyber Security Studies is to enhance the education of midshipmen in all areas of cyber warfare, to facilitate the sharing of expertise...

  1. Kennedy Space Center Design Visualization

    Science.gov (United States)

    Humeniuk, Bob

    2013-01-01

    Perform simulations of ground operations leading up to launch at Kennedy Space Center and Vandenberg Air Force Base in CA since 1987. We use 3D Laser Scanning, Modeling and Simulations to verify that operations are feasible, efficient and safe.

  2. Telework centers as local development

    DEFF Research Database (Denmark)

    Lorentzen, Anne

    2013-01-01

    projects. A record of the development challenges of the two host municipalities Jammerbugt and Brønderslev, to contextualize the telework centers in the local context. And finally a preliminary analysis and discussion of the two telework centers in relation to their potential community benefits......This paper discusses the establishment of distant work centers as an element in local development strategies in rural areas with a particular view on two new telework centers in Region North Denmark Distant work is a phenomenon on the rise, due to the development of the internet on the one hand...... regardless of location, as long as there is access to internet. Not only firms, but individual labor is potentially liberated from the logic of physical location and proximity. Technically speaking ‘geography is dead’ and the clustering of new service jobs in big cities is no longer a technical necessity...

  3. PTSD: National Center for PTSD

    Medline Plus

    Full Text Available ... Espanol Apps, Videos and More Mobile Apps Videos Web Links PTSD Site Search For Professionals Professional Section ... Education Handouts Manuals Mobile Apps Publications Toolkits Videos Web Links Advanced Search About Us National Center for ...

  4. FEMA Disaster Recovery Centers - KML

    Data.gov (United States)

    Department of Homeland Security — This is a KML file for FEMA's Disaster Recovery Centers (DRC). A DRC is a readily accessible facility or mobile office set up by FEMA where applicants may go for...

  5. National Center for Health Statistics

    Science.gov (United States)

    ... Submit Search The CDC National Center for Health Statistics Note: Javascript is disabled or is not supported ... Survey of Family Growth Vital Records National Vital Statistics System National Death Index Provider Surveys National Health ...

  6. Records Center Program Billing System

    Data.gov (United States)

    National Archives and Records Administration — RCPBS supports the Records center programs (RCP) in producing invoices for the storage (NARS-5) and servicing of National Archives and Records Administration’s...

  7. Parent and Child Living Centers.

    Science.gov (United States)

    Pushaw, David R.

    1978-01-01

    Parent and child living centers offer a program to improve parenting skills with areas of learning including child growth and development, family management, home care and repair, and personal growth and development. (MM)

  8. Engineering Technical Support Center (ETSC)

    Science.gov (United States)

    ETSC is EPA’s technical support and resource centers responsible for providing specialized scientific and engineering support to decision-makers in the Agency’s ten regional offices, states, communities, and local businesses.

  9. Human-Centered Design Capability

    Science.gov (United States)

    Fitts, David J.; Howard, Robert

    2009-01-01

    For NASA, human-centered design (HCD) seeks opportunities to mitigate the challenges of living and working in space in order to enhance human productivity and well-being. Direct design participation during the development stage is difficult, however, during project formulation, a HCD approach can lead to better more cost-effective products. HCD can also help a program enter the development stage with a clear vision for product acquisition. HCD tools for clarifying design intent are listed. To infuse HCD into the spaceflight lifecycle the Space and Life Sciences Directorate developed the Habitability Design Center. The Center has collaborated successfully with program and project design teams and with JSC's Engineering Directorate. This presentation discusses HCD capabilities and depicts the Center's design examples and capabilities.

  10. Transportation Research & Analysis Computing Center

    Data.gov (United States)

    Federal Laboratory Consortium — The technical objectives of the TRACC project included the establishment of a high performance computing center for use by USDOT research teams, including those from...

  11. Joint Center for Robotics (JCR)

    Science.gov (United States)

    2008-04-15

    Unclassified 1 Joint Center for Robotics (JCR) Dr. Jim Overholt 15 April 2008 DISTRIBUTION STATEMENT A. Approved for public release; distribution is...REPORT DATE APR 2008 2. REPORT TYPE N/A 3. DATES COVERED - 4. TITLE AND SUBTITLE Joint Center for Robotics (JCR) 5a. CONTRACT NUMBER 5b. GRANT...ANSI Std Z39-18 Unclassified 2 TARDEC JCR Robotics CAST Projects & Cells “White Hat” Organization - Understand the needs of the user and create

  12. Italy INAF Analysis Center Report

    Science.gov (United States)

    Negusini, M.; Sarti, P.

    2013-01-01

    This report summarizes the activity of the Italian INAF VLBI Analysis Center. Our Analysis Center is located in Bologna, Italy and belongs to the Institute of Radioastronomy, which is part of the National Institute of Astrophysics. IRA runs the observatories of Medicina and Noto, where two 32-m VLBI AZ-EL telescopes are situated. This report contains the AC's VLBI data analysis activities and shortly outlines the investigations into the co-locations of space geodetic instruments.

  13. Centered Sublattice and its Application

    Institute of Scientific and Technical Information of China (English)

    宋振明; 徐扬; 等

    1993-01-01

    In this paper,the concept of the centered sublattice is introduceed for lattice theory and the dis-composition theorem of a lattice is given.Based on the centered sublattice,we give some new descriptions of a modular lattice,a distributive lattice,a complemented lattice and an relatively complemented lattice,etc.These new decriptions established now researching methods for lattice theory.

  14. User-Centered Data Management

    CERN Document Server

    Catarci, Tiziana; Kimani, Stephen

    2010-01-01

    This lecture covers several core issues in user-centered data management, including how to design usable interfaces that suitably support database tasks, and relevant approaches to visual querying, information visualization, and visual data mining. Novel interaction paradigms, e.g., mobile and interfaces that go beyond the visual dimension, are also discussed. Table of Contents: Why User-Centered / The Early Days: Visual Query Systems / Beyond Querying / More Advanced Applications / Non-Visual Interfaces / Conclusions

  15. AICAR and Metformin Exert AMPK-dependent Effects on INS-1E Pancreatic β-cell Apoptosis via Differential Downstream Mechanisms.

    Science.gov (United States)

    Dai, Yu-Lu; Huang, Su-Ling; Leng, Ying

    2015-01-01

    The role of AMP-activated protein kinase (AMPK) in pancreatic β-cell apoptosis is still controversial, and the reasons for the discrepancies have not been clarified. In the current study, we observed the effects of two well-known AMPK activators 5-aminoimidazole-4-carboxamide ribonucleoside (AICAR) and metformin, on apoptosis in rat insulinoma INS-1E cells, and further explored their possible mechanisms. Both AICAR and metformin protected INS-1E cells from palmitate-induced apoptosis, as reflected by decreases in both cleaved caspase 3 protein expression and caspase 3/7 activity, and these protective effects were abrogated by AMPK inhibitor compound C. The protective action of AICAR was probably mediated by the suppression of triacylglycerol accumulation, increase in Akt phosphorylation and decrease in p38 MAPK phosphorylation, while metformin might exert its protective effect on INS-1E cells by decreases in both JNK and p38 MAPK phosphorylation. All these regulations were dependent on AMPK activation. However, under standard culture condition, AICAR increased JNK phosphorylation and promoted INS-1E cell apoptosis in an AMPK-dependent manner, whereas metformin showed no effect on apoptosis. Our study revealed that AMPK activators AICAR and metformin exhibited different effects on INS-1E cell apoptosis under different culture conditions, which might be largely attributed to different downstream mediators. Our results provided new and informative clues for better understanding of the role of AMPK in β-cell apoptosis.

  16. Chandra and XMM-Newton study of the supernova remnant Kes 73 hosting the magnetar 1E 1841-045

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Harsha S.; Safi-Harb, Samar [Department of Physics and Astronomy, University of Manitoba, Winnipeg MB R3T 2N2 (Canada); Slane, Patrick O. [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA 02138 (United States); Gotthelf, E. V., E-mail: harsha@physics.umanitoba.ca, E-mail: samar@physics.umanitoba.ca, E-mail: slane@cfa.harvard.edu, E-mail: eric@astro.columbia.edu [Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States)

    2014-01-20

    We present a Chandra and XMM-Newton study of the supernova remnant (SNR) Kes 73 hosting the anomalous X-ray pulsar 1E 1841–045. The Chandra image reveals clumpy structures across the remnant with enhanced emission along the western rim. The X-ray emission fills the radio shell and spatially correlates with the infrared image. The global X-ray spectrum is described by a two-component thermal model with a column density N {sub H} = 2.6{sub −0.3}{sup +0.4}×10{sup 22} cm{sup –2} and a total luminosity of L{sub X} = 3.3{sub −0.5}{sup +0.7}×10{sup 37} erg s{sup –1} (0.5-10 keV, at an assumed distance of 8.5 kpc). The soft component is characterized by a temperature kT{sub s} = 0.5{sub −0.2}{sup +0.1} keV, a high ionization timescale, and enhanced Si and S abundances, suggesting emission that is dominated by shocked ejecta. The hard component has a temperature kT{sub h} = 1.6{sub −0.7}{sup +0.8} keV, a relatively low ionization timescale, and mostly solar abundances suggesting emission that is dominated by interstellar/circumstellar shocked material. A spatially resolved spectroscopy study reveals no significant variations in the spectral properties. We infer an SNR age ranging between 750 yr and 2100 yr, an explosion energy of 3.0{sub −1.8}{sup +2.8}×10{sup 50} erg and a shock velocity of (1.2 ± 0.3)×10{sup 3} km s{sup –1} (under the Sedov phase assumption). We also discuss the possible scenario for Kes 73 expanding into the late red-supergiant wind phase of its massive progenitor. Comparing the inferred metal abundances to core-collapse nucleosynthesis model yields, we estimate a progenitor mass ≳20 M {sub ☉}, adding a candidate to the growing list of highly magnetized neutron stars proposed to be associated with very massive progenitors.

