WorldWideScience

Sample records for ccl daresbury laboratory

  1. Beam tomography research at Daresbury Laboratory

    International Nuclear Information System (INIS)

    Beam tomography research at Daresbury Laboratory has focussed on the development of normalised phase space techniques—starting with the idea of sampling tomographic projections at equal phase advances. This idea has influenced the design and operation of the tomography sections at the Photo Injector Test Facility at Zeuthen (PITZ) and at the Accelerator and Lasers in Combined Experiments (ALICE) at Daresbury. We have studied the feasibility of using normalised phase space to measure the effect of space charge. Quadrupole scan measurements are carried out at two different parts of a beamline. Reconstructions at the same location give results that are clearly rotated with respect to each other in normalised phase space. We are able to show that a significant part of this rotation can be attributed to the effect of space charge. We show how the normalised phase space technique can be used to increase the reliability of the Maximum Entropy Technique (MENT). While MENT is known for its ability to work with just a few projections, the accuracy of its reconstructions has seldom been questioned. We show that for typical phase space distributions, MENT could produce results that look quite different from the original. We demonstrate that a normalised phase space technique could give results that are closer to the actual distribution. We also present simpler ways of deriving the phase space tomography formalism and the Maximum Entropy Technique

  2. The Daresbury Laboratory 1993/1994

    International Nuclear Information System (INIS)

    The scientific programme based on the Synchrotron Radiation Source (SRS) has continued in 1993/94 to be at the centre of the Daresbury Laboratory's work. The wide range of research in materials and surface science, atomic and molecular physics, chemistry and structural and molecular biology using SRS includes: the interaction between the proteins actin and gelsolin which has relevance to genetic disease; the crystallinity of polythene; the epitaxial growth of lattice-mismatched semi-conducting material systems; cell uptake of molecules by receptor-mediated endocytosis; the crystal structure of copper-palladium alloys; the kinetics of intercalation and its application to molecular electronics; the crystal structure of the minerals antigorite and chrysotile; the development of experimental facilities to allow surface studies of catalytic processes. Major upgrades and improvements in the SRS are also reported. Highlights of the continuing successful use of parallel supercomputers and distributed computing in the collaborative research undertaken by the Theory, Computational Science and Computing group are presented. These range over applications to pharmaceuticals, plasma and ionization on processes, crystal structures of organic molecules and magnetic storage media. (UK)

  3. Plasma wakefield acceleration at CLARA facility in Daresbury Laboratory

    Science.gov (United States)

    Xia, G.; Nie, Y.; Mete, O.; Hanahoe, K.; Dover, M.; Wigram, M.; Wright, J.; Zhang, J.; Smith, J.; Pacey, T.; Li, Y.; Wei, Y.; Welsch, C.

    2016-09-01

    A plasma accelerator research station (PARS) has been proposed to study the key issues in electron driven plasma wakefield acceleration at CLARA facility in Daresbury Laboratory. In this paper, the quasi-nonlinear regime of beam driven plasma wakefield acceleration is analysed. The wakefield excited by various CLARA beam settings are simulated by using a 2D particle-in-cell (PIC) code. For a single drive beam, an accelerating gradient up to 3 GV/m can be achieved. For a two bunch acceleration scenario, simulation shows that a witness bunch can achieve a significant energy gain in a 10-50 cm long plasma cell.

  4. Simulation studies of plasma lens experiments at Daresbury laboratory

    Science.gov (United States)

    Hanahoe, K.; Mete, O.; Xia, G.; Angal-Kalinin, D.; Jones, J.; Smith, J.

    2016-03-01

    Experiments are planned to study plasma lensing using the VELA and CLARA Front End accelerators at Daresbury Laboratory. This paper presents results of 2-dimensional particle-in-cell simulations of the proposed experiments. The variation in focusing strength and emittance growth with beam and plasma parameters are studied in the overdense (plasma density much greater than bunch density) regime for the VELA beam. The effect of spherical and longitudinal aberrations on the beam emittance was estimated through numerical and theoretical studies. Simulation results show that a focusing strength equivalent to a magnetic field gradient of 10 T m-1 can be achieved using VELA, and a gradient of 247 T m-1 can be achieved using CLARA Front End.

  5. Daresbury 1980

    International Nuclear Information System (INIS)

    This annual report of the Daresbury Laboratory describes work carried out during 1980 on: (1) Synchrotron radiation (synchrotron radiation source, synchrotron radiation experiments, theoretical studies, new projects). (2) Nuclear structure (nuclear structure facility, experimental physics, nuclear physics). (3) Computer services and computational science. (4) Laboratory services. Publications are listed in an appendix. (U.K.)

  6. A review of beam tomography research at Daresbury Laboratory

    CERN Document Server

    Hock, K M; Holder, D J; Muratori, B D; Wolski, A

    2013-01-01

    This is a review on beam tomography research at Daresbury. The research has focussed on development of normalised phase space techniques. It starts with the idea of sampling tomographic projections at equal phase advances and shows that this would give the optimal reconstruction results. This idea has influenced the design, construction and operation of the tomography sections at the Photo Injector Test Facility at Zeuthen (PITZ) and at the Accelerator and Laser in Combined Experiments (ALICE) at Daresbury. The theoretical justification of this idea is later developed through simulations and analysis of the measurements results at ALICE. The mathematical formalism is constructed around the normalised phase space and the idea of equal phase advances become the basis of this. This formalism is applied to a variety of experimental and simulated situations and shown to be useful in improving resolution, increasing reliability and providing diagnostic information. In this review, we also present the simplifying co...

  7. Daresbury 1975

    International Nuclear Information System (INIS)

    This annual report falls under the following headings: high energy physics (including the NINA programme, CERN programme, technical support and theoretical studies); synchrotron radiation (including studies for the new Synchrotron Radiation Source); nuclear structure (including details of the new Nuclear Structure Facility); computer systems; and appendices covering finance and administration, health and safety, and a list of publications by Daresbury Laboratory staff. (U.K.)

  8. Daresbury 1977

    International Nuclear Information System (INIS)

    The programme of the Daresbury Laboratory is described. Sections on nuclear structure (the building of the Nuclear Structure Facility (NSF), tandem construction, experimental physics, nuclear theory), synchrotron radiation (the synchrotron Radiation Sourse (SRS) and its use in atomic, molecular and solid state physics and X-ray Studies) high energy physics (the NINA and CERN programmes and the closure of the electron synchrotron) and computer systems are included. (U.K.)

  9. PREPARATIONS FOR ASSEMBLY OF THE INTERNATIONAL ERL CRYOMODULE AT DARESBURY LABORATORY

    International Nuclear Information System (INIS)

    The collaborative development of an optimised cavity/cryomodule solution for application on ERL facilities has now progressed to final assembly and testing of the cavity string components and their subsequent cryomodule integration. This paper outlines the verification of the various cryomodule sub-components and details the processes utilised forfinal cavity string integration. The paper also describes the modifications needed to facilitate this new cryomodule installation and ultimate operation on the ALICE facility at Daresbury Laboratory.

  10. PREPARATIONS FOR ASSEMBLY OF THE INTERNATIONAL ERL CRYOMODULE AT DARESBURY LABORATORY

    Energy Technology Data Exchange (ETDEWEB)

    McIntosh, P. A.; Bate, R.; Beard, C. D.; Cordwell, M. A.; Dykes, D. M.; Pattalwar, S. M.; Strachan, J.; Belomestnykh, S.; Liepe, M.; Padamsee, H.; Quigley, P.; Sears, J.; Shemelin, V.; Veshcherevich, V.; Proch, D.; Sekutowicz, J.; Buchner, A.; Gabriel, F.; Michel, P.; Corlett, J. N.; Li, D.; Lidia, S.; Kimura, T.; Smith, T. I.

    2009-04-29

    The collaborative development of an optimised cavity/cryomodule solution for application on ERL facilities has now progressed to final assembly and testing of the cavity string components and their subsequent cryomodule integration. This paper outlines the verification of the various cryomodule sub-components and details the processes utilised forfinal cavity string integration. The paper also describes the modifications needed to facilitate this new cryomodule installation and ultimate operation on the ALICE facility at Daresbury Laboratory.

  11. Daresbury 1984/5

    International Nuclear Information System (INIS)

    The 1984/85 annual report of the Daresbury Laboratory, United Kingdom, is presented. Attention is centred on the Synchrotron Radiation Source and its scientific programme, and the Nuclear Structure Facility and its experimental work. Theoretical work at Daresbury including computational science is described, as well as computing and electronics. (U.K.)

  12. Remote real time oscilloscope displays for accelerator diagnostics on the tandem Van de Graaff at the Daresbury Laboratory

    International Nuclear Information System (INIS)

    The tandem Van de Graaff accelerator built at the Daresbury Laboratory as a national nuclear structure facility makes extensive use of microprocessors and computers in its control system. This present paper describes that part of the system that gives remote real time oscilloscope displays to an operator. A particular example is made of the signal processing for a rotating wire beam scanner that is used for beam profile and position monitoring. (orig.)

  13. Daresbury 1981/82

    International Nuclear Information System (INIS)

    This annual report covers the work of the Daresbury Laboratory during the period January 1981 - March 1982 under the headings; nuclear structure (nuclear structure facility, experimental physics), synchrotron radiation (synchrotron radiation source, experimental physics), theory and computational science, computing and electronics, other activities and services. Figures concerning staffing and expenditure are given and laboratory publications covering the period are listed. (U.K.)

  14. Daresbury 1990/91

    International Nuclear Information System (INIS)

    This report highlights some of the diverse range of work engaged in at the Daresbury Laboratory of the United Kingdom Science and Engineering Research Council in 1990/91. It contains brief descriptions of the Laboratory's facilities and research programmes. These fall into three main areas; theory, computational science and computing; lower temperature nuclear physics using the Nuclear Structure Facility; and the development and application of the synchrotron radiation source. Separate appendices to the report cover these areas in greater detail. (UK)

  15. Daresbury 1989/90

    International Nuclear Information System (INIS)

    This annual report on Daresbury Laboratory for 1989/90 focuses on existing and prospective research efforts. The Synchrotron Radiation Source has been operating effectively and successfully. The Theory and Computational Science group has used many increasingly powerful computing tools. The Nuclear Structure Facility is now fully operational and exciting discoveries, some not predicted by theory, have been observed. Collaboration with the external scientific community has continued successfully as well. (UK)

  16. Daresbury 1985/6

    International Nuclear Information System (INIS)

    The paper is the annual report of the Daresbury Laboratory, United Kingdom, 1985/6. The research programme using the Nuclear Structure Facility (NSF) and the Synchrotron Radiation Source (SRS) is described, along with some of the scientific highlights. The performance, operation and other activities associated with the SRS and NSF are summarized. Computational science studies concerned with atoms, molecules, condensed matter, chemical databank service and the FPS-164 computer system, are also outlined. (U.K.)

  17. Daresbury 1987/8

    International Nuclear Information System (INIS)

    1987 was the twenty fifth anniversary of the Daresbury Laboratory and special events were held to celebrate this. Over the twenty five years the projects have changed but the role of the laboratory, which is to provide and operate facilities too large for a single University to operate on its own and to collaborate with the Universities using them, has not changed. The report covers the main facilities at Daresbury. The main events and progress throughout the year are highlighted. For the Nuclear Structure facility highlights included collaboration on the largest array of high resolution germanium gamma-ray detectors ever assembled, work on super deformed nuclei at high angular momentum and the use of the polarised heavy ion source. At the Synchrotron Radiation Source a High Brightness Lattice has been installed and this has resulted in improved imaging and diffraction. Protein molecules, semiconductor materials, very small crystals and muscle structure have been studied using the high brightness lattice facility. A review of the computational science support for projects is included. Facts and figures about Daresbury are presented and a list of publications resulting from work done at the Laboratory during the year is given. (U.K.)

  18. Daresbury 1991/92

    International Nuclear Information System (INIS)

    The report gives an overview of the activities over the year 1991/92. There are more than 4000 registered uses of the facilities at Daresbury so only the highlights can be included. The largest programme is that centred on the Synchrotron Radiation source. During the year this was shut down so that a second superconducting wiggler magnet could be installed. The smallest programme is that associated with Theory, Computational Science and Computing. Collaboration between the Medical and the Science and Engineering Research Councils reflects the interest of both in structural biology. A feasibility study for an Advanced Proton Source has been undertaken as part of the long-term planning for the laboratory. The work on EUROGAM, a Joint UK/France Gamma-Ray Detector is reported. A list of publications of scientists using the facilities at the laboratory is included. Separate appendices are available on the SRS, NSF (Nuclear Structure) and the Theory, Computational Science and Computing facilities. (UK)

  19. Daresbury 1978

    International Nuclear Information System (INIS)

    The report falls under the following headings: introduction; synchrotron radiation (synchrotron radiation source, synchrotron radiation experiments, theoretical studies); nuclear structure (nuclear structure facility, NSF experimental physics, nuclear theory); computational science; high energy physics; computer systems; laboratory services; appendix (publications). (U.K.)

  20. Daresbury 1988/89

    International Nuclear Information System (INIS)

    The main areas of research reported from the Daresbury Laboratory are in synchrotron radiation, nuclear physics and theory and computational science. The Synchrotron Radiation source research programme has employed the experimental techniques of small angle scattering, protein crystallography, surface diffraction, powder diffraction and x-ray absorption spectroscopy. These have been applied to such problems as corrosion in steels, kinetics in cell biology, the structure of viruses (notably the foot-and-mouth virus), sulphur disruption of metal surfaces, metal-semiconductor interfaces, and the electronic and vibrational structure of molecules. Research with the Nuclear Structure Facility has included experiments to study nuclear collective motion, nuclei far from stability and nuclear reaction mechanisms. Much development effort has been directed towards the production of beams of polarized nuclei. Other highlights have been work with the Recoil Separator on exotic nuclei, the Giant Dipole Resonance and isomers. A problem of particular theoretical interest is the effect of breakup on the nucleus-nucleus potential. In computational science, the Laboratory is in the forefront of software development for the collection and theoretical analysis of experimental data and university research is supported through a series of Collaborative Computational Projects. Industrial collaboration in computational science is extending the contribution of the Laboratory to the solution of significant technological problems. (UK)

  1. Around the laboratories: Dubna: Physics results and progress on bubble chamber techniques; Stanford (SLAC): Operation of a very rapid cycling bubble chamber; Daresbury: Photographs of visitors to the Laboratory; Argonne: Charge exchange injection tests into the ZGS in preparation for a proposed Booster

    CERN Multimedia

    1969-01-01

    Around the laboratories: Dubna: Physics results and progress on bubble chamber techniques; Stanford (SLAC): Operation of a very rapid cycling bubble chamber; Daresbury: Photographs of visitors to the Laboratory; Argonne: Charge exchange injection tests into the ZGS in preparation for a proposed Booster

  2. Daresbury 1992/93

    International Nuclear Information System (INIS)

    An overview of the activities at Daresbury over the year 1992/3 is given. The Nuclear Structure Facility (NSF) was closed at the end of March 1993. The EUROGAM gamma-ray spectrometer was brought into operation in October 1992 and the scheduled experiments were completed before the NSF closure. The results are still being analysed by the participating groups. A detailed explanation of EUROGAM and some of the experimental results obtained are given. The Synchrotron Radiation Source has continued to provide powerful light beams for academic and and industrial users to study the physical properties of matter. A new wiggler magnet has improved its operation and research into solid catalysts sleeping sickness, the measurement of spin and orbital angular momentum, surface structure and the photodissociation and photoionization of hydrogen has been carried out. The computational science activities are described. Two new areas of research are medium energy ion scattering and the Research Unit for Surfaces, Transforms and Interfaces. (UK)

  3. Intershield to tank sparks at the Daresbury tandem

    International Nuclear Information System (INIS)

    The causes of serious metallic melting and denting due to discharges in the insulating gas of the Daresbury tandem are examined. In order to explain the melting, high oscillating currents have to flow in the spark channels, and those can only be expected when return strokes excite local electromagnetic modes at the site of the origin of breakdown. In the case of intershield to tank sparks, evidence that magnetic confinement of the spark channel produces denting is presented. A model which accounts for the differences between sparks at Oak Ridge and sparks at Daresbury is also presented. (author)

  4. VME applications to the Daresbury SRS control system

    International Nuclear Information System (INIS)

    The control system for the Daresbury SRS has recently been extended with a VME based alarm system which is operational. A further development is a steering system to provide servo control of the electron beam orbit position in the storage ring. (author)

  5. An advanced beam steering system for the SRS at Daresbury

    International Nuclear Information System (INIS)

    The Daresbury SRS is a 2 GeV electron storage ring dedicated to providing synchrotron radiation to approximately 32 stations on 10 beamlines. The storage ring beam steering systems are being replaced to allow automatic real time correction of the electron beam position. The stability problem and the proposed solutions are briefly summarized. Progress on development of the constituent systems is reviewed and some data from early performance trials is presented. (author) 7 refs.; 7 figs

  6. Synchrotron radiation: appendix to the Daresbury annual report 1990/91

    International Nuclear Information System (INIS)

    This Appendix to the Annual Report of the Daresbury Laboratory of the United Kingdom Science and Engineering Research Council contains the 1990 Annual Report of the Synchrotron Radiation Facilities Committee, specifications for the beamlines and stations, the index for the synchrotron radiation user reports, the reports themselves and the list of publications detailing work performed on the Synchrotron Radiation Source. By far the largest part of the Appendix is taken up with the user reports for the period 1990 to 1991. They include reports on structural determination of sodium methyl, an investigation of DNA-Binding Proteins, monitoring of vital processes in live cells, the structure of semiconductor interfaces, the structure and properties of glasses and soft x-ray absorption spectroscopy of liquid samples. (author)

  7. Synchrotron radiation. Appendix to the Daresbury annual report 1993/1994

    International Nuclear Information System (INIS)

    This appendix to the main report of the Daresbury Laboratory contains 387 contributions on research carried out using the Synchrotron Radiation Source. The research areas covered include: biological solution scattering; protein crystallography; biological radiation damage; biological spectroscopy; fibre diffraction of biological systems; membranes and liquid systems; machine physics; polymer studies; quantum wells; carbon fibre diffraction; organometallics; phase studies at high pressure; semiconductors; metal oxides; magnetic materials; non-linear optics; alloys; metallic glass; amorphous materials/aqueous solutions; porous silicon and mesoporous materials; silica sols and emulsions; thin films; geology and mineralogy; liquid crystals; catalysis; ceramics and glass; superconductors; detectors for structural biology; metal oxide gas sensors; X-ray scattering techniques; new developments in X-ray techniques; structural studies of powders; single crystal and small molecule crystallography; molecular spectroscopy; lime resolved spectroscopy; surface spectroscopy; topography and diffuse scattering; X-ray microscopy; X-ray studies of surfaces. (UK)

  8. Nuclear physics: appendix to the Daresbury annual report 1990/91

    International Nuclear Information System (INIS)

    This nuclear physics chapter of the Annual Report of the Daresbury Laboratory of the United Kingdom Science and Engineering Research Council describes the work of the Nuclear Structure Facility. In the limited space available it necessarily provides only a broad outline of the facility, its development and a flavour of the research in a selection of a few highlighted topics. This appendix complements the first volume of the Report reproducing users' short camera ready scientific reports. These describe the progress and results of each experimental proposal. Reports are grouped in five sections: research into nuclear structure with contributions ordered in increasing Z number of the nuclei studies; investigations of nuclear reaction mechanisms; nuclear theory; atomic physics; and accelerator operations, developments and instrumentation. The appendix forms a compact record of the work of the Nuclear Structure Facility for the year 1990/91. (author)

  9. Commissioning a second superconducting wiggler in the Daresbury SRS

    International Nuclear Information System (INIS)

    A second superconducting wiggler magnet has now been installed on the SRS at Daresbury. This three pole device generates a field of 6 T on the beam axis and greatly extends the range of useful synchrotron radiation on the light source. The magnet properties are briefly reviewed, together with the necessary and major modifications that have had to be made to the SRS to accomodate this powerful addition to the lattice. Initial commissioning trials in the Spring of 1993 are described and a comparison made with expected influence on the beam behavior. Successful operation has been demonstrated, including simultaneous excitation with the earlier 5 T wiggler

  10. Results from the Daresbury Compton backscattering X-ray source

    Science.gov (United States)

    Laundy, D.; Priebe, G.; Jamison, S. P.; Graham, D. M.; Phillips, P. J.; Smith, S. L.; Saveliev, Y.; Vassilev, S.; Seddon, E. A.

    2012-10-01

    The Daresbury Compton Backscattering X-ray Source uses a high power Ti Sapphire laser interacting in head on geometry with electron bunches in the ALICE energy recovery linear accelerator. X-ray photons with peak energy of 21 keV were generated with the accelerator operating at an energy of 29.6 MeV. The spatial profile of the X-rays emitted near the electron beam axis was measured. The characteristics of the X-ray yield measured as a function of relative timing between the laser pulse and the interacting electron bunch was found to be consistent with the modelled intensity behaviour using measured electron and laser beam parameters.

  11. Results from the Daresbury Compton backscattering X-ray source

    International Nuclear Information System (INIS)

    The Daresbury Compton Backscattering X-ray Source uses a high power Ti Sapphire laser interacting in head on geometry with electron bunches in the ALICE energy recovery linear accelerator. X-ray photons with peak energy of 21 keV were generated with the accelerator operating at an energy of 29.6 MeV. The spatial profile of the X-rays emitted near the electron beam axis was measured. The characteristics of the X-ray yield measured as a function of relative timing between the laser pulse and the interacting electron bunch was found to be consistent with the modelled intensity behaviour using measured electron and laser beam parameters.

  12. The Correlation of Serums CCL11, CCL17, CCL26, and CCL27 and Disease Severity in Patients with Urticaria

    Directory of Open Access Journals (Sweden)

    Tao Lu

    2016-01-01

    Full Text Available Background. Chemokines may be involved in the pathogenesis of urticaria, but their correlation with disease severity as well as eruption type is unclear. Objectives. The aim of this study was to explore the expression of chemokines in patients with urticaria. The association between disease severity and levels of chemokines was analysed. Materials and Methods. Serums CCL11, CCL17, CCL26, and CCL27, D-dimer, C-reactive protein, and total IgE were measured in 51 patients with urticaria and in 25 healthy control subjects. Results. Serums CCL11, CCL17, CCL26, and CCL27 were significantly higher in patients with urticaria than in the healthy controls (P<0.05. Serum CCL27 strongly correlated with urticarial disease severity. Serums CCL17, CCL26, and CCL27 significantly correlated with D-dimer, while innercorrelations were noted among the chemokines. Conclusion. Our findings reveal that chemokines participate in the pathogenesis of urticaria. Further study in larger cohort is needed to testify whether they could be the biomarkers for predicting the severity of urticaria.

  13. Age dating ground water by use of chlorofluorocarbons (CCl3F and CCl2F2), and distribution of chlorofluorocarbons in the unsaturated zone, Snake River Plain aquifer, Idaho National Engineering Laboratory, Idaho

    International Nuclear Information System (INIS)

    Detectable concentrations of chlorofluorocarbons (CFC's) were observed in ground water and unsaturated-zone air at the Idaho National Engineering Laboratory (INEL) and vicinity. The recharge ages of waters were determined to be from 4 to more than 50 years on the basis of CFC concentrations and other environmental data; most ground waters have ages of 14 to 30 years. These results indicate that young ground water was added at various locations to the older regional ground water (greater than 50 years) within and outside the INEL boundaries. The wells drilled into the Snake River Plain aquifer at INEL sampled mainly this local recharge. The Big Lost River, Birch Creek, the Little Lost River, and the Mud Lake-Terreton area appear to be major sources of recharge of the Snake River Plain aquifer at INEL. An average recharge temperature of 9.7±1.3 degrees C (degrees Celsius) was calculated from dissolved nitrogen and argon concentrations in the ground waters, a temperature that is similar to the mean annual soil temperature of 9 degrees C measured at INEL. This similarity indicates that the aquifer was recharged at INEL and not at higher elevations that would have cooler soil temperatures than INEL. Soil-gas concentrations at Test Area North (TAN) are explained by diffusion theory

  14. CCL2 modulates cytokine production in cultured mouse astrocytes

    Directory of Open Access Journals (Sweden)

    Frugier Tony

    2010-10-01

    Full Text Available Abstract Background The chemokine CCL2 (also known as monocyte chemoattractant protein-1, or MCP-1 is upregulated in patients and rodent models of traumatic brain injury (TBI, contributing to post-traumatic neuroinflammation and degeneration by directing the infiltration of blood-derived macrophages into the injured brain. Our laboratory has previously reported that Ccl2-/- mice show reduced macrophage accumulation and tissue damage, corresponding to improved motor recovery, following experimental TBI. Surprisingly, Ccl2-deficient mice also exhibited delayed but exacerbated secretion of key proinflammatory cytokines in the injured cortex. Thus we sought to further characterise CCL2's potential ability to modulate immunoactivation of astrocytes in vitro. Methods Primary astrocytes were isolated from neonatal wild-type and Ccl2-deficient mice. Established astrocyte cultures were stimulated with various concentrations of lipopolysaccharide (LPS and interleukin (IL-1β for up to 24 hours. Separate experiments involved pre-incubation with mouse recombinant (rCCL2 prior to IL-1β stimulation in wild-type cells. Following stimulation, cytokine secretion was measured in culture supernatant by immunoassays, whilst cytokine gene expression was quantified by real-time reverse transcriptase polymerase chain reaction. Results LPS (0.1-100 μg/ml; 8 h induced the significantly greater secretion of five key cytokines and chemokines in Ccl2-/- astrocytes compared to wild-type cells. Consistently, IL-6 mRNA levels were 2-fold higher in Ccl2-deficient cells. IL-1β (10 and 50 ng/ml; 2-24 h also resulted in exacerbated IL-6 production from Ccl2-/- cultures. Despite this, treatment of wild-type cultures with rCCL2 alone (50-500 ng/ml did not induce cytokine/chemokine production by astrocytes. However, pre-incubation of wild-type astrocytes with rCCL2 (250 ng/ml, 12 h prior to stimulation with IL-1β (10 ng/ml, 8 h significantly reduced IL-6 protein and gene

  15. CCL21 Cancer Immunotherapy

    International Nuclear Information System (INIS)

    Cancer, a major health problem, affects 12 million people worldwide every year. With surgery and chemo-radiation the long term survival rate for the majority of cancer patients is dismal. Thus novel treatments are urgently needed. Immunotherapy, the harnessing of the immune system to destroy cancer cells is an attractive option with potential for long term anti-tumor benefit. Cytokines are biological response modifiers that stimulate anti-tumor immune responses. In this review, we discuss the anti-tumor efficacy of the chemotactic cytokine CCL21 and its pre-clinical and clinical application in cancer

  16. SRP meeting: social and political implications of communicating radiation risk, Daresbury, Warrington, 20 June 2001

    International Nuclear Information System (INIS)

    The SRP held a very interesting meeting in June at the Daresbury Laboratory in Warrington on the social and political implications of communicating radiation risk. In today's risk-aware society, effective communication is just as important as the control measures introduced to prevent or restrict exposure. In relation to radiation protection, risk communicators had a hard job because of: Public dread Likelihood of risk intensification Perceived inequitable distribution of risks. The higher the uncertainty, the more wary people were likely to be. Julie cited the International Nuclear Events Scale (INES) as a possible tool for promoting a consistent message across all publics. This was because it aimed to put events into proper perspective and provide a common understanding amongst the nuclear community, the media and the public. Julie summed up by saying that the risk communication was not just any form of communication and the issue of communicating radiation risks involved special consideration. Further research established that the more information given to the local population, the more likely that they would deny that there was a problem. Denial could moderate beliefs or emotional reactions to a situation. This then affected their dose as they were more likely to adopt risky behaviour by eating contaminated food and entering contaminated areas. Avoiding the need to undertake safe behaviour reduced stress levels. Furthermore, people adopted beliefs to suit their situation. For example, some inhabitants of the affected areas became adapted to the radiation and actually felt worse outside the contaminated area. There was strong pressure for the maintenance of a situation which actually prevented appropriate precautions being taken. Peter concluded that there was often confusion over the details of technical information that sometimes might not help to prevent a course of action being taken. However on a positive note the research did find credence and positive

  17. Zinc In CCl4 Toxicity

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Objective To investigate the protective effect of zinc in CCl4-induced hepatotoxicity. Methods Rats were treated with zinc acetate for four days. The zinc doses were 5 mg Zn/kg and 10 mg Zn/kg body weight respectively. Two groups of the zinc acetate-treated rats were later challenged with a single dose of CCl4 (1.5 mL/kg body weight). Results Compared to control animals, the plasma of rats treated with CCl4 showed hyperbilirubinaemia, hypoglycaemia, hypercreatinaemia and hypoproteinaemia. When the animals were however supplemented with zinc in form of zinc acetate before being dosed with CCl4, the 5 mg Zn/kg body weight of zinc acetate reversed the hypoproteinaemia induced by CCl4, whereas the 10mg Zn/kg body weight of zinc acetate reversed the hypoglycaemia, hyperbilimbinaemia and hypercreatinaemia induced by CCl4. Conclusion The 10mug Zn/kg body weight of zinc acetate is more consistent in protecting against CCl4 hepatotoxicity. The possible mechanisms of protection are highlighted.

  18. The role of nuclear shapes in nuclear structure (from the perspective of the Daresbury Tandem)

    International Nuclear Information System (INIS)

    In specific regions of the nuclear periodic chart, large multipole moments are observed and the low-lying excitations have a rotational character. These features are understood if the nuclei in question are assumed to have a stable deformation, i.e., a non-spherical distribution of the nuclear matter. In other (transitional) regions the quasi-rotational bands are present; they are strongly coupled to low-lying vibrational modes. Those nuclei are best understood in terms of small static deformations but large dynamic fluctuations around local equilibria. As a matter of fact, the vast majority of nuclei are deformed; even in those which are spherical or almost spherical, the dynamical couplings to shape vibrations are crucial. The issue of nuclear deformation is many-faceted. If the nuclear shape (nuclear mean field) is deformed, characteristic excitation modes are present, such as rotations and vibrations built upon the non-spherical equilibrium. Through the particle-core coupling, nuclear deformations can dramatically influence the single-particle properties of nucleons moving in the average nuclear potential. Many experimental investigations using the Daresbury Tandem were related in one way or another to the physics of nuclear shapes. Fundamental discoveries from Daresbury include the observation of superdeformed structures in rapidly rotating nuclei, the observation of identical (open-quotes twinnedclose quotes) rotational bands, various studies of structural changes induced by very fast rotation (band-crossings, band-terminations), the observation of the oblate-deformed open-quotes dipoleclose quotes bands, studies of reflection-asymmetric shapes, studies of (quasimolecular) cluster configurations in light nuclei, and many, many others. The author reviews the forefront research at Daresbury from the global perspective; the common denominator being the nuclear shape deformation

  19. Photoionization of ions and the general program in atomic and molecular physics at Daresbury

    International Nuclear Information System (INIS)

    The current program in Atomic and Molecular Science is focused on photoionization of atoms and small molecules. On the atomic side, experiments on the double ionization of helium were completed recently, verifying the Wannier threshold law for double photoionization. Also, the angular distribution of the electrons has just been measured, and these results show a marked divergence form theoretical expectations. Other experiments include fluorescence polarization measurements for the atomic ions calcium and strontium, which, when combined with photoelectron angular distribution measurements, form the complete photoionization experiment. A sizeable part of the program is devoted to studying molecular fragmentation. The triple coincidence technique, in which the two fragment ions are detected in coincidence with the photoelectron after the parent molecule has been doubly ionized, was developed at Daresbury, and experiments in this area continue with the addition of fluorescence measurements. Looking to the future, the atomic and molecular science program at Daresbury will move closer to applied science areas, with metal clusters and transient species becoming more prominent. Much of this work will require a source with two to three orders of magnitude advantage in photon intensity over the SRS, and a design study is presently under way for a VUV/Soft X-ray source to meet these requirements

  20. Induction of the Chemokines CCL3α, CCL3α and CCL5 in Atherosclerotic Patients

    Directory of Open Access Journals (Sweden)

    Alyaa Mousa

    2007-01-01

    Full Text Available Chemokines recruit immune cells to inflammatory sites and promote the process of inflammation. The role of these mediators in the disease process in atherosclerosis is not fully studied. The spontaneous mRNA expression and intracellular protein production of the potential inflammatory chemokines CCL3 and CCL3 (macrophage- inflammatory protein-1and ; CCR3 ligand and CCL5 (regulated upon activation, normal T cell expressed and secreted (RANTES; CCR5 ligand in atherosclerotic patients was examined together with the effects of the chlamydial antigen HSP60 and LPS on the gene expression and protein induction of these mediators. Detection of chemokine mRNA and protein levels was assessed by in situ hybridization and immunohistochemistry respectively. The examined chemokines were detected at significantly high levels on atherosclerotic patients compared to healthy controls at both mRNA and protein levels. Stimulation with HSP60 and LPS from Chlamydia pneumoniae (C. pneumoniae and E. coli showed increased numbers of CCL3, CCL3 and CCL5 mRNA expressing cells in patients compared to health controls. Protein translation of these chemokines was depicted in correspondence to the mRNA gene expression for all examined chemokines spontaneously and after stimulation with chlamydial HSP60 and LPS and E. coli LPS. Thus, the herein data demonstrate the induction of potential inflammatory chemokines in atherosclerotic patients and that bacterial antigens play a role in the immunopathologic events in this disease by generating more inflammatory mediators.

  1. CCL8 BASED IMMUNOLOGICAL MONITORING

    DEFF Research Database (Denmark)

    The present invention relates to an immunological method and, more particularly, a method for measuring cell-mediated immune reactivity (CMI) in mammals based on the production of CCL8.The invention further discloses an assay and a kit for measuring CMI to an antigen using whole blood or other...

  2. Structural basis for oligomerization and glycosaminoglycan binding of CCL5 and CCL3.

    Science.gov (United States)

    Liang, Wenguang G; Triandafillou, Catherine G; Huang, Teng-Yi; Zulueta, Medel Manuel L; Banerjee, Shiladitya; Dinner, Aaron R; Hung, Shang-Cheng; Tang, Wei-Jen

    2016-05-01

    CC chemokine ligand 5 (CCL5) and CCL3 are critical for immune surveillance and inflammation. Consequently, they are linked to the pathogenesis of many inflammatory conditions and are therapeutic targets. Oligomerization and glycosaminoglycan (GAG) binding of CCL5 and CCL3 are vital for the functions of these chemokines. Our structural and biophysical analyses of human CCL5 reveal that CCL5 oligomerization is a polymerization process in which CCL5 forms rod-shaped, double-helical oligomers. This CCL5 structure explains mutational data and offers a unified mechanism for CCL3, CCL4, and CCL5 assembly into high-molecular-weight, polydisperse oligomers. A conserved, positively charged BBXB motif is key for the binding of CC chemokines to GAG. However, this motif is partially buried when CCL3, CCL4, and CCL5 are oligomerized; thus, the mechanism by which GAG binds these chemokine oligomers has been elusive. Our structures of GAG-bound CCL5 and CCL3 oligomers reveal that these chemokine oligomers have distinct GAG-binding mechanisms. The CCL5 oligomer uses another positively charged and fully exposed motif, KKWVR, in GAG binding. However, residues from two partially buried BBXB motifs along with other residues combine to form a GAG-binding groove in the CCL3 oligomer. The N termini of CC chemokines are shown to be involved in receptor binding and oligomerization. We also report an alternative CCL3 oligomer structure that reveals how conformational changes in CCL3 N termini profoundly alter its surface properties and dimer-dimer interactions to affect GAG binding and oligomerization. Such complexity in oligomerization and GAG binding enables intricate, physiologically relevant regulation of CC chemokine functions. PMID:27091995

  3. Recent Developments on ALICE (Accelerators and Lasers In Combined Experiments) at Daresbury Laboratory

    International Nuclear Information System (INIS)

    Progress made in ALICE (Accelerators and Lasers In Combined Experiments) commissioning and a summary of the latest experimental results are presented in this paper. After an extensive work on beam loading effects in SC RF linac (booster) and linac cavities conditioning, ALICE can now operate in full energy recovery mode at the bunch charge of 40pC, the beam energy of 30MeV and train lengths of up to 100us. This improved operation of the machine resulted in generation of coherently enhanced broadband THz radiation with the energy of several tens of uJ per pulse and in successful demonstration of the Compton Backscattering x-ray source experiment. The next steps in the ALICE scientific programme are commissioning of the IR FEL and start of the research on the first non-scaling FFAG accelerator EMMA. Results from both projects will be also reported.

  4. Recent Developments on ALICE (Accelerators and Lasers In Combined Experiments) at Daresbury Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Saveliev, Y M; Buckley, R K; Buckley, S R; Clarke, J A; Corlett, P A; Dunning, D J; Goulden, A R; Hill, S F; Jackson, F; Jamison, S P; Jones, J K; Jones, L B; Leonard, S; McIntosh, P A; McKenzie, J W; Middleman, K J; Militsyn, B L; Moss, A J; Muratori, B D; Orrett, J F; Pattalwar, S M; Phillips, P J; Scott, D J; Seddon, E A; Shepherd, B.J.A.; Smith, S L; Thompson, N; Wheelhouse, A E; Williams, P H; Harrison, P; Holder, D J; Holder, G M; Schofield, A L; Weightman, P; Williams, R L; Laundry, D; Powers, T; Priebe, G

    2010-05-01

    Progress made in ALICE (Accelerators and Lasers In Combined Experiments) commissioning and a summary of the latest experimental results are presented in this paper. After an extensive work on beam loading effects in SC RF linac (booster) and linac cavities conditioning, ALICE can now operate in full energy recovery mode at the bunch charge of 40pC, the beam energy of 30MeV and train lengths of up to 100us. This improved operation of the machine resulted in generation of coherently enhanced broadband THz radiation with the energy of several tens of uJ per pulse and in successful demonstration of the Compton Backscattering x-ray source experiment. The next steps in the ALICE scientific programme are commissioning of the IR FEL and start of the research on the first non-scaling FFAG accelerator EMMA. Results from both projects will be also reported.

  5. Higher Expression of CCL2, CCL4, CCL5, CCL21, and CXCL8 Chemokines in the Skin Associated with Parasite Density in Canine Visceral Leishmaniasis

    Science.gov (United States)

    Menezes-Souza, Daniel; Guerra-Sá, Renata; Carneiro, Cláudia Martins; Vitoriano-Souza, Juliana; Giunchetti, Rodolfo Cordeiro; Teixeira-Carvalho, Andréa; Silveira-Lemos, Denise; Oliveira, Guilherme Corrêa; Corrêa-Oliveira, Rodrigo; Reis, Alexandre Barbosa

    2012-01-01

    Background The immune response in the skin of dogs infected with Leishmania infantum is poorly understood, and limited studies have described the immunopathological profile with regard to distinct levels of tissue parasitism and the clinical progression of canine visceral leishmaniasis (CVL). Methodology/Principal Findings A detailed analysis of inflammatory cells (neutrophils, eosinophils, mast cells, lymphocytes, and macrophages) as well as the expression of chemokines (CCL2, CCL4, CCL5, CCL13, CCL17, CCL21, CCL24, and CXCL8) was carried out in dermis skin samples from 35 dogs that were naturally infected with L. infantum. The analysis was based on real-time polymerase chain reaction (PCR) in the context of skin parasitism and the clinical status of CVL. We demonstrated increased inflammatory infiltrate composed mainly of mononuclear cells in the skin of animals with severe forms of CVL and high parasite density. Analysis of the inflammatory cell profile of the skin revealed an increase in the number of macrophages and reductions in lymphocytes, eosinophils, and mast cells that correlated with clinical progression of the disease. Additionally, enhanced parasite density was correlated with an increase in macrophages and decreases in eosinophils and mast cells. The chemokine mRNA expression demonstrated that enhanced parasite density was positively correlated with the expression of CCL2, CCL4, CCL5, CCL21, and CXCL8. In contrast, there was a negative correlation between parasite density and CCL24 expression. Conclusions/Significance These findings represent an advance in the knowledge about skin inflammatory infiltrates in CVL and the systemic consequences. Additionally, the findings may contribute to the design of new and more efficient prophylactic tools and immunological therapies against CVL. PMID:22506080

  6. Markkinointisuunnitelma : case: CCL-Design

    OpenAIRE

    Ahonen, Henri

    2014-01-01

    Opinnäytetyön tarkoituksena on tehdä markkinointisuunnitelma, jossa käydään läpi markkinointisuunnitelmaan vaadittavaa teoriaa, tarkastellaan jo tehtyjä ratkaisuja ja kehitellään uusia kasvuun tähtääviä ja asiakkaita tuovia toimenpiteitä. Tämän opinnäytetyön toimeksiantaja on lahtelainen pk-yritys CCL-Design. Yritys on perustettu vuonna 2009 ja se on keskittynyt autofiksaukseen ja mainosteippaukseen sekä teippien tulostamiseen. Yrityksen toimipaikka sijaitsee Hollolassa. Teoriaosuus k...

  7. ADVANCED OXIDATION PROCESSES (AOP'S FOR THE TREATMENT OF CCL CHEMICALS

    Science.gov (United States)

    Research on treatment of Contaminant Candidate List (CCL) chemicals is being conducted. Specific groups of contaminants on the CCL will be evaluated using numerous advanced oxidation processes (AOPs). Initially, these CCL contaminants will be evaluated in groups based on chemical...

  8. Ragweed-allergic subjects have decreased serum levels of chemokines CCL2, CCL3, CCL4 and CCL5 out of the pollen season.

    Science.gov (United States)

    Kostova, Zhivka; Batsalova, Tsvetelina; Moten, Dzhemal; Teneva, Ivanka; Dzhambazov, Balik

    2015-01-01

    CC-chemokines are important mediators of the allergic responses and regulate the cell trafficking. The aim of this study was to examine the serum levels of CCL2/MCP-1, CCL3/MIP-1α, CCL4/MIP-1β and CCL5/RANTES, and to determine whether there are differences between ragweed-allergic subjects and healthy individuals out of the pollen season. Peripheral blood samples were collected from 24 subjects allergic to ragweed pollen and 12 healthy controls. Serum concentrations of chemokines/cytokines were measured by an enzyme-linked immunosorbent assay. We observed significantly decreased concentrations of CCL2/MCP-1, CCL3/MIP-1α, CCL4/MIP-1β and CCL5/RANTES in the sera of ragweed-allergic patients compared to the healthy individuals (32.2 vs. 106.4 pg/ml, 89.5 vs. 135.7 pg/ml, 63.4 vs. 119.2 pg/ml and 11.2 vs. 18.1 ng/ml, respectively, p pollen allergy out of the season, to study the mechanisms for activation/inhibition of the subclinical allergic responses and for development of therapeutic strategies. PMID:26862308

  9. Chemokines CXCL10 and CCL2

    DEFF Research Database (Denmark)

    Sørensen, Torben Lykke; Sellebjerg, F; Jensen, C V; Strieter, R M; Ransohoff, R M

    2001-01-01

    leukocyte count, the CSF concentration of neopterin, matrix metalloproteinase (MMP)-9, and intrathecal IgG and IgM synthesis. The concentration of CCL2 increased between baseline for 3 weeks in both groups, more distinctly so in patients treated with methylprednisolone. CCL2 correlated negatively with MMP-9...... patients in relapse, whilst levels of CCL2 (MCP-1) were reduced. Here, we report a serial analysis of CSF CXCL10 and CCL2 concentrations in 22 patients with attacks of MS or acute optic neuritis (ON) treated with methylprednisolone, and 26 patients treated with placebo in two randomized controlled trials....... Chemokine concentrations were measured by enzyme linked immunosorbent assay (ELISA) in CSF obtained at baseline and after 3 weeks, and were compared with other measures of intrathecal inflammation. At baseline CSF concentrations of CCL2 were significantly lower in the patient group than in controls. The...

  10. Immune response CC Chemokines, CCL2 and CCL5 are associated with Pulmonary Sarcoidosis

    LENUS (Irish Health Repository)

    Palchevskiy, Vyacheslav

    2011-04-04

    Abstract Background Pulmonary sarcoidosis involves an intense leukocyte infiltration of the lung with the formation of non-necrotizing granulomas. CC chemokines (chemokine (C-C motif) ligand 2 (CCL2)-CCL5) are chemoattractants of mononuclear cells and act through seven transmembrane G-coupled receptors. Previous studies have demonstrated conflicting results with regard to the associations of these chemokines with sarcoidosis. In an effort to clarify previous discrepancies, we performed the largest observational study to date of CC chemokines in bronchoalveolar lavage fluid (BALF) from patients with pulmonary sarcoidosis. Results BALF chemokine levels from 72 patients affected by pulmonary sarcoidosis were analyzed by enzyme-linked immunosorbent assay (ELISA) and compared to 8 healthy volunteers. BALF CCL3 and CCL4 levels from pulmonary sarcoidosis patients were not increased compared to controls. However, CCL2 and CCL5 levels were elevated, and subgroup analysis showed higher levels of both chemokines in all stages of pulmonary sarcoidosis. CCL2, CCL5, CC chemokine receptor type 1 (CCR1), CCR2 and CCR3 were expressed from mononuclear cells forming the lung granulomas, while CCR5 was only found on mast cells. Conclusions These data suggest that CCL2 and CCL5 are important mediators in recruiting CCR1, CCR2, and CCR3 expressing mononuclear cells as well as CCR5-expressing mast cells during all stages of pulmonary sarcoidosis.

  11. A detection system for the study of alpha and proton radioactivity on the Daresbury recoil mass separator

    International Nuclear Information System (INIS)

    A detection system has been constructed to measure the alpha and proton decays of short-lived (> μs) nuclear species lying in the proximity of the proton drip line. Proton-rich nuclei produced in fusion-evaporation reactions at angles around 00 are mass separated in flight using the Daresbury Recoil Mass Separator. A two-dimensionally position sensitive silicon surface barrier detector is used to measure evaporation residue implantations and decays. The position information is used to identify the mass of the parent nucleus and to correlate causally related events. The operation and performance of the detection system are described. (orig.)

  12. Compartmentalized Production of CCL17 In Vivo

    OpenAIRE

    Alferink, Judith; Lieberam, Ivo; Reindl, Wolfgang; Behrens, Andrea; Weiß, Susanne; Hüser, Norbert; Gerauer, Klaus; Ross, Ralf; Reske-Kunz, Angelika B.; Ahmad-Nejad, Parviz; Wagner, Hermann; Förster, Irmgard

    2003-01-01

    Dendritic cells (DCs)* fulfill an important regulatory function at the interface of the innate and adaptive immune system. The thymus and activation-regulated chemokine (TARC/CCL17) is produced by DCs and facilitates the attraction of activated T cells. Using a fluorescence-based in vivo reporter system, we show that CCL17 expression in mice is found in activated Langerhans cells and mature DCs located in various lymphoid and nonlymphoid organs, and is up-regulated after stimulation with Toll...

  13. X-ray study of a SODART flight telescope using the expanded beam x-ray optics beamline at the Daresbury synchrotron

    DEFF Research Database (Denmark)

    Christensen, Finn Erland; Hornstrup, Allan; Frederiksen, P. K.;

    1995-01-01

    The on- and off-axis imaging properties of the first of two SODART flight telescopes have been studied using the expanded beam x-ray facility at the Daresbury synchrotron. From on- axis measurements the encircled power distribution and the point spread function at three energies 6.627 keV, 8.837 ke...

  14. Macrophage derived chemokine (CCL22, thymus and activation-regulated chemokine (CCL17, and CCR4 in idiopathic pulmonary fibrosis

    Directory of Open Access Journals (Sweden)

    Yamaguchi Kazuhiro

    2009-08-01

    Full Text Available Abstract Background Idiopathic pulmonary fibrosis (IPF is a chronically progressive interstitial lung disease of unknown etiology. Previously, we have demonstrated the selective upregulation of the macrophage-derived chemokine CCL22 and the thymus activation-regulated chemokine CCL17 among chemokines, in a rat model of radiation pneumonitis/pulmonary fibrosis and preliminarily observed an increase in bronchoalveolar (BAL fluid CCL22 levels of IPF patients. Methods We examined the expression of CCR4, a specific receptor for CCL22 and CCL17, in bronchoalveolar lavage (BAL fluid cells, as well as the levels of CCL22 and CCL17, to elucidate their pathophysiological roles in pulmonary fibrosis. We also studied their immunohistochemical localization. Results BAL fluid CCL22 and CCL17 levels were significantly higher in patients with IPF than those with collagen vascular diseases and healthy volunteers, and there was a significant correlation between the levels of CCL22 and CCL17 in patients with IPF. CCL22 levels in the BAL fluid did not correlate with the total cell numbers, alveolar lymphocytes, or macrophages in BAL fluid. However, the CCL22 levels significantly correlated with the numbers of CCR4-expressing alveolar macrophages. By immunohistochemical and immunofluorescence analysis, localization of CCL22 and CCR4 to CD68-positive alveolar macrophages as well as that of CCL17 to hyperplastic epithelial cells were shown. Clinically, CCL22 BAL fluid levels inversely correlated with DLco/VA values in IPF patients. Conclusion We speculated that locally overexpressed CCL22 may induce lung dysfunction through recruitment and activation of CCR4-positive alveolar macrophages.

  15. CCL9 - Wikipedia, the free encyclopedia [Gene Wiki

    Lifescience Database Archive (English)

    Full Text Available CCL9 - Wikipedia, the free encyclopediaCCL9From Wikipedia, the free encyclopediaJump to:navigati ... doi:10.4049/jimmunol.171.6.2797. PMID 12960300. ^ Lean ... J, Murphy C, Fuller K, Chambers T (2002). "CCL9/MI ...

  16. Many Roles of CCL20: Emphasis on Breast Cancer

    Science.gov (United States)

    Osuala, Kingsley O.; Sloane, Bonnie F.

    2016-01-01

    CCL20 or MIP3α is a small ~8 kDa protein primarily expressed in the liver, colon, prostate, cervix, and skin. The cellular receptor for CCL20 is CCR6. CCl20 unlike many other cytokines only binds CCR6, making the CCL20/CCR6 pathway an attractive drug target. Since the initial discovery of CCL20 in the early 1990's, there has been an increase in the evidence implicating the chemokine and its receptor in a number of diseases, including rheumatoid arthritis and human immunodeficiency virus infection. CCL20 has also been linked to malignancies such as ovarian, colorectal and pancreatic cancers. CCL20 can also attract tumor-promoting immune-suppressive cells to the tumor microenvironment, which may contribute to the immune evasive potential of the tumor and tumor progression.

  17. CCL7 and CCL21 overexpression in gastric cancer is associated with lymph node metastasis and poor prognosis

    Institute of Scientific and Technical Information of China (English)

    Tsann-Long Hwang; Li-Yu Lee; Chee-Chan Wang; Ying Liang; Shu-Fang Huang; Chi-Ming Wu

    2012-01-01

    AIM:TO investigate how a complex network of CC chemokine ligands (CCLs) and their receptors influence the progression of tumor and metastasis.METHODS:In the present study,we used immunohistochemistry to examine the expression of CCL7,CCL8 and CCL21 in 194 gastric cancer samples and adjacent normal tissues.We analyzed their correlation with tumor metastasis,clinicopathologic parameters and clinical outcome.RESULTS:We found that the higher expression of CCL7 and CCL21 in cancer tissues than in normal tissues was significantly correlated with advanced depth of wall invasion,lymph node metastasis and higher tumor node metastasis stage.Moreover,Kaplan-Meier survival analysis revealed that CCL7 and CCL21 overexpression in cancer tissues was correlated with poor prognosis.CONCLUSION:These results suggest that overexpression of these two CC chemokine ligands is associated with tumor metastasis and serves as a prognostic factor in patients with gastric cancer.

  18. The Carbon Tetrachloride (CCl4) Budget: Mystery or Not

    Science.gov (United States)

    Liang, Qing; Newman, Paul A.; Daniel, John S.; Reimann, Stefan; Hall, Bradley; Dutton, Geoff; Kuijpers, Lambert J. M.

    2014-01-01

    Carbon tetrachloride (CCl4) is a major anthropogenic ozone-depleting substance and greenhouse gas and has been regulated under the Montreal Protocol. However, atmospheric observations show a very slow decline in CCl4 concentrations, inconsistent with the nearly zero emissions estimate based on the UNEP reported production and feedstock usage in recent years. It is now apparent that there are either unidentified industrial leakages, an unknown production source of CCl4, or large legacy emissions from CCl4 contaminated sites. In this paper we use a global chemistry climate model to assess the budget mystery of atmospheric CCl4. We explore various factors that affect the global trend and the gradient between the Northern and Southern hemispheres or interhemispheric gradient (IHG): emissions, emission hemispheric partitioning, and lifetime variations. We find a present-day emission of 30-50 Gg per yr and a total lifetime 25 - 36 years are necessary to reconcile both the observed CCl4 global trend and IHG.

  19. Biological destruction of CCl4: I -- Experimental design and data

    International Nuclear Information System (INIS)

    A denitrifying consortium capable of transforming carbon tetrachloride (CCl4) was cultured from aquifer sediment from the US Department of Energy's Hanford Site in southeastern Washington State. To understand the kinetics of the biological destruction of CCl4 by these microbes, a set of experiments, the conditions of which were chosen according to a fractional factorial experimental design, were completed. This article reports on the experimental design along with the results for CCl4, biomass, acetate, nitrate, and nitrite concentrations. These data indicate that growth is inhibited by high nitrite concentrations, whereas CCl4 degradation is slowed by the presence of nitrate and/or nitrite

  20. Regulation of CCL2 and CCL3 expression in human brain endothelial cells by cytokines and lipopolysaccharide

    Directory of Open Access Journals (Sweden)

    Dorovini-Zis Katerina

    2010-01-01

    Full Text Available Abstract Background Chemokines are emerging as important mediators of CNS inflammation capable of activating leukocyte integrins and directing the migration of leukocyte subsets to sites of antigenic challenge. In this study we investigated the expression, release and binding of CCL2 (MCP-1 and CCL3 (MIP-1α in an in vitro model of the human blood-brain barrier. Methods The kinetics of expression and cytokine upregulation and release of the β-chemokines CCL2 and CCL3 were studied by immunocytochemistry and enzyme-linked immunosorbent assay in primary cultures of human brain microvessel endothelial cells (HBMEC. In addition, the differential binding of these chemokines to the basal and apical endothelial cell surfaces was assessed by immunoelectron microscopy. Results Untreated HBMEC synthesize and release low levels of CCL2. CCL3 is minimally expressed, but not released by resting HBMEC. Treatment with TNF-α, IL-1β, LPS and a combination of TNF-α and IFN-γ, but not IFN-γ alone, significantly upregulated the expression and release of both chemokines in a time-dependent manner. The released CCL2 and CCL3 bound to the apical and basal endothelial surfaces, respectively. This distribution was reversed in cytokine-activated HBMEC resulting in a predominantly basal localization of CCL2 and apical distribution of CCL3. Conclusions Since cerebral endothelial cells are the first resident CNS cells to contact circulating leukocytes, expression, release and presentation of CCL2 and CCL3 on cerebral endothelium suggests an important role for these chemokines in regulating the trafficking of inflammatory cells across the BBB in CNS inflammation.

  1. CCL2 mediates the circadian response to low dose endotoxin.

    Science.gov (United States)

    Duhart, José M; Brocardo, Lucila; Mul Fedele, Malena L; Guglielmotti, Angelo; Golombek, Diego A

    2016-09-01

    The mammalian circadian system is mainly originated in a master oscillator located in the suprachiasmatic nuclei (SCN) in the hypothalamus. Previous reports from our and other groups have shown that the SCN are sensitive to systemic immune activation during the early night, through a mechanism that relies on the action of proinflammatory factors within this structure. Chemokine (C-C motif) ligand 2 (CCL2) is induced in the brain upon peripheral immune activation, and it has been shown to modulate neuronal physiology. In the present work we tested whether CCL2 might be involved in the response of the circadian clock to peripheral endotoxin administration. The CCL2 receptor, C-C chemokine receptor type 2 (CCR2), was detected in the SCN of mice, with higher levels of expression during the early night, when the clock is sensitive to immune activation. Ccl2 was induced in the SCN upon intraperitoneal lipopolysaccharide (LPS) administration. Furthermore, mice receiving an intracerebroventricular (Icv) administration of a CCL2 synthesis inhibitor (Bindarit), showed a reduction LPS-induced circadian phase changes and Icv delivery of CCL2 led to phase delays in the circadian clock. In addition, we tested the possibility that CCL2 might also be involved in the photic regulation of the clock. Icv administration of Bindarit did not modify the effects of light pulses on the circadian clock. In summary, we found that CCL2, acting at the SCN level is important for the circadian effects of immune activation. PMID:27178133

  2. 15 CFR 738.2 - Commerce Control List (CCL) structure.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 2 2010-01-01 2010-01-01 false Commerce Control List (CCL) structure... COMMERCE CONTROL LIST OVERVIEW AND THE COUNTRY CHART § 738.2 Commerce Control List (CCL) structure. (a... Avionics 8—Marine 9—Propulsion Systems, Space Vehicles and Related Equipment (b) Groups. Within...

  3. Thymic CCL2 influences induction of T-cell tolerance

    DEFF Research Database (Denmark)

    Cédile, O; Løbner, M; Toft-Hansen, H;

    2014-01-01

    promoting experimental autoimmune encephalomyelitis (EAE), a mouse model for multiple sclerosis. We here show that CCL2 is constitutively expressed by endothelial cells and TEC in the thymus. Transgenic mice overexpressing CCL2 in the thymus showed an increased number of thymic plasmacytoid DC and...

  4. Fine structure of the CCl3 UV absorption spectrum and CCl3 kinetics

    DEFF Research Database (Denmark)

    Ellermann, T.

    1992-01-01

    The UV gas-phase spectrum of CCl3 was recorded in the range 220-300 nm using pulse radiolysis of CHCl3/SF6 or CCl4/Ar gas mixtures. The UV spectrum exhibits a pronounced vibrational fine structure which is assigned to transition into the (C2A1'(3s)) Rydberg state. The vibronic progression has a...

  5. Induction and effector phase of allergic lung inflammation is independent of CCL21/CCL19 and LT-beta

    Directory of Open Access Journals (Sweden)

    Corinne Ploix, Riaz I. Zuberi, Fu-Tong Liu, Monica J. Carson, David D. Lo

    2009-01-01

    Full Text Available The chemokines CCL21 and CCL19, and cell bound TNF family ligand lymphotoxin beta (LTβ, have been associated with numerous chronic inflammatory diseases. A general role in chronic inflammatory diseases cannot be assumed however; in the case of allergic inflammatory disease, CCL21/CCL19 and LTβ have not been associated with the induction, recruitment, or effector function of Th2 cells nor dendritic cells to the lung. We have examined the induction of allergic inflammatory lung disease in mice deficient in CCL21/CCL19 or LTβ and found that both kinds of mice can develop allergic lung inflammation. To control for effects of priming differences in knockout mice, adoptive transfers of Th2 cells were also performed, and they showed that such effector cells had equivalent effects on airway hyper-responsiveness in both knockout background recipients. Moreover, class II positive antigen presenting cells (B cells and CD11c+ dendritic cells showed normal recruitment to the peribronchial spaces along with CD4 T cells. Thus, the induction of allergic responses and recruitment of both effector Th2 cells and antigen presenting cells to lung peribronchial spaces can develop independently of CCL21/CCL19 and LTβ.

  6. The Intricate Expression of CC Chemokines in Glial Tumors: Evidence for Involvement of CCL2 and CCL5 but Not CCL11

    Directory of Open Access Journals (Sweden)

    Mozhgan Moogooei

    2015-12-01

    Full Text Available Chemokines are biologically active peptides involved in the pathogenesis of various pathologies including brain malignancies. They are amongst primitive regulators of the development of immune responses against malignant glial tumors. The present study aimed to examine the expression of CC chemokines in anaplastic astrocytoma and glioblastoma multiform patients at both mRNA and protein levels. Blood specimens in parallel with stereotactic biopsy specimens were obtained from 123 patients suffering from glial tumors and 100 healthy participants as a control. The serum levels of CCL2, CCL5, and CCL11 were measured by ELISA and stereotactic samples subjected to western and northern blotting methods for protein and mRNA, respectively. Demographic characteristics were also collected by a researcher-designed questionnaire. Results of the present study indicated that, however,CCL2 andCCL5 are elevated in serum and tumor tissues of patients suffering from a glial tumor at both mRNA and protein levels, theCCL11 was almost undetectable. According to the findings of the present investigation, it could presumably be reasonable to conclude that chemokines are good predictive molecules for expecting disease severity, metastasis, and response to treatment.