  17. Relationship between Tiam1, E-cadherin, Vimentin expression and EMT in lung adenocarcinoma cells%肺腺癌细胞Tiam1,E-cadherin和Vimentin的表达及与上皮间质转化的关系

    Institute of Scientific and Technical Information of China (English)

    刘士君; 唐娜; 孙波; 王秀茹; 李建华

    2012-01-01

    Objective: To investigate the clinical significance of relationship between Tiaml ( T-lymphoma invasion and metastasis inducing factor 1 ) , E-cadherin, Vimentin and EMT ( epithelial and mesenchymal transition) in lung adenocarcinoma cells. Methods: Lung adenocarcinoma cells were obtained to analyze in 112 cases of malignant pleural effusion. 39 hyperplasia epithelium cells of non-malignant pleural effusions were obtained as control. Malignant pleural effusions were analyzed by thin-prep cytology test (TCT) , H&E staining and immunocytochemistry staining. Immunocytochemistry staining was used to test Tiaml, E-cadherin, and Vimentin. Results; Tiaml positive expression was found in 75 of 112 (67. 0%) cases malignant pleural effusions. E-cadherin and vimentin expression was found in 81/112 (72. 3% ) and 94/112 (83. 9% ) cases, respectively. Our data showed elevated levels of Tiaml were accompanied by down regulation of E-cadherin and the up regulation expression of vimentin in lung adenocarcinoma cells. Hyperplasia epithelium cells from non-malignant pleural fluid were uniformly negative for E-cadherin and Tiaml. Conclusion: Our study shows Tiaml positive expression in lung adenocarcinoma cells may be related to EMT.%目的:探讨T淋巴瘤侵袭转移诱导因子1(Tiam1)及E-eadherin,Vimentin蛋白与上皮间质转化(epithelial and mesenchymal transition,EMT)在肺腺癌细胞中的表达关系的临床意义.方法:从112例恶性胸水中提取肺腺癌细胞为研究对象,以39例良性胸水中增生上皮细胞为对照,常规液基细胞薄层(TCT)技术、H&E染色、免疫细胞化学染色检测胸水中的肺腺癌细胞.采用免疫细胞化学方法检测细胞中Tiam1、E钙粘素蛋白、Vimentin的表达.结果:112例恶性胸水标本中,75例Tiam1在肺腺癌细胞中表达阳性,阳性率为67.0%.E-cadherin及Vimentin蛋白在肺腺癌细胞中的表达率分别为81/112 (72.3%)和94/112 (83.9%).结果显示,Tiam1在肺腺癌细胞中的

  18. Correlations between Abelian monopoles and center vortices

    Science.gov (United States)

    Hosseini Nejad, Seyed Mohsen; Deldar, Sedigheh

    2017-04-01

    We study the correlations between center vortices and Abelian monopoles for SU(3) gauge group. Combining fractional fluxes of monopoles, center vortex fluxes are constructed in the thick center vortex model. Calculating the potentials induced by fractional fluxes constructing the center vortex flux in a thick center vortex-like model and comparing with the potential induced by center vortices, we observe an attraction between fractional fluxes of monopoles constructing the center vortex flux. We conclude that the center vortex flux is stable, as expected. In addition, we show that adding a contribution of the monopole-antimonopole pairs in the potentials induced by center vortices ruins the Casimir scaling at intermediate regime.

  19. The Research Role of a National Center.

    Science.gov (United States)

    Silberman, Harry F.

    The functional role of a national center for vocational education depends on the people doing the work; consequently, the center sets its own agenda when it makes personal decisions. A center's role should include two elements: in setting its own research agenda, a center should take a broad perspective on vocational education; and a center should…

  20. Advanced Call Center Supporting WAP Access

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    Traditional call centers can be accessed via speech only, and the call center based on web provides both data and speech access, but it needs a powerful terminal-computer. By analyzing traditional call centers and call centers based on web, this paper presents the framework of an advanced call center supporting WAP access. A typical service is also described in detail.

  1. TRPV4 regulates insulin mRNA expression and INS-1E cell death via ERK1/2 and NO-dependent mechanisms.

    Science.gov (United States)

    Billert, M; Skrzypski, M; Sassek, M; Szczepankiewicz, D; Wojciechowicz, T; Mergler, S; Strowski, M Z; Nowak, K W

    2017-03-27

    TRPV4 is a Ca(2+)-permeable, nonselective cation channel. Recently, TRPV4 was implicated in controlling peripheral insulin sensitivity, insulin secretion and apoptosis of pancreatic beta cells. Here, we characterize the role and potential mechanisms of TRPV4 in regulating insulin mRNA expression and cell death in insulin producing INS-1E cells and rat pancreatic islets. TRPV4 protein production was downregulated by siRNA. Intracellular calcium level was measured using Fluo-3 AM. Gene expression was studied by real-time PCR. Phosphorylation of extracellular signal-regulated kinase (ERK1 and ERK2) was detected by Western blot. Nitric oxide (NO) production was assessed by chemiluminescent reaction. Reactive oxygen species (ROS) level was analysed using a fluorogenic dye (DCFDA). Cell death was evaluated by determination of cytoplasmic histone-associated DNA fragments. Downregulation of TRPV4 neither affected insulin mRNA expression nor INS-1E cell growth. By contrast, pharmacological TRPV4 activation by 100nmol/l GSK1016790A increased Ca(2+) levels in INS-1E cells and enhanced insulin mRNA expression after 1 and 3h, whereas a suppression of both was detected after 24h incubation. GSK1016790A increased ERK1/2 phosphorylation and NO production but not ROS production. Pharmacological blockade of ERK1/2 attenuated GSK1016790A-induced insulin mRNA expression. Inhibition of NO synthesis by l-NAME failed to affect insulin mRNA expression in GSK1016790A treated INS-1E cells. Furthermore, inhibition of NO production attenuated GSK1016790A-induced INS-1E cell death. In pancreatic islets, 100nmol/l GSK1016790A increased insulin mRNA levels after 3h without inducing cytotoxicity after 24h. In conclusion, TRPV4 differently regulates insulin mRNA expression in INS-1E cells via ERK1/2 and NO-dependent mechanisms.

  2. PED/PEA-15 inhibits hydrogen peroxide-induced apoptosis in Ins-1E pancreatic beta-cells via PLD-1.

    Directory of Open Access Journals (Sweden)

    Francesca Fiory

    Full Text Available The small scaffold protein PED/PEA-15 is involved in several different physiologic and pathologic processes, such as cell proliferation and survival, diabetes and cancer. PED/PEA-15 exerts an anti-apoptotic function due to its ability to interfere with both extrinsic and intrinsic apoptotic pathways in different cell types. Recent evidence shows that mice overexpressing PED/PEA-15 present larger pancreatic islets and increased beta-cells mass. In the present work we investigated PED/PEA-15 role in hydrogen peroxide-induced apoptosis in Ins-1E beta-cells. In pancreatic islets isolated from Tg(PED/PEA-15 mice hydrogen peroxide-induced DNA fragmentation was lower compared to WT islets. TUNEL analysis showed that PED/PEA-15 overexpression increases the viability of Ins-1E beta-cells and enhances their resistance to apoptosis induced by hydrogen peroxide exposure. The activity of caspase-3 and the cleavage of PARP-1 were markedly reduced in Ins-1E cells overexpressing PED/PEA-15 (Ins-1E(PED/PEA-15. In parallel, we observed a decrease of the mRNA levels of pro-apoptotic genes Bcl-xS and Bad. In contrast, the expression of the anti-apoptotic gene Bcl-xL was enhanced. Accordingly, DNA fragmentation was higher in control cells compared to Ins-1E(PED/PEA-15 cells. Interestingly, the preincubation with propranolol, an inhibitor of the pathway of PLD-1, a known interactor of PED/PEA-15, responsible for its deleterious effects on glucose tolerance, abolishes the antiapoptotic effects of PED/PEA-15 overexpression in Ins-1E beta-cells. The same results have been obtained by inhibiting PED/PEA-15 interaction with PLD-1 in Ins-1E(PED/PEA-15. These results show that PED/PEA-15 overexpression is sufficient to block hydrogen peroxide-induced apoptosis in Ins-1E cells through a PLD-1 mediated mechanism.