  7. The Intricate Expression of CC Chemokines in Glial Tumors: Evidence for Involvement of CCL2 and CCL5 but Not CCL11.

    Science.gov (United States)

    Moogooei, Mozhgan; Shamaei, Masoud; Khorramdelazad, Hossein; Fattahpour, Shirin; Seyedmehdi, Seyed Mohammad; Moogooei, Maryam; Hassanshahi, Gholamhossein; Kalantari Khandani, Behjat

    2015-12-01

    Chemokines are biologically active peptides involved in the pathogenesis of various pathologies including brain malignancies. They are amongst primitive regulators of the development of immune responses against malignant glial tumors. The present study aimed to examine the expression of CC chemokines in anaplastic astrocytoma and glioblastoma multiform patients at both mRNA and protein levels. Blood specimens in parallel with stereotactic biopsy specimens were obtained from 123 patients suffering from glial tumors and 100 healthy participants as a control. The serum levels of CCL2, CCL5, and CCL11 were measured by ELISA and stereotactic samples subjected to western and northern blotting methods for protein and mRNA, respectively. Demographic characteristics were also collected by a researcher-designed questionnaire. Results of the present study indicated that, however,CCL2 and CCL5 are elevated in serum and tumor tissues of patients suffering from a glial tumor at both mRNA and protein levels, the CCL11 was almost undetectable. According to the findings of the present investigation, it could presumably be reasonable to conclude that chemokines are good predictive molecules for expecting disease severity, metastasis, and response to treatment. PMID:26749234

  8. Daresbury 1982/3

    International Nuclear Information System (INIS)

    Report headings are: introduction (general survey); synchrotron radiation (experimental programme; Synchrotron Radiation Source); nuclear structure (experimental work on the NSF; Nuclear Structure Facility); theory and computational science; computing and electronics; other activities and services; events 1982/83; facts and figures; publications. (U.K.)

  9. CCL3L1-CCR5 genotype improves the assessment of AIDS Risk in HIV-1-infected individuals.

    Directory of Open Access Journals (Sweden)

    Hemant Kulkarni

    Full Text Available BACKGROUND: Whether vexing clinical decision-making dilemmas can be partly addressed by recent advances in genomics is unclear. For example, when to initiate highly active antiretroviral therapy (HAART during HIV-1 infection remains a clinical dilemma. This decision relies heavily on assessing AIDS risk based on the CD4+ T cell count and plasma viral load. However, the trajectories of these two laboratory markers are influenced, in part, by polymorphisms in CCR5, the major HIV coreceptor, and the gene copy number of CCL3L1, a potent CCR5 ligand and HIV-suppressive chemokine. Therefore, we determined whether accounting for both genetic and laboratory markers provided an improved means of assessing AIDS risk. METHODS AND FINDINGS: In a prospective, single-site, ethnically-mixed cohort of 1,132 HIV-positive subjects, we determined the AIDS risk conveyed by the laboratory and genetic markers separately and in combination. Subjects were assigned to a low, moderate or high genetic risk group (GRG based on variations in CCL3L1 and CCR5. The predictive value of the CCL3L1-CCR5 GRGs, as estimated by likelihood ratios, was equivalent to that of the laboratory markers. GRG status also predicted AIDS development when the laboratory markers conveyed a contrary risk. Additionally, in two separate and large groups of HIV+ subjects from a natural history cohort, the results from additive risk-scoring systems and classification and regression tree (CART analysis revealed that the laboratory and CCL3L1-CCR5 genetic markers together provided more prognostic information than either marker alone. Furthermore, GRGs independently predicted the time interval from seroconversion to CD4+ cell count thresholds used to guide HAART initiation. CONCLUSIONS: The combination of the laboratory and genetic markers captures a broader spectrum of AIDS risk than either marker alone. By tracking a unique aspect of AIDS risk distinct from that captured by the laboratory parameters

  10. Higher circulating levels of chemokines CXCL10, CCL20 and CCL22 in patients with ischemic heart disease.

    Science.gov (United States)

    Safa, A; Rashidinejad, H R; Khalili, M; Dabiri, S; Nemati, M; Mohammadi, M M; Jafarzadeh, A

    2016-07-01

    Recruitment of leukocytes is one of the earliest events in the pathogenesis of ischemic heart disease (IHD) and chemokines play an important role in the migration of these cells into the inflammation sites. The aim of this study was to evaluate the CXCL10, CCL20 and CCL22 levels and the single nucleotide polymorphisms (SNPs) rs4508917, rs6749704 and rs4359426 in chemokine genes in patients with IHD to clarify any association. A total of 300 patients with IHD as having acute myocardial infarction (AMI; n=100), stable angina (SA; n=100) or unstable angina (UA; n=100) and 100 healthy subjects as a control group were enrolled to study. Serum samples from all participants were tested for the CXCL10, CCL20 and CCL22 levels by using ELISA. The SNPs were determined by polymerase chain reaction-restriction length polymorphism (PCR-RFLP) method. The mean serum concentrations of CXCL10, CCL20 and CCL22 in AMI patients (395.97±21.20Pg/mL, 108.38±10.31Pg/mL and 1852.58±205.77Pg/mL), SA patients (405.48±27.36Pg/mL, 90.20±7.69Pg/mL and 2322.04±231.23Pg/mL) and UA patients (396.69±22.79Pg/mL, 141.87±18.10Pg/mL and 2754.89±211.70Pg/mL) were significantly higher than in the healthy group (179.38±8.85Pg/mL, 51.92±4.62Pg/mL and 451.82±23.76Pg/mL, respectively; PACE) inhibitors and patients without mentioned treatment regarding the levels of chemokines. The frequency of the GG genotype at SNP rs4508917 in CXCL10 gene was higher, whereas the frequency of the AA genotype at SNP rs4359426 in CCL22 gene was lower in total patients with IHD as compared with healthy subjects (P<0.04 and P<0.002, respectively). These results showed that the higher levels of CXCL10, CCL20 and CCL22 were associated with IHD. The serum levels of chemokines may influence by the certain traditional risk factors of IHD and some studied SNPs, but did not influence by treatment and gender of patients. PMID:27152707

  11. Analysis of the heat capacity for pure CH4 and CH4/CCl4 on graphite near the melting point and calculation of the T-X phase diagram for (CH3)CCl3 + CCl4

    Science.gov (United States)

    Yurtseven, Hamit; Yılmaz, Aygül

    2016-06-01

    We study the temperature dependence of the heat capacity Cp for the pure CH4 and the coadsorbed CH4/CCl4 on graphite near the melting point. The heat capacity peaks are analyzed using the experimental data from the literature by means of the power-law formula. The critical exponents for the heat capacity are deduced below and above the melting point for CH4 (Tm = 104.8 K) and CH4/CCl4 (Tm = 99.2 K). Our exponent values are larger as compared with the predicted values of some theoretical models exhibiting second order transition. Our analyses indicate that the pure methane shows a nearly second order (weak discontinuity in the heat capacity peak), whereas the transition in coadsorbed CH4/CCl4 is of first order (apparent discontinuity in Cp). We also study the T – X phase diagram of a two-component system of CH3CCl3+CCl4 using the Landau phenomenological model. Phase lines of the R+L (rhombohedral+liquid) and FCC+L (face-centred cubic + liquid) are calculated using the observed T – X phase diagram of this binary mixture. Our results show that the Landau mean field theory describes the observed behavior of CH3CCl3+CCl4 adequately. From the calculated T – X phase diagram, critical behavior of some thermodynamic quantities can be predicted at various temperatures and concentrations (CCl4) for a binary mixture of CH3CCl3+CCl4.

  12. Error and tolerance estimates for the SSC CCL

    International Nuclear Information System (INIS)

    After a CCL is designed, its performance is usually checked by a multiparticle simulation code, such as CCLDYN, which can estimate beam loss and emittance growth and display beam profiles and phase-space projections at points along the length of the CCL. The code CCLTRACE replaces the multi-particle dynamics of CCLDYN with the beam ellipsoid dynamics of TRACE 3-D. The authors have used a new code, CCLTRACE, to estimate error and tolerance limits for two possible examples of a 1,284-MHz, 70- to 600-MeV coupled-cavity linac (CCL) for the SSC linac. By calculating the dynamics of the beam center as well as the beam ellipsoid, CCLTRACE can efficiently perform error studies using Monte Carlo techniques

  13. Effect of CCl4 on positronium formation in isooctane

    International Nuclear Information System (INIS)

    The effect of CCl4 in positronium (Ps) formation is examined in isooctane through positron lifetime spectroscopy experiments, in the framework of a series of studies on AOT-based reverse micellar systems. This solute appears as a rather strong Ps formation inhibitor, as expected in view of its well-known electron scavenging properties. The reciprocal of the triplet Ps intensity (1/Ι3) varies linearly with CCl4 concentration (C), up to about 0.08M, allowing to derive a high inhibition constant, k=36.6M-1. Above 0.08M, however, the inhibition slackens out, which is attributed to an anti-inhibition effect. On the basis of previous reports on halocompounds, a general scheme of reactions is proposed to occur in the positron spur, including, besides the primary Ps formation through the e+/e- reaction and the recombination reactions, electron scavenging by CCl4 as the direct inhibiting reaction, followed by the reaction of the thus formed anion with the positron. The latter reaction may lead either to a [CCl4Ps] bound-state or, if the positron picks off the electron from the anion, to some additional Ps formation. By using a simple quantitative approach to this scheme, an equation descriptive of the variation of Ι3 with C is derived which agrees well with the experimental data. (author)

  14. Error and tolerance estimates for the SSC CCL

    International Nuclear Information System (INIS)

    A new code, CCLTRACE, has been used to estimate error and tolerance limits for two possible examples of a 1284-MHz, 70--600 MeV CCL for the SSC Linac. By calculating the dynamics of the beam center as well as the beam ellipsoid, CCLTRACE can efficiently perform error studies using Monte Carlo techniques

  15. Photocatalytic decomposition of CCl4 on Zr-MCM-41

    International Nuclear Information System (INIS)

    Photocatalytic decomposition of CCl4 (80 mg L-1 in H2O) effected by Zr-MCM-41 (Zr incorporated in the amorphous wall of MCM-41) has been studied in the present work. Experimentally, photocatalytic decomposition of CCl4 on Zr-MCM-41 was enhanced by about 1.96 times over that on ZrO2. Photocatalytic decomposition of CCl4 may proceed via a two-electron transfer process that yields mainly CHCl3, Cl- and H2. Since little C2Cl2, C2Cl6 or CH2Cl2 was found, it is unlikely that CHCl3 involved in the secondary photocatalytic degradation process. In addition, photocatalytic splitting of H2O on Zr-MCM-41 was also enhanced. The yield of H2 was 6.5 mmol (g ZrO2)-1. About 68% of this hydrogen (6.5 mmol (g ZrO2)-1) was consumed in the photocatalytic decomposition of CCl4

  16. Dynamic Heterogeneity In The Monoclinic Phase Of CCl$_4$

    CERN Document Server

    Caballero, Nirvana B; Carignano, Marcelo; Serra, Pablo

    2016-01-01

    Carbon tetrachloride (CCl$_4$) is one of the simplest compounds having a translationally stable monoclinic phase while exhibiting a rich rotational dynamics below 226 K. Recent nuclear quadrupolar resonance (NQR) experiments revealed that the dynamics of CCl$_4$ is similar to that of the other members of the isostructural series CBr$_{n}$Cl$_{4-n}$, suggesting that the universal relaxation features of canonical glasses such as $\\alpha$- and $\\beta$-relaxation are also present in non-glass formers. Using molecular dynamics (MD) simulations we studied the rotational dynamics in the monoclinic phase of CCl$_4$. The molecules undergo $C3$ type jump-like rotations around each one of the four C-Cl bonds. The rotational dynamics is very well described with a master equation using as the only input the rotational rates measured from the simulated trajectories. It is found that the heterogeneous dynamics emerges from faster and slower modes associated with different rotational axes, which have fixed orientations relat...

  17. CCL11-induced eosinophils inhibit the formation of blood vessels and cause tumor necrosis.

    Science.gov (United States)

    Xing, Yanjiang; Tian, Yijun; Kurosawa, Takamasa; Matsui, Sayaka; Touma, Maki; Yanai, Takanori; Wu, Qiong; Sugimoto, Kenkichi

    2016-06-01

    We previously demonstrated that IL-18 and CCL11 were highly expressed in an NFSA tumor cell line that showed limited angiogenesis and severe necrosis. However, IL-18 was not responsible for the immune cell accumulation and necrosis. Here, we attempted to clarify the relevance of CCL11 in angiogenesis and tumor formation. We established CCL11-overexpressing MS-K cell clones (MS-K-CCL11) to assess the role of CCL11 in immune cell accumulation and angiogenesis. The MS-K-CCL11 cells did not form tumors in mice. MS-K-CCL11-conditioned medium (CM) and recombinant CCL11 induced macrophage and eosinophil differentiation from bone marrow cells. The MS-K-CCL11-CM effectively recruited the differentiated eosinophils. Furthermore, the eosinophils damaged the MS-K, NFSA and endothelial cells in a dose-dependent manner. Administration of an antagonist of CCR3, a CCL11 receptor, to NFSA tumor-bearing mice restored the blood vessel formation and blocked the eosinophil infiltration into the NFSA tumors. Furthermore, other CCL11-overexpressing LM8 clones were established, and their tumor formation ability was reduced compared to the parental LM8 cells, accompanied by increased eosinophil infiltration, blockade of angiogenesis and necrosis. These results indicate that CCL11 was responsible for the limited angiogenesis and necrosis by inducing and attracting eosinophils in the tumors. PMID:27169545

  18. Protective role of Juniperus phoenicea and Cupressus sempervirens against CCl

    Directory of Open Access Journals (Sweden)

    Sanaa Ahmed Ali

    2010-12-01

    Full Text Available AIM: To investigate the role of Cupressus sempervirens (C. sempervirens and Juniperus phoenicea (J. phoenicea extracts as therapeutic effect against CCl4 with biochemical, histopathological evaluations.METHODS: A single intraperitoneal dose of 10% CCl4 in olive oil (1 mL/kg body weight was administered to a group of female Wister rats, sacrificed after 24 h (as the injury group. The other groups were given CCl4 as described above and divided as follows: two groups of ten rats each were orally administered either J. phoenicea extract or C. sempervirens extract three times per week for six weeks and a further group administered CCl4 was left for six weeks to allow self-recovery. At the end of experiment, the rats from all groups were sacrificed for sampling and for biochemical and histological analysis.RESULTS: Remarkable disturbances were observed in the levels of all tested parameters. On the other hand, rats injected with the toxic agent and left for one and a half month to self recover showed moderate improvements in the studied parameters while, treatment with both medicinal herbal extracts ameliorated the levels of the disturbed biochemical parameters. The group treated with J. phoenicea extract showed a remarkable improvement in comparison to the CCl4 treated group. The C. sempervirens group revealing an even more remarkable effect showing histopathological liver& kidney profiles close to those of the control group.CONCLUSION: C. sempervirens and J. phoenicea leaf extracts show a remarkable effect in enhancing liver and kidney functions and may thus be of therapeutic potential in treatment hepatotoxicity and nephrotoxicity.

  19. Attractive halogen-halogen interactions: F3CCl...FH and F3CCl...FCH3 dimers

    International Nuclear Information System (INIS)

    The F3CCl...FH and F3CCl...FCH3 dimers, which feature the halogen-halogen contacts, are investigated at MP2/6-311++G(d,p) and MP2/aug-cc-pVDZ levels of approximation. The binding energies of these complexes are found to be comparable to those of the weak hydrogen bonds. In both complexes the Cl...F are found to be significantly shorter than the sum of the corresponding van der Waals radii. The C-Cl...F contacts are also found to exhibit certain deviation from linearity. However, the energy differences between linear and bent structures are very small and primarily accounted for by electrostatic interactions between remote parts of the dimer. This indicates a high conformational flexibility of the halogen-halogen contacts and may help to explain the diversity of structural features in crystals formed by halogen-containing molecules. In both dimers the halogen-halogen interaction leads to certain shortening of the C-Cl electron accepting bond. This is accompanied by a small increase of the C-Cl stretching frequency. Hence, the two investigated dimers can possibly be classified as the blue-shifting halogen-halogen contacts

  20. Role of CCR4 Ligands, CCL17 and CCL22, During Schistosoma mansoni Egg-Induced Pulmonary Granuloma Formation in Mice

    OpenAIRE

    Jakubzick, Claudia; Wen, Haitao; Matsukawa, Akihiro; Keller, Maya; Kunkel, Steven L.; Hogaboam, Cory M.

    2004-01-01

    Controversy persists pertaining to the role of CCR4 ligands, namely CCL17 (or thymus and activation regulated chemokine; TARC) and CCL22 (or macrophage-derived chemokine; MDC), in Th2-type cytokine-dominated responses in the lung. Accordingly, the present study addressed the relative role of each of these CC chemokines during an evolving pulmonary granulomatous response elicited by the intrapulmonary embolization of live Schistosoma mansoni eggs into S. mansoni-sensitized mice. CCL22 protein ...

  1. CCL2 Increases X4-tropic HIV-1 Entry into Resting CD4+ T Cells*

    OpenAIRE

    Campbell, Grant R.; Spector, Stephen A.

    2008-01-01

    During human immunodeficiency virus type 1 (HIV-1) infection, there is a strong positive correlation between CCL2 levels and HIV viral load. To determine whether CCL2 alters HIV-1 infection of resting CD4+ T cells, we infected purified resting CD4+ T cells after incubation with CCL2. We show that CCL2 up-regulates CXCR4 on resting CD4+ T cells in a CCR2-dependent mechanism, and that this augmentation of CXCR4 expression by CCL2 increases the ability of these cells to b...

  2. Interferon-gamma coordinates CCL3-mediated neutrophil recruitment in vivo

    Directory of Open Access Journals (Sweden)

    Foster Barbara

    2009-03-01

    Full Text Available Abstract Background We have shown previously that acute infection with the respiratory pathogen, pneumonia virus of mice (PVM, results in local production of the proinflammatory chemokine, CCL3, and that neutrophil recruitment in response to PVM infection is reduced dramatically in CCL3 -/- mice. Results In this work, we demonstrate that CCL3-mediated neutrophil recruitment is coordinated by interferon-gamma (IFNγ. Neutrophil recruitment in response to PVM infection was diminished five-fold in IFNγ receptor gene-deleted mice, although neutrophils from IFNγR -/- mice expressed transcripts for the CCL3 receptor, CCR1 and responded functionally to CCL3 ex vivo. Similarly, in the absence of PVM infection, CCL3 overexpression alone could not elicit neutrophil recruitment in the absence of IFNγ. Interestingly, although supplemental IFNγ restored neutrophil recruitment and resulted in a sustained weight loss among CCL3-overexpressing IFNγ -/- mice, CCL3-mediated neutrophil recruitment alone did not result in the pulmonary edema or respiratory failure characteristic of severe viral infection, suggesting that CCL3 and IFN-γ together are sufficient to promote neutrophil recruitment but not pathologic activation. Conclusion Our findings reveal a heretofore unrecognized hierarchical interaction between the IFNγ and CCL3, which demonstrate that IFNγ is crucial for CCL3-mediated neutrophil recruitment in vivo.

  3. Role of suppressed hepatocellular regeneration and Ca2+ in chlordecone-potentiated CCl4 hepatotoxicity

    International Nuclear Information System (INIS)

    The mechanism by which the chlorinated pesticide chlordecone (CD; Kepone) potentiates CCl4-induced hepatotoxicity and lethality was investigated. It was hypothesized that perturbations in Ca2+ homeostasis, greater than those observed with a low dose of CCl4 alone, in concert with a suppression of hepatocellular regeneration induced by CD alone or by CD + CCl4 are responsible, at least in part, for CD-potentiated CCl4 hepatotoxicity. Ca2+ homeostasis was evaluated by measuring total cell Ca2+ and 45Ca2+ uptake in viable isolated hepatocyte suspension obtained from normal and CD-pretreated rats receiving CCl4 in vivo. In the normal rats in vivo CCL challenge did not affect 45Ca2+ uptake by viable isolated hepatocytes. In contrast, 45Ca2+ uptake was inhibited in viable isolated hepatocytes obtained from rats exposed to CD + CCl4

  4. Computer simulation and cold model testing of CCL cavities

    International Nuclear Information System (INIS)

    The SSC coupled-cavity-linac (CCL) consists of nine modules with eight tanks in each module. Multicavity magnetically coupled bridge couplers are used to couple the eight tanks within a module into one RF resonant chain. The operating frequency is 1282.851 MHz. In this paper we discuss both computer calculations and cold model measurements to determine the geometry dimension of the RF structure

  5. CCL3L gene copy number and survival in an HIV-1 infected Zimbabwean population

    DEFF Research Database (Denmark)

    Larsen, Margit Hørup; Wegner, Lise Thørner; Zinyama, Rutendo;

    2012-01-01

    The C-C motif chemokine ligand 3-like (CCL3L) protein is a potent chemoattractant which by binding to C-C chemokine receptor type 5 (CCR5) inhibits human immunodeficiency virus (HIV) entry. Copy number variation (CNV) of the CCL3L has been shown to be associated with HIV susceptibility and progre.......9), viral load (P=0.9), or CCL3 protein levels (P=1.0). Survival among the HIV infected individuals did not differ according to CCL3L copy number. In this cohort, CCL3L CNV did not affect HIV status, pathogenesis, or survival.......The C-C motif chemokine ligand 3-like (CCL3L) protein is a potent chemoattractant which by binding to C-C chemokine receptor type 5 (CCR5) inhibits human immunodeficiency virus (HIV) entry. Copy number variation (CNV) of the CCL3L has been shown to be associated with HIV susceptibility and...... progression to AIDS, but these results have been inconsistent. We examined a Zimbabwean study population for an association of CCL3L CNV with HIV status, progression (CD4 T-cells and viral load), and survival. Another aim was to investigate the possible effects of CCL3L CNV on CCL3 protein concentration. A...

  6. Functional characterization of ferret CCL20 and CCR6 and identification of chemotactic inhibitors.

    Science.gov (United States)

    Qin, Shulin; Klamar, Cynthia R; Fallert Junecko, Beth A; Craigo, Jodi; Fuller, Deborah H; Reinhart, Todd A

    2013-03-01

    CCL20 is currently the only known chemokine ligand for the receptor CCR6, and is a mucosal chemokine involved in normal and pathological immune responses. Although nucleotide sequence data are available for ccl20 and ccr6 sequences from multiple species, the ferret ccl20 and ccr6 sequences have not been determined. To increase our understanding of immune function in ferret models of infection and vaccination, we have used RT-PCR to obtain the ferret ccl20 and ccr6 cDNA sequences and functionally characterize the encoded proteins. The open reading frames of both genes were highly conserved across species and mostly closely related to canine sequences. For functional analyses, single cell clones expressing ferret CCR6 were generated, a ferret CCL20/mouse IgG(2a) fusion protein (fCCL20-mIgG(2a)) was produced, and fCCL20 was chemically synthesized. Cell clones expressing ferret CCR6 responded chemotactically to fCCL20-mIgG2a fusion protein and synthetic ferret CCL20. Chemotaxis inhibition studies identified the polyphenol epigallocatechin-3-gallate and the murine γ-herpesvirus 68 M3 protein as inhibitors of fCCL20. Surface plasmon resonance studies revealed that EGCG bound directly to fCCL20. These results provide molecular characterization of previously unreported ferret immune gene sequences and for the first time identify a broad-spectrum small molecule inhibitor of CCL20 and reveal CCL20 as a target for the herpesviral M3 protein. PMID:23360828

  7. Elevated expression of the chemokine CCL18 in chronic rhinosinusitis with nasal polyps

    Science.gov (United States)

    Peterson, Sarah; Poposki, Julie A.; Nagarkar, Deepti R.; Chustz, Regina T.; Peters, Anju T.; Suh, Lydia A.; Carter, Roderick; Norton, James; Harris, Kathleen E.; Grammer, Leslie C.; Tan, Bruce K.; Chandra, Rakesh K.; Conley, David B.; Kern, Robert C.; Schleimer, Robert P.; Kato, Atsushi

    2011-01-01

    Background Chronic rhinosinusitis with nasal polyps (CRSwNP) is associated with Th2-dominant inflammation including eosinophilia, in contrast to non-polypoid CRS (CRSsNP). Chemokine CCL18/PARC (pulmonary and activation regulated chemokine) is known to recruit naïve T cells, B cells, and immature dendritic cells, as well as activate fibroblasts. CCL18is thought to be involved in Th2-related inflammatory diseases including asthma and atopic dermatitis. Objectives The objective of this study was to investigate the expression of CCL18 in patients with CRS. Methods Using nasal polyp tissue (NP) and uncinate tissue (UT) from controls and patients with CRS, we examined the expression of CCL18 mRNA by real-time PCR and measured CCL18 protein by ELISA, western blot and immunofluorescence. Results Compared to UT tissue in control subjects, CCL18 mRNA was significantly increased in NP (p<0.001) and UT (p<0.05) from patients with CRSwNP but not in UT from patients with CRSsNP. Similarly, CCL18 protein was elevated in NP and UT from CRSwNP and levels were even higher in Samter’s triad patients. Immunohistochemical analysis revealed CCL18 expression in inflammatory cells and CCL18+ cells were significantly increased in NP. Immunofluorescence data showed co-localization of CCL18 in CD68+/CD163+/macrophage mannose receptor+ M2 macrophages and tryptase+ mast cells in NP. Levels of CCL18 correlated with markers of M2 macrophages but not with tryptase, suggesting that M2 macrophages are a major CCL18-producing cells in NP. Conclusion Overproduction of CCL18 might contribute to the pathogenesis of CRSwNP through its known activities, which include recruitment of lymphocytes and dendritic cells, activation of fibroblasts, and initiation of local inflammation. PMID:21943944

  8. Laser capture microdissection and cDNA array analysis of endometrium identify CCL16 and CCL21 as epithelial-derived inflammatory mediators associated with endometriosis

    Directory of Open Access Journals (Sweden)

    Jones Rebecca L

    2007-05-01

    Full Text Available Abstract Background Understanding the pathophysiology of chemokine secretion in endometriosis may offer a novel area of therapeutic intervention. This study aimed to identify chemokines differentially expressed in epithelial glands in eutopic endometrium from normal women and those with endometriosis, and to establish the expression profiles of key chemokines in endometriotic lesions. Methods Laser capture microdissection isolated epithelial glands from endometrial eutopic tissue from women with and without endometriosis in the mid-secretory phase of their menstrual cycles. Gene profiling of the excised glands used a human chemokine and receptor cDNA array. Selected chemokines were further examined using real-time PCR and immunohistochemistry. Results 22 chemokine/receptor genes were upregulated and two downregulated in pooled endometrial epithelium of women with endometriosis compared with controls. CCL16 and CCL21 mRNA was confirmed as elevated in some women with endometriosis compared to controls on individual samples. Immunoreactive CCL16 and CCL21 were predominantly confined to glands in eutopic and ectopic endometrium: leukocytes also stained. Immunoreactive CCL16 was overall higher in glands in ectopic vs. eutopic endometrium from the same woman (P Conclusion This study provides novel candidate molecules and suggests a potential local role for CCL16 and CCL21 as mediators contributing to the inflammatory events associated with endometriosis.

  9. CONSTRUCTION OF EUKARYOTIC EXPRESSION VECTOR FOR HUMAN CCL21 AND CHARACTERIZATION OF ITS CHEMOTACTIC ACTIVITY

    Institute of Scientific and Technical Information of China (English)

    HOU Li; LIU Qi; JIAO Yu-lian; ZHANG Jie; WANG Lai-cheng; MA Chun-yan; CUI Bin; ZHANG Xue; ZHAO Yue-ran

    2006-01-01

    Objective: To obtain recombinant human CCL21 with biological activity from eukaryotic expression system for further use in cancer gene therapy. Methods: A fragment of human CCL21 gene was obtained from pSK-hCCL21 plasmid digested by Xho I and BamH I, inserted into the responding sites of eukaryotic expression vector pVAX1, and then transfected into COS-7 cells by electroporation method. The expression of hCCL21 protein was detected by western blotting analysis. The in vitro chemotaxis assay was used to test the chemotactic function of the expression product to lymphocytes. Results: Human CCL21 protein was expressed by transfected COS-7 cells with recombinant plasmid containing hCCL21 gene, and was verified by western blotting. The in vitro chemotaxis assay demonstrated that human CCL21 protein had a potent chemotactic function to lymphocytes. Conclusion: Human CCL21 was successfully and transiently expressed in eukaryotic cells, which lays some foundation for the study of CCL21 gene therapy in murine tumor models.

  10. Decomposition of CCl4 and CHCl3 on gliding arc plasma

    Institute of Scientific and Technical Information of China (English)

    Antonius Indarto; CHOI Jae-wook; LEE Hwaung; SONG Hyung-keun

    2006-01-01

    Decomposition of chlorinated hydrocarbons, CCl4 and CHCl3, in gliding plasma was examined. The effects of initial concentrations, total gas flow rates, and power consumption have been investigated. The conversion result was relatively high. It reached 80% for CCl4 and 97% for CHCl3. Using atmospheric air as the carrier gas, the plasma reaction occurred at exothermic reaction and the main products were CO2, CO, and Cl2. Transformation into CCl4 was also detected for CHCl3 decomposition reaction.The conversion of CCl4 and CHCl3 were increased with the increasing applied frequency and decreasing total gas flow rate.

  11. Impact of Tumor-Derived CCL2 on Macrophage Effector Function

    Directory of Open Access Journals (Sweden)

    Brault M. S.

    2005-01-01

    Full Text Available Monocyte chemoattractant protein-1 (MCP-1, CCL2 is produced by many different types of cells. In the current investigation, the effect of tumor-derived CCL2 on macrophages was evaluated to determine the extent to which this chemokine influenced the innate immune response to cancer. To do this, we used the 4T1 murine mammary carcinoma cell line that constitutively expresses CCL2 and generated 4T1 expressing an antisense CCL2 transcript. The antisense-CCL2-expressing 4T1 produced no detectable CCL2. Macrophages from female BALB/c mice were exposed to supernatants from these tumor cells. The results showed that tumor-derived CCL2 was capable of modulating cytokine gene expression but not protein production in resting, activated, and tumor-associated macrophages. In addition, tumor-derived CCL2 did not affect phagocytic activity, nitric oxide production, or cytolytic activity of the macrophages. Overall, these data suggest that tumor-derived CCL2 does not directly influence macrophage-mediated antitumor activity.

  12. CCL7 Is a Protective Factor Secreted by Mechanically Loaded Osteocytes

    OpenAIRE

    Kitase, Y.; Lee, S.; Gluhak-Heinrich, J; Johnson, M.L.; Harris, S.E.; Bonewald, L. F.

    2014-01-01

    In a search for factors up-regulated by mechanical strain in osteocytes, we discovered that chemokine (C-C motif) ligand 7 (CCL7), a chemotactic myokine, was highly expressed in MLO-Y4 osteocyte-like cells. Although MLO-Y4 cells secrete potent chemotactic factors for osteoclast precursors, CCL7 was not responsible for this activity. CCL7 was increased in osteocytes in response to tooth movement in vivo. Since mechanical loading plays a crucial role in maintaining osteocyte viability, CCL7 was...

  13. CCL7 is a protective factor secreted by mechanically loaded osteocytes.

    Science.gov (United States)

    Kitase, Y; Lee, S; Gluhak-Heinrich, J; Johnson, M L; Harris, S E; Bonewald, L F

    2014-11-01

    In a search for factors up-regulated by mechanical strain in osteocytes, we discovered that chemokine (C-C motif) ligand 7 (CCL7), a chemotactic myokine, was highly expressed in MLO-Y4 osteocyte-like cells. Although MLO-Y4 cells secrete potent chemotactic factors for osteoclast precursors, CCL7 was not responsible for this activity. CCL7 was increased in osteocytes in response to tooth movement in vivo. Since mechanical loading plays a crucial role in maintaining osteocyte viability, CCL7 was tested for protective activity and found to be protective against cell death induced by dexamethasone and etoposide. CCL7 specific antibody partially, but in combination with indomethacin, completely abrogated the protective effects of fluid flow shear stress against dexamethasone-induced cell death. CCL7 activated the β-catenin pathway through phosphorylation of glycogen synthase kinase 3 (GSK-3), suggesting that this pathway is responsible for the observed protective effects. A related cytokine, CCL2, also produced by MLO-Y4 cells but not regulated by mechanical loading, proved to be more potent and protected against cell death induced by not only dexamethasone, but also by Tumor Necrosis Factor α (TNFα). Whereas osteocytes may produce CCL2 in constitutively low levels, a major function of mechanically induced CCL7 may be to selectively protect osteocytes in an autocrine manner against glucocorticoid-induced cell death. PMID:25274752

  14. CCL11 enhances excitotoxic neuronal death by producing reactive oxygen species in microglia.

    Science.gov (United States)

    Parajuli, Bijay; Horiuchi, Hiroshi; Mizuno, Tetsuya; Takeuchi, Hideyuki; Suzumura, Akio

    2015-12-01

    The chemokine CCL11 (also known as eotaxin-1) is a potent eosinophil chemoattractant that mediates allergic diseases such as asthma, atopic dermatitis, and inflammatory bowel diseases. Previous studies demonstrated that concentrations of CCL11 are elevated in the sera and cerebrospinal fluids (CSF) of patients with neuroinflammatory disorders, including multiple sclerosis. Moreover, the levels of CCL11 in plasma and CSF increase with age, and CCL11 suppresses adult neurogenesis in the central nervous system (CNS), resulting in memory impairment. However, the precise source and function of CCL11 in the CNS are not fully understood. In this study, we found that activated astrocytes release CCL11, whereas microglia predominantly express the CCL11 receptor. CCL11 significantly promoted the migration of microglia, and induced microglial production of reactive oxygen species by upregulating nicotinamide adenine dinucleotide phosphate-oxidase 1 (NOX1), thereby promoting excitotoxic neuronal death. These effects were reversed by inhibition of NOX1. Our findings suggest that CCL11 released from activated astrocytes triggers oxidative stress via microglial NOX1 activation and potentiates glutamate-mediated neurotoxicity, which may be involved in the pathogenesis of various neurological disorders. PMID:26184677

  15. Estudi immunogenètic de les quimiocines CCL4 i CCL4L exemple i model de la complexitat de la superfamília de les quimiocines /

    OpenAIRE

    Colobran i Oriol, Roger

    2008-01-01

    Els resultats d'aquesta tesi doctoral, presentada per compendi de publicacions, es divideixen en 2 grups:A) Basats en la variabilitat de CCL4 i CCL4L:Article: Multiple Products Derived from Two CCL4 Loci: High Incidence of a New Polymorphism in HIV+ Patients. Roger Colobran, Patricia Adreani, Yaqoub Ashhab, Anuska Llano, José A. Esté, Orlando Dominguez, Ricardo Pujol-Borrell, and Manel Juan. The Journal of Immunology, 2005, 174: 5655-5664. Els locus CCL4 i CCL4L originen les quimiocines CCL4 ...

  16. TRPV1 receptor inhibition decreases CCL2-induced hyperalgesia

    Czech Academy of Sciences Publication Activity Database

    Špicarová, Diana; Adámek, Pavel; Kalynovska, Nataliia; Mrózková, Petra; Paleček, Jiří

    2014-01-01

    Roč. 81, JUN (2014), s. 75-84. ISSN 0028-3908 R&D Projects: GA ČR(CZ) GA305/09/1228; GA ČR(CZ) GPP303/12/P510; GA ČR(CZ) GBP304/12/G069; GA MŠk(CZ) LH12058 Grant ostatní: Univerzita Karlova(CZ) 253154 Institutional support: RVO:67985823 Keywords : pain * spinal cord * synaptic transmission * CCL2 * TRPV1 * EPSC Subject RIV: FH - Neurology Impact factor: 5.106, year: 2014

  17. Role of CCL17 and CCL22 expression in dendritic cells in maternal-fetal immune tolerance%母胎界面树突状细胞CCL17和CCL22表达在母胎免疫耐受中的作用

    Institute of Scientific and Technical Information of China (English)

    刘玉昆; 刘梅兰; 王蕴慧; 陈慧; 孟丽丽; 张建平

    2012-01-01

    AIM; To determine the expression of CCL17 and CCL22 in dendrilic cells (DC) from human de-cidua and endomelria. METHODS; The decidua were collecled from normal pregnanl women undergoing induced abortion and recurrent spontaneous abortion ( RSA) women undergoing early abortion. The endomelria were cllecled from non - pregnanl women undergoing abdominal hyslereclomy. The mononuclear cells in the decidua and endomelria were isolated. DC were induced by GM - CSF and IL - 4, cullured in vitro and idenlified. The expression of CCL17 and CCL22 in DC al mR-NA and prolein levels was analyzed by real - lime PCR and ELISA. RESULTS; The mRNA levels of CCL17 and CCL22 in decidual DC in normal pregnancy group were 3.04 ±0.40 and 1.83 ±0.24, respectively, significantly higher than those in endomelrial DC in non - pregnancy group (0. 85 ±0. 24 and 0. 31 ±0. 08 , respectively, P <0. 01) and ihose in decidual DC in RSA group (1.65 ±0. 14 and 0.96 ±0. 09,respectively,P <0. 01) . Decidual DC continually and slrongly secreted CCL17 and CCL22. The levels of CCL17 and CCL22 in normal pregnancy group were significantly higher than those in non - pregnancy group and RSA group at the same culture time point ( P < 0. 01). CONCLUSION; The expression of CCL17 and CCL22 in decidual DC in pregnant woman increases. This may attract more CD4 + CD25 + regulatory T cells to decidua and play an important role in the establishment of maternal - fetal immune tolerance.%目的:检测非孕期子宫内膜和正常妊娠早期及复发性自然流产患者蜕膜中树突状细胞(DC)CCL17和CCL22的表达差异,探讨母胎界面DC在CD4+CD25+调节性T细胞(Treg)的募集及母胎免疫耐受微环境形成中的作用.方法:正常早孕组人工流产时、复发性流产组清宫时取其蜕膜,正常未孕组行子宫切除时取其内膜组织.分离蜕膜或子宫内膜单个核细胞,体外诱导培养DC,用real-time PCR法分析3组DC CCL17和CCL22 mRNA的表达水平,ELISA法检测3组DC培养上清液中CCL

  18. Mutations in BALB mitochondrial DNA induce CCL20 up-regulation promoting tumorigenic phenotypes

    Energy Technology Data Exchange (ETDEWEB)

    Sligh, James [Department of Medicine—Dermatology Division, University of Arizona, Tucson, AZ 857 24 (United States); University of Arizona Cancer Center, Tucson, AZ 85724 (United States); Janda, Jaroslav [University of Arizona Cancer Center, Tucson, AZ 85724 (United States); Jandova, Jana, E-mail: jjandova@email.arizona.edu [Department of Medicine—Dermatology Division, University of Arizona, Tucson, AZ 857 24 (United States); University of Arizona Cancer Center, Tucson, AZ 85724 (United States)

    2014-11-15

    Highlights: • Alterations in mitochondrial DNA are commonly found in various human cancers. • Mutations in BALB mitochondrial DNA induce up-regulation of chemokine CCL20. • Increased growth and motility of mtBALB cells is associated with CCL20 levels. • mtDNA changes in BALB induce in vivo tumor growth through CCL20 up-regulation. • Mutations in mitochondrial DNA play important roles in keratinocyte neoplasia. - Abstract: mtDNA mutations are common in human cancers and are thought to contribute to the process of neoplasia. We examined the role of mtDNA mutations in skin cancer by generating fibroblast cybrids harboring a mutation in the gene encoding the mitochondrial tRNA for arginine. This somatic mutation (9821insA) was previously reported in UV-induced hyperkeratotic skin tumors in hairless mice and confers specific tumorigenic phenotypes to mutant cybrids. Microarray analysis revealed and RT-PCR along with Western blot analysis confirmed the up-regulation of CCL20 and its receptor CCR6 in mtBALB haplotype containing the mt-Tr 9821insA allele compared to wild type mtB6 haplotype. Based on reported role of CCL20 in cancer progression we examined whether the hyper-proliferation and enhanced motility of mtBALB haplotype would be associated with CCL20 levels. Treatment of both genotypes with recombinant CCL20 (rmCCL20) resulted in enhanced growth and motility of mtB6 cybrids. Furthermore, the acquired somatic alteration increased the in vivo tumor growth of mtBALB cybrids through the up-regulation of CCL20 since neutralizing antibody significantly decreased in vivo tumor growth of these cells; and tumors from anti-CCL20 treated mice injected with mtBALB cybrids showed significantly decreased CCL20 levels. When rmCCL20 or mtBALB cybrids were used as chemotactic stimuli, mtB6 cybrids showed increased motility while anti-CCL20 antibody decreased the migration and in vivo tumor growth of mtBALB cybrids. Moreover, the inhibitors of MAPK signaling and NF

  19. Mutations in BALB mitochondrial DNA induce CCL20 up-regulation promoting tumorigenic phenotypes

    International Nuclear Information System (INIS)

    Highlights: • Alterations in mitochondrial DNA are commonly found in various human cancers. • Mutations in BALB mitochondrial DNA induce up-regulation of chemokine CCL20. • Increased growth and motility of mtBALB cells is associated with CCL20 levels. • mtDNA changes in BALB induce in vivo tumor growth through CCL20 up-regulation. • Mutations in mitochondrial DNA play important roles in keratinocyte neoplasia. - Abstract: mtDNA mutations are common in human cancers and are thought to contribute to the process of neoplasia. We examined the role of mtDNA mutations in skin cancer by generating fibroblast cybrids harboring a mutation in the gene encoding the mitochondrial tRNA for arginine. This somatic mutation (9821insA) was previously reported in UV-induced hyperkeratotic skin tumors in hairless mice and confers specific tumorigenic phenotypes to mutant cybrids. Microarray analysis revealed and RT-PCR along with Western blot analysis confirmed the up-regulation of CCL20 and its receptor CCR6 in mtBALB haplotype containing the mt-Tr 9821insA allele compared to wild type mtB6 haplotype. Based on reported role of CCL20 in cancer progression we examined whether the hyper-proliferation and enhanced motility of mtBALB haplotype would be associated with CCL20 levels. Treatment of both genotypes with recombinant CCL20 (rmCCL20) resulted in enhanced growth and motility of mtB6 cybrids. Furthermore, the acquired somatic alteration increased the in vivo tumor growth of mtBALB cybrids through the up-regulation of CCL20 since neutralizing antibody significantly decreased in vivo tumor growth of these cells; and tumors from anti-CCL20 treated mice injected with mtBALB cybrids showed significantly decreased CCL20 levels. When rmCCL20 or mtBALB cybrids were used as chemotactic stimuli, mtB6 cybrids showed increased motility while anti-CCL20 antibody decreased the migration and in vivo tumor growth of mtBALB cybrids. Moreover, the inhibitors of MAPK signaling and NF

  20. CCL20/CCR6 Signaling Regulates Bone Mass Accrual in Mice.

    Science.gov (United States)

    Doucet, Michele; Jayaraman, Swaathi; Swenson, Emily; Tusing, Brittany; Weber, Kristy L; Kominsky, Scott L

    2016-07-01

    CCL20 is a member of the macrophage inflammatory protein family and is reported to signal monogamously through the receptor CCR6. Although studies have identified the genomic locations of both Ccl20 and Ccr6 as regions important for bone quality, the role of CCL20/CCR6 signaling in regulating bone mass is unknown. By micro-computed tomography (μCT) and histomorphometric analysis, we show that global loss of Ccr6 in mice significantly decreases trabecular bone mass coincident with reduced osteoblast numbers. Notably, CCL20 and CCR6 were co-expressed in osteoblast progenitors and levels increased during osteoblast differentiation, indicating the potential of CCL20/CCR6 signaling to influence osteoblasts through both autocrine and paracrine actions. With respect to autocrine effects, CCR6 was found to act as a functional G protein-coupled receptor in osteoblasts and although its loss did not appear to affect the number or proliferation rate of osteoblast progenitors, differentiation was significantly inhibited as evidenced by delays in osteoblast marker gene expression, alkaline phosphatase activity, and mineralization. In addition, CCL20 promoted osteoblast survival concordant with activation of the PI3K-AKT pathway. Beyond these potential autocrine effects, osteoblast-derived CCL20 stimulated the recruitment of macrophages and T cells, known facilitators of osteoblast differentiation and survival. Finally, we generated mice harboring a global deletion of Ccl20 and found that Ccl20(-/-) mice exhibit a reduction in bone mass similar to that observed in Ccr6(-/-) mice, confirming that this phenomenon is regulated by CCL20 rather than alternate CCR6 ligands. Collectively, these data indicate that CCL20/CCR6 signaling may play an important role in regulating bone mass accrual, potentially by modulating osteoblast maturation, survival, and the recruitment of osteoblast-supporting cells. © 2016 American Society for Bone and Mineral Research. PMID:26890063

  1. Expression of Ccl11 associates with immune response modulation and protection against neuroinflammation in rats.

    Directory of Open Access Journals (Sweden)

    Milena Z Adzemovic

    Full Text Available Multiple sclerosis (MS is a polygenic disease characterized by inflammation and demyelination in the central nervous system (CNS, which can be modeled in experimental autoimmune encephalomyelitis (EAE. The Eae18b locus on rat chromosome 10 has previously been linked to regulation of beta-chemokine expression and severity of EAE. Moreover, the homologous chemokine cluster in humans showed evidence of association with susceptibility to MS. We here established a congenic rat strain with Eae18b locus containing a chemokine cluster (Ccl2, Ccl7, Ccl11, Ccl12 and Ccl1 from the EAE- resistant PVG rat strain on the susceptible DA background and utilized myelin oligodendrocyte glycoprotein (MOG-induced EAE to characterize the mechanisms underlying the genetic regulation. Congenic rats developed a milder disease compared to the susceptible DA strain, and this was reflected in decreased demyelination and in reduced recruitment of inflammatory cells to the brain. The congenic strain also showed significantly increased Ccl11 mRNA expression in draining lymph nodes and spinal cord after EAE induction. In the lymph nodes, macrophages were the main producers of CCL11, whereas macrophages and lymphocytes expressed the main CCL11 receptor, namely CCR3. Accordingly, the congenic strain also showed significantly increased Ccr3 mRNA expression in lymph nodes. In the CNS, the main producers of CCL11 were neurons, whereas CCR3 was detected on neurons and CSF producing ependymal cells. This corresponded to increased levels of CCL11 protein in the cerebrospinal fluid of the congenic rats. Increased intrathecal production of CCL11 in congenic rats was accompanied by a tighter blood brain barrier, reflected by more occludin(+ blood vessels. In addition, the congenic strain showed a reduced antigen specific response and a predominant anti-inflammatory Th2 phenotype. These results indicate novel mechanisms in the genetic regulation of neuroinflammation.

  2. Upregulated baseline plasma CCL19 and CCR7 cell-surface expression on monocytes in early rheumatoid arthritis normalized during treatment and CCL19 correlated with radiographic progression

    DEFF Research Database (Denmark)

    Ellingsen, T; Hansen, I; Thorsen, J;

    2014-01-01

    OBJECTIVES: The aim of this study was to measure, in early rheumatoid arthritis (RA) patients, the concentration of CC-chemokine ligand 19 (CCL19) in plasma and the cell-surface expression of CC-chemokine receptor 7 (CCR7) on circulating monocytes and CD4+ T lymphocytes and to analyse correlations...... with disease activity and 5-year radiographic progression. METHOD: In disease-modifying anti-rheumatic drug (DMARD)-naïve RA patients (disease duration < 6 months), we measured plasma CCL19 by enzyme-linked immunosorbent assay (ELISA) (n = 160) and CCR7 cell-surface expression on monocytes and CD4+ T......-naïve RA patients, CCL19 plasma level and CCR7 surface expression on monocytes were upregulated and normalized after 1 year of treatment. Increased baseline plasma CCL19 level, anti-CCP antibody status, and TSS > 0 at baseline correlated independently with 5-year radiographic progression....

  3. Kinin B2 receptor regulates chemokines CCL2 and CCL5 expression and modulates leukocyte recruitment and pathology in experimental autoimmune encephalomyelitis (EAE in mice

    Directory of Open Access Journals (Sweden)

    Bader Michael

    2008-11-01

    Full Text Available Abstract Background Kinins are important mediators of inflammation and act through stimulation of two receptor subtypes, B1 and B2. Leukocyte infiltration contributes to the pathogenesis of autoimmune inflammation in the central nervous system (CNS, occurring not only in multiple sclerosis (MS but also in experimental autoimmune encephalomyelitis (EAE. We have previously shown that the chemokines CCL2 and CCL5 play an important role in the adhesion of leukocytes to the brain microcirculation in EAE. The aim of the present study was to evaluate the relevance of B2 receptors to leukocyte-endothelium interactions in the cerebral microcirculation, and its participation in CNS inflammation in the experimental model of myelin-oligodendrocyte-glycoprotein (MOG35–55-induced EAE in mice. Methods In order to evaluate the role of B2 receptor in the cerebral microvasculature we used wild-type (WT and kinin B2 receptor knockout (B2-/- mice subjected to MOG35–55-induced EAE. Intravital microscopy was used to investigate leukocyte recruitment on pial matter vessels in B2-/- and WT EAE mice. Histological documentation of inflammatory infiltrates in brain and spinal cords was correlated with intravital findings. The expression of CCL5 and CCL2 in cerebral tissue was assessed by ELISA. Results Clinical parameters of disease were reduced in B2-/- mice in comparison to wild type EAE mice. At day 14 after EAE induction, there was a significant decrease in the number of adherent leukocytes, a reduction of cerebral CCL5 and CCL2 expressions, and smaller inflammatory and degenerative changes in B2-/- mice when compared to WT. Conclusion Our results suggest that B2 receptors have two major effects in the control of EAE severity: (i B2 regulates the expression of chemokines, including CCL2 and CCL5, and (ii B2 modulates leukocyte recruitment and inflammatory lesions in the CNS.

  4. Chemokine CCL2 and chemokine receptor CCR2 in early active multiple sclerosis

    DEFF Research Database (Denmark)

    Sørensen, Torben Lykke; Ransohoff, R M; Strieter, R M; Sellebjerg, F

    2004-01-01

    The chemokine monocyte chemoattractant protein (MCP)-1/CCL2 and its receptor CCR2 have been strongly implicated in disease pathogenesis in experimental autoimmune encephalomyelitis, an animal model of multiple sclerosis (MS), whereas data on the CCL2-CCR2 axis are scarce in MS. We studied the...

  5. Polymerization of MIP-1 chemokine (CCL3 and CCL4) and clearance of MIP-1 by insulin-degrading enzyme

    Energy Technology Data Exchange (ETDEWEB)

    Ren, Min; Guo, Qing; Guo, Liang; Lenz, Martin; Qian, Feng; Koenen, Rory R.; Xu, Hua; Schilling, Alexander B.; Weber, Christian; Ye, Richard D.; Dinner, Aaron R.; Tang, Wei-Jen (IIT); (Aachen); (UC); (UIC)

    2010-12-07

    Macrophage inflammatory protein-1 (MIP-1), MIP-1{alpha} (CCL3) and MIP-1{beta} (CCL4) are chemokines crucial for immune responses towards infection and inflammation. Both MIP-1{alpha} and MIP-1{beta} form high-molecular-weight aggregates. Our crystal structures reveal that MIP-1 aggregation is a polymerization process and human MIP-1{alpha} and MIP-1{beta} form rod-shaped, double-helical polymers. Biophysical analyses and mathematical modelling show that MIP-1 reversibly forms a polydisperse distribution of rod-shaped polymers in solution. Polymerization buries receptor-binding sites of MIP-1{alpha}, thus depolymerization mutations enhance MIP-1{alpha} to arrest monocytes onto activated human endothelium. However, same depolymerization mutations render MIP-1{alpha} ineffective in mouse peritoneal cell recruitment. Mathematical modelling reveals that, for a long-range chemotaxis of MIP-1, polymerization could protect MIP-1 from proteases that selectively degrade monomeric MIP-1. Insulin-degrading enzyme (IDE) is identified as such a protease and decreased expression of IDE leads to elevated MIP-1 levels in microglial cells. Our structural and proteomic studies offer a molecular basis for selective degradation of MIP-1. The regulated MIP-1 polymerization and selective inactivation of MIP-1 monomers by IDE could aid in controlling the MIP-1 chemotactic gradient for immune surveillance.

  6. Absence of CCL2 and CCL3 Ameliorates Central Nervous System Grey Matter But Not White Matter Demyelination in the Presence of an Intact Blood-Brain Barrier.

    Science.gov (United States)

    Janssen, Katharina; Rickert, Mira; Clarner, Tim; Beyer, Cordian; Kipp, Markus

    2016-04-01

    A broad spectrum of diseases is characterized by myelin abnormalities, oligodendrocyte pathology, and concomitant glia activation, among multiple sclerosis (MS). Our knowledge regarding the factors triggering gliosis and demyelination is scanty. Chemokines are pivotal for microglia and astrocyte activation and orchestrate critical steps during the formation of central nervous system (CNS) demyelinating lesions. Redundant functions of chemokines complicate, however, the study of their functional relevance. We used the cuprizone model to study redundant functions of two chemokines, CCL2/MCP1 and CCL3/MIP1α, which are critically involved in the pathological process of cuprizone-induced demyelination. First, we generated a mutant mouse strain lacking functional genes of both chemokines and demonstrated that double-mutant animals are viable, fertile, and do not present with gross abnormalities. Astrocytes and peritoneal macrophages, cultured form tissues of these animals did neither express CCL2 nor CCL3. Exposure to cuprizone resulted in increased CCL2 and CCL3 brain levels in wild-type but not mutant animals. Cuprizone-induced demyelination, oligodendrocyte loss, and astrogliosis were significantly ameliorated in the cortex but not corpus callosum of chemokine-deficient animals. In summary, we provide a novel powerful model to study the redundant function of two important chemokines. Our study reveals that chemokine function in the CNS redounds to region-specific pathophysiological events. PMID:25663168

  7. Chemokines CXCL10 and CCL2: differential involvement in intrathecal inflammation in multiple sclerosis

    DEFF Research Database (Denmark)

    Sørensen, T.L.; Sellebjerg, F; Jensen, C.V.; Strieter, R.M.; Ransohoff, R.M.

    2001-01-01

    leukocyte count, the CSF concentration of neopterin, matrix metalloproteinase (MMP)-9, and intrathecal IgG and IgM synthesis. The concentration of CCL2 increased between baseline for 3 weeks in both groups, more distinctly so in patients treated with methylprednisolone. CCL2 correlated negatively with MMP-9...... patients in relapse, whilst levels of CCL2 (MCP-1) were reduced. Here, we report a serial analysis of CSF CXCL10 and CCL2 concentrations in 22 patients with attacks of MS or acute optic neuritis (ON) treated with methylprednisolone, and 26 patients treated with placebo in two randomized controlled trials....... Chemokine concentrations were measured by enzyme linked immunosorbent assay (ELISA) in CSF obtained at baseline and after 3 weeks, and were compared with other measures of intrathecal inflammation. At baseline CSF concentrations of CCL2 were significantly lower in the patient group than in controls. The...

  8. Antioksidan Ekstrak Air Biji Kopi Robusta Lampung dalam Menghambat Degenerasi Sel Hati Tikus Model Hepatitis yang Diinduksi CCL4

    Directory of Open Access Journals (Sweden)

    Asep Sukohar

    2012-09-01

    Full Text Available Liver plays an important role in maintaining homeostasis and is critical for physiological functions of other organs. Morphological changes of the liver will have an impact on changes in liver function and may appear as clinical manifestations. Hepatitis is a serious disorder that causes inflammation of the liver cells and is caused by viruses, chemicals and toxins. Reactions that occur in the form of oxidative stress, free radicals dominant condition of antioxidants. Traditionally coffee is used as an everyday beverage and known as antioxidants because it contains flavonoids (chlorogenic acid. This study aim was to determine the hepatoprotective/antioxidant effect of coffee growing in Pesawaran Lampung, on the description of hepatocyte cell damage in Wistar rats hepatitis model induced with carbon tetrachloride (CCl4. Laboratory experimental research has been conducted in Pharmacology >Department, Faculty Medicine Padjadjaran University Bandung and pathology examinations was performed at the Hospital Abdoel Moeloek Lampung in December 2008–July 2009, using 15 male Wistar rats divided in three groups, the negative control group, positive control as a model of hepatitis, and hepatitis model that received the water extract of robusta coffee beans 25 mg/kgBW/days for 7 days and then received CCl4 induction. The results were analyzed by analysis of variance and independent t test. Administration of water extract of robusta coffee beans can prevented damage to the liver cell degeneration picture from 58.4±7.09 to 34.4±5.85, these results differed significantly (p≤0.05 compared with positive and negative control. In conclusion, water extract of robusta coffee beans has the potential to prevent interference with the effects of liver function as antioxidants in the ra model of hepatitis which has been inducted with CCL4.

  9. In vivo metabolism of CCl/sub 4/ by rats pretreated with chlordecone, mirex, or phenobarbital

    Energy Technology Data Exchange (ETDEWEB)

    Mehendale, H.M.; Klingensmith, J.S.

    1988-04-01

    The propensity of chlordecone (CD) to potentiate hepatotoxic and lethal effects of CCl4 is well established. Mirex (M), a close structural analogue of CD, or phenobarbital (PB), powerful inducers of hepatic microsomal drug metabolizing enzymes, are much weaker potentiators of CCl4 toxicity. The purpose of this study was to test the possibility that CD potentiates the toxicity of CCl4 by increasing the metabolism of CCl4 to a greater degree than either PB or M. We compared the in vivo metabolism of CCl4 in rats pretreated with CD, M, or PB, by measuring the hepatic content of 14CCl4, the expiration of 14CCl4, expiration of 14CCl4-derived 14CO2, and lipid peroxidation. Male Sprague-Dawley rats (250-270 g) were pretreated with a single oral dose of CD (10 mg/kg), M (10 mg/kg), or corn oil vehicle (1 ml/kg). PB pretreatment consisted of an ip injection of sodium PB (80 mg/kg) in saline (0.9%) for 2 successive days. Twenty-four hours later, 14CCl4 (0.1 ml/kg; sp act: 0.04 mCi/mmol) was administered ip in corn oil and the radioactivity present in the expired air was collected for 6 hr. Excretion of the parent compound as represented by the 14C label in the toluene trap was unchanged by any of the pretreatments. Expiration of 14CO2 measured during the 6 hr after CCl4 administration was increased in animals pretreated with PB or CD. In vivo lipid peroxidation measured as diene conjugation in lipids extracted from the livers was increased to a similar extent in animals pretreated with PB and CD, whereas the serum transaminases (ALT, AST) were significantly elevated only in animals pretreated with CD.M did not affect 14CO2 production and was without a significant effect on the lipid peroxidation.

  10. In vivo metabolism of CCl4 by rats pretreated with chlordecone, mirex, or phenobarbital

    International Nuclear Information System (INIS)

    The propensity of chlordecone (CD) to potentiate hepatotoxic and lethal effects of CCl4 is well established. Mirex (M), a close structural analogue of CD, or phenobarbital (PB), powerful inducers of hepatic microsomal drug metabolizing enzymes, are much weaker potentiators of CCl4 toxicity. The purpose of this study was to test the possibility that CD potentiates the toxicity of CCl4 by increasing the metabolism of CCl4 to a greater degree than either PB or M. We compared the in vivo metabolism of CCl4 in rats pretreated with CD, M, or PB, by measuring the hepatic content of 14CCl4, the expiration of 14CCl4, expiration of 14CCl4-derived 14CO2, and lipid peroxidation. Male Sprague-Dawley rats (250-270 g) were pretreated with a single oral dose of CD (10 mg/kg), M (10 mg/kg), or corn oil vehicle (1 ml/kg). PB pretreatment consisted of an ip injection of sodium PB (80 mg/kg) in saline (0.9%) for 2 successive days. Twenty-four hours later, 14CCl4 (0.1 ml/kg; sp act: 0.04 mCi/mmol) was administered ip in corn oil and the radioactivity present in the expired air was collected for 6 hr. Excretion of the parent compound as represented by the 14C label in the toluene trap was unchanged by any of the pretreatments. Expiration of 14CO2 measured during the 6 hr after CCl4 administration was increased in animals pretreated with PB or CD. In vivo lipid peroxidation measured as diene conjugation in lipids extracted from the livers was increased to a similar extent in animals pretreated with PB and CD, whereas the serum transaminases (ALT, AST) were significantly elevated only in animals pretreated with CD.M did not affect 14CO2 production and was without a significant effect on the lipid peroxidation

  11. CCL2 responses to Mycobacterium tuberculosis are associated with disease severity in tuberculosis.

    Directory of Open Access Journals (Sweden)

    Zahra Hasan

    Full Text Available BACKGROUND: Leucocyte activating chemokines such as CCL2, CCL3, and CXCL8 together with proinflammatory IFNgamma, TNFalpha and downmodulatory IL10 play a central role in the restriction of M. tuberculosis infections, but is unclear whether these markers are indicative of tuberculosis disease severity. METHODOLOGY: We investigated live M. tuberculosis- and M. bovis BCG-induced peripheral blood mononuclear cell responses in patients with tuberculosis (TB and healthy endemic controls (ECs, n = 36. TB patients comprised pulmonary (PTB, n = 34 and extrapulmonary groups, subdivided into those with less severe localized extrapulmonary TB (L-ETB, n = 16 or severe disseminated ETB (D-ETB, n = 16. Secretion of CCL2, IFNgamma, IL10 and CCL3, and mRNA expression of CCL2, TNFalpha, CCL3 and CXCL8 were determined. RESULTS: M. tuberculosis- and BCG-induced CCL2 secretion was significantly increased in both PTB and D-ETB (p<0.05, p<0.01 as compared with L-ETB patients. CCL2 secretion in response to M. tuberculosis was significantly greater than to BCG in the PTB and D-ETB groups. M. tuberculosis-induced CCL2 mRNA transcription was greater in PTB than L-ETB (p = 0.023, while CCL2 was reduced in L-ETB as compared with D-ETB (p = 0.005 patients. M. tuberculosis-induced IFNgamma was greater in L-ETB than PTB (p = 0.04, while BCG-induced IFNgamma was greater in L-ETB as compared with D-ETB patients (p = 0.036. TNFalpha mRNA expression was raised in PTB as compared with L-ETB group in response to M. tuberculosis (p = 0.02 and BCG (p = 0.03. Mycobacterium-induced CCL3 and CXCL8 was comparable between TB groups. CONCLUSIONS: The increased CCL2 and TNFalpha in PTB patients may support effective leucocyte recruitment and M. tuberculosis localization. CCL2 alone is associated with severity of TB, possibly due to increased systemic inflammation found in severe disseminated TB or due to increased monocyte infiltration to lung parenchyma in pulmonary disease.