  3. The study of ctx B and rstR variations of toxigenic Vibrio cholerae O1 E1 Tor strains isolated from 1961 to 2010 in China

    Institute of Scientific and Technical Information of China (English)

    梁未丽

    2014-01-01

    Objective To understand the ctx B and rstR variations of toxigenic Vibrio cholerae(V.cholerae)O1 E1 Tor strains isolated from different provinces in China from1961 to 2010.Methods All 385 toxigenic V.cholerae O1 E1 Tor strains were selected,which were isolated in China between year 1961 and 2010.ctx B gene was amplified by PCR method and sequenced for further analysis.rstR was detected with PCR by using the genotype

  4. PED/PEA-15 inhibits hydrogen peroxide-induced apoptosis in Ins-1E pancreatic beta-cells via PLD-1.

    Science.gov (United States)

    Fiory, Francesca; Parrillo, Luca; Raciti, Gregory Alexander; Zatterale, Federica; Nigro, Cecilia; Mirra, Paola; Falco, Roberta; Ulianich, Luca; Di Jeso, Bruno; Formisano, Pietro; Miele, Claudia; Beguinot, Francesco

    2014-01-01

    The small scaffold protein PED/PEA-15 is involved in several different physiologic and pathologic processes, such as cell proliferation and survival, diabetes and cancer. PED/PEA-15 exerts an anti-apoptotic function due to its ability to interfere with both extrinsic and intrinsic apoptotic pathways in different cell types. Recent evidence shows that mice overexpressing PED/PEA-15 present larger pancreatic islets and increased beta-cells mass. In the present work we investigated PED/PEA-15 role in hydrogen peroxide-induced apoptosis in Ins-1E beta-cells. In pancreatic islets isolated from Tg(PED/PEA-15) mice hydrogen peroxide-induced DNA fragmentation was lower compared to WT islets. TUNEL analysis showed that PED/PEA-15 overexpression increases the viability of Ins-1E beta-cells and enhances their resistance to apoptosis induced by hydrogen peroxide exposure. The activity of caspase-3 and the cleavage of PARP-1 were markedly reduced in Ins-1E cells overexpressing PED/PEA-15 (Ins-1E(PED/PEA-15)). In parallel, we observed a decrease of the mRNA levels of pro-apoptotic genes Bcl-xS and Bad. In contrast, the expression of the anti-apoptotic gene Bcl-xL was enhanced. Accordingly, DNA fragmentation was higher in control cells compared to Ins-1E(PED/PEA-15) cells. Interestingly, the preincubation with propranolol, an inhibitor of the pathway of PLD-1, a known interactor of PED/PEA-15, responsible for its deleterious effects on glucose tolerance, abolishes the antiapoptotic effects of PED/PEA-15 overexpression in Ins-1E beta-cells. The same results have been obtained by inhibiting PED/PEA-15 interaction with PLD-1 in Ins-1E(PED/PEA-15). These results show that PED/PEA-15 overexpression is sufficient to block hydrogen peroxide-induced apoptosis in Ins-1E cells through a PLD-1 mediated mechanism.

  5. Finding Communities by Their Centers

    Science.gov (United States)

    Chen, Yan; Zhao, Pei; Li, Ping; Zhang, Kai; Zhang, Jie

    2016-04-01

    Detecting communities or clusters in a real-world, networked system is of considerable interest in various fields such as sociology, biology, physics, engineering science, and interdisciplinary subjects, with significant efforts devoted in recent years. Many existing algorithms are only designed to identify the composition of communities, but not the structures. Whereas we believe that the local structures of communities can also shed important light on their detection. In this work, we develop a simple yet effective approach that simultaneously uncovers communities and their centers. The idea is based on the premise that organization of a community generally can be viewed as a high-density node surrounded by neighbors with lower densities, and community centers reside far apart from each other. We propose so-called “community centrality” to quantify likelihood of a node being the community centers in such a landscape, and then propagate multiple, significant center likelihood throughout the network via a diffusion process. Our approach is an efficient linear algorithm, and has demonstrated superior performance on a wide spectrum of synthetic and real world networks especially those with sparse connections amongst the community centers.

  6. Center Innovation Fund: KSC CIF Program

    Data.gov (United States)

    National Aeronautics and Space Administration — Each individual NASA Center has full discretion on the use of the funds and the Center Chief Technologists coordinates a competitive process at their Center for the...

  7. RESPONSIBILITY CENTERS AND ENTITY BUDGETS

    Directory of Open Access Journals (Sweden)

    BÎRCĂ ALIONA

    2016-12-01

    Full Text Available The investigation on relationships between responsibility centers and budgets supposes examining the influence of management control over the entity management structures. Thus, responsibility centers help to streamline the management structure and ensure the implementation of the budget system into practice. Budgeting refers to the transformation of financial plans into monetary units. The pragmatic approach of the relationship between responsibility centers and budgets is analyzed on the basis of Romanian entities in the regulated market of the Bucharest Stock Exchange. The fact that entities which show the management structure and at the same time show the income and expense budget makes us claim that both have an important role to play in implementing the entity strategies.

  8. Self-Access Centers: Maximizing Learners’ Access to Center Resources

    Directory of Open Access Journals (Sweden)

    Mark W. Tanner

    2010-09-01

    Full Text Available Originally published in TESL-EJ March 2009, Volume 12, Number 4 (http://tesl-ej.org/ej48/a2.html. Reprinted with permission from the authors.Although some students have discovered how to use self-access centers effectively, the majority appear to be unaware of available resources. A website and database of materials were created to help students locate materials and use the Self-Access Study Center (SASC at Brigham Young University’s English Language Center (ELC more effectively. Students took two surveys regarding their use of the SASC. The first survey was given before the website and database were made available. A second survey was administered 12 weeks after students had been introduced to the resource. An analysis of the data shows that students tend to use SASC resources more autonomously as a result of having a web-based database. The survey results suggest that SAC managers can encourage more autonomous use of center materials by provided a website and database to help students find appropriate materials to use to learn English.

  9. NASA(Field Center Based) Technology Commercialization Centers

    Science.gov (United States)

    1995-01-01

    Under the direction of the IC(sup 2) Institute, the Johnson Technology Commercialization Center has met or exceeded all planned milestones and metrics during the first two and a half years of the NTCC program. The Center has established itself as an agent for technology transfer and economic development in- the Clear Lake community, and is positioned to continue as a stand-alone operation. This report presents data on the experimental JTCC program, including all objective measures tracked over its duration. While the metrics are all positive, the data indicates a shortage of NASA technologies with strong commercial potential, barriers to the identification and transfer of technologies which may have potential, and small financial return to NASA via royalty-bearing licenses. The Center has not yet reached the goal of self-sufficiency based on rental income, and remains dependent on NASA funding. The most important issues raised by the report are the need for broader and deeper community participation in the Center, technology sourcing beyond JSC, and the form of future funding which will be appropriate.

  10. User-centered agile method

    CERN Document Server

    Deuff, Dominique

    2013-01-01

    Agile development methods began to emerge around 20 years ago. However, it was not until the early 2000s that they began to be widely used in industry. This growth was often due to the advent of Internet services requiring faster cycles of development in order to heighten the rate at which an ever-greater number of functionalities were made available. In parallel, user-centered design (UCD) methods were also becoming more and more widely used: hence, user-centered design and agile methods were bound to cross paths, at least in the telecoms industry! During this period, in the field of telec

  11. Gliadin Fragments and a Specific Gliadin 33-mer Peptide Close KATP Channels and Induce Insulin Secretion in INS-1E Cells and Rat Islets of Langerhans

    DEFF Research Database (Denmark)

    Dall, Morten; Calloe, Kirstine; Haupt-Jorgensen, Martin

    2013-01-01

    In non-obese diabetic (NOD) mice, diabetes incidence is reduced by a gluten-free diet. Gluten peptides, such as the compound gliadin, can cross the intestinal barrier and may directly affect pancreatic beta cells. We investigated the effects of enzymatically-digested gliadin in NOD mice, INS-1E...

  12. A model for the parabolic slices Per1(e2πip/q) in moduli space of quadratic rational maps

    DEFF Research Database (Denmark)

    Uhre, Eva

    2010-01-01

    The notion of relatedness loci in the parabolic slices Per1(e2πip/q) in moduli space of quadratic rational maps is introduced. They are counterparts of the disconnectedness or escape locus in the slice of quadratic polynomials. A model for these loci is presented, and a strategy of proof of the f...

  13. Validation of the hepatocyte-like HPCT-1E3 cell line as an in vitro model for the prediction of acute in vivo toxicity.

    Science.gov (United States)

    Halwachs, Sandra; Lakoma, Cathleen; Honscha, Walther

    2013-11-01

    In a pilot study, we tested 20 randomly-selected chemicals for their cytotoxicity toward the HPCT-1E3 cell model, in order to prove the ability of this in vitro model to predict human acute in vivo toxicity. The study revealed that, in contrast to most other in vitro models, results from the HPCT-1E3 cell-based system show better correlation with the more-relevant human acute lethal doses, whereas results from most other systems have a high predictivity for human lethal serum concentrations. For the prevalidation of the HPCT-1E3 model as a surrogate for regulatory acute in vivo toxicity tests, we have now expanded the list of tested chemicals to 57 substances, and have compared the results with data from the HepG2 cell assay. Again, a better correlation of HPCT-1E3 IC50 values with human oral lethal doses, as compared to correlation with human lethal serum concentrations, was observed after the pooling of all the tested substances (r(2) = 0.53 [P in vivo toxicity tests.

  14. Evolutionary analysis of rubella viruses in mainland China during 2010-2012: endemic circulation of genotype 1E and introductions of genotype 2B.

    Science.gov (United States)

    Zhu, Zhen; Rivailler, Pierre; Abernathy, Emily; Cui, Aili; Zhang, Yan; Mao, Naiyin; Xu, Songtao; Zhou, Shujie; Lei, Yue; Wang, Yan; Zheng, Huanying; He, Jilan; Chen, Ying; Li, Chongshan; Bo, Fang; Zhao, Chunfang; Chen, Meng; Lu, Peishan; Li, Fangcai; Gu, Suyi; Gao, Hui; Guo, Yu; Chen, Hui; Feng, Daxing; Wang, Shuang; Tang, Xiaomin; Lei, Yake; Feng, Yan; Deng, Lili; Gong, Tian; Fan, Lixia; Xu, Wenbo; Icenogle, Joseph

    2015-01-23

    Rubella remains a significant burden in mainland China. In this report, 667 viruses collected in 24 of 31 provinces of mainland China during 2010-2012 were sequenced and analyzed, significantly extending previous reports on limited numbers of viruses collected before 2010. Only viruses of genotypes 1E and 2B were found. Genotype 1E viruses were found in all 24 provinces. Genotype 1E viruses were likely introduced into mainland China around 1997 and endemic transmission of primarily one lineage became established. Viruses reported here from 2010-2012 are largely in a single cluster within this lineage. Genotype 2B viruses were rarely detected in China prior to 2010. This report documents a previously undetected 2B lineage, which likely became endemic in eastern provinces of China between 2010 and 2012. Bayesian analyses were performed to estimate the evolutionary rates and dates of appearance of the genotype 1E and 2B viral linages in China. A skyline plot of viral population diversity did not provide evidence of reduction of diversity as a result of vaccination, but should be useful as a baseline for such reductions as vaccination programs for rubella become widespread in mainland China.

  15. Full-length human placental sFlt-1-e15a isoform induces distinct maternal phenotypes of preeclampsia in mice.

    Directory of Open Access Journals (Sweden)

    Gabor Szalai

    Full Text Available Most anti-angiogenic preeclampsia models in rodents utilized the overexpression of a truncated soluble fms-like tyrosine kinase-1 (sFlt-1 not expressed in any species. Other limitations of mouse preeclampsia models included stressful blood pressure measurements and the lack of postpartum monitoring. We aimed to 1 develop a mouse model of preeclampsia by administering the most abundant human placental sFlt-1 isoform (hsFlt-1-e15a in preeclampsia; 2 determine blood pressures in non-stressed conditions; and 3 develop a survival surgery that enables the collection of fetuses and placentas and postpartum (PP monitoring.Pregnancy status of CD-1 mice was evaluated with high-frequency ultrasound on gestational days (GD 6 and 7. Telemetry catheters were implanted in the carotid artery on GD7, and their positions were verified by ultrasound on GD13. Mice were injected through tail-vein with adenoviruses expressing hsFlt-1-e15a (n = 11 or green fluorescent protein (GFP; n = 9 on GD8/GD11. Placentas and pups were delivered by cesarean section on GD18 allowing PP monitoring. Urine samples were collected with cystocentesis on GD6/GD7, GD13, GD18, and PPD8, and albumin/creatinine ratios were determined. GFP and hsFlt-1-e15a expression profiles were determined by qRT-PCR. Aortic ring assays were performed to assess the effect of hsFlt-1-e15a on endothelia.Ultrasound predicted pregnancy on GD7 in 97% of cases. Cesarean section survival rate was 100%. Mean arterial blood pressure was higher in hsFlt-1-e15a-treated than in GFP-treated mice (∆MAP = 13.2 mmHg, p = 0.00107; GD18. Focal glomerular changes were found in hsFlt-1-e15a -treated mice, which had higher urine albumin/creatinine ratios than controls (109.3 ± 51.7 μg/mg vs. 19.3 ± 5.6 μg/mg, p = 4.4 x 10(-2; GD18. Aortic ring assays showed a 46% lesser microvessel outgrowth in hsFlt-1-e15a-treated than in GFP-treated mice (p = 1.2 x 10(-2. Placental and fetal weights did not differ between the groups

  16. Interaction of the amyloid precursor protein-like protein 1 (APLP1) E2 domain with heparan sulfate involves two distinct binding modes

    Energy Technology Data Exchange (ETDEWEB)

    Dahms, Sven O., E-mail: sdahms@fli-leibniz.de [Leibniz Institute for Age Research (FLI), Beutenbergstrasse 11, 07745 Jena (Germany); Mayer, Magnus C. [Freie Universität Berlin, Thielallee 63, 14195 Berlin (Germany); Miltenyi Biotec GmbH, Robert-Koch-Strasse 1, 17166 Teterow (Germany); Roeser, Dirk [Leibniz Institute for Age Research (FLI), Beutenbergstrasse 11, 07745 Jena (Germany); Multhaup, Gerd [McGill University Montreal, Montreal, Quebec H3G 1Y6 (Canada); Than, Manuel E., E-mail: sdahms@fli-leibniz.de [Leibniz Institute for Age Research (FLI), Beutenbergstrasse 11, 07745 Jena (Germany)

    2015-03-01

    Two X-ray structures of APLP1 E2 with and without a heparin dodecasaccharide are presented, revealing two distinct binding modes of the protein to heparan sulfate. The data provide a mechanistic explanation of how APP-like proteins bind to heparan sulfates and how they specifically recognize nonreducing structures of heparan sulfates. Beyond the pathology of Alzheimer’s disease, the members of the amyloid precursor protein (APP) family are essential for neuronal development and cell homeostasis in mammals. APP and its paralogues APP-like protein 1 (APLP1) and APP-like protein 2 (APLP2) contain the highly conserved heparan sulfate (HS) binding domain E2, which effects various (patho)physiological functions. Here, two crystal structures of the E2 domain of APLP1 are presented in the apo form and in complex with a heparin dodecasaccharide at 2.5 Å resolution. The apo structure of APLP1 E2 revealed an unfolded and hence flexible N-terminal helix αA. The (APLP1 E2){sub 2}–(heparin){sub 2} complex structure revealed two distinct binding modes, with APLP1 E2 explicitly recognizing the heparin terminus but also interacting with a continuous heparin chain. The latter only requires a certain register of the sugar moieties that fits to a positively charged surface patch and contributes to the general heparin-binding capability of APP-family proteins. Terminal binding of APLP1 E2 to heparin specifically involves a structure of the nonreducing end that is very similar to heparanase-processed HS chains. These data reveal a conserved mechanism for the binding of APP-family proteins to HS and imply a specific regulatory role of HS modifications in the biology of APP and APP-like proteins.

  17. Orexin A modulates INS-1E cell proliferation and insulin secretion via extracellular signal-regulated kinase and transient receptor potential channels.

    Science.gov (United States)

    Skrzypski, M; Khajavi, N; Mergler, S; Billert, M; Szczepankiewicz, D; Wojciechowicz, T; Nowak, K W; Strowski, M Z

    2016-10-01

    Orexins A (OXA) and B (OXB) control energy homeostasis by regulating food intake, energy expenditure and sleep-wake cycle. Several studies showed that OXA stimulates insulin secretion and proliferation of beta cells. However, mechanisms of action are still not well understood. Here, we investigated whether ERK and transient receptor potential channels (TRPs) play a role in mediating the effect of OXA on cell growth, insulin production, and secretion using the established INS-1E cell line. Cell proliferation was measured using BrdU assay. Insulin mRNA expression was detected by real-time PCR. Insulin secretion was assessed using ELISA. Intracellular calcium levels were measured using fluorescence calcium imaging (fura-2/AM). Extracellular signal-regulated kinase 1/2 (ERK1/2) phosphorylation was detected by Western blot. TRP channel activity was blocked by lanthanum (III) chloride (La(3+); 100 - 300 μM) or ruthenium red (RuR; 10 μM). OXA (100 nM) stimulated INS-1E cell proliferation, insulin secretion, intracellular Ca(2+) concentration and ERK1/2 phosphorylation, without changing insulin mRNA expression. Inhibition of ERK1/2 by 10 μM U0126 attenuated OXA-stimulated INS-1E cell proliferation. Blockade of TRP channel activity by La(3+) or RuR rendered OXA ineffective at modulating Ca(2+) regulation and insulin release. In contrast, the L-type channel blocker nifedipine (10 μM) failed to affect OXA-stimulated insulin release. Taken together, OXA increases INS-1E cell proliferation via ERK1/2-dependent mechanism. Furthermore, OXA stimulates insulin secretion from INS-1E cells. TRPs are relevant for OXA-stimulated insulin secretion and intracellular calcium regulation.

  18. New center for IT research

    Directory of Open Access Journals (Sweden)

    Larry R Dalton

    2002-09-01

    The motivation for creating such a center is quite obvious. Despite the ‘dot com’ crash, IT continues to be the fastest growing and dominant component of world economy. Computing power and the ability to rapidly move information around the world are, of course, important drivers of that IT economy.