  12. In vivo metabolism of CCl4 by gerbils pretreated with chlordecone, phenobarbital, or mirex

    International Nuclear Information System (INIS)

    Gerbils are known to be much more sensitive to CCl4 lethality than rats as indicated by 48 hours LD50 (0.08 vs 2.8 ml/kg). On the other hand, gerbils are refractory to chlordecone (CD) potentiation of CCl4 toxicity. To investigate the possible mechanism underlying gerbil's high sensitivity to CCl4 lethality, the authors studied in vivo metabolism of CCl4 in gerbils pretreated with dietary CD (10 ppm), phenobarbital (PB, 225 ppm) or mirex (M, 10 ppm). The hepatic content of CCl4, the expiration of 14CCl4 and 14CCl4-derived Co2, and lipid peroxidation were measured and the results were compared with our previous data for rats. After 15-day dietary pretreatment, male gerbils (60-80 g) received 14CCl4 (80 ml/kg; sp act: 0.04 mCi/mmol) ip in corn oil and the expired air was collected for 6 hours. More than 80% of the dose administered was expired as parent compound in 6 hours regardless of pretreatments. Expiration of 14CCl4 derived 14CO2 in control gerbils was 3.5-fold more than in control rats and was increased significantly in pretreated gerbils (M>PB>CD). PB and M pretreatments resulted in significant increase of 14C label bound to non-lipid fraction of hepatic content as compared with CD or control gerbils. The radiolabel present in hepatic content of control gerbils was 5-fold higher than that of control rats. In vivo liquid peroxidation measured as diene conjugation in lipid extracts from the livers was lower in gerbils than in rats, and there were no significant differences among control and pretreated gerbils. These data indicate that the more extensive metabolism of CCl4 in gerbils may partially explain their high sensitivity to CCl4 toxicity. However, the significantly enhanced metabolism of CCl4 found in CD, PB, or M pretreated gerbils did not lead to amplification of CCl4 hepatotoxic and lethal effects

  13. UV and infrared absorption spectra, atmospheric lifetimes, and ozone depletion and global warming potentials for CCl2FCCl2F (CFC-112), CCl3CClF2 (CFC-112a), CCl3CF3 (CFC-113a), and CCl2FCF3 (CFC-114a)

    Science.gov (United States)

    Davis, Maxine E.; Bernard, François; McGillen, Max R.; Fleming, Eric L.; Burkholder, James B.

    2016-07-01

    The potential impact of CCl2FCF3 (CFC-114a) and the recently observed CCl2FCCl2F (CFC-112), CCl3CClF2 (CFC-112a), and CCl3CF3 (CFC-113a) chlorofluorocarbons (CFCs) on stratospheric ozone and climate is presently not well characterized. In this study, the UV absorption spectra of these CFCs were measured between 192.5 and 235 nm over the temperature range 207-323 K. Precise parameterizations of the UV absorption spectra are presented. A 2-D atmospheric model was used to evaluate the CFC atmospheric loss processes, lifetimes, ozone depletion potentials (ODPs), and the associated uncertainty ranges in these metrics due to the kinetic and photochemical uncertainty. The CFCs are primarily removed in the stratosphere by short-wavelength UV photolysis with calculated global annually averaged steady-state lifetimes (years) of 63.6 (61.9-64.7), 51.5 (50.0-52.6), 55.4 (54.3-56.3), and 105.3 (102.9-107.4) for CFC-112, CFC-112a, CFC-113a, and CFC-114a, respectively. The range of lifetimes given in parentheses is due to the 2σ uncertainty in the UV absorption spectra and O(1D) rate coefficients included in the model calculations. The 2-D model was also used to calculate the CFC ozone depletion potentials (ODPs) with values of 0.98, 0.86, 0.73, and 0.72 obtained for CFC-112, CFC-112a, CFC-113a, and CFC-114a, respectively. Using the infrared absorption spectra and lifetimes determined in this work, the CFC global warming potentials (GWPs) were estimated to be 4260 (CFC-112), 3330 (CFC-112a), 3650 (CFC-113a), and 6510 (CFC-114a) for the 100-year time horizon.

  14. CCL2 Promotes Colorectal Carcinogenesis by Enhancing Polymorphonuclear Myeloid-Derived Suppressor Cell Population and Function

    Directory of Open Access Journals (Sweden)

    Eunyoung Chun

    2015-07-01

    Full Text Available Our study reveals a non-canonical role for CCL2 in modulating non-macrophage, myeloid-derived suppressor cells (MDSCs and shaping a tumor-permissive microenvironment during colon cancer development. We found that intratumoral CCL2 levels increased in patients with colitis-associated colorectal cancer (CRC, adenocarcinomas, and adenomas. Deletion of CCL2 blocked progression from dysplasia to adenocarcinoma and reduced the number of colonic MDSCs in a spontaneous mouse model of colitis-associated CRC. In a transplantable mouse model of adenocarcinoma and an APC-driven adenoma model, CCL2 fostered MDSC accumulation in evolving colonic tumors and enhanced polymorphonuclear (PMN-MDSC immunosuppressive features. Mechanistically, CCL2 regulated T cell suppression of PMN-MDSCs in a STAT3-mediated manner. Furthermore, CCL2 neutralization decreased tumor numbers and MDSC accumulation and function. Collectively, our experiments support that perturbing CCL2 and targeting MDSCs may afford therapeutic opportunities for colon cancer interception and prevention.

  15. IL-9 induces CCL11 expression via STAT3 signalling in human airway smooth muscle cells.

    Directory of Open Access Journals (Sweden)

    Akira Yamasaki

    Full Text Available BACKGROUND: Previous findings support the concept that IL-9 may play a significant role in mediating both pro-inflammatory and changes in airway responsiveness that characterizes the atopic asthmatic state. We previously demonstrated that human airway smooth muscle (ASM cells express a functional IL-9R that mediate CCL11 expression. However, the signaling pathway governing this effect is not well understood. METHODOLOGY/PRINCIPAL FINDINGS: In this study, we showed that IL-9 mediated CCL11 expression in ASM cells does not rely on STAT6 or STAT5 but on STAT3 pathway. IL-9 induced rapid STAT3 activation in primary ASM cells that was not observed in case of STAT6 or STAT5. STAT3 binding to CCL11 promoter was also observed in vivo upon IL-9 stimulation of ASM cells. Disruption of STAT3 activity with SH2 domain binding inhibitory peptide results in significant reduction of IL-9 mediated CCL11 promoter activity. DN STAT3beta over-expression in ASM cells, but not Ser 727 STAT3 or STAT6 DN, abolishes IL-9 mediated CCL11 promoter activity. Finally, STAT3 but not STAT6 silenced ASM cells showed significant reduction in IL-9 mediated CCL11 promoter activity and mRNA expression. CONCLUSION/SIGNIFICANCE: Taken together, our results indicate that IL-9 mediated CCL11 via STAT3 signalling pathway may play a crucial role in airway inflammatory responses.

  16. Variations in CCL3L gene cluster sequence and non-specific gene copy numbers

    Directory of Open Access Journals (Sweden)

    Edberg Jeffrey C

    2010-03-01

    Full Text Available Abstract Background Copy number variations (CNVs of the gene CC chemokine ligand 3-like1 (CCL3L1 have been implicated in HIV-1 susceptibility, but the association has been inconsistent. CCL3L1 shares homology with a cluster of genes localized to chromosome 17q12, namely CCL3, CCL3L2, and, CCL3L3. These genes are involved in host defense and inflammatory processes. Several CNV assays have been developed for the CCL3L1 gene. Findings Through pairwise and multiple alignments of these genes, we have shown that the homology between these genes ranges from 50% to 99% in complete gene sequences and from 70-100% in the exonic regions, with CCL3L1 and CCL3L3 being identical. By use of MEGA 4 and BioEdit, we aligned sense primers, anti-sense primers, and probes used in several previously described assays against pre-multiple alignments of all four chemokine genes. Each set of probes and primers aligned and matched with overlapping sequences in at least two of the four genes, indicating that previously utilized RT-PCR based CNV assays are not specific for only CCL3L1. The four available assays measured median copies of 2 and 3-4 in European and African American, respectively. The concordance between the assays ranged from 0.44-0.83 suggesting individual discordant calls and inconsistencies with the assays from the expected gene coverage from the known sequence. Conclusions This indicates that some of the inconsistencies in the association studies could be due to assays that provide heterogenous results. Sequence information to determine CNV of the three genes separately would allow to test whether their association with the pathogenesis of a human disease or phenotype is affected by an individual gene or by a combination of these genes.

  17. CCL21/IL21-armed oncolytic adenovirus enhances antitumor activity against TERT-positive tumor cells.

    Science.gov (United States)

    Li, Yang; Li, Yi-Fei; Si, Chong-Zhan; Zhu, Yu-Hui; Jin, Yan; Zhu, Tong-Tong; Liu, Ming-Yuan; Liu, Guang-Yao

    2016-07-15

    Multigene-armed oncolytic adenoviruses are capable of efficiently generating a productive antitumor immune response. The chemokine (C-C motif) ligand 21 (CCL21) binds to CCR7 on naïve T cells and dendritic cells (DCs) to promote their chemoattraction to the tumor and resultant antitumor activity. Interleukin 21 (IL21) promotes survival of naïve T cells while maintaining their CCR7 surface expression, which increases their capacity to transmigrate in response to CCL21 chemoattraction. IL21 is also involved in NK cell differentiation and B cell activation and proliferation. The generation of effective antitumor immune responses is a complex process dependent upon coordinated interactions of various subsets of effector cells. Using the AdEasy system, we aimed to construct an oncolytic adenovirus co-expressing CCL21 and IL21 that could selectively replicate in TERTp-positive tumor cells (Ad-CCL21-IL21 virus). The E1A promoter of these oncolytic adenoviruses was replaced by telomerase reverse transcriptase promoter (TERTp). Ad-CCL21-IL21 was constructed from three plasmids, pGTE-IL21, pShuttle-CMV-CCL21 and AdEasy-1 and was homologously recombined and propagated in the Escherichia coli strain BJ5183 and the packaging cell line HEK-293, respectively. Our results showed that our targeted and armed oncolytic adenoviruses Ad-CCL21-IL21 can induce apoptosis in TERTp-positive tumor cells to give rise to viral propagation, in a dose-dependent manner. Importantly, we confirm that these modified oncolytic adenoviruses do not replicate efficiently in normal cells even under high viral loads. Additionally, we investigate the role of Ad-CCL21-IL21 in inducing antitumor activity and tumor specific cytotoxicity of CTLs in vitro. This study suggests that Ad-CCL21-IL21 is a promising targeted tumor-specific oncolytic adenovirus. PMID:27157859

  18. Zinc finger protein TTP interacts with CCL3 mRNA and regulates tissue inflammation*

    OpenAIRE

    Kang, Ju-Gyeong; Amar, Marcelo J.; Remaley, Alan T.; Kwon, Jaeyul; Blackshear, Perry J.; Wang, Ping-yuan; Hwang, Paul M.

    2011-01-01

    Zinc finger protein tristetraprolin (TTP) modulates macrophage inflammatory activity by destabilizing cytokine mRNAs. Here, through a screen of TTP-bound mRNAs in activated human macrophages, we have identified CC chemokine ligand 3 (CCL3) mRNA as the most abundantly bound TTP target mRNA and have characterized this interaction via conserved AU-rich elements. Compared to the wild-type cells, TTP−/− macrophages produced higher levels of LPS-induced CCL3. In addition, the plasma level of CCL3 i...

  19. Negative ion formation and motion in a mixture of CCl4 and Ar

    International Nuclear Information System (INIS)

    This paper deals with the measurement of the mobility of negative ions in the mixtures of CCl4 with Ar with the CCl4 ratio up to 33.3%. The pulsed Townsend technique was employed to produce an integrated ionic avalanche over a range of the density-reduced electric field E/N for which ionization is either negligible or absent, and attachment processes are dominant, leading to the formation of mostly CCl4-. The E/N range of measurement was 1-50 Td (1 Td=10-17 V cm2). Our measurements strongly suggest that attachment is the dominant process and only negative ions are formed

  20. A comprehensive estimate for loss of atmospheric carbon tetrachloride (CCl4) to the ocean

    OpenAIRE

    Butler, J. H.; S. A. Yvon-Lewis; Lobert, J. M.; King, D. B.; S. A. Montzka; Bullister, J. L.; Koropalov, V.; J. W. Elkins; B. D. Hall; Hu, L.; Liu, Y.

    2016-01-01

    Abstract. Extensive undersaturations of carbon tetrachloride (CCl4) in Pacific, Atlantic, and Southern Ocean surface waters indicate that atmospheric CCl4 is consumed in large amounts by the ocean. Observations made on 16 research cruises between 1987 and 2010, ranging in latitude from 60° N to 77° S, show that negative saturations extend over most of the surface ocean. Corrected for physical effects associated with radiative heat flux, mixing, and air injection, these anomalies were ...

  1. Adipose Tissue MicroRNAs as Regulators of CCL2 Production in Human Obesity

    OpenAIRE

    Arner, Erik; Mejhert, Niklas; Kulyté, Agné; Balwierz, Piotr J.; Pachkov, Mikhail; Cormont, Mireille; Lorente-Cebrián, Silvia; Ehrlund, Anna; Laurencikiene, Jurga; Hedén, Per; Dahlman-Wright, Karin; Tanti, Jean-François; Hayashizaki, Yoshihide; Rydén, Mikael; Dahlman, Ingrid

    2012-01-01

    In obesity, white adipose tissue (WAT) inflammation is linked to insulin resistance. Increased adipocyte chemokine (C-C motif) ligand 2 (CCL2) secretion may initiate adipose inflammation by attracting the migration of inflammatory cells into the tissue. Using an unbiased approach, we identified adipose microRNAs (miRNAs) that are dysregulated in human obesity and assessed their possible role in controlling CCL2 production. In subcutaneous WAT obtained from 56 subjects, 11 miRNAs were present ...

  2. Up-regulation of the chemokine CCL21 in the skin of subjects exposed to irritants

    Directory of Open Access Journals (Sweden)

    Kuznitzky Raquel

    2004-04-01

    Full Text Available Abstract Background Expression of murine CCL21 by dermal lymphatic endothelial cells (LEC has been demonstrated to be one of the most important steps in Langerhans cell emigration from skin. Previously, our group and others have found that this chemokine is up-regulated in different human inflammatory skin diseases mediated by diverse specific immune responses. This study was carried out to investigate the involvement of CCL21 in human skin after challenge with irritant agents responsible for inducing Irritant Contact Dermatitis (ICD. Results Eleven normal individuals were challenged with different chemical or physical irritants. Two patients with Allergic Contact Dermatitis (ACD were also challenged with the relevant antigen in order to have a positive control for CCL21 expression. Macroscopic as well as microscopic responses were evaluated. We observed typical ICD responses with mostly mononuclear cells in perivascular areas, but a predominance of polymorphonuclear cells away from the inflamed blood vessels and in the epidermis at 24 hours. Immunohistochemical studies showed up-regulation of CCL21 by lymphatic endothelial cells in all the biopsies taken from ICD and ACD lesions compared to normal skin. Kinetic study at 10, 48, 96 and 168 hours after contact with a classical irritant (sodium lauryl sulphate showed that the expression of CCL21 was increased in lymphatic vessels at 10 hours, peaked at 48 hours, and then gradually declined. There was a strong correlation between CCL21 expression and the macroscopic response (r = 0.69; p = 0.0008, but not between CCL21 and the number of infiltrating cells in the lesions. Conclusions These results provide new evidence for the role of CCL21 in inflammatory processes. Since the up-regulation of this chemokine was observed in ICD and ACD, it is tempting to speculate that this mechanism operates independently of the type of dermal insult, facilitating the emigration of CCR7+ cells.

  3. Up-regulation of the chemokine CCL21 in the skin of subjects exposed to irritants

    OpenAIRE

    Kuznitzky Raquel; Ruiz Lascano Alejandro; Ortiz Susana; Eberhard Yanina; Serra Horacio

    2004-01-01

    Abstract Background Expression of murine CCL21 by dermal lymphatic endothelial cells (LEC) has been demonstrated to be one of the most important steps in Langerhans cell emigration from skin. Previously, our group and others have found that this chemokine is up-regulated in different human inflammatory skin diseases mediated by diverse specific immune responses. This study was carried out to investigate the involvement of CCL21 in human skin after challenge with irritant agents responsible fo...

  4. Vibrational spectroscopy of SnBr4 and CCl4 using Lie algebraic approach

    Indian Academy of Sciences (India)

    Joydeep Choudhury; Srinivasa Rao Karmuri; Nirmal Kumar Sarkar; Ramendu Bhattacharjee

    2008-09-01

    The stretching and bending vibrational energies of SnBr4 and CCl4 are calculated in the one-dimensional framework. The dynamical symmetry group of tetrahedral molecule was taken into consideration to construct the model Hamiltonian in this frame-work. Casimir and Majorana invariant operators were also determined accordingly. Using the model Hamiltonian so constructed, we reported the vibrational energy levels of SnBr4 and CCl4 molecules accurately.

  5. CCL2-ethanol interactions and hippocampal synaptic protein expression in a transgenic mouse model

    Directory of Open Access Journals (Sweden)

    Donna eGruol

    2014-04-01

    Full Text Available Chronic exposure to ethanol produces a number of detrimental effects on behavior. Neuroadaptive changes in brain structure or function underlie these behavioral changes and may be transient or persistent in nature. Central to the functional changes are alterations in the biology of neuronal and glial cells of the brain. Recent data show that ethanol induces glial cells of the brain to produce elevated levels of neuroimmune factors including CCL2, a key innate immune chemokine. Depending on the conditions of ethanol exposure, the upregulated levels of CCL2 can be transient or persistent and outlast the period of ethanol exposure. Importantly, results indicate that the upregulated levels of CCL2 may lead to CCL2-ethanol interactions that mediate or regulate the effects of ethanol on the brain. Glial cells are in close association with neurons and regulate many neuronal functions. Therefore, effects of ethanol on glial cells may underlie some of the effects of ethanol on neurons. To investigate this possibility, we are studying the effects of chronic ethanol on hippocampal synaptic function in a transgenic mouse model that expresses elevated levels of CCL2 in the brain through enhanced glial expression, a situation know to occur in alcoholics. Both CCL2 and ethanol have been reported to alter synaptic function in the hippocampus. In the current study, we determined if interactions are evident between CCL2 and ethanol at level of hippocampal synaptic proteins. Two ethanol exposure paradigms were used; the first involved ethanol exposure by drinking and the second involved ethanol exposure in a paradigm that combines drinking plus ethanol vapor. The first paradigm does not produce dependence on ethanol, whereas the second paradigm is commonly used to produce ethanol dependence. Results show modest effects of both ethanol exposure paradigms on the level of synaptic proteins in the hippocampus of CCL2 transgenic mice compared with their non

  6. Phase Transition in CCl4 under Pressure: a Raman Spectroscopic Study

    Institute of Scientific and Technical Information of China (English)

    LIU Tie-Cheng; ZHOU Mi; GAO Shu-Qin; LI Zuo-Wei; LI Zhan-Long; ZHANG Peng; LI Liang; LV Tian-Quan; XU Da-Peng

    2009-01-01

    High-pressure Raman studies at room temperature are performed on CCla up to 13 GPa. The Raman bands of the internal modes (v2, v4 and v1) show entirely positive pressure dependence. The slopes dw/dP of the internal modes exhibit two sudden changes at 0.73 GPa and 7.13 GPa, respectively. A new lower frequency mode (225cm-1) appears at 3.03 GPa, and the splitting of v2, v3 and v4 occurs at about 7.13 GPa. Moreover, Raman spectra of Fermi resonance show that the relative position of the v1 + v4 combination and the v3 fundamental firstly interchanges corresponding to that at ambient pressure, then the v1 + va combination disappears in the gradual process of compression. It is indicated that the pressure-induced phase transition from CCl4 II to CCl4 III occurs at 0.73 GPa, and CCl4 III undergoes a transition to CCl4 IV below 3.03 GPa. Further CCl4 IV transforms in a new high-pressure phase at about 7.13 GPa, and the symmetry of the new high-pressure phase is lower than that of CCl4 IV. All the transitions are reversible during decompression.

  7. Neuronal-derived Ccl7 drives neuropathic pain by promoting astrocyte proliferation.

    Science.gov (United States)

    Ke, Bin Chang; Huang, Xia Xiao; Li, Yang; Li, Li Ya; Xu, Qin Xue; Gao, Yan; Liu, Yingju; Luo, Jie

    2016-08-01

    Recent studies suggest that peripheral nerve injury converts resting spinal cord astroglial cells into an activated state, which is required for the development and maintenance of neuropathic pain. However, the underlying mechanisms of how resting astrocytes are activated after nerve injury remain largely unknown. Astroglial cell proliferation and activation could be affected by endogenous factors including chemokines, growth factors, and neurotropic factor. Chemokine (C-C motif) ligand 7 (Ccl7) is essential in facilitating the development of neuropathic pain; however, the mechanism is unknown. In the present study, we found that Ccl7 promoted astrocyte proliferation and thus contributed toward neuropathic pain. Spinal nerve ligation increased the expression in the spinal cord of neuronal Ccl7. Behavioral analyses showed that knockdown of Ccl7 alleviated spinal nerve ligation-induced neuropathic pain. Further in-vitro study showed that neuronal-derived Ccl7 was sufficient for the proliferation and activation of astroglial cells. We found a novel mechanism of Ccl7 stimulating the proliferation and activation of spinal cord astrocytes that contributes toward neuropathic pain. PMID:27295026

  8. CCL2/MCP-I genotype-phenotype relationship in latent tuberculosis infection.

    Science.gov (United States)

    Hussain, Rabia; Ansari, Ambreen; Talat, Najeeha; Hasan, Zahra; Dawood, Ghaffar

    2011-01-01

    Among the known biomarkers, chemokines, secreted by activated macrophages and T cells, attract groups of immune cells to the site of infection and may determine the clinical outcome. Association studies of CCL-2/MCP-1 -2518 A/G functional SNP linked to high and low phenotypes with tuberculosis disease susceptibility have shown conflicting results in tuberculosis. Some of these differences could be due the variability of latent infection and recent exposure in the control groups. We have therefore carried out a detailed analysis of CCL-2 genotype SNP -2518 (A/G transition) with plasma CCL-2 levels and related these levels to tuberculin skin test positivity in asymptomatic community controls with no known exposure to tuberculosis and in recently exposed household contacts of pulmonary tuberculosis patients. TST positivity was linked to higher concentrations of plasma CCL2 (Mann Whitney U test; p = 0.004) and was more marked when the G allele was present in TST+ asymptomatic controls (A/G; p = 0.01). Recent exposure also had a significant effect on CCL-2 levels and was linked to the G allele (p = 0.007). Therefore association studies for susceptibility or protection from disease should take into consideration the PPD status as well as recent exposure of the controls group used for comparison. Our results also suggest a role for CCL-2 in maintaining the integrity of granuloma in asymptomatic individuals with latent infection in high TB burden settings. Therefore additional studies into the role of CCL-2 in disease reactivation and progression are warranted. PMID:21991356

  9. CCL2/MCP-I genotype-phenotype relationship in latent tuberculosis infection.

    Directory of Open Access Journals (Sweden)

    Rabia Hussain

    Full Text Available Among the known biomarkers, chemokines, secreted by activated macrophages and T cells, attract groups of immune cells to the site of infection and may determine the clinical outcome. Association studies of CCL-2/MCP-1 -2518 A/G functional SNP linked to high and low phenotypes with tuberculosis disease susceptibility have shown conflicting results in tuberculosis. Some of these differences could be due the variability of latent infection and recent exposure in the control groups. We have therefore carried out a detailed analysis of CCL-2 genotype SNP -2518 (A/G transition with plasma CCL-2 levels and related these levels to tuberculin skin test positivity in asymptomatic community controls with no known exposure to tuberculosis and in recently exposed household contacts of pulmonary tuberculosis patients. TST positivity was linked to higher concentrations of plasma CCL2 (Mann Whitney U test; p = 0.004 and was more marked when the G allele was present in TST+ asymptomatic controls (A/G; p = 0.01. Recent exposure also had a significant effect on CCL-2 levels and was linked to the G allele (p = 0.007. Therefore association studies for susceptibility or protection from disease should take into consideration the PPD status as well as recent exposure of the controls group used for comparison. Our results also suggest a role for CCL-2 in maintaining the integrity of granuloma in asymptomatic individuals with latent infection in high TB burden settings. Therefore additional studies into the role of CCL-2 in disease reactivation and progression are warranted.

  10. Expression and histopathological correlation of CCR9 and CCL25 in ovarian cancer.

    Science.gov (United States)

    Singh, Rajesh; Stockard, Cecil R; Grizzle, William E; Lillard, James W; Singh, Shailesh

    2011-08-01

    Ovarian carcinoma is the most lethal gynecological malignancy among women and its poor prognosis is mainly due to metastasis. Chemokine receptor CCR9 is primarily expressed by a small subset of immune cells. The interactions between CCL25 and CCR9 have been implicated in leukocyte trafficking to the small bowel, a frequent metastatic site for ovarian cancer cells. We have previously shown that ovarian cancer cells express CCR9 and play an important role in cell migration, invasion and survival in the presence of its natural ligand in vitro. In this study, we have evaluated the expression of CCR9 and CCL25 in ovarian cancer cells and clinical samples. Ovarian cancer tissue microarrays from University of Alabama at Birmingham and AccuMax were stained for CCR9 and CCL25. Aperio ScanScope was used to acquire 80X digital images and expression analysis of CCR9 and CCL25. Flow cytometry and the Image stream system were used to conform the expression of CCR9 and CCL25 in ovarian cancer cells. Our results show significantly higher (ptumor, dysgerminoma, transitional cell carcinoma, Brenner tumor, yolk sac tumor, adenocarcinoma and fibroma cases, compared to non-neoplastic ovarian tissue. Similar to tissue expression, CCR9 was also significantly expressed by the ovarian cancer cell lines (OVCAR-3 and SK-OV-3) in comparison to normal adult ovarian epithelial cell. We provide the first evidence that CCR9 and its natural ligand CCL25 are highly expressed by ovarian cancer tissue and their expression correlates with histological subtypes. Expression of this chemokine receptor and its ligand CCL25 within primary tumor tissue further suggests a potential role of this chemokine-receptor axis in ovarian cancer progression. PMID:21637913

  11. CCL2 Serum Levels and Adiposity Are Associated with the Polymorphic Phenotypes -2518A on CCL2 and 64ILE on CCR2 in a Mexican Population with Insulin Resistance

    OpenAIRE

    Milton-Omar Guzmán-Ornelas; Marcelo Heron Petri; Mónica Vázquez-Del Mercado; Efraín Chavarría-Ávila; Fernanda-Isadora Corona-Meraz; Sandra-Luz Ruíz-Quezada; Perla-Monserrat Madrigal-Ruíz; Jorge Castro-Albarrán; Flavio Sandoval-García; Rosa-Elena Navarro-Hernández

    2016-01-01

    Genetic susceptibility has been described in insulin resistance (IR). Chemokine (C-C motif) ligand-2 (CCL2) is overexpressed in white adipose tissue and is the ligand of C-C motif receptor-2 (CCR2). The CCL2 G-2518A polymorphism is known to regulate gene expression, whereas the physiological effects of the CCR2Val64Ile polymorphism are unknown. The aim of the study is to investigate the relationship between these polymorphisms with soluble CCL2 levels (sCCL2), metabolic markers, and adiposit...

  12. CCL-34, a synthetic toll-like receptor 4 activator, modulates differentiation and maturation of myeloid dendritic cells.

    Science.gov (United States)

    Fu, Shu-Ling; Lin, Chun-Cheng; Hsu, Ming-Ling; Liu, Sheng-Hung; Huang, Yu-Chuen; Chen, Yu-Jen

    2016-03-01

    CCL-34, a synthetic α-galactosylceramide analog, has been reported as an activator of toll-like receptor 4 (TLR4) in macrophages. TLR4 is highly expressed in dendritic cell (DC) and several TLR4 agonists are known to trigger DC maturation. We herein evaluated the effect of CCL-34 on DC maturation. Human CD14+ monocyte-derived immature DC were treated with CCL-34, its inactive structural analog CCL-44, or LPS to assess the DC maturation. CCL-34 induced DC maturation according to their characteristically dendrite-forming morphology, CD83 expression and IL-12p70 production. The allostimulatory activity of DC on proliferation of naive CD4+CD45+RA+ T cells and their secretion of interferon-γ was increased by CCL-34. Phagocytosis, an important function of immature DC, was reduced after CCL-34 treatment. All these effects related to DC maturation were evidently induced by positive control LPS but not by CCL-44 treatment. TLR4 neutralization impaired human DC maturation triggered by CCL-34. The induction of IL-12, a hallmark of DC maturation, by CCL-34 and LPS was only evident in TLR4-competent C3H/HeN, but not in TLR4-defective C3H/HeJ mice. CCL-34 could further elicit the antigen presentation capability in mice inoculated with doxorubicin-treated colorectal cancer cells. In summary, CCL-34 triggers DC maturation via a TLR4-dependent manner, which supports its potential application as an immunostimulator. PMID:26883191

  13. Pulse radiolysis study on the mechanisms of reactions of CCl3OO· radical with quercetin, rutin and epigallocatechin gallate

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    The mechanisms of reactions between CCl3OO· radical and quercetin, rutin and epigallocatechin gallate (EGCG) have been studied using pulse radiolytic technique. It is suggested that the electron transfer reaction is the main reaction between CCl3OO· radical and rutin, EGCG, but there are two main pathways for the reaction of CCl3OO· radical with quercetin, one is the electron transfer reaction, the other is addition reaction. The reaction rate constants were determined. It is proved that quercetin and rutin are better CCl3OO· radical scavengers than EGCG.