  19. Center for Intelligent Control Systems

    Science.gov (United States)

    1992-12-01

    CENTER FOR INTELLIGENT CONTROL SYSTEMS Brown Umiversity Harvard University Marsachomtta Institute of Tecnology PUBLICATIONS LIST CICS Number Authors...Equivalence of the Auction Algorithm for 11/1/92 Assignment and die e-Relaxation (Preflow- Push ) Method for Min Cost Flow 26

  20. Financial Management in Imaging Center

    Directory of Open Access Journals (Sweden)

    Arash Deljou

    2009-01-01

    Full Text Available "nIn this article, we provide a brief overview of the three main financial statements: income statement, balance sheet, and statement of cash flows, and we discuss the major landmarks in each. We discuss financial ratios and other measures of performance that radiologists and CFOs of radiology department can use to detect problems and isolate their root cause. "nInterest rates are a factor in a number of decisions (more specifically in an inflated economy, including the required rate of return on a new diagnostic imaging center, expansion, refinancing, lease versus buy decisions, and others. We discuss the factors that cause interest rates to rise or fall and what can be done about them. "nWhen considering the development of a new diagnostic imaging center, one of the key factors that a financing source, manufacturer-based, independent bank, or other third party, considers is how much cash equity the owners are putting into the project. They want to know this answer for a variety of reasons and will analyze the answer in a few different ways. "nDiagnostic imaging center equity is usually defined as the amount of cash required to get the center up and running, and until it begins to cash flow positively on its own. The art of determining equity comes from a couple of factors and from the early stages of the development of a project.  

  1. Kepler Science Operations Center Architecture

    Science.gov (United States)

    Middour, Christopher; Klaus, Todd; Jenkins, Jon; Pletcher, David; Cote, Miles; Chandrasekaran, Hema; Wohler, Bill; Girouard, Forrest; Gunter, Jay P.; Uddin, Kamal; Allen, Christopher; Hall, Jennifer; Ibrahim, Khadeejah; Clarke, Bruce; Li, Jie; McCauliff, Sean; Quintana, Elisa; Sommers, Jeneen; Stroozas, Brett; Tenenbaum, Peter; Twicken, Joseph; Wu, Hayley; Caldwell, Doug; Bryson, Stephen; Bhavsar,Paresh

    2010-01-01

    We give an overview of the operational concepts and architecture of the Kepler Science Data Pipeline. Designed, developed, operated, and maintained by the Science Operations Center (SOC) at NASA Ames Research Center, the Kepler Science Data Pipeline is central element of the Kepler Ground Data System. The SOC charter is to analyze stellar photometric data from the Kepler spacecraft and report results to the Kepler Science Office for further analysis. We describe how this is accomplished via the Kepler Science Data Pipeline, including the hardware infrastructure, scientific algorithms, and operational procedures. The SOC consists of an office at Ames Research Center, software development and operations departments, and a data center that hosts the computers required to perform data analysis. We discuss the high-performance, parallel computing software modules of the Kepler Science Data Pipeline that perform transit photometry, pixel-level calibration, systematic error-correction, attitude determination, stellar target management, and instrument characterization. We explain how data processing environments are divided to support operational processing and test needs. We explain the operational timelines for data processing and the data constructs that flow into the Kepler Science Data Pipeline.

  2. The DLESE Community Services Center

    Science.gov (United States)

    Geary, E.; Aivazian, B.; Manduca, C.; Mogk, D.

    2003-12-01

    The DLESE Community Services Center (DCSC) is one of several centers recently funded by the National Science Foundation to promote greater and more effective use of Digital Library resources. The primary goals of the DCSC are to: (1) increase the current resource user and contributor base to include greater numbers of K-12, informal, and college educators and students, (2) diversify the DLESE user and contributor base to include rich and robust representation of ethnic, cultural, and differently-abled groups, (3) improve the ability of users and contributors to easily find, adapt, and use high quality digital resources in their classrooms, laboratories, and communities and (4) demonstrate how DLESE can support community activity addressing issues in geoscience education. During the course of the next three years we will: (a) solicit, create, and disseminate "exemplars" that highlight effective digital resource use in a variety of diverse educational settings, (b) continue to support and promote on-line DLESE community services, and (c) work to develop a DLESE ambassadors outreach program involving educators, scientists, and students working across the Earth, space, and environmental sciences. Collaborations with the DLESE Evaluation and Data Centers, collection builders, the DLESE Program Center staff, as well as diverse audience groups will be a key focus of our efforts. We invite you to join us as we work to build and support the next generation of digital services and resources for educators and students at all levels.

  3. Kempinski Hotel Beijing Lufthansa Center

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    A shining star on the eastern part of Beijing Kempinski Hotel Beijing Lufthansa Center is located at the heart of the city, a fully integrated business complex with serviced apartments, top-class offices and showrooms. The hotel offers unrivaled conference, business and leisure facilities ideal for business travelers and leisure guests alike. Its impressive blend of grand Chinese cul-

  4. VMware vCenter cookbook

    CERN Document Server

    Kuminsky, Konstantin

    2015-01-01

    If you are a system administrator who has some experience with virtualization and already uses VMware vCenter, but wishes to learn more, then this is the book for you. If you are looking for tips or shortcuts for common administration tasks as well as workarounds for pain points in vSphere administration, you'll find this guide useful.

  5. The Mud Center: Recapturing Childhood.

    Science.gov (United States)

    Jensen, Becky J.; Bullard, Julie A.

    2002-01-01

    Describes a Montana child development center's creation of an area in which children could enjoy messy, creative, sensory experiences playing with mud and a wide variety of outdoor props. Discusses how mud play contributed to young children's emerging interests and provided opportunities for expressing creativity, enhancing fine motor skills, and…

  6. An International Development Technology Center

    Science.gov (United States)

    Morgan, Robert P.

    1969-01-01

    Main focus of the Center is "the application of science and technology to the solution of problems faced by people in less-developed areas of the world. Adapted from paper presented at ASEE Annual Meeting, The Pennsylvania State University, June, 1969. (Author/WM)

  7. ITMO Photonics: center of excellence

    Science.gov (United States)

    Voznesenskaya, Anna; Bougrov, Vladislav; Kozlov, Sergey; Vasilev, Vladimir

    2016-09-01

    ITMO University, the leading Russian center in photonics research and education, has the mission to train highlyqualified competitive professionals able to act in conditions of fast-changing world. This paradigm is implemented through creation of a strategic academic unit ITMO Photonics, the center of excellence concentrating organizational, scientific, educational, financial, laboratory and human resources. This Center has the following features: dissemination of breakthrough scientific results in photonics such as advanced photonic materials, ultrafast optical and quantum information, laser physics, engineering and technologies, into undergraduate and graduate educational programs through including special modules into the curricula and considerable student's research and internships; transformation of the educational process in accordance with the best international educational practices, presence in the global education market in the form of joint educational programs with leading universities, i.e. those being included in the network programs of international scientific cooperation, and international accreditation of educational programs; development of mechanisms for the commercialization of innovative products - results of scientific research; securing financial sustainability of research in the field of photonics of informationcommunication systems via funding increase and the diversification of funding sources. Along with focusing on the research promotion, the Center is involved in science popularization through such projects as career guidance for high school students; interaction between student's chapters of international optical societies; invited lectures of World-famous experts in photonics; short educational programs in optics, photonics and light engineering for international students; contests, Olympics and grants for talented young researchers; social events; interactive demonstrations.

  8. Directory of Manufacturing Research Centers

    Science.gov (United States)

    1989-06-01

    L. Lehn P. Klinefelter A DoD Information Analysis Center UNCLASSIFIED ECURITY CLASSIFICATION OF THIS PAGE REPORT DOCUMENTATION PAGE a. REPORT...in R&D, industrial innovation case histories , and managing innovation. Industry recognizes that research and development are indispensable to the

  9. Adult Learning Center Curriculum Activities.

    Science.gov (United States)

    City Univ. of New York, Bronx. Herbert H. Lehman Coll. Inst. for Literacy Studies.

    These curriculum materials were collected from teachers in the Lehman College Adult Learning Center (New York). They include various activities and resources, such as a series of questions about the aims of teaching adults, a list of sources for adult basic education (ABE) materials, poems, and autobiographical materials. Teaching suggestions and…

  10. Center for electron nanoscopy, DTU

    DEFF Research Database (Denmark)

    Horsewell, Andy; Somers, Marcel A. J.; Chorkendorff, Ib

    2006-01-01

    DTU has been given[1] the opportunity to create a world-class facility with a unique suite of 8 electron microscopes, preparation equipment and facilities for image analysis and interpretation; all to be placed in a purpose-built building. This opportunity comes at the beginning of a new era...... in which several dramatic advances have recently taken place on two fronts. The first is in the field of transmission electron microscopy, TEM: I) As a result of Cs correction and monochromators, high resolution TEM can achieve spatial resolutions of 0.7Å and spectroscopy resolutions of 0.1eV; II) Using...... front is in the field of scanning electron microscopy, SEM, which has already seen major advances due to field emission electron guns, FEG: I) Adding a focussed ion beam, so that specimen surface layers can be removed by controlled sputtering, a dual-beam FEGSEM FIB allows reconstruction...

  11. What Is A Teacher Education Center?

    Science.gov (United States)

    O'Gorman, David E.

    The introductory portion of this report defines teacher education centers and briefly describes their developmental continuum. A synthesis of documents concerning student teaching and teacher education centers is followed by a list of features differentiating conventional programs, student teaching centers, and teacher education centers.…

  12. Counseling Services in Adult Day Care Centers.

    Science.gov (United States)

    Zaki, Gamal; Zaki, Sylvia

    Federal support for adult day care centers began in the United States approximately 10 years ago. To examine the counseling practices in the adult day care centers across the country and to explore how the services are affected by the staffing patterns at these centers, 135 centers completed a questionnaire. The questionnaire addressed…

  13. The Peculiar Galactic Center Neutron Star X-Ray Binary XMM J174457-2850.3

    Science.gov (United States)

    Degenaar, N.; Wijnands, R.; Reynolds, M. T.; Miller, J. M.; Altamirano, D.; Kennea, J.; Gehrels, N.; Haggard, D.; Ponti, G.

    2014-01-01

    The recent discovery of a milli-second radio pulsar experiencing an accretion outburst similar to those seen in low mass X-ray binaries, has opened up a new opportunity to investigate the evolutionary link between these two different neutron star manifestations. The remarkable X-ray variability and hard X-ray spectrum of this object can potentially serve as a template to search for other X-ray binary radio pulsar transitional objects. Here we demonstrate that the transient X-ray source XMM J174457-2850.3 near the Galactic center displays similar X-ray properties. We report on the detection of an energetic thermonuclear burst with an estimated duration of 2 hr and a radiated energy output of 5E40 erg, which unambiguously demonstrates that the source harbors an accreting neutron star. It has a quiescent X-ray luminosity of Lx5E32 ergs and exhibits occasional accretion outbursts during which it brightens to Lx1E35-1E36 ergs for a few weeks (2-10 keV). However, the source often lingers in between outburst and quiescence at Lx1E33-1E34 ergs. This unusual X-ray flux behavior and its relatively hard X-ray spectrum, a power law with an index of 1.4, could possibly be explained in terms of the interaction between the accretion flow and the magnetic field of the neutron star.

  14. Vitamin C Inhibits Benzo[a]pyrene-lnduced Cell Cycle Changes Partly via Cyclin D1/ E2F Pathway in Human Embryo Lung Fibroblasts

    Institute of Scientific and Technical Information of China (English)

    AI GAO; BING-CI LIU; XIANG-LIN SHI; CHUAN-SHU HUANG; XIAO-WEI JLA; BAO-RONG YOU; MENG YE; FU-HAI SHEN; HONG-JU DU

    2006-01-01

    Objective To study the molecular mechanism of the inhibitory effects of vitamin C on benzo[a]pyrene (B[a]P)-induced changes of cell cycle in human embryo lung fibroblast (HELF) cells. Methods The stable transfectants, HELF transfected with antisense cyclin D1 and antisense CDK4, were established. Cells were cultured and pretreated with vitamin C before stimulation with B[a]P for 24 h. The expression levels of cyclin D1, CDK4, E2F1, and E2F4 were determined by Western blot. Flow cytometric analysis was employed to detect the distributions of cell cycle. Results B[a]P significantly elevated the expression levels of cyclin D1, E2F1, and E2F4 in HELF cells. Vitamin C decreased the expression levels of cyclin D1, E2F1, and E2F4 in B[a]P-stimulated HELF cells. Dose-dependent relationships were not found between the different concentrations of vitamin C (10, 100, 500, 1000, and 5000 μmol/L) and the expression levels of cyclin D1, E2F1, and E2F4 in HELF cells. The expression levels of cyclin D1, E2F1, and E2F4 in B[a]P-treated transfectants were lower than those in B[a]P-treated HELF cells. The expression levels of cyclin D1 and E2F4 treated with vitamin C and antisense cyclin D1 were decreased compared with those treated with antisense cyclin D1 alone. The effects of vitamin C combined with antisense CDK4 on the expression levels of cyclin D1 and E2F1/E2F4 were similar to those of antisense CDK4 alone. B[a]P progressed HELF cells from G1 to S phase. Both vitamin C and antisense cyclin D1 suppressed the changes of cell cycle progressed by B[a]P. However, antisenseCDK4 did not attenuate the above changes. Vitamin C combined with antisense CDK4 markedly suppressed B[a]P-induced changes of cell cycle as compared with antisense CDK4. But the inhibitory effects of vitamin C combined with antisense cyclin D1 on B[a]P-induced changes of cell cycle were similar to those of vitamin C alone or antisense cyclin D1 alone. Conclusions B[a]P progressed HELF cells from G1 to S phase via

  15. Advanced Call Center Supporting WAP Access

    Institute of Scientific and Technical Information of China (English)

    YUANXiao-hua; CHENJun-liang

    2001-01-01

    Traditional call centers can be accessed via speech only, and the call center based on web provides both da-ta and speech access,but it needs a powerful terminal-computer.By analyzing traditional call centers and call cen-ters based on web, this paper presents the framework of an advanced call center supporting WAP access.A typical service is also described in detail.

  16. Jellyfish: Networking Data Centers Randomly

    CERN Document Server

    Singla, Ankit; Popa, Lucian; Godfrey, P Brighten

    2011-01-01

    Industry experience indicates that the ability to incrementally expand data centers is essential. However, existing high-bandwidth network designs have rigid structure that interferes with incremental expansion. We present Jellyfish, a high-capacity network interconnect, which, by adopting a random graph topology, yields itself naturally to incremental expansion. Somewhat surprisingly, Jellyfish is more cost-efficient than a fat-tree: A Jellyfish interconnect built using the same equipment as a fat-tree, supports as many as 25% more servers at full capacity at the scale of a few thousand nodes, and this advantage improves with scale. Jellyfish also allows great flexibility in building networks with different degrees of oversubscription. However, Jellyfish's unstructured design brings new challenges in routing, physical layout, and wiring. We describe and evaluate approaches that resolve these challenges effectively, indicating that Jellyfish could be deployed in today's data centers.

  17. Rolex learning center English guide

    CERN Document Server

    Della Casa, Francesco

    2012-01-01

    The novel architectural form of this building, conceived of by the architects of SAANA (winners of the Pritzker Prize in 2010), compelled the building engineers to come up with unprecedented structural, technical and logistical solutions. And yet, once the Rolex Learning Center was complete, the ingenuity required for its construction had become practically invisible in the eyes of the uninitiated. This richly illustrated guide provides, in condensed form, an account of the extraordinary adventure of the realization of the Rolex Learning Center. It explains in detail the context of its construction and brings to light the spatial subtleties of its architecture. In addition, it provides the visitor of the building with all the needed technical information and many novel facts and figures.

  18. The Fermilab Particle Astrophysics Center

    Energy Technology Data Exchange (ETDEWEB)

    2004-11-01

    The Particle Astrophysics Center was established in fall of 2004. Fermilab director Michael S. Witherell has named Fermilab cosmologist Edward ''Rocky'' Kolb as its first director. The Center will function as an intellectual focus for particle astrophysics at Fermilab, bringing together the Theoretical and Experimental Astrophysics Groups. It also encompasses existing astrophysics projects, including the Sloan Digital Sky Survey, the Cryogenic Dark Matter Search, and the Pierre Auger Cosmic Ray Observatory, as well as proposed projects, including the SuperNova Acceleration Probe to study dark energy as part of the Joint Dark Energy Mission, and the ground-based Dark Energy Survey aimed at measuring the dark energy equation of state.

  19. Learning System Center App Controller

    CERN Document Server

    Naeem, Nasir

    2015-01-01

    This book is intended for IT professionals working with Hyper-V, Azure cloud, VMM, and private cloud technologies who are looking for a quick way to get up and running with System Center 2012 R2 App Controller. To get the most out of this book, you should be familiar with Microsoft Hyper-V technology. Knowledge of Virtual Machine Manager is helpful but not mandatory.

  20. World Reference Center for Arboviruses.

    Science.gov (United States)

    1985-01-01

    viruses from many parts of the world. 7 %, 1.1%vl ’ e- "., Distribution of reagents. The reference center distributed 970 ampoules of reference sera...eight pools of Culiseta melanura collected during 1984 as part of a field study on Lyme disease and other zoonoses in Connecticut. A ninth strain was...dense amorphous masses, were present also in the cytoplasm. Smooth-surfaced reticula occurred in the cytoplasm and contained viral particles in

  1. The Fort Collins Science Center

    Science.gov (United States)

    Wilson, Juliette T.; Banowetz, Michele M.

    2012-01-01

    With a focus on biological research, the U.S. Geological Survey Fort Collins Science Center (FORT) develops and disseminates science-based information and tools to support natural resource decision-making. This brochure succinctly describes the integrated science capabilities, products, and services that the FORT science community offers across the disciplines of aquatic systems, ecosystem dynamics, information science, invasive species science, policy analysis and social science assistance, and trust species and habitats.

  2. NCI Technology Transfer Center | TTC

    Science.gov (United States)

    The National Cancer Institute’s Technology Transfer Center (TTC) facilitates partnerships between the NIH research laboratories and external partners. With specialized teams, TTC guides the interactions of our partners from the point of discovery to patenting, from invention development to licensing. We play a key role in helping to accelerate development of cutting-edge research by connecting our partners to NIH’s world-class researchers, facilities, and knowledge.