  14. Solving the carbon tetrachloride (CCl4) budget mystery using surface observations

    Science.gov (United States)

    Liang, Q.; Newman, P. A.; Daniel, J. S.; Reimann, S.; Hall, B. D.; Dutton, G. S.; Kuijpers, L. J. M.

    2014-12-01

    Carbon tetrachloride (CCl4) is a major anthropogenic ozone-depleting substance, with an ozone depletion potential (with respect to CFC-11) of 0.82. CCl4 is also a greenhouse gas and the 100-yr global warming potential is 1,400. In 1987, the Montreal Protocol (MP) included CCl4, and production and consumption were phased out for developed countries in 1996. Developing countries were allowed a delayed reduction, but CCl4 was fully phased out from emissive uses in 2010. However, the near-zero 2007-2012 emissions estimate based on the UNEP reported production and feedstock usage cannot be reconciled with the observed slow decline of atmospheric concentrations, year-to-year variability, and the inter-hemispheric gradient (IHG). We use available source and sink data in the NASA 3-Dimensional (3-D) Chemistry Climate Model, GEOSCCM, to test existing emissions and lifetime estimates against CCl4 mixing ratio observations. Our model results show that the IHG and global trend provide useful information for quantitatively constraining CCl4 emissions and lifetime estimates. The observed IHG (1.5±0.2 ppt for 2000-2012) is primarily caused by ongoing current emissions, while ocean and soil losses and stratosphere-troposphere exchange together contribute a small negative gradient (~0 - -0.3 ppt). Using the observed CCl4 global trend and IHG from the National Oceanic and Atmospheric Administration - Global Monitoring Division (NOAA-GMD) and Advanced Global Atmospheric Gases Experiment (AGAGE) networks, we deduce the mean global emissions for the 2000-2012 period are 39 (34-45, lower-upper limit emission estimates) Gg/yr (~ 30% of the peak 1980s emissions) and a corresponding total lifetime of 35 (37-32, upper-lower limit lifetime estimates) years. These results point to the need for a more accurate bottom-up estimate of CCl4 emissions as well as re-evaluation of the CCl4 best estimate lifetime (currently 25 years).

  15. Herbal Supplement Ameliorates Cardiac Hypertrophy in Rats with CCl4-Induced Liver Cirrhosis

    Directory of Open Access Journals (Sweden)

    Ping-Chun Li

    2012-01-01

    Full Text Available We used the carbon tetrachloride (CCl4 induced liver cirrhosis model to test the molecular mechanism of action involved in cirrhosis-associated cardiac hypertrophy and the effectiveness of Ocimum gratissimum extract (OGE and silymarin against cardiac hypertrophy. We treated male wistar rats with CCl4 and either OGE (0.02 g/kg B.W. or 0.04 g/kg B.W. or silymarin (0.2 g/kg B.W.. Cardiac eccentric hypertrophy was induced by CCl4 along with cirrhosis and increased expression of cardiac hypertrophy related genes NFAT, TAGA4, and NBP, and the interleukin-6 (IL-6 signaling pathway related genes MEK5, ERK5, JAK, and STAT3. OGE or silymarin co-treatment attenuated CCl4-induced cardiac abnormalities, and lowered expression of genes which were elevated by this hepatotoxin. Our results suggest that the IL-6 signaling pathway may be related to CCl4-induced cardiac hypertrophy. OGE and silymarin were able to lower liver fibrosis, which reduces the chance of cardiac hypertrophy perhaps by lowering the expressions of IL-6 signaling pathway related genes. We conclude that treatment of cirrhosis using herbal supplements is a viable option for protecting cardiac tissues against cirrhosis-related cardiac hypertrophy.

  16. Effect of Platelet-Rich Plasma on CCl4-Induced Chronic Liver Injury in Male Rats.

    Science.gov (United States)

    Hesami, Zahra; Jamshidzadeh, Akram; Ayatollahi, Maryam; Geramizadeh, Bita; Farshad, Omid; Vahdati, Akbar

    2014-01-01

    Platelet-rich plasma (PRP) has been of great concern to the scientists and doctors who are involved in wound healing and regenerative medicine which focuses on repairing and replacing damaged cells and tissues. Growth factors of platelet-rich plasma are cost-effective, available, and is more stable than recombinant human growth factors. Given these valuable properties, we decided to assess the effect of PRP on CCl4-induced hepatotoxicity on rats. The rats received CCl4 (1 mL/kg, i.p. 1 : 1 in olive oil) twice per week for 8 weeks. Five weeks after CCl4 injection, the rats also received PRP (0.5 mL/kg, s.c.) two days a week for three weeks. Twenty-four hours after last CCl4 injection, the animals bled and their livers dissected for biochemical and histopathological studies. Blood analysis was performed to evaluate enzyme activity. The results showed that PRP itself was not toxic for liver and could protect the liver from CCl4-induced histological damages and attenuated oxidative stress by increase in glutathione content and decrease in lipid peroxidative marker of liver tissue. The results of the present study lend support to our beliefs in hepatoprotective effects of PRP. PMID:24707405

  17. [Protective effects of S-adenosylmethionine against CCl4 - and ethanol-induced experimental hepatic fibrosis].

    Science.gov (United States)

    Zhang, F; Gu, J-X; Zou, X-P; Zhuge, Y-Z

    2016-01-01

    In this study the effects of S-adenosylmethionine (SAM) on experimental hepatic fibrotic rats induced by carbon tetrachloride (CCl(4)) and ethanol and the relevant potential mechanisms were explored. Hepatic fibrotic rat models were established with CCl(4) diluted in olive oil being drunk with 10% ethanol in water. SAM was used both for prevention and treatment. Histological evaluation was carried out by hematoxylin-eosin (HE) and Masson staining of hepatic samples. Serum biochemical assays showed that alanine aminotransferase (ALT) was increased and albumin (ALB) was decreased by CCl(4) and ethanol, and both effects were suppressed by preventing and treating use of SAM. The model control rats got significantly higher scores in fatty degeneration, lobular inflammation, and hepatocyte ballooning. A significant improvement was observed in the SAM-prevented rats and SAM-treated rats, which was consistent with the change of fibrosis scoring in each group. Smad3 was induced by CCl(4) and ethanol in the model control group, which was significantly down regulated by SAM. SAM reduced both total Smad3 and phospho-Smad3 in vitro. SAM had a protective effect on hepatic fibrosis in rats induced by CCl(4) combined with ethanol and the down-regulation of activity and expression of Smad3 were involved in the potential mechanisms. PMID:27239849

  18. Ultrastructural changes in hepatocytes after taurine treatment in CCl4 induced liver injury

    Institute of Scientific and Technical Information of China (English)

    Ilker Tasci; Nuket Has; Mehmet Refik Has; Muwet Tuncer; Bilgin Comert

    2008-01-01

    AIM:To search the organelle based changes in hepatocytes after taurine treatment in experimental liver fibrosis induced by CCl4 administration.METHODS:Thirty rats were divided into two groups.Group 1(η=15)was injected with CCl4 plus taurine and Group 2(η=is)with Ccl4 plus saline for 12 wk.At the end of 12th wk,mitochondria,rough and smooth endoplasmic reticulum,and nuclei of hepatocytes were evaluated using a scoring system.The results were compared with histopathological findings,as well.RESULTS:Taurine treatment reduced fibrosis scores significantly as compared to placebo.Organelle injury scores decreased significantly with taurine treatment.Ultrastructural and hiStopathological scores in both groups were in strong correlation(r=0.931 for CCl4 plus taurine and r=0.899 fOr CCl4 plus saline group).CONCLUSION:Organelle based transmission electron microscopy findings can reflect successfully histological results as well as tissue healing in hepatocytes from hepatotoxin-induced liver fibrosis.

  19. The essential oil of Artemisia capillaris protects against CCl4-induced liver injury in vivo

    Directory of Open Access Journals (Sweden)

    Qinghan Gao

    2016-06-01

    Full Text Available Abstract To study the hepatoprotective effect of the essential oil of Artemisia capillaris Thunb., Asteraceae, on CCl4-induced liver injury in mice, the levels of serum aspartate aminotransferase and alanine aminotransferase, hepatic levels of reduced glutathione, activity of glutathione peroxidase, and the activities of superoxide dismutase and malondialdehyde were assayed. Administration of the essential oil of A. capillaris at 100 and 50 mg/kg to mice prior to CCl4 injection was shown to confer stronger in vivo protective effects and could observably antagonize the CCl4-induced increase in the serum alanine aminotransferase and aspartate aminotransferase activities and malondialdehyde levels as well as prevent CCl4-induced decrease in the antioxidant superoxide dismutase activity, glutathione level and glutathione peroxidase activity (p < 0.01. The oil mainly contained β-citronellol, 1,8-cineole, camphor, linalool, α-pinene, β-pinene, thymol and myrcene. This finding demonstrates that the essential oil of A. capillaris can protect hepatic function against CCl4-induced liver injury in mice.

  20. CCR6 and CCL20: partners in intestinal immunity and lymphorganogenesis.

    Science.gov (United States)

    Williams, Ifor R

    2006-08-01

    The CCR6 chemokine receptor is expressed by most B cells and subsets of T cells and dendritic cells (DCs) found in the gut mucosal immune system. CCL20, the single chemokine ligand for CCR6, is selectively made by the follicle-associated epithelium (FAE) overlying Peyer's patches (PPs) and isolated lymphoid follicles (ILFs). CCL20 contributes to the recruitment of CCR6-expressing B cells to these structures. CCL20 expression by the intestinal epithelium is also highly inducible in response to inflammatory stimuli. Thus, CCL20 functions as both an inflammatory and homeostatic chemokine. Interactions between CCR6 and CCL20 play a role at several stages in the development of intestinal lymphoid structures. A subset of the c-kit(+) lymphoid precursors found in cryptopatches (CPs) expresses CCR6. Recruitment of B cells to CPs and the subsequent expansion and organization of these B cells allows differentiation of some of these structures into ILFs. In CCR6 knockout mice, PPs are smaller with fewer follicles and the development of ILFs is compromised. These defects in the development of mucosal inductive sites in CCR6-deficient mice are responsible for decreased IgA production to oral antigens. CCR6 can be included with CXCR5 and CCR7 in a list of chemokine receptors that participate in shaping the organized lymphoid structures that are part of the intestinal immune system. PMID:17057190

  1. Antioxidant Bioactivity of Samsum Ant (Pachycondyla sennaarensis Venom Protects against CCL4-Induced Nephrotoxicity in Mice

    Directory of Open Access Journals (Sweden)

    Hossam Ebaid

    2014-01-01

    Full Text Available To assess whether SAV could influence the effects of carbon tetrachloride (CCL4 exposure, mice were treated with SAV in doses of 100, 200, 300 and 400 μg/kg body weight and the effects on oxidative status and kidney function were studied. Serum levels of creatinine, malondialdehyde (MDA, and blood urea, together with renal and hepatic levels of MDA, glutathione (GSH, superoxide dismutase (SOD, and catalase (CAT were quantified in order to evaluate antioxidant activity. Results showed that the group injected with CCL4 exhibited significantly higher levels of oxidative stress markers, MDA, and significantly lower concentrations of GSH, SOD and catalase. SAV was found to significantly improve these oxidative markers, occasionally, in a dose-dependent manner. Furthermore, treatment with SAV was associated with the same behaviour in respect to kidney functions which had previously been impaired by CCL4. Histopathological examination demonstrated that SAV, in different groups, improved the renal tissue damage induced by CCL4 and histological scores confirmed that significant improvements were obtained after treatment with SAV, particularly with the lowest dose (100 μg/kg body weight. In conclusion, SAV has the potential capability to restore oxidative stability and to improve kidney functions after CCL4 acute injury.

  2. Protective effects of L-carnosine on CCl4 -induced hepatic injury in rats.

    Science.gov (United States)

    Alsheblak, Mehyar Mohammad; Elsherbiny, Nehal M; El-Karef, Amro; El-Shishtawy, Mamdouh M

    2016-03-01

    The present study was undertaken to investigate the possible protective effect of L-carnosine (CAR), an endogenous dipeptide of alanine and histidine, on carbon tetrachloride (CCl4)-induced hepatic injury. Liver injury was induced in male Sprague-Dawley rats by intraperitoneal (i.p.) injections of CCl4, twice weekly for six weeks. CAR was administered to rats daily, at dose of 250 mg/kg, i.p. At the end of six weeks, blood and liver tissue specimens were collected. Results show that CAR treatment attenuated the hepatic morphological changes, necroinflammation and fibrosis induced by CCl4, as indicated by hepatic histopathology scoring. In addition, CAR treatment significantly reduced the CCl4-induced elevation of liver-injury parameters in serum. CAR treatment also combatted oxidative stress; possibly by restoring hepatic nuclear factor erythroid 2-related factor 2 (Nrf-2) levels. Moreover, CAR treatment prevented the activation of hepatic stellate cells (HSCs), as indicated by reduced α-smooth muscle actin (α-SMA) expression in the liver, and decreased hepatic inflammation as demonstrated by a reduction in hepatic tumor necrosis factor-α (TNF-α) and restoration of interleukin-10 (IL-10) levels. In conclusion, CCl4-induced hepatic injury was alleviated by CAR treatment. The results suggest that these beneficial, protective effects are due, at least in part, to its anti-oxidant, anti-inflammatory and anti-fibrotic activities. PMID:27094155

  3. CCL2/MCP-1 modulation of microglial activation and proliferation

    Directory of Open Access Journals (Sweden)

    Garcia-Bueno Borja

    2011-07-01

    Full Text Available Abstract Background Monocyte chemoattractant protein (CCL2/MCP-1 is a chemokine that attracts cells involved in the immune/inflammatory response. As microglia are one of the main cell types sustaining inflammation in brain, we proposed here to analyze the direct effects of MCP-1 on cultured primary microglia. Methods Primary microglia and neuronal cultures were obtained from neonatal and embryonic Wistar rats, respectively. Microglia were incubated with different concentrations of recombinant MCP-1 and LPS. Cell proliferation was quantified by measuring incorporation of bromodeoxyuridine (BrdU. Nitrite accumulation was measured using the Griess assay. The expression and synthesis of different proteins was measured by RT-PCR and ELISA. Cell death was quantified by measuring release of LDH into the culture medium. Results MCP-1 treatment (50 ng/ml, 24 h did not induce morphological changes in microglial cultures. Protein and mRNA levels of different cytokines were measured, showing that MCP-1 was not able to induce proinflammatory cytokines (IL-1β, IL6, MIP-1α, either by itself or in combination with LPS. A similar lack of effect was observed when measuring inducible nitric oxide synthase (NOS2 expression or accumulation of nitrites in the culture media as a different indicator of microglial activation. MCP-1 was also unable to alter the expression of different trophic factors that were reduced by LPS treatment. In order to explore the possible release of other products by microglia and their potential neurotoxicity, neurons were co-cultured with microglia: no death of neurons could be detected when treated with MCP-1. However, the presence of MCP-1 induced proliferation of microglia, an effect opposite to that observed with LPS. Conclusion These data indicate that, while causing migration and proliferation of microglia, MCP-1 does not appear to directly activate an inflammatory response in this cell type, and therefore, other factors may be

  4. Endoplasmic Reticulum Stress-induced Overexpression of CCL5 in Human Breast Cancer Cell MCF-7%内质网应激对乳腺癌MCF-7细胞CCL5表达的影响

    Institute of Scientific and Technical Information of China (English)

    范威; 潘翠萍; 张懿敏; 廖仕翀; 魏文; 马彪; 孙圣荣

    2012-01-01

    Objective To discuss the relationship between ER stress and the expression of CCL5 in human breast cancer cell MCF-7 and identify the correlation between CCL5 and the proliferation and metastasis capacity of human breast cancer MCF-7 cells. Methods The ER stress and the expression of CCL5 in the tissue of human breast cancer and adjacent tissue were datected by Western blot. ER stress inducer Tu-niamycin and ER stress inhibitor 4-PBA were used to MCF-7 cells respectively. Samples were collected the total cell protein after 24 hours treatment. Tthe ER stress and the expression of CCL5 in MCF-7 cells was analyzed by Westernblot. The proliferation and metastasis capacity of human breast cancer MCF-7 cells were measured by MTT colorimetry and transwell experiment respectively. ELISA was employed to detect the content of CCL5 in the culture medium. Results The ER stress and the expression of CCL5 in the tissue of human breast cancer were in higher level than that in adjacent tissue. The ER stress of the cells treated with ER stress inducer was in higher level and these cells expressed more CCL5. On the contrary, the ER stress of the cells treated with ER stress inhibitor was in lower level and these cells expressed less CCL5. In addition,the cells treated with ER stress inducer were more proliferative than the cells treated with ER stress inhibitor . CCL5 secreted to the culture medium could enhance the capacity of proliferation and metastasis of human breast cancer MCF-7 cells. Conclution ER stress can induce the endogenous expression of CCL5 in MCF-7 cells. Endogenous CCL5 can promote the proliferation of human breast cancer MCF-7 cells and extraneous CCL5 can promote the metastasis of MCF-7 cells.%目的 探讨内质网应激水平与人乳腺癌MCF-7细胞CCL5表达之间的关系,明确CCL5与人乳腺癌MCF-7细胞增殖侵袭转移能力之间的关系.方法 使用内质网应激诱导剂(Tuniamycin)和内质网应激抑制剂(4-PBA)分别处理人乳腺癌MCF-7

  5. PROTECTIVE EFFECT OF Solanum Pubescens LINN ON CCL4 INDUCED HEPATOTOXICITY IN ALBINO RATS

    Directory of Open Access Journals (Sweden)

    M.Pushpalatha

    2012-01-01

    Full Text Available Ethanol extract of Solanum pubescens Linn was evaluated for hepato protective and antioxidant activities in rats. The plant extract (500mg/kg/day showed a remarkable hepatoprotective and antioxidant activity against Carbon tetrachloride (CCl4-induced hepatotoxicity as judged from the serum marker enzymes and antioxidant levels in liver tissues. CCl4 induced a significant rise in aspartate amino transferase (AST, alanine amino transferase (ALT, alkaline phosphatase (ALP, total bilirubin, LPO with a reduction of total protein, superoxide dismutase (SOD, catalase, and reduced glutathione (GSH. Treatment of rats with plant extract (500 mg/kg significantly (P<0.01 altered serum marker enzymes and antioxidant levels to near normal against CCl4 - treated rats. The activity of the extract at dose of 500 mg/kg was comparable to the standard drug, Silymarin (50 mg/kg, p.o.. Histopathological examination of the liver tissues supported the hepatoprotective activity of plant.

  6. Enhanced Ccl2-Ccr2 signaling drives more severe choroidal neovascularization with aging.

    Science.gov (United States)

    Robbie, Scott J; Georgiadis, Anastasios; Barker, Susie E; Duran, Yanai; Smith, Alexander J; Ali, Robin R; Luhmann, Ulrich F O; Bainbridge, James W

    2016-04-01

    The impact of many inflammatory diseases is influenced by age-related changes in the activation of resident and circulating myeloid cells. In the eye, a major sight-threatening consequence of age-related macular degeneration is the development of severe choroidal neovascularization (CNV). To identify the molecular pathways and myeloid cell populations involved in this increased neovascular response, we characterized the immune status of murine choroid and retina during aging and in the context of experimental CNV. In the choroid, but not in the retina, advancing age is associated with proinflammatory upregulation of CCL2-CCR2 signaling. Genetic excision of CCL2 diminishes age-related inflammatory changes in the choroid, with reduced recruitment of proinflammatory myeloid cells and attenuation of CNV. These findings indicate that CCL2-driven recruitment of myeloid cells contributes to increased severity of CNV with age. Similar mechanisms may be involved in other age-related inflammatory diseases. PMID:26973110

  7. Constraining the carbon tetrachloride (CCl4) budget using its global trend and inter-hemispheric gradient

    Science.gov (United States)

    Liang, Qing; Newman, Paul A.; Daniel, John S.; Reimann, Stefan; Hall, Bradley D.; Dutton, Geoff; Kuijpers, Lambert J. M.

    2014-07-01

    Carbon tetrachloride (CCl4) is a major anthropogenic ozone-depleting substance and greenhouse gas and has been regulated under the Montreal Protocol. However, the near-zero 2007-2012 emissions estimate based on the UNEP reported production and feedstock usage cannot be reconciled with the observed slow decline of atmospheric concentrations and the inter-hemispheric gradient (IHG) for CCl4. Our 3-D model simulations suggest that the observed IHG (1.5 ± 0.2 ppt for 2000-2012) is primarily caused by ongoing current emissions, while ocean and soil losses and stratosphere-troposphere exchange together contribute a small negative gradient (~0 - -0.3 ppt). Using the observed CCl4 global trend and IHG, we deduce that the mean global emissions for the 2000-2012 period are 393445 Gg/yr (~30% of the peak 1980s emissions) and a corresponding total lifetime of 353732 years.

  8. Clusterin Modulates Allergic Airway Inflammation by Attenuating CCL20-Mediated Dendritic Cell Recruitment.

    Science.gov (United States)

    Hong, Gyong Hwa; Kwon, Hyouk-Soo; Moon, Keun-Ai; Park, So Young; Park, Sunjoo; Lee, Kyoung Young; Ha, Eun Hee; Kim, Tae-Bum; Moon, Hee-Bom; Lee, Heung Kyu; Cho, You Sook

    2016-03-01

    Recruitment and activation of dendritic cells (DCs) in the lungs are critical for Th2 responses in asthma, and CCL20 secreted from bronchial epithelial cells (BECs) is known to influence the recruitment of DCs. Because asthma is a disease that is closely associated with oxidative stress, we hypothesized that clusterin, an oxidative stress regulatory molecule, may have a role in the development of allergic airway inflammation. The aim of this study was to examine whether clusterin regulates CCL20 production from the BECs and the subsequent DC recruitment in the lungs. To verify the idea, clusterin knockout (Clu(-/-)), clusterin heterogeneous (Clu(+/-)), and wild-type mice were exposed intranasally to house dust mite (HDM) extract to induce allergic airway inflammation. We found that the total number of immune cells in bronchoalveolar lavage fluid and the lung was increased in Clu(-/-) and Clu(+/-) mice. Of these immune cells, inflammatory DCs (CD11b(+)CD11c(+)) and Ly6C(high) monocyte populations in the lung were significantly increased, which was accompanied by increased levels of various chemokines, including CCL20 in bronchoalveolar lavage fluid, and increased oxidative stress markers in the lung. Moreover, HDM-stimulated human BECs with either up- or downregulated clusterin expression showed that CCL20 secretion was negatively associated with clusterin expression. Interestingly, clusterin also reduced the level of intracellular reactive oxygen species, which is related to induction of CCL20 expression after HDM stimulation. Thus, the antioxidant property of clusterin is suggested to regulate the expression of CCL20 in BECs and the subsequent recruitment of inflammatory DCs in the airway. PMID:26826245

  9. Protective Effect of Procyanidin B2 against CCl4-Induced Acute Liver Injury in Mice

    Directory of Open Access Journals (Sweden)

    Bing-Ya Yang

    2015-07-01

    Full Text Available Procyanidin B2 has demonstrated several health benefits and medical properties. However, its protective effects against CCl4-induced hepatotoxicity have not been clarified. The present study aimed to investigate the hepatoprotective effects of procyanidin B2 in CCl4-treated mice. Our data showed that procyanidin B2 significantly decreased the CCl4-induced elevation of serum alanine aminotransferase activities, as well as improved hepatic histopathological abnormalities. Procyanidin B2 also significantly decreased the content of MDA but enhanced the activities of antioxidant enzymes SOD, CAT and GSH-Px. Further research demonstrated that procyanidin B2 decreased the expression of TNF-α, IL-1β, cyclooxygenase-2 (COX-2 and inducible nitric oxide synthase (iNOS, as well as inhibited the translocation of nuclear factor-kappa B (NF-κB p65 from the cytosol to the nuclear fraction in mouse liver. Moreover, CCl4-induced apoptosis in mouse liver was measured by (terminal-deoxynucleotidyl transferase mediated nick end labeling TUNEL assay and the cleaved caspase-3. Meanwhile, the expression of apoptosis-related proteins Bax and Bcl-xL was analyzed by Western blot. Results showed that procyanidin B2 significantly inhibited CCl4-induced hepatocyte apoptosis, markedly suppressed the upregulation of Bax expression and restored the downregulation of Bcl-xL expression. Overall, the findings indicated that procyanidin B2 exhibited a protective effect on CCl4-induced hepatic injury by elevating the antioxidative defense potential and consequently suppressing the inflammatory response and apoptosis of liver tissues.

  10. Hepatoprotective activity of cinnamon ethanolic extract against CCl4-induced liver injury in rats

    OpenAIRE

    Bazargan, Maryam; Eidi, Akram; MORTAZAVI, Pejman; Zaringalam, Jalal

    2012-01-01

    The inner bark of cinnamon (Cinnamomum zeylanicum L.) is commonly used as a spice and has also been widely employed in the treatment and prevention of disease. The aim of the present study is to evaluate the protective effect of cinnamon bark extract against carbon tetrachloride (CCl4)-induced liver damage in male Wistar rats. Administration with cinnamon extracts (0.01, 0.05 and 0.1 g/kg) for 28 days significantly reduced the impact of CCl4 toxicity on the serum markers of liver damage, ...

  11. Variation in CCL3L1 copy number in rhesus macaques (Macaca mulatta).

    Science.gov (United States)

    Taormina, Patrick L; Satkoski Trask, Jessica A; Smith, David G; Kanthaswamy, Sreetharan

    2012-06-01

    We used real-time quantitative PCR (qPCR) methodology to examine copy number variation (CNV) of the CCL3L1 gene among pure Indian-origin, pure Chinese-origin, and hybrid Indian-Chinese rhesus macaques (Macaca mulatta). CNV among purebred macaques fell within expected ranges, with Indian macaques having lower copy numbers than those of Chinese macaques. Compared with the purebred macaques, Indian-Chinese hybrid rhesus macaques showed much greater variance in copy number and an intermediate average copy number. Copy numbers of CCL3L1 in rhesus macaque trios (sire, dam, and offspring) were consistent with Mendelian inheritance. PMID:22776055

  12. L -Carnitine and Melatonin Reverse CCl4 Induced Liver Fibrosis In Rats (Histological and Histochemical Studies

    Directory of Open Access Journals (Sweden)

    Fatma, A. Morsy, Abdel Razik, H. Farrag and Sonya, L. El-Sharkawy

    2004-12-01

    Full Text Available Carbontetrachloride (CCl4 is closely related chemically to chloroform and likewise in hepatic poisons. This study was designed to evaluate the effects of carbon tetrachloride on liver of male rats and the reversing effects of L-carnitine and melatonin on established liver fibrosis. A total of 72 adult male albino rats were used in this study. The animals were divided into six groups. Group (1 animals of the first group were kept as control andtreated with paraffin oil twice weekly for eight weeks. Group (2 rats of the second group were injected with CCl4 intraperitoneally at 0.15 ml per rats (diluted 1:1 in liquid paraffin twice weekly for eight weeks to produced liver fibrosis. Group (3 following establishment with CCl4 which induced liver fibrosis, the rats were treated with L-carnitine at a dose level of 50 mg/kg for four weeks. Group (4 rats with liver fibrosis were injected intraperitoneally with melatonin at dose level of 10 mg/kg for four weeks. The fifth and sixth groups were given L-carnitine and/or melatonin at dose levels of 50 mg/kg and 10 mg/kg respectively for four weeks. Histological changes in the liver of rats treated with CCl4 including liver fibrosis, architecture distortion and appearance of many pseudolobule. The fibrous tissues run in septa between the nodules. The liver damage varied from one area to another and varied from moderate fibrosis to cirrhosis. Quantitative measurement of the severity of liver fibrosis (area damage was achieved by using computerized image analysis (Leica image showed that highly significant increase in area of fibrosis was recorded in the case of rats treated with CCl4 only. Quantitative DNA image analysis showed that 3% of aneuploid cells could be noticed in liver of rats treated with CCl4 only. Histochemical results of rats treated with CCl4 showed highly significant increase in grey level of mucopolysaccharides and protein levels. No histological and histochemical changes could be noticed in

  13. Inhibitory effect of Newcastle disease virus on hepatic fibrosis induced by CCl4

    OpenAIRE

    Ya-lin LI

    2013-01-01

    Objective To explore the inhibitory effect of Newcastle diseases virus (NDV) on CCl4-induced liver fibrosis in mice. Methods Liver fibrosis model was reproduced in 30 Kunming mice by intraperitoneal injection of CCl4/peanut oil solution for 2 times a week, and the total treatment lasted for 8 weeks. Three days after last injection, NDV was injected through tail vein for 1 or 3 times (24h intervals). Twenty-four hours after NDV infusion, mice were sacrificed and the livers were removed for gro...

  14. Profile of circulating levels of IL-1Ra, CXCL10/IP-10, CCL4/MIP-1β and CCL2/MCP-1 in dengue fever and parvovirosis

    Directory of Open Access Journals (Sweden)

    Luzia Maria de-Oliveira-Pinto

    2012-02-01

    Full Text Available Dengue virus (DENV and parvovirus B19 (B19V infections are acute exanthematic febrile illnesses that are not easily differentiated on clinical grounds and affect the paediatric population. Patients with these acute exanthematic diseases were studied. Fever was more frequent in DENV than in B19V-infected patients. Arthritis/arthralgias with DENV infection were shown to be significantly more frequent in adults than in children. The circulating levels of interleukin (IL-1 receptor antagonist (Ra, CXCL10/inducible protein-10 (IP-10, CCL4/macrophage inflammatory protein-1 beta and CCL2/monocyte chemotactic protein-1 (MCP-1 were determined by multiplex immunoassay in serum samples obtained from B19V (37 and DENV-infected (36 patients and from healthy individuals (7. Forward stepwise logistic regression analysis revealed that circulating CXCL10/IP-10 tends to be associated with DENV infection and that IL-1Ra was significantly associated with DENV infection. Similar analysis showed that circulating CCL2/MCP-1 tends to be associated with B19V infection. In dengue fever, increased circulating IL-1Ra may exert antipyretic actions in an effort to counteract the already increased concentrations of IL-1β, while CXCL10/IP-10 was confirmed as a strong pro-inflammatory marker. Recruitment of monocytes/macrophages and upregulation of the humoral immune response by CCL2/MCP-1 by B19V may be involved in the persistence of the infection. Children with B19V or DENV infections had levels of these cytokines similar to those of adult patients.