  3. The Scientific Data Management Center

    OpenAIRE

    Shoshani, Arie

    2006-01-01

    With the increasing volume and complexity of data produced by ultra-scale simulations and high-throughput experiments, understanding the science is largely hampered by the lack of comprehensive, end-to-end data management solutions ranging from initial data acquisition to final analysis and visualization. The Scientific Data Management (SDM) Center is bringing a set of advanced data management technologies to DOE scientists in various application domains including astrophysics, climate, ...

  4. Drinfeld center of planar algebra

    CERN Document Server

    Das, Paramita; Gupta, Ved Prakash

    2012-01-01

    We introduce fusion and contragadient of affine representations of a planar algebra $P$ (not necessarily having finite depth). We prove that if $N \\subset M$ is a subfactor realization of $P$, then the Drinfeld center of the $N$-$N$-bimodule category generated by $_N L^2 (M)_M$, is equivalent to the category Hilbert affine representations of $P$ satisfying certain finiteness criterion. As a consequence, we prove Kevin Walker's conjecture for planar algebras.

  5. Center for Advanced Propulsion Systems

    Science.gov (United States)

    1993-02-01

    compression ignition ( HCCI ) combustion using the CFR engine described earlier (see Fig. 7.3.5 and Table 7.3.2). The concept of these first experiments was...model of Yang and Martin (1990) can give very good results when applied to either motored, HCCI , or HCSI engines for cases with small pressure...ORGANIZATION NAME(S) AND ADDRESS(ES) 8. PERFORMING ORGANIZATION Engine Research Center REPORT NUMBER University of Wisconsin - Madison 1500 Johnson Drive

  6. Clean Energy Solutions Center (Presentation)

    Energy Technology Data Exchange (ETDEWEB)

    Reategui, S.

    2012-07-01

    The Clean Energy Ministerial launched the Clean Energy Solutions Center in April, 2011 for major economy countries, led by Australia and U.S. with other CEM partners. Partnership with UN-Energy is extending scope to support all developing countries: 1. Enhance resources on policies relating to energy access, small to medium enterprises (SMEs), and financing programs; 2. Offer expert policy assistance to all countries; 3. Expand peer to peer learning, training, and deployment and policy data for developing countries.

  7. A Hybrid Spin-Down Model and its Application to the Radio Quiet X-Ray Pulsar 1E 1207.4-5209

    Institute of Scientific and Technical Information of China (English)

    张灵娣; 彭秋和; 罗新炼

    2003-01-01

    A series of newly published papers are focusing on the formation of the absorption features discovered by Chandra and XMM-Newton from the young radio quiet x-ray pulsar 1E 1207.4-5209. We try to interpret it as cyclotron absorption lines since this possibility could not be ruled out. With new development and application of a hybrid model, i.e., the magnetic dipole spin-down model combined with the neutrino cyclotron radiation spin-down model, we can easily avoid the contradiction between the normal rotation energy loss rate and the relatively lower magnetic field, and then we obtain the possible initial spin period (~0.420s). We suppose that the progenitor of 1E 1207.4-5209 may be a white dwarf.

  8. Burst and Persistent Emission Properties during the Recent Active Episode of the Anomalous X-ray Pulsar 1E 1841-045

    CERN Document Server

    Lin, Lin; Gogus, Ersin; van der Horst, Alexander J; Watts, Anna L; Baring, Matthew G; Kaneko, Yuki; Wijers, Ralph A M J; Woods, Peter M; Barthelmy, Scott; Burgess, J Michael; Chaplin, Vandiver; Gehrels, Neil; Goldstein, Adam; Granot, Jonathan; Guiriec, Sylvain; Mcenery, Julie; Preece, Robert D; Tierney, David; van der Klis, Michiel; von Kienlin, Andreas; Zhang, Shuang Nan

    2011-01-01

    Swift/BAT detected the first burst from 1E 1841-045 in May 2010 with intermittent burst activity recorded through at least July 2011. Here we present Swift and Fermi/GBM observations of this burst activity and search for correlated changes to the persistent X-ray emission of the source. The T90 durations of the bursts range between 18-140 ms, comparable to other magnetar burst durations, while the energy released in each burst ranges between (0.8 - 25)E38 erg, which is in the low side of SGR bursts. We find that the bursting activity did not have a significant effect on the persistent flux level of the source. We argue that the mechanism leading to this sporadic burst activity in 1E 1841-045 might not involve large scale restructuring (either crustal or magnetospheric) as seen in other magnetar sources.

  9. 17 CFR 240.15c3-1e - Deductions for market and credit risk for certain brokers or dealers (Appendix E to 17 CFR 240...

    Science.gov (United States)

    2010-04-01

    ... credit risk for certain brokers or dealers (Appendix E to 17 CFR 240.15c3-1). 240.15c3-1e Section 240....15c3-1(c)(2)(vi) and (c)(2)(vii) and to compute deductions for credit risk pursuant to this Appendix E... the broker or dealer will use to calculate deductions for market and credit risk on those...

  10. Effects of Hyperglycemia on Angiotensin II Receptor Type 1 Expression and Insulin Secretion in an INS-1E Pancreatic Beta-Cell Line

    Directory of Open Access Journals (Sweden)

    Kwan Keung Leung

    2008-05-01

    Full Text Available Context A local pancreatic islet renin-angiotensin system has been identified and found to be upregulated in type 2 diabetes mellitus. Inhibition of this system improves beta-cell function and structure. The effects of hyperglycemia, a condition observed in diabetes, on angiotensin II type 1 receptor (AT1R expression and beta-cell secretory function have yet to be explored. Objective This study investigated the effects of chronic hyperglycemia (glucotoxicity on the expression of AT1Rs, and possibly thereby on oxidative stress-induced insulin release, in an INS-1E beta-cell line. Settings INS-1E beta-cells cultured and incubated in different glucose concentrations with a varying time course. Main outcome measures Immunocytochemistry was employed for the precise localization of AT1Rs in INS-1E cells. The effects of hyperglycemia-induced AT1R expression changes in gene and protein levels were examined by real-time RT-PCR and Western blot analysis, respectively. AT1R activation-mediated oxidative stress was assessed by changes in NADPH oxidase expression, and the level of superoxide production was determined by nitroblue tetrazolium (NBT assay. Glucotoxicity-induced AT1R activation- mediated secretory dysfunction was also assessed by insulin release from INS-1E cells Results AT1R immunoreactivity was found to be localized specifically on the cell membrane. Chronic hyperglycemia resulted in dose-dependent upregulation of AT1R gene and protein expression accompanied by concomitantly-enhanced oxidative stress. Glucose-stimulated insulin secretion via AT1R activation was impaired by hyperglycemia. Conclusion These data indicate that hyperglycemia-induced AT1R activation impairs insulin secretion; this impairment may be mediated via AT1R-dependent oxidative stress.

  11. A ultra-sonografia do pâncreas é eficaz em diagnosticar o diabete melito tipo 1 e tipo 2?

    Directory of Open Access Journals (Sweden)

    Pimenta Walkyria de Paula

    2002-01-01

    Full Text Available Este trabalho foi realizado para verificar se a ultra-sonografia do pâncreas oferece dados auxiliares na classificação de diabéticos adultos dos tipos 1 e 2. O tamanho e a ecogenicidade do pâncreas foram determinados pela ultra-sonografia em 81 diabéticos, sendo 20 do tipo 1 e 61 do tipo 2 (53 obesos e oito não-obesos. Os pacientes tipo 2 obesos diferiram dos demais por apresentarem área total e diâmetro ântero-posterior do corpo do pâncreas significativamente maiores. Quanto à ecogenicidade pancreática, esta estava aumentada com maior freqüência nos diabéticos tipo 2 obesos que nos diabéticos tipo 1. Consideramos, assim, que a ultra-sonografia do pâncreas constitui metodologia auxiliar na classificação de diabéticos entre os tipo 1 e 2, sendo menos eficaz quando os últimos não são obesos.

  12. Geniposide protects pancreatic INS-1E β cells from hIAPP-induced cell damage: potential involvement of insulin degrading-enzyme.

    Science.gov (United States)

    Zhang, Yonglan; Yin, Fei; Liu, Jianhui; Wang, Yanwen

    2015-04-01

    Islet amyloid deposition is increasingly seen as a pathogenic feature of type 2 diabetes mellitus (T2DM), with the deposits containing the unique amyloidogenic peptide islet amyloid polypeptide (IAPP, also known as amylin). The fibril precursors of IAPP contribute to its cytotoxicity on pancreatic β cells and be important in causing β-cell dysfunction in T2DM. However, the development of effective this study, inhibitors against the toxicity of IAPP has been extremely challenging. We have found that pre-incubation with geniposide dose-dependently prevented human IAPP (hIAPP)-induced cell damage in INS-1E cells, and bacitracin, an inhibitor of IDE activity, prevented significantly the protective effects of geniposide in pancreatic INS-1E cells significantly. Geniposide induced the expression of insulin-degrading enzyme (IDE), a key degrading protein of hIAPP, but had no significant effect on the aggregation of hIAPP. These findings indicate that geniposide prevents hIAPP-induced cytotoxicity in INS-1E cells involving upregulation of IDE expression.