  15. Rotational Spectroscopy of Newly Detected Atmospheric Ozone Depleters: CF_3CH_2Cl, CF_3CCl_3, and CF_2ClCCl_3

    Science.gov (United States)

    Kisiel, Zbigniew; Bialkowska-Jaworska, Ewa; Pszczólkowski, Lech; Uriarte, Iciar; Ecija, Patricia; Basterretxea, Francisco J.; Cocinero, Emilio J.

    2015-06-01

    In a recent study of unpolluted air samples from Tasmania and of deep firn snow in Greenland four previously overlooked ozone-depleting substances have been identified. These compounds started to emerge in the atmosphere in the 1960s, and two: CF_3CCl_3 (CFC-113a) and CF_3CH_2Cl (HCHF-133a) continue to accumulate in the atmosphere. Three of the four compounds have non-zero dipole moments and are amenable to study by rotational spectroscopy, establishing the basis for analytic applications. Relatively limited studies have been reported for CF_3CH_2Cl and CF_3CCl_3, while CF_2ClCCl_3 has not yet been studied by this technique. We presently report extensive results obtained for all three compounds, resulting from concerted application of supersonic expansion FTMW spectroscopy in chirped pulse and cavity modes, and room-temperature MMW spectroscopy. Among the plentiful results, we have been able to resolve and fit the complex nuclear quadrupole hyperfine splitting. J.C.Laube, et al., Nature Geoscience 7, 266 (2014). Ogata, et al., J. Mol. Struct. 144, 1 (1986). R.Holm, et al., Z. Naturforsch. 23a, 1040 (1968). J.H.Carpenter et al., J. Mol. Spectrosc. 154, 207 (1992); P.J.Seo et al., J. Mol. Spectrosc. 169, 58 (1995).

  16. Chicory (Cichorium intybus L.) root extract regulates the oxidative status and antioxidant gene transcripts in CCl4-induced hepatotoxicity.

    Science.gov (United States)

    El-Sayed, Yasser S; Lebda, Mohamed A; Hassinin, Mohammed; Neoman, Saad A

    2015-01-01

    The ability of Cichorium intybus root extract (chicory extract) to protect against carbon tetrachloride (CCl4)-induced oxidative stress and hepatotoxicity was evaluated in male rats. The rats were divided into four groups according to treatment: saline (control); chicory extract (100 mg/kg body weight daily, given orally for 2 weeks); CCl4 (1 ml/kg body weight by intraperitoneal injection for 2 consecutive days only); or chicory extract (100 mg/kg body weight daily for 2 weeks) + CCl4 injection on days 16 and 17. The levels of hepatic lipid peroxidation, antioxidants, and molecular biomarkers were estimated twenty-four hours after the last CCl4 injection. Pretreatment with chicory extract significantly reduced CCl4-induced elevation of malondialdehyde levels and nearly normalized levels of glutathione and activity of glutathione S-transferase, glutathione peroxidase (GPx), glutathione reductase, catalase (CAT), paraoxonase-1 (PON1), and arylesterase in the liver. Chicory extract also attenuated CCl4-induced downregulation of hepatic mRNA expression levels of GPx1, CAT and PON1 genes. Results of DNA fragmentation support the ability of chicory extract to ameliorate CCl4-induced liver toxicity. Taken together, our results demonstrate that chicory extract is rich in natural antioxidants and able to attenuate CCl4-induced hepatocellular injury, likely by scavenging reactive free radicals, boosting the endogenous antioxidant defense system, and overexpressing genes encoding antioxidant enzymes. PMID:25807561

  17. Chicory (Cichorium intybus L. root extract regulates the oxidative status and antioxidant gene transcripts in CCl4-induced hepatotoxicity.

    Directory of Open Access Journals (Sweden)

    Yasser S El-Sayed

    Full Text Available The ability of Cichorium intybus root extract (chicory extract to protect against carbon tetrachloride (CCl4-induced oxidative stress and hepatotoxicity was evaluated in male rats. The rats were divided into four groups according to treatment: saline (control; chicory extract (100 mg/kg body weight daily, given orally for 2 weeks; CCl4 (1 ml/kg body weight by intraperitoneal injection for 2 consecutive days only; or chicory extract (100 mg/kg body weight daily for 2 weeks + CCl4 injection on days 16 and 17. The levels of hepatic lipid peroxidation, antioxidants, and molecular biomarkers were estimated twenty-four hours after the last CCl4 injection. Pretreatment with chicory extract significantly reduced CCl4-induced elevation of malondialdehyde levels and nearly normalized levels of glutathione and activity of glutathione S-transferase, glutathione peroxidase (GPx, glutathione reductase, catalase (CAT, paraoxonase-1 (PON1, and arylesterase in the liver. Chicory extract also attenuated CCl4-induced downregulation of hepatic mRNA expression levels of GPx1, CAT and PON1 genes. Results of DNA fragmentation support the ability of chicory extract to ameliorate CCl4-induced liver toxicity. Taken together, our results demonstrate that chicory extract is rich in natural antioxidants and able to attenuate CCl4-induced hepatocellular injury, likely by scavenging reactive free radicals, boosting the endogenous antioxidant defense system, and overexpressing genes encoding antioxidant enzymes.

  18. CCL21-induced calcium transients and proliferation in primary mouse astrocytes : CXCR3-dependent and independent responses

    NARCIS (Netherlands)

    van Weering, Hilmar R. J.; de Jong, Arthur P. H.; de Haas, Alexander H.; Biber, Knut P. H.; Boddeke, Hendrikus W. G. M.

    2010-01-01

    CCL21 is a homeostatic chemokine that is expressed constitutively in secondary lymph nodes and attracts immune cells via chemokine receptor CCR7. In the brain however, CCL21 is inducibly expressed in damaged neurons both in vitro and in vivo and has been shown to activate microglia in vitro, albeit

  19. Expression of CCL21 in Ewing sarcoma shows an inverse correlation with metastases and is a candidate target for immunotherapy.

    Science.gov (United States)

    Sand, Laurens G L; Berghuis, Dagmar; Szuhai, Karoly; Hogendoorn, Pancras C W

    2016-08-01

    Ewing sarcoma is an aggressive neoplasm predominantly occurring in adolescents and has a poor prognosis when metastasized. For patients with metastatic disease in particular, immunotherapy has been proposed as possible beneficial additive therapy. CCL21 activation-based immunotherapy was successful in preclinical studies in other tumor types; therefore, we investigated CCL21 expression in Ewing sarcoma as potential target for immunotherapy. The CCL21 RNA expression was determined in 21 Ewing sarcoma cell lines and 18 primary therapy-naive Ewing sarcoma samples. In the tumor samples, this was correlated with the number and CD4(+)/CD8(+) ratio of infiltrating T cells and clinical parameters. Higher RNA expression levels of CCL21 significantly correlated with a lower CD4(+)/CD8(+) T cell ratio (P = 0.009), good chemotherapeutic response (P = 0.01) and improved outcome (P factor. Protein expression analysis of CCL21 and its receptor CCR7 in 24 therapy-naïve tumors showed that there was no expression in all bar one Ewing sarcoma cells. In conclusion, CCL21 is expressed in clinical Ewing sarcoma samples by nontumor-infiltrating immune cells. The observed positive correlation with survival implies that CCL21 might be a potential prognostic marker for Ewing sarcoma and marks the potential of CCL21 immunotherapy for use in Ewing sarcoma. PMID:27369431

  20. Blood-brain barrier disruption in CCL2 transgenic mice during pertussis toxin-induced brain inflammation

    DEFF Research Database (Denmark)

    Schellenberg, Angela E; Buist, Richard; Del Bigio, Marc R;

    2012-01-01

    ABSTRACT: BACKGROUND: The chemokine CCL2 has an important role in the recruitment of inflammatory cells into the central nervous system (CNS). A transgenic mouse model that overexpresses CCL2 in the CNS shows an accumulation of leukocytes within the perivascular space surrounding vessels, which i...

  1. Blood expression levels of chemokine receptor CCR3 and chemokine CCL11 in age-related macular degeneration

    DEFF Research Database (Denmark)

    Falk, Mads Krüger; Singh, Amardeep; Faber, Carsten; Nissen, Mogens Holst; Hviid, Thomas; Sørensen, Torben Lykke

    2014-01-01

    Dysregulation of the CCR3/CCL11 pathway has been implicated in the pathogenesis of choroidal neovascularisation, a common feature of late age-related macular degeneration (AMD). The aim of this study was to investigate the expression of CCR3 and its ligand CCL11 in peripheral blood in patients with...

  2. Local release from affinity-based polymers increases urethral concentration of the stem cell chemokine CCL7 in rats.

    Science.gov (United States)

    Rivera-Delgado, Edgardo; Sadeghi, Zhina; Wang, Nick X; Kenyon, Jonathan; Satyanarayan, Sapna; Kavran, Michael; Flask, Chris; Hijaz, Adonis Z; von Recum, Horst A

    2016-01-01

    The protein chemokine (C-C motif) ligand 7 (CCL7) is significantly over-expressed in urethral and vaginal tissues immediately following vaginal distention in a rat model of stress urinary incontinence. Further evidence, in this scenario and other clinical scenarios, indicates CCL7 stimulates stem cell homing for regenerative repair. This CCL7 gradient is likely absent or compromised in the natural repair process of women who continue to suffer from SUI into advanced age. We evaluated the feasibility of locally providing this missing CCL7 gradient by means of an affinity-based implantable polymer. To engineer these polymers we screened the affinity of different proteoglycans, to use them as CCL7-binding hosts. We found heparin to be the strongest binding host for CCL7 with a 0.323 nM dissociation constant. Our experimental approach indicates conjugation of heparin to a polymer backbone (using either bovine serum albumin or poly (ethylene glycol) as the base polymer) can be used as a delivery system capable of providing sustained concentrations of CCL7 in a therapeutically useful range up to a month in vitro. With this approach we are able to detect, after polymer implantation, significant increase in CCL7 in the urethral tissue directly surrounding the polymer implants with only trace amounts of human CCL7 present in the blood of the animals. Whole animal serial sectioning shows evidence of retention of locally injected human mesenchymal stem cells (hMSCs) only in animals with sustained CCL7 delivery, 2 weeks after affinity-polymers were implanted. PMID:27097800

  3. CCL2 is associated with a faster rate of cognitive decline during early stages of Alzheimer's disease.

    Directory of Open Access Journals (Sweden)

    Karin Westin

    Full Text Available Chemokine (C-C motif receptor 2 (CCR2-signaling can mediate accumulation of microglia at sites affected by neuroinflammation. CCR2 and its main ligand CCL2 (MCP-1 might also be involved in the altered metabolism of beta-amyloid (Aβ underlying Alzheimer's disease (AD. We therefore measured the levels of CCL2 and three other CCR2 ligands, i.e. CCL11 (eotaxin, CCL13 (MCP-4 and CCL26 (eotaxin-3, in the cerebrospinal fluid (CSF and plasma of 30 controls and 119 patients with mild cognitive impairment (MCI at baseline. During clinical follow-up 52 MCI patients were clinically stable for five years, 47 developed AD (i.e. cases with prodromal AD at baseline and 20 developed other dementias. Only CSF CCL26 was statistically significantly elevated in patients with prodromal AD when compared to controls (p = 0.002. However, in patients with prodromal AD, the CCL2 levels in CSF at baseline correlated with a faster cognitive decline during follow-up (r(s = 0.42, p = 0.004. Furthermore, prodromal AD patients in the highest tertile of CSF CCL2 exhibited a significantly faster cognitive decline (p<0.001 and developed AD dementia within a shorter time period (p<0.003 compared to those in the lowest tertile. Finally, in the entire MCI cohort, CSF CCL2 could be combined with CSF Tau, P-tau and Aβ42 to predict both future conversion to AD and the rate of cognitive decline. If these results are corroborated in future studies, CCL2 in CSF could be a candidate biomarker for prediction of future disease progression rate in prodromal AD. Moreover, CCR2-related signaling pathways might be new therapeutic targets for therapies aiming at slowing down the disease progression rate of AD.

  4. Modulation of pathogen-induced CCL20 secretion from HT-29 human intestinal epithelial cells by commensal bacteria.

    LENUS (Irish Health Repository)

    Sibartie, Shomik

    2009-01-01

    BACKGROUND: Human intestinal epithelial cells (IECs) secrete the chemokine CCL20 in response to infection by various enteropathogenic bacteria or exposure to bacterial flagellin. CCL20 recruits immature dendritic cells and lymphocytes to target sites. Here we investigated IEC responses to various pathogenic and commensal bacteria as well as the modulatory effects of commensal bacteria on pathogen-induced CCL20 secretion. HT-29 human IECs were incubated with commensal bacteria (Bifidobacterium infantis or Lactobacillus salivarius), or with Salmonella typhimurium, its flagellin, Clostridium difficile, Mycobacterium paratuberculosis, or Mycobacterium smegmatis for varying times. In some studies, HT-29 cells were pre-treated with a commensal strain for 2 hr prior to infection or flagellin stimulation. CCL20 and interleukin (IL)-8 secretion and nuclear factor (NF)-kappaB activation were measured using enzyme-linked immunosorbent assays. RESULTS: Compared to untreated cells, S. typhimurium, C. difficile, M. paratuberculosis, and flagellin activated NF-kappaB and stimulated significant secretion of CCL20 and IL-8 by HT-29 cells. Conversely, B. infantis, L. salivarius or M. smegmatis did not activate NF-kappaB or augment CCL20 or IL-8 production. Treatment with B. infantis, but not L. salivarius, dose-dependently inhibited the baseline secretion of CCL20. In cells pre-treated with B. infantis, C. difficile-, S. typhimurium-, and flagellin-induced CCL20 were significantly attenuated. B. infantis did not limit M. Paratuberculosis-induced CCL20 secretion. CONCLUSION: This study is the first to demonstrate that a commensal strain can attenuate CCL20 secretion in HT-29 IECs. Collectively, the data indicate that M. paratuberculosis may mediate mucosal damage and that B. infantis can exert immunomodulatory effects on IECs that mediate host responses to flagellin and flagellated enteric pathogens.

  5. Effect of extracts from araticum (Annona crassiflora on CCl4-induced liver damage in rats

    Directory of Open Access Journals (Sweden)

    Roberta Roesler

    2011-03-01

    Full Text Available The influence of ethanolic extracts of Annona crassiflora on the activities of hepatic antioxidant enzymes was examined. Extracts of A. crassiflora seeds and peel were administered orally (50 mg of galic acid equivalents.kg-1 to Wistar rats for 14 consecutive days followed by a single oral dose of carbon tetrachloride (CCl4, 2 g.kg-1. Lipid peroxidation and the activities of hepatic catalase (CAT, cytochromes P450 (CP450 and b5, glutathione peroxidase (GPx, glutathione reductase (GRed, superoxide dismutase (SOD, and the content of glutathione equivalents (GSH were evaluated. The treatment with CCl4 increased lipid peroxidation, the level of GSH equivalents and the content of cytochrome b5 by 44, 140 and 32%, respectively, with concomitant reductions of 23, 34 and 39% in the activities of CAT, SOD, and CP450, respectively. The treatment with A. crassiflora seeds and peel extracts alone inhibited lipid peroxidation by 27 and 22%, respectively without affecting the CP450 content. The pretreatment with the A. crassiflora extracts prevented the lipid peroxidation, the increase in GSH equivalents and the decrease in CAT activity caused by CCl4, but it had no effect on the CCl4-mediated changes in CP450 and b5 and SOD. These results show that A. crassiflora seeds and peel contain antioxidant activity in vivo that could be of potential therapeutic use.

  6. Effect of preoperative FOLFOX chemotherapy on CCL20/CCR6 expression in colorectal liver metastases

    Institute of Scientific and Technical Information of China (English)

    Claudia Rubie; Vilma Oliveira Frick; Pirus Ghadjar; Mathias Wagner; Christoph Justinger; Stefan Graeber; Jens Sperling; Otto Kollmar; Martin K Schilling

    2011-01-01

    AIM: To evaluate the influence of preoperative FOLFOX chemotherapy on CCL20/CCR6 expression in liver metastases of stage Ⅳ colorectal cancer (CRC) patients. METHODS: Using Real Time-PCR, enzyme-linked immunosorbent assay, Western Blots and immunohistochemistry, we have analyzed the expression of CCL20, CCR6 and proliferation marker Ki-67 in colorectal liver metastasis (CRLM) specimens from stage Ⅳ CRC patients who received preoperative FOLFOX chemotherapy (n = 53) and in patients who did not receive FOLFOX chemotherapy prior to liver surgery (n = 29). RESULTS: Of the 53 patients who received FOLFOX, time to liver surgery was ≤ 1 mo in 14 patients, ≤ 1 year in 22 patients and > 1 year in 17 patients, respectively. In addition, we investigated the proliferation rate of CRC cells in liver metastases in the different patient groups. Both CCL20 and CCR6 mRNA and protein expression levels were significantly increased in patients who received preoperative FOLFOX chemotherapy ≤ 12 mo before liver surgery (P < 0.001) in comparison to patients who did not undergo FOLFOX treatment. Further, proliferation of CRLM cells as measured by Ki-67 was increased in patients who underwent FOLFOX treatment. CCL20 and CCR6 expression levels were significantly increased in CRLM patients who had undergone preoperative FOLFOX chemotherapy. CONCLUSION: This chemokine/receptor up-regulation could lead to increased proliferation/migration through an autocrine mechanism which might be used by surviving metastatic cells to escape cell death caused by FOLFOX.

  7. Structural Evidence for the Tetrameric Assembly of Chemokine CCL11 and the Glycosaminoglycan Arixtra™

    Science.gov (United States)

    Dykstra, Andrew B.; Sweeney, Matt D.; Leary, Julie A.

    2013-01-01

    Understanding chemokine interactions with glycosaminoglycans (GAG) is critical as these interactions have been linked to a number of inflammatory medical conditions, such as arthritis and asthma. To better characterize in vivo protein function, comprehensive knowledge of multimeric species, formed by chemokines under native conditions, is necessary. Herein is the first report of a tetrameric assembly of the human chemokine CCL11, which was shown bound to the GAG Arixtra™. Isothermal titration calorimetry data indicated that CCL11 interacts with Arixtra, and ion mobility mass spectrometry (IM-MS) was used to identify ions corresponding to the CCL11 tetrameric species bound to Arixtra. Collisional cross sections (CCS) of the CCL11 tetramer-Arixtra noncovalent complex were compared to theoretical CCS values calculated using a preliminary structure of the complex deduced using X-ray crystallography. Experimental CCS values were in agreement with theoretical values, strengthening the IM-MS evidence for the formation of the noncovalent complex. Tandem mass spectrometry data of the complex indicated that the tetramer-GAG complex dissociates into a monomer and a trimer-GAG species, suggesting that two CC-like dimers are bridged by Arixtra. As development of chemokine inhibitors is of utmost importance to treatment of medical inflammatory conditions, these results provide vital insights into chemokine-GAG interactions. PMID:24970196

  8. Protective effect of wedelolactone against CCl4-induced acute liver injury in mice.

    Science.gov (United States)

    Lu, Yang; Hu, DongMei; Ma, ShanBo; Zhao, Xian; Wang, Shan; Wei, Guo; Wang, XiFang; Wen, AiDong; Wang, JingWen

    2016-05-01

    Eclipta, a traditional Chinese medicine, has been used to treat liver disease for centuries. However, the chemical basis and biological mechanisms of Eclipta remain elusive. The current study aims to investigate the hepatoprotective effect of wedelolactone (WEL), a major coumarin in Eclipta, using C57BL/6 mice with carbon tetrachloride CCl4-induced acute liver injury (ALI). Our data showed that WEL markedly decreased the CCl4-induced elevation of serum alanine aminotransferase (ALT) and aspartate aminotransferase (AST) activities, and improved hepatic histopathology changes. WEL also significantly decreased the content of MDA in liver tissues, meanwhile increased the activities of antioxidant enzymes SOD and GSH-Px. In addition, WEL reduced the protein expression of TNF-α, IL-1β and IL-6, as well as mRNA expression. Western blot results revealed that WEL repressed phosphorylation of extracellular signal-regulated kinase (ERK) and translocation of NF-κB p65 from cytoplasm to nucleus and enhanced the phosphorylation of c-Jun. N-terminal kinase (JNK). Moreover, results showed that WEL significantly inhibited CCl4-induced hepatocytes apoptosis, markedly suppressed the down-regulation of Bax and active Caspase-3 expression and accelerated the expression of Bcl-2. Overall, the findings indicate that WEL exhibits a protective effect against CCl4-induced ALI in mice by enhancing the antioxidative defense system, suppressing the inflammatory response and cell apoptosis of liver. PMID:26921731

  9. Inhibitory effect of Newcastle disease virus on hepatic fibrosis induced by CCl4

    Directory of Open Access Journals (Sweden)

    Ya-lin LI

    2013-11-01

    Full Text Available Objective To explore the inhibitory effect of Newcastle diseases virus (NDV on CCl4-induced liver fibrosis in mice. Methods Liver fibrosis model was reproduced in 30 Kunming mice by intraperitoneal injection of CCl4/peanut oil solution for 2 times a week, and the total treatment lasted for 8 weeks. Three days after last injection, NDV was injected through tail vein for 1 or 3 times (24h intervals. Twenty-four hours after NDV infusion, mice were sacrificed and the livers were removed for gross morphology observation. The liver tissue sections were stained by HE and Sirius red dyeing. α-smooth muscle actin (α-SMA expression was detected by Western blotting. Results After CCl4 induction for 8 weeks, obvious fibrosis symptoms appeared in the liver of model mice, and the surface of liver tissue became hard with rough, with white patches on it. HE staining showed that there was loosening of tissue and enlarged perisinusoidal spaces in liver with fibrosis. Sirius red dyeing displayed abnormal collagen deposition in the fibrotic liver tissues. After NDV injection for 3 times, white spots on the surface of mouse liver were significantly reduced, and collagen deposition was lowered. Western blotting showed that α-SMA levels decreased with increasing frequency of NDV injection. Conclusion NDV may effectively suppress the development of CCl4-induced liver fibrosis in mice. DOI: 10.11855/j.issn.0577-7402.2013.11.003

  10. Structural Evidence for the Tetrameric Assembly of Chemokine CCL11 and the Glycosaminoglycan Arixtra™

    Directory of Open Access Journals (Sweden)

    Julie A. Leary

    2013-11-01

    Full Text Available Understanding chemokine interactions with glycosaminoglycans (GAG is critical as these interactions have been linked to a number of inflammatory medical conditions, such as arthritis and asthma. To better characterize in vivo protein function, comprehensive knowledge of multimeric species, formed by chemokines under native conditions, is necessary. Herein is the first report of a tetrameric assembly of the human chemokine CCL11, which was shown bound to the GAG Arixtra™. Isothermal titration calorimetry data indicated that CCL11 interacts with Arixtra, and ion mobility mass spectrometry (IM-MS was used to identify ions corresponding to the CCL11 tetrameric species bound to Arixtra. Collisional cross sections (CCS of the CCL11 tetramer-Arixtra noncovalent complex were compared to theoretical CCS values calculated using a preliminary structure of the complex deduced using X-ray crystallography. Experimental CCS values were in agreement with theoretical values, strengthening the IM-MS evidence for the formation of the noncovalent complex. Tandem mass spectrometry data of the complex indicated that the tetramer-GAG complex dissociates into a monomer and a trimer-GAG species, suggesting that two CC-like dimers are bridged by Arixtra. As development of chemokine inhibitors is of utmost importance to treatment of medical inflammatory conditions, these results provide vital insights into chemokine-GAG interactions.

  11. Carbon Tetrachloride (CCl4) in the Atmosphere: A Mystery Between Sources and Sinks

    Science.gov (United States)

    Reimann, S.; Newman, P. A.; Liang, Q.; Rigby, M. L.; Kuijpers, L.

    2013-12-01

    Carbon tetrachloride (CCl4) is an ozone depleting substance and therefore has been banned from usage under the Montreal Protocol. However, it is still allowed for contained use in industrial processes as so-called feedstock substance, where emissions should be negligible. The regulation of CCl4 in the Montreal Protocol suggests that, presently, emission should be zero, and that CCl4 ought to be declining exponentially depending on its atmospheric lifetime. Although atmospheric CCl4 concentrations are declining, the rate is slower than expected, suggesting that there is an unknown source of CCl4 or that the combined partial lifetimes in different environmental compartments (atmosphere, ocean, soil) are slower than our understood processes. In the last years there were increasing discrepancies between emissions reported under the Montreal Protocol ('bottom-up method') and those which are inferred from measurements at global background sites ('top-down method'). In 2012 the potential gap in global emissions between the two methods widened to several ten thousand tons per year. In order to close this gap several possibilities were tested with atmospheric models and results are verified against the global trends and the interhemispheric gradients. 1) Existing data from sources and sinks were fed into the models to test the incompatibility of the existing emission data with the observed atmospheric observation for CCl4. 2) A newly revised 44-year steady-state atmospheric lifetime was assessed. This new lifetime together with an improved uncertainty has been carefully evaluated within a lifetime assessment for ODSs and related substances under SPARC (Stratosphere-troposphere Processes And their Role in Climate). The new atmospheric lifetime is substantially longer than the 35-years which were used in WMO (2011) for the atmosphere alone. However, estimates of soil sinks (195 yr) and ocean sinks (81 yr) lead to a best-estimated global lifetime of only 25 years, comparable

  12. Minocycline, a microglial inhibitor, blocks spinal CCL2-induced heat hyperalgesia and augmentation of glutamatergic transmission in substantia gelatinosa neurons

    Science.gov (United States)

    2014-01-01

    Background Several lines of evidence suggest that CCL2 could initiate the hyperalgesia of neuropathic pain by causing central sensitization of spinal dorsal horn neurons and facilitating nociceptive transmission in the spinal dorsal horn. The cellular and molecular mechanisms by which CCL2 enhances spinal pain transmission and causes hyperalgesia remain unknown. The substantia gelatinosa (lamina II) of the spinal dorsal horn plays a critical role in nociceptive transmission. An activated spinal microglia, which is believed to release pro-inflammatory cytokines including TNF-α, plays an important role in the development of neuropathic pain, and CCL2 is a key mediator for spinal microglia activation. In the present study, we tested the hypothesis that spinal CCL2 causes the central sensitization of substantia gelatinosa neurons and enhances spinal nociceptive transmission by activating the spinal microglia and augmenting glutamatergic transmission in lamina II neurons. Methods CCL2 was intrathecally administered to 2-month-old male rats. An intrathecal injection of CCL2 induced heat hyperalgesia, which was assessed using the hot plate test. Whole-cell voltage-clamp recordings substantia gelatinosa neurons in spinal cord slices were performed to record glutamatergic excitatory postsynaptic currents (EPSCs) and GABAergic inhibitory postsynaptic currents (IPSCs). Results The hot plate test showed that 1 day after the intrathecal injection of CCL2 (1 μg), the latency of hind-paw withdrawal caused by a heat stimulus was significantly reduced in rats. One day after the intrathecal administration of CCL2, the amplitude of the evoked glutamatergic EPSCs and the frequency of spontaneous glutamatergic miniature EPSCs (mEPSCs) were significantly increased in outer lamina II neurons. Intrathecal co-injection of minocycline, a specific inhibitor of microglial activation, and CCL2 blocked the CCL2-induced reduction in the latency of hind-paw withdrawal and thermal hyperalgesia

  13. Adaptive Gene Loss? Tracing Back the Pseudogenization of the Rabbit CCL8 Chemokine.

    Science.gov (United States)

    van der Loo, Wessel; Magalhaes, Maria João; de Matos, Ana Lemos; Abrantes, Joana; Yamada, Fumio; Esteves, Pedro J

    2016-08-01

    Studies of the process of pseudogenization have widened our understanding of adaptive evolutionary change. In Rabbit, an alteration at the second extra-cellular loop of the CCR5 chemokine receptor was found to be associated with the pseudogenization of one of its prime ligands, the chemokine CCL8. This relationship has raised questions about the existence of a causal link between both events, which would imply adaptive gene loss. This hypothesis is evaluated here by tracing back the history of the genetic modifications underlying the chemokine pseudogenization. The obtained data indicate that mutations at receptor and ligand genes occurred after the lineage split of New World Leporids versus Old World Leporids and prior to the generic split of the of Old World species studied, which occurred an estimated 8-9 million years ago. More important, they revealed the emergence, before this zoographical split, of a "slippery" nucleotide motif (CCCCGGG) at the 3' region of CCL8-exon2. Such motives are liable of generating +1G or -1G frameshifts, which could, however, be overcome by "translesion" synthesis or somatic reversion. The CCL8 pseudogenization in the Old World lineage was apparently initiated by three synapomorphic point mutations at the exon2-intron2 boundary which provide at short range premature terminating codons, independently of the reading frame imposed by the slippery motif. The presence of this motif in New World Leporids might allow verifying this scenario. The importance of CCL8-CCR5 signaling in parasite-host interaction would suggest that the CCL8 knock-out in Old World populations might be related to changes in pathogenic environment. PMID:27306379

  14. COPD promotes migration of A549 lung cancer cells: the role of chemokine CCL21

    Directory of Open Access Journals (Sweden)

    Kuźnar-Kamińska B

    2016-05-01

    Full Text Available Barbara Kuźnar-Kamińska,1 Justyna Mikuła-Pietrasik,2 Patrycja Sosińska,2 Krzysztof Książek,2 Halina Batura-Gabryel1 1Department of Pulmonology, Allergology and Respiratory Oncology, 2Department of Pathophysiology, Poznań University of Medical Sciences, Poznań, Poland Abstract: Patients with COPD develop lung cancer more frequently than healthy smokers. At the same time, molecular mediators promoting various aspects of cancer cell progression are still elusive. In this report, we examined whether COPD can be coupled with increased migration of non-small-cell lung cancer cells A549 and, if so, whether this effect may be related to altered production and activity of chemokines CCL21, CXCL5, and CXCL12. The study showed that the migration of A549 cells through the polycarbonate membrane and basement membrane extract toward a chemotactic gradient elicited by serum from patients with COPD was markedly higher as compared with serum from healthy donors. The concentration of CCL21 and CXCL12, but not CXCL5, in serum from patients with COPD was also increased. Experiments in which CCL21- and CXCL12-dependent signaling was blocked revealed that increased migration of the cancer cells upon treatment with serum from patients with COPD was mediated exclusively by CCL21. Collectively, our results indicate that COPD may contribute to the progression of lung cancer via CCL21-dependent intensification of cancer cell migration. Keywords: chemokines, COPD, lung cancer, migration

  15. CCL28 involvement in mucosal tissues protection as a chemokine and as an antibacterial peptide.

    Science.gov (United States)

    Berri, Mustapha; Virlogeux-Payant, Isabelle; Chevaleyre, Claire; Melo, Sandrine; Zanello, Galliano; Salmon, Henri; Meurens, François

    2014-06-01

    CCL28 chemokine is expressed by epithelial cells of various mucosal tissues. This chemokine binds to CCR3 and CCR10 receptors and plays an essential role in the IgA antibody secreting cells (IgA-ASC) homing to mucosal surfaces and to lactating mammary gland as well. In addition, CCL28 has been shown to exert a potent antimicrobial activity against both Gram-negative and Gram-positive bacteria and fungi. Using the pig model, we investigated the expression of both CCR10 and CCR3 receptors in a large panel of mucosal tissues. RT-PCR analysis revealed the expression of CCR3 and CCR10 mRNA in salivary glands, nasal mucosae, Peyer's patches, small and large intestine, suggesting the presence of leucocytes expressing these receptors within these tissues. CCR10 mRNA was observed in sow mammary gland at late gestation with an increasing level during lactation. Recombinant porcine CCL28 protein was produced and mass spectrometry analysis revealed antimicrobial chemokines features such as a high pI value (10.2) and a C-terminal highly positively-charged region. Using a viable count assay, we showed that CCL28 displayed antimicrobial activity against enteric pathogens and was effective in killing Salmonella serotypes Dublin and Choleraesuis, enteroinvasive Escherichia coli K88 and non-pathogenic E. Coli K12. The potent antimicrobial function of CCL28 combined with its wide distribution in mucosal tissues and secretions suggest that this protein plays an important role in innate immune protection of the epithelial surfaces. PMID:24445014

  16. Lateral fluid percussion injury of the brain induces CCL20 inflammatory chemokine expression in rats

    Directory of Open Access Journals (Sweden)

    Das Mahasweta

    2011-10-01

    Full Text Available Abstract Background Traumatic brain injury (TBI evokes a systemic immune response including leukocyte migration into the brain and release of pro-inflammatory cytokines; however, the mechanisms underlying TBI pathogenesis and protection are poorly understood. Due to the high incidence of head trauma in the sports field, battlefield and automobile accidents identification of the molecular signals involved in TBI progression is critical for the development of novel therapeutics. Methods In this report, we used a rat lateral fluid percussion impact (LFPI model of TBI to characterize neurodegeneration, apoptosis and alterations in pro-inflammatory mediators at two time points within the secondary injury phase. Brain histopathology was evaluated by fluoro-jade (FJ staining and terminal deoxynucleotidyl transferase dUTP nick end labelling (TUNEL assay, polymerase chain reaction (qRT PCR, enzyme linked immunosorbent assay (ELISA and immunohistochemistry were employed to evaluate the CCL20 gene expression in different tissues. Results Histological analysis of neurodegeneration by FJ staining showed mild injury in the cerebral cortex, hippocampus and thalamus. TUNEL staining confirmed the presence of apoptotic cells and CD11b+ microglia indicated initiation of an inflammatory reaction leading to secondary damage in these areas. Analysis of spleen mRNA by PCR microarray of an inflammation panel led to the identification of CCL20 as an important pro-inflammatory signal upregulated 24 h after TBI. Although, CCL20 expression was observed in spleen and thymus after 24h of TBI, it was not expressed in degenerating cortex or hippocampal neurons until 48 h after insult. Splenectomy partially but significantly decreased the CCL20 expression in brain tissues. Conclusion These results demonstrate that the systemic inflammatory reaction to TBI starts earlier than the local brain response and suggest that spleen- and/ or thymus-derived CCL20 might play a role in

  17. Prevention of carbon tetrachloride (CCl4)-induced toxicity in testes of rats treated with Physalis peruviana L. fruit.