  13. Precise Localization of the Soft Gamma Repeater SGR 1627-41 with Chandra and the Anomalous X-Ray Pulsar AXP 1E1841-045 with Chandra

    Science.gov (United States)

    Wachter, Stefanie; Patel, Sandeep K.; Kouveliotou, Chryssa; Bouchet, Patrice; Ozel, Feryal; Tennant, Allyn F.; Woods, Peter M.; Hurley, Kevin; Becker, Werner; Slane, Patrick

    2004-01-01

    We present precise localizations of AXP 1E184-045 and SGR 1627-41 with Chandra. We obtained new infrared observations of SGR 1627-41 and reanalyzed archival observations of AXP 1E1841-045 in order to refine their positions and search for infrared counterparts. A faint source is detected inside the error circle of AXP 1E1841-045. In the case of SGR 1627-41, several sources are located within the error radius of the X-ray position, and we discuss the likelihood of one of them being the counterpart. We compare the properties of our candidates to those of other known anomalous X-ray pulsar (AXP) and soft gamma repeater (SGR) counterparts. We find that the counterpart candidates for SGR 1627-41 and SGR 1806-20 would have to be intrinsically much brighter than AXPs in order to have counterparts detectable with the observational limits currently available for these sources. To confirm the reported counterpart of SGR 1806-20, we obtained new infrared observations during the 2003 July burst activation of the source. No brightening of the suggested counterpart is detected, implying that the counterpart of SGR 1806-20 remains yet to be identified.

  14. Boosting of synaptic potentials and spine Ca transients by the peptide toxin SNX-482 requires alpha-1E-encoded voltage-gated Ca channels.

    Directory of Open Access Journals (Sweden)

    Andrew J Giessel

    Full Text Available The majority of glutamatergic synapses formed onto principal neurons of the mammalian central nervous system are associated with dendritic spines. Spines are tiny protuberances that house the proteins that mediate the response of the postsynaptic cell to the presynaptic release of glutamate. Postsynaptic signals are regulated by an ion channel signaling cascade that is active in individual dendritic spines and involves voltage-gated calcium (Ca channels, small conductance (SK-type Ca-activated potassium channels, and NMDA-type glutamate receptors. Pharmacological studies using the toxin SNX-482 indicated that the voltage-gated Ca channels that signal within spines to open SK channels belong to the class Ca(V2.3, which is encoded by the Alpha-1E pore-forming subunit. In order to specifically test this conclusion, we examined the effects of SNX-482 on synaptic signals in acute hippocampal slices from knock-out mice lacking the Alpha-1E gene. We find that in these mice, application of SNX-482 has no effect on glutamate-uncaging evoked synaptic potentials and Ca influx, indicating that that SNX-482 indeed acts via the Alpha-1E-encoded Ca(V2.3 channel.

  15. Designing of 1 eV GaNAs/GaInAs superlattice subcell in current-matched four-junction solar cell

    Science.gov (United States)

    Haixiao, Wang; Xinhe, Zheng; Xingyuan, Gan; Naiming, Wang; Hui, Yang

    2016-01-01

    A reasonably-thick GaNAs/GaInAs superlattice could be an option as a roughly 1 eV subcell to achieve high-efficiency multi-junction solar cells on a lattice-matched Ge substrate. A detailed consideration of a high-efficiency design for a GaInP/GaAs/1 eV/Ge device is presented. Calculations have been done for this structure to obtain the confined energies of the electrons and holes by utilizing the Kronig-Penney model, as well as the absorption coefficient and thereby the external quantum efficiency. The effect of well layers, GaNAs or GaInAs, on the absorption and photocurrent density under the AM 1.5 condition is discussed in order to realize a requirement of current matching in the four-junction solar cells. The management of these considerations implies the feasibility of the GaNAs/GaInAs superlattice subcell design to improve the overall conversion efficiency of lattice matched GaInP/GaAs/1 eV/Ge cells. Project supported by the National Natural Science Foundation of China (No. 61274134) and the International Cooperation Program of Suzhou, China (No. SH201215).

  16. Comparison of osteogenic potentials of human rat BMP4 and BMP6 gene therapy using [E1-] and [E1-,E2b-] adenoviral vectors

    Directory of Open Access Journals (Sweden)

    Hongwei Li, Jin Zhong Li, Debra D. Pittman, Andy Amalfitano, Gerald R. Hankins, Gregory A. Helm

    2006-01-01

    Full Text Available Osteogenic potentials of some recombinant human bone morphogenetic protein (BMP first-generation adenoviral vectors (ADhBMPs are significantly limited in immunocompetent animals. It is unclear what role expression of viral proteins and foreign proteins transduced by adenoviral vectors play in the host immune response and in ectopic bone formation. In this study two sets of experiments were designed and performed. First, rat BMP6 cDNA were amplified, sequenced, and recombined in first-generation adenoviral vector (ADrBMP6. A comparison of human and rat BMP6 adenoviral vectors demonstrated identical osteogenic activities in both immunodeficient and immunocompetent rats. Second, the activities of recombinant human BMP6 in E1- (ADhBMP6 and [E1-,E2b-] ( [E1-,E2b-]ADGFP&hBMP6, and [E1-,E2b-]ADhBMP6 adenoviral vectors were compared in both in vitro and in vivo models. Similar activities of these two generations of BMP adenoviral vectors were found in all models. These results indicate that the amount of viral gene expression and the source of the BMP cDNA are not major factors in the interruption of osteogenic potentials of recombinant BMP6 adenoviral vectors in immunocompetent animals.

  17. A ultra-sonografia do pâncreas é eficaz em diagnosticar o diabete melito tipo 1 e tipo 2?

    Directory of Open Access Journals (Sweden)

    Walkyria de Paula Pimenta

    2002-07-01

    Full Text Available Este trabalho foi realizado para verificar se a ultra-sonografia do pâncreas oferece dados auxiliares na classificação de diabéticos adultos dos tipos 1 e 2. O tamanho e a ecogenicidade do pâncreas foram determinados pela ultra-sonografia em 81 diabéticos, sendo 20 do tipo 1 e 61 do tipo 2 (53 obesos e oito não-obesos. Os pacientes tipo 2 obesos diferiram dos demais por apresentarem área total e diâmetro ântero-posterior do corpo do pâncreas significativamente maiores. Quanto à ecogenicidade pancreática, esta estava aumentada com maior freqüência nos diabéticos tipo 2 obesos que nos diabéticos tipo 1. Consideramos, assim, que a ultra-sonografia do pâncreas constitui metodologia auxiliar na classificação de diabéticos entre os tipo 1 e 2, sendo menos eficaz quando os últimos não são obesos.

  18. Liquid cooled data center design selection

    Energy Technology Data Exchange (ETDEWEB)

    Chainer, Timothy J.; Iyengar, Madhusudan K.; Parida, Pritish R.

    2016-09-13

    Input data, specifying aspects of a thermal design of a liquid cooled data center, is obtained. The input data includes data indicative of ambient outdoor temperature for a location of the data center; and/or data representing workload power dissipation for the data center. The input data is evaluated to obtain performance of the data center thermal design. The performance includes cooling energy usage; and/or one pertinent temperature associated with the data center. The performance of the data center thermal design is output.

  19. The Northeast Climate Science Center

    Science.gov (United States)

    Ratnaswamy, M. J.; Palmer, R. N.; Morelli, T.; Staudinger, M.; Holland, A. R.

    2013-12-01

    The Department of Interior Northeast Climate Science Center (NE CSC) is part of a federal network of eight Climate Science Centers created to provide scientific information, tools, and techniques that managers and other parties interested in land, water, wildlife and cultural resources can use to anticipate, monitor, and adapt to climate change. Recognizing the critical threats, unique climate challenges, and expansive and diverse nature of the northeast region, the University of Massachusetts Amherst, College of Menominee Nation, Columbia University, Marine Biological Laboratory, University of Minnesota, University of Missouri Columbia, and University of Wisconsin-Madison have formed a consortium to host the NE CSC. This partnership with the U.S. Geological Survey climate science center network provides wide-reaching expertise, resources, and established professional collaborations in both climate science and natural and cultural resources management. This interdisciplinary approach is needed for successfully meeting the regional needs for climate impact assessment, adaptive management, education, and stakeholder outreach throughout the northeast region. Thus, the NE CSC conducts research, both through its general funds and its annual competitive award process, that responds to the needs of natural resource management partners that exist, in part or whole, within the NE CSC bounds. This domain includes the North Atlantic, Upper Midwest and Great Lakes, Eastern Tallgrass and Big Rivers, and Appalachian Landscape Conservation Cooperatives (LCCs), among other management stakeholders. For example, researchers are developing techniques to monitor tree range dynamics as affected by natural disturbances which can enable adaptation of projected climate impacts; conducting a Designing Sustainable Landscapes project to assess the capability of current and potential future landscapes in the Northeast to provide integral ecosystems and suitable habitat for a suite of

  20. Human-Centered Information Fusion

    CERN Document Server

    Hall, David L

    2010-01-01

    Information fusion refers to the merging of information from disparate sources with differing conceptual, contextual and typographical representations. Rather than focusing on traditional data fusion applications which have been mainly concerned with physical military targets, this unique resource explores new human-centered trends, such as locations, identity, and interactions of individuals and groups (social networks). Moreover, the book discusses two new major sources of information: human observations and web-based information.This cutting-edge volume presents a new view of multi-sensor d