    Science.gov (United States)

    Abdel Moneim, Ahmed E

    2016-06-01

    Treatment of rats with carbon tetrachloride (CCl4; 2 ml/kg body weight) once a week for 12 weeks caused a significant decrease in serum levels of testosterone, luteinizing hormone, and follicle-stimulating hormone. These decreases in sex hormones were reduced with Physalis peruviana L. (Cape gooseberry) juice supplementation. In addition, testicular activity of antioxidant enzymes such as superoxide dismutase, catalase, glutathione peroxidase, glutathione reductase, and glutathione-S-transferase suppressed with CCl4 were elevated after P. peruviana juice supplements. P. peruviana juice supplementation significantly increased the testicular glutathione and significantly decreased the level of lipid peroxidation and the nitric oxide production compared with the CCl4 group. In addition, the decline in the activity of antioxidant enzymes after CCl4 was ameliorated by P. peruviana Moreover, degeneration of germ and Leydig cells along with deformities in spermatogenesis induced after CCl4 injections were prevented with the supplementation of P. peruviana juice. Furthermore, P. peruviana juice attenuated CCl4-induced apoptosis in testes tissue by inhibition of caspase-3 activity. The results clearly demonstrate that P. peruviana juice augments the antioxidants defense mechanism against CCl4-induced reproductive toxicity and provides evidence that the juice may have a therapeutic role in free radical-mediated diseases and infertility. PMID:25147302

  18. CCL5 promotes proliferation of MCF-7 cells through mTOR-dependent mRNA translation

    International Nuclear Information System (INIS)

    The proliferative capacity of cancer cells is regulated by factors intrinsic to cancer cells and by secreted factors in the microenvironment. Here, we investigated the proto-oncogenic potential of the chemokine receptor, CCR5, in MCF-7 breast cancer cell lines. At physiological levels, CCL5, a ligand for CCR5, enhanced MCF-7.CCR5 proliferation. Treatment with the mTOR inhibitor, rapamycin, inhibited this CCL5-inducible proliferation. Because mTOR directly modulates mRNA translation, we investigated whether CCL5 activation of CCR5 leads to increased translation. CCL5 induced the formation of the eIF4F translation initiation complex through an mTOR-dependent process. Indeed, CCL5 initiated mRNA translation, shown by an increase in high-molecular-weight polysomes. Specifically, we show that CCL5 mediated a rapid up-regulation of protein expression for cyclin D1, c-Myc and Dad-1, without affecting their mRNA levels. Taken together, we describe a mechanism by which CCL5 influences translation of rapamycin-sensitive mRNAs, thereby providing CCR5-positive breast cancer cells with a proliferative advantage.

  19. Diallyl disulfide inhibits TNFα induced CCL2 release through MAPK/ERK and NF-Kappa-B signaling.

    Science.gov (United States)

    Bauer, D; Redmon, N; Mazzio, E; Taka, E; Reuben, J S; Day, A; Sadrud-Din, S; Flores-Rozas, H; Soliman, K F A; Darling-Reed, S

    2015-09-01

    TNFα receptors are constitutively overexpressed in tumor cells, correlating to sustain elevated NFκB and monocyte chemotactic protein-1 (MCP-1/CCL2) expression. The elevation of CCL2 evokes aggressive forms of malignant tumors marked by tumor associated macrophage (TAM) recruitment, cell proliferation, invasion and angiogenesis. Previously, we have shown that the organo-sulfur compound diallyl disulfide (DADS) found in garlic (Allium sativum) attenuates TNFα induced CCL2 production in MDA-MB-231 cells. In the current study, we explored the signaling pathways responsible for DADS suppressive effect on TNFα mediated CCL2 release using PCR Arrays, RT-PCR and western blots. The data in this study show that TNFα initiates a rise in NFκB mRNA, which is not reversed by DADS. However, TNFα induced heightened expression of IKKε and phosphorylated ERK. The expression of these proteins corresponds to increased CCL2 release that can be attenuated by DADS. CCL2 induction by TNFα was also lessened by inhibitors of p38 (SB202190) and MEK (U0126) but not JNK (SP 600125), all of which were suppressed by DADS. In conclusion, the obtained results indicate that DADS down regulates TNFα invoked CCL2 production primarily through reduction of IKKε and phosphorylated-ERK, thereby impairing MAPK/ERK, and NFκB pathway signaling. Future research will be required to evaluate the effects of DADS on the function and expression of TNFα surface receptors. PMID:26100848

  20. MIP-3alpha/CCL20 in renal transplantation and its possible involvement as dendritic cell chemoattractant in allograft rejection.

    Science.gov (United States)

    Woltman, Andrea M; de Fijter, Johan W; van der Kooij, Sandra W; Jie, Kim E; Massacrier, Catherine; Caux, Christophe; Daha, Mohamed R; van Kooten, Cees

    2005-09-01

    Graft-infiltrating dendritic cells (DC) and alloreactive T lymphocytes play a critical role in renal allograft rejection. Renal proximal tubular epithelial cells (TEC) are considered as active players in the attraction of leukocytes during renal inflammatory responses. Macrophage inflammatory protein (MIP)-3alpha/CCL20 is a major chemokine expressed by epithelial cells that attracts immature DC. In the present study, we present evidence that also the transplanted kidney can be a major source of MIP-3alpha/CCL20. Renal transplant recipients with rejection showed significantly increased excretion of urinary MIP-3alpha/CCL20 that correlated with transplant function. The tubular staining for MIP-3alpha/CCL20 in renal biopsies of patients with rejection as well as in vitro studies with primary human TEC indicated that TEC might be responsible for the increased urinary MIP-3alpha/CCL20. Furthermore, MIP-3alpha/CCL20 produced by activated TEC was highly potent in the attraction of CD1a+CD34+-derived DC precursors. These data suggest a role for MIP-3alpha/CCL20 in amplification of the immune response during renal allograft rejection by attraction of CCR6+ inflammatory cells, which may include DC, to the site of inflammation. PMID:16095490

  1. Bovine CCL28 Mediates Chemotaxis via CCR10 and Demonstrates Direct Antimicrobial Activity against Mastitis Causing Bacteria.

    Directory of Open Access Journals (Sweden)

    Kyler B Pallister

    Full Text Available In addition to the well characterized function of chemokines in mediating the homing and accumulation of leukocytes to tissues, some chemokines also exhibit potent antimicrobial activity. Little is known of the potential role of chemokines in bovine mammary gland health and disease. The chemokine CCL28 has previously been shown to play a key role in the homing and accumulation of IgA antibody secreting cells to the lactating murine mammary gland. CCL28 has also been shown to act as an antimicrobial peptide with activity demonstrated against a wide range of pathogens including bacteria, fungi and protozoans. Here we describe the cloning and function of bovine CCL28 and document the concentration of this chemokine in bovine milk. Bovine CCL28 was shown to mediate cellular chemotaxis via the CCR10 chemokine receptor and exhibited antimicrobial activity against a variety of bovine mastitis causing organisms. The concentration of bovine CCL28 in milk was found to be highly correlated with the lactation cycle. Highest concentrations of CCL28 were observed soon after parturition, with levels decreasing over time. These results suggest a potential role for CCL28 in the prevention/resolution of bovine mastitis.

  2. CCl4对左旋氧氟沙星超声降解的影响%Effect of CCl4 on Antibiotics Levofloxacin' s Ultrasonic Degradation

    Institute of Scientific and Technical Information of China (English)

    魏红; 李娟; 李克斌; 孙剑宇; 赵锋

    2012-01-01

    The ultrasonic degradation of quinolone antibiotics levofloxacin in water with CC14 enhancement was investigated. The effects of CC14.dosage, ultrasonic power, pH value and initial concentration of levofloxacin were discussed. The products were examined by HPLC and LC-MS/MS. The results.indicated that the ultrasonic degradation of levofloxacin was obviously enhanced by CC14 addition; the degradation efficiency increased from 1. 9% to 69. 2% with CC14 dosage changed from 0 to 0. 06% ( volume fraction). The enhancement effect was attributed to the increasing · OH radical concentration and formation of chlorine-containing radicals in the presence of CC14 during ultrasonic processes. Levofloxacin degradation efficiency by ultrasonic in the presence of CC14 increased with the increasing of ultrasonic power in 100-200 W. The pH values of solution had prominent effect on levofloxacin degradation, while the initial concentration of levofloxacin had a negative effect. The temperature between 33-49 ℃ was found to be favorable to levofloxacin degradation. Moreover, HPLC analysis showed that two main by-products were simultaneously produced in the course of the ultrasonic degradation of levofloxacin in addition of CC14, the two products were confirmed by LC-MS/MS analysis.%研究了CCl4对超声降解喹诺酮类抗生素左旋氧氟沙星(Levofloxacin)的影响,考察了CCl4添加量、超声功率、溶液初始pH值及左旋氧氟沙星初始浓度等影响因素,并采用HPLC和LC-MS/MS对超声降解产物进行了初步分析.结果表明,CCl4增强了左旋氧氟沙星的超声降解,当反应液体积为50 mL,超声35 min时,随着CCl4体积分数的增大(0~0.06%),左旋氧氟沙星的降解率由1.9%增至69.2%;超声功率为100 ~200 W时,降解率随着功率的升高而增大,功率为200~400 W时降解率有所降低;pH值对左旋氧氟沙星的超声降解影响很大,pH =7.14时容易超声降解,pH过低或过高均导致降解率显著减小;CCl

  3. HMG-CoA reductase regulates CCL17-induced colon cancer cell migration via geranylgeranylation and RhoA activation

    Energy Technology Data Exchange (ETDEWEB)

    Al-Haidari, Amr A.; Syk, Ingvar; Thorlacius, Henrik, E-mail: henrik.thorlacius@med.lu.se

    2014-03-28

    Highlights: • Simvastatin blocked CCL17-induced and CCR4-dependent RhoA activation in HT29 cells. • CCL17/CCR4-mediated migration of colon cancer cells was antagonised by simvastatin. • Cell migration recovered by adding Mevalonate and geranylgeranyl pyrophosphate. • Targeting HMG-CoA reductase might be useful to inhibit colon cancer metastasis. - Abstract: Background: Simvastatin is widely used to lower cholesterol levels in patients with cardiovascular diseases, although accumulating evidence suggests that statins, such as simvastatin, also exert numerous anti-tumoral effects. Aim: The aim of this study was to examine the effect of simvastatin on colon cancer cell migration. Methods: Migration assays were performed to evaluate CCL17-induced colon cancer cell (HT-29) chemotaxis. In vitro tumor growth and apoptosis were assessed using a proliferation assay and annexin V assay, respectively. Active RhoA protein levels in CCL17-stimulated colon cancer cells were quantified using a G-LISA assay. Results: We found that simvastatin dose-dependently decreased CCL17-induced colon cancer cell migration. Simvastatin had no effect on colon cancer cell proliferation or apoptosis. Inhibition of beta chemokine receptor 4, CCR4, reduced CCL17-evoked activation of RhoA in colon cancer cells. Moreover, administration of mevalonate reversed the inhibitory effect of simvastatin on CCL17-induced colon cancer cell migration. Interestingly, co-incubation with geranylgeranyl pyrophosphate (GGPP) antagonized the inhibitory impact of simvastatin on colon cancer cell migration triggered by CCL17. Moreover, we observed that simvastatin decreased CCL17-induced activation of RhoA in colon cancer cells. Administration of mevalonate and GGPP reversed the inhibitory effect of simvastatin on CCL17-provoked RhoA activation in colon cancer cells. Conclusions: Taken together, our findings show for the first time that HMG-CoA reductase regulates CCL17-induced colon cancer cell migration via

  4. Chicory (Cichorium intybus L.) Root Extract Regulates the Oxidative Status and Antioxidant Gene Transcripts in CCl4-Induced Hepatotoxicity

    OpenAIRE

    El-Sayed, Yasser S.; Lebda, Mohamed A.; Mohammed Hassinin; Neoman, Saad A.

    2015-01-01

    The ability of Cichorium intybus root extract (chicory extract) to protect against carbon tetrachloride (CCl4)-induced oxidative stress and hepatotoxicity was evaluated in male rats. The rats were divided into four groups according to treatment: saline (control); chicory extract (100 mg/kg body weight daily, given orally for 2 weeks); CCl4 (1 ml/kg body weight by intraperitoneal injection for 2 consecutive days only); or chicory extract (100 mg/kg body weight daily for 2 weeks) + CCl4 injecti...

  5. Protective effect of recombinant human IL-1Ra on CCl_4-induced acute liver injury in mice

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    AIM: To evaluate the effects of positive regulation of recombinant human interleukin 1 receptor antagonist (rhIL-1Ra) on hepatic tissue recovery in acute liver injury in mice induced by carbon tetrachloride (CCl 4 ). METHODS: Acute liver damage was induced by injecting 8-wk-old mice with CCl 4 1 mL/kg (1:3 dilution in corn oil) intraperitoneally (ip). Survival after liver failure was assessed by injecting 8-wk-old mice with a lethal dose of CCl 4 2.6 mL/kg (1:1 dilution in corn oil) ip. Mice were subcutaneo...

  6. HMG-CoA reductase regulates CCL17-induced colon cancer cell migration via geranylgeranylation and RhoA activation

    International Nuclear Information System (INIS)

    Highlights: • Simvastatin blocked CCL17-induced and CCR4-dependent RhoA activation in HT29 cells. • CCL17/CCR4-mediated migration of colon cancer cells was antagonised by simvastatin. • Cell migration recovered by adding Mevalonate and geranylgeranyl pyrophosphate. • Targeting HMG-CoA reductase might be useful to inhibit colon cancer metastasis. - Abstract: Background: Simvastatin is widely used to lower cholesterol levels in patients with cardiovascular diseases, although accumulating evidence suggests that statins, such as simvastatin, also exert numerous anti-tumoral effects. Aim: The aim of this study was to examine the effect of simvastatin on colon cancer cell migration. Methods: Migration assays were performed to evaluate CCL17-induced colon cancer cell (HT-29) chemotaxis. In vitro tumor growth and apoptosis were assessed using a proliferation assay and annexin V assay, respectively. Active RhoA protein levels in CCL17-stimulated colon cancer cells were quantified using a G-LISA assay. Results: We found that simvastatin dose-dependently decreased CCL17-induced colon cancer cell migration. Simvastatin had no effect on colon cancer cell proliferation or apoptosis. Inhibition of beta chemokine receptor 4, CCR4, reduced CCL17-evoked activation of RhoA in colon cancer cells. Moreover, administration of mevalonate reversed the inhibitory effect of simvastatin on CCL17-induced colon cancer cell migration. Interestingly, co-incubation with geranylgeranyl pyrophosphate (GGPP) antagonized the inhibitory impact of simvastatin on colon cancer cell migration triggered by CCL17. Moreover, we observed that simvastatin decreased CCL17-induced activation of RhoA in colon cancer cells. Administration of mevalonate and GGPP reversed the inhibitory effect of simvastatin on CCL17-provoked RhoA activation in colon cancer cells. Conclusions: Taken together, our findings show for the first time that HMG-CoA reductase regulates CCL17-induced colon cancer cell migration via

  7. Structural and functional characterization of the interactions of platelet derived chemokines CCL5, CXCL4 and CXCL4L1

    OpenAIRE

    Sarabi, Alisina

    2011-01-01

    Chemokines play an important role in the development of inflammation and in the recruitment of leukocytes from the vessel into the inflamed tissue. Activated platelets serve as a rich source of chemokines, e.g. CCL5, CXCL4 and its closely related variant CXCL4L1. The pro-inflammatory CCL5 is a known potent chemoattractant for monocytes and also responsible for its arrest on inflamed endothelium. Since this arrest is enhanced by the interaction of CCL5 with CXCL4, we aimed to determine the str...

  8. Dynamic change of hepcidin in liver fibrosis induced by CCl4 among mice

    Directory of Open Access Journals (Sweden)

    PANG Guojin

    2015-03-01

    Full Text Available ObjectiveTo investigate the dynamic change of hepcidin in liver fibrosis induced by CCl4 among mice. MethodsC57BL/6 mice were given CCl4 by intragastric administration to establish a liver fibrosis model. The degree of liver injury and fibrosis was evaluated by HE and Masson staining. Prussian blue staining was used to detect liver iron deposition in the progression of liver fibrosis. Primary hepatocytes, hepatic stellate cells, and Kupffer cells were isolated from C57BL/6 mice by two-step in situ collagenase perfusion and density gradient centrifugation. The mRNA levels of tumor necrosis factor alpha (TNFα, interleukin-6 (IL-6, interleukin-1β (IL-1β, and hepcidin were measured by quantitative real-time PCR (qRT-PCR. Continuous data were expressed as mean±SD, and comparison of continuous data between the two groups was made by t test. ResultsThe HE and Masson staining of liver tissues showed that the degree of liver fibrosis gradually increased as CCl4 was given, and hepatic fibrosis was reversed after the administration of CCl4 was stopped. Prussian blue staining showed that liver iron deposition increased as CCl4 was given; the area of liver iron deposition was significantly increased compared with that of the normal control group at week 4 of administration (t=4.772, P<0.05, but no significant increase was seen from week 4 to week 6; the area of liver iron deposition at week 6 was still higher than that of the normal control group (t=10.32, P<0.05; liver iron deposition decreased in the spontaneous reversal after the administration was stopped. The mRNA levels of TNFα, IL-1β, and IL-6 assessed by qRT-PCR continuously increased in model mice, reaching the peak levels at week 6, and significant differences were observed between the model mice and normal controls (t=4.322, 9.707, and 5.678, P<0.05 for all. The expression of hepcidin in the liver increased in the early stage of model establishment and reached the peak level at week 4

  9. P1/Fas-CCL19双表达重组腺病毒载体的构建及表达鉴定%Construction and Identification of PI/Fas-CCL19 Double Expressed Reorganization Adenovirus Carrier

    Institute of Scientific and Technical Information of China (English)

    姜兆静; 李纪强; 张积仁

    2012-01-01

    目的 利用pAdEasy-1腺病毒包装系统构建血型B抗原模拟多肽P1/Fas CCL19双表达重组腺病毒,并在体内外试验中验证其表达及可能的疗效.方法 应用腺病毒穿梭质粒pShuttle-CMV、骨架质粒pAdEasy-1构建重组腺病毒质粒pAd-CMV-P1/Fas-CCL19并转染至HEK293A细胞,获得重组腺病毒Ad-P1/Fas-CCL19颗粒后进一步感染乳腺癌4T1细胞并鉴定转染4T1细胞内P1/Fas-CCL19mRNA和蛋白质的表达.构建经人B型血红细胞免疫的4T1荷瘤小鼠模型,比较瘤内注射重组腺病毒Ad-P1/Fas-CCL19组、空腺病毒组、0.9%氯化钠溶液组的荷瘤小鼠的肿瘤变化及生存期.结果 感染后4T1细胞中P1/Fas-CCL19 mRNA和蛋白质均有表达.瘤内注射重组腺病毒Ad-P1/Fas-CCL19较瘤内注射空腺病毒、0.9%氯化钠溶液明显抑制4T1肿瘤的生长,但三组小鼠的生存期无明显区别.结论 P1/Fas-CCL19重组腺病毒载体成功构建,体内外实验均证明了其稳定表达及有效性,为进一步临床研究奠定了基础.%Objective To construct recombinant adenovirus expressing both simulated peptide of blood group B antigen Pi/Fas and CCL19 by pAdEasy-1 packaging system,and test their expression. Methods We constructed pShutt Ie-CMV-P1/Fas-CCL19 by adenovirus Shuttle plasmid pShuttle-CMV and pAdEasy-1. Then,we transfected pAd-CMV-P1/Fas CCL19 to HEK293A cells and obtained recombinant Ad-Pl/Fas-CCL19 particles which can infect 4T1 cells. At last we detected mRNA and protein expression of Pl/Fas-CCL19 in 4T1 cells. 4T1 tumor-bearing mice model immuned by the B red blood cell was established successfully,and injected with recombinant adenovirus Ad-Pl/Fas-CCL19,empty adenovirus,saline into the tumors, respectively. Then, tumor changes and survival period of the three groups were compared. Results Pl/Fas-CCL19 can be effectively expressed in 4T1 cells on both mRNA and protein levels. Intratumor injection of recombinant adenovirus Ad-Pl/Fas-CCL19 group inhibited 4T1

  10. Antihepatotoxic effect of golden berry (Physalis peruviana Linn.) in carbon tetrachloride (CCl4) intoxicated rats.

    Science.gov (United States)

    Taj, Darakhshan; Khan, Hira; Sultana, Viqar; Ara, Jehan; Ehteshamul-Haque, Syed

    2014-05-01

    Liver is the main site in the body for intense metabolism and excretion. A number of chemicals and drugs which are used routinely cause liver damage. The present study investigates the antihepatotoxic effect of Physalis peruviana whole ripe fruit, water and ethanol extracts of fruit in normal as well as in carbon tetrachloride (CCl(4)) intoxicated rats. The CCl(4) treated rats showed marked elevation in liver enzymes: alanine transaminse, aspratate transaminase, alkaline phosphatase, lactate dehydrogenase and other biochemical parameters: bilirubin, creatinine and urea, thus indicating liver injury. Whereas animal treated/fed with various preparations of Physalis peruviana showed significant lowering effect (pPhysalis peruviana showed highest activity in both rat models while ripe fruit and ethanol extract showed moderate activity compared to standard drug. PMID:24811807

  11. Reaction of carotenoids with CCl3OO· by using pulse radiolysis

    Institute of Scientific and Technical Information of China (English)

    赵文恩; 姚思德; 王强; 钱素平; 王文峰; 韩雅珊

    2003-01-01

    The interactions of carotenoids (bixin, β-carotene and lycopene) with CCl3OO@ in aqueous and i-propylalcohol solution saturated with air have been studied by pulse radiolysis. For bixin and β-carotene reaction products from forming process, absorbing in the region of 650 nm, is observed with concomitant carotenoid bleaching (bixin at 500 nm, β-carotene at 450 nm). Their rate constants from forming process are 1.78×108 and 7.8×107 mol-1@L@s-1 respectively. However, in the case of lycopene, no such a forming process of reaction as bixin and β-carotene can be observed although there is the bleaching reaction (rate constant 4×107 mol-1@L@s-1). The results suggest that the carotenoid radical cationand an additional radical are produced in the case of bixin and β-carotene, whereas lycopene undergoes electron transfer with CCl3OO@, forming cation radical.

  12. Suppression of indium droplet formation by adding CCl4 during metalorganic chemical vapor deposition growth of InN films

    International Nuclear Information System (INIS)

    In this work, the influences of CCl4 on the metalorganic chemical vapor deposition (MOCVD) growth of InN were studied for the first time. It was found that the addition of CCl4 can effectively suppress the formation of metal indium (In) droplets during InN growth, which was ascribed to the etching effect of Cl to In. However, with increasing of CCl4 flow, the InN growth rate decreased but the lateral growth of InN islands was enhanced. This provides a possibility of promoting islands coalescence toward a smooth surface of the InN film by MOCVD. The influence of addition of CCl4 on the electrical properties was also investigated

  13. Protective effect of recombinant human IL-1Ra on CCl4-induced acute liver injury in mice

    OpenAIRE

    Zhu, Run-Zhi; Xiang, Di; Xie, Chao; Li, Jing-Jing; Hu, Jian-Jun; He, Hong-Lin; Yuan, Yun-Sheng; GAO, JIN; HAN, WEI; Yu, Yan

    2010-01-01

    AIM: To evaluate the effects of positive regulation of recombinant human interleukin 1 receptor antagonist (rhIL-1Ra) on hepatic tissue recovery in acute liver injury in mice induced by carbon tetrachloride (CCl4).

  14. HEPATOPROTECTIVE EFFECT OF METHANOLIC EXTRACT OF HEDYOTIS HERBACEA LINN IN CCl4 TREATED MALE RATS

    OpenAIRE

    Sharma Naveen; Jain AK; Sharma Vipin; Jain Suman; Saluja Gurdeep

    2012-01-01

    To evaluate the hepatoprotective effect of methanolic extract of Hedyotis herbacea Linn in rats treated with CCl4. In Hepatotoxic rats, liver damage was studied by assessing parameters such as aspartate amino transferase (AST), alanine amino transferase (ALT), alkaline phosphate transferase (ALP) and gamma glutamyl transpeptidase (GGT) in serum and concentration of total proteins, total lipids, phospholipids, triglycerides and cholesterol in both serum and liver. The effect of co-administrati...

  15. CCL2-ethanol interactions and hippocampal synaptic protein expression in a transgenic mouse model

    OpenAIRE

    Gruol, Donna L.; Vo, Khanh; Bray, Jennifer G.; Roberts, Amanda J.

    2014-01-01

    Chronic exposure to ethanol produces a number of detrimental effects on behavior. Neuroadaptive changes in brain structure or function underlie these behavioral effects and may be transient or persistent in nature. Central to the functional changes are alterations in the biology of neuronal and glial cells of the brain. Recent data show that ethanol induces glial cells of the brain to produce elevated levels of neuroimmune factors including CCL2, a key innate immune chemokine. Depending on th...

  16. Pharmacological investigation of Polyherbal formulation on Carbon tetrachloride (CCl4-induced liver damage in wistar rats

    Directory of Open Access Journals (Sweden)

    Hardik Soni

    2014-09-01

    Full Text Available Objective: To investigate effect of Polyherbal formulation on Carbon tetrachloride (CCl4-induced liver damage in wistar rats. Methods: Wistar albino rats weighing 180-230 g either sex were used. The selected animals were divided in to four groups where each group consisted of six animals. Experimentally liver damage was produced by intra-peritoneal administration of CCl4 and olive oil mixture (1:1 v/v (1 mL/kg, once daily, i.p. for 7 days. Test Drug, Polyherbal formulation was administered orally for 7 consecutive days at 3 mL/kg, once daily. On 8th day, Blood samples were collected to evaluate different serum biochemical parameters like Aspartate aminotransferase (AST, Alanine aminotransferase (ALT, Alkaline phosphatase (ALP, Total bilirubin and Total protein. Liver from animals of each group was dissected out for histopathological examination. Statistical analysis: Statistical calculation were done by analysis of variance (ANOVA followed by post hoc Dunnett’s test, with significant level of p<0.05. Results and dDiscussion: Polyherbal formulation showed significant effect on activity levels of serum AST, ALT, ALP and total bilirubin level while comparing test group to disease control group. It also showed significant elevation in decreased level of serum total protein. Pre-treatment of Polyherbal formulation restored the hepatic architecture and protected the liver tissue from fatty degenerative changes by preventing the toxic chemical reaction induced by CCl4. Conclusion: Finding of this study concludes that Polyherbal formulation (Vasuliv Syrup has promising hepatoprotective activity against CCl4-induced liver damage. It can be employed as safe and effective treatment for hepato-toxicity or liver damage.

  17. PROTECTIVE ABILITY OF MOMORDICA CHARANTIA L AGAINST CCL4 INDUCED HEPATIC DAMAGE IN RATS

    OpenAIRE

    Pingale Shirish S

    2010-01-01

    The aim of this study is to evaluate the efficacy of Momordica charantia on the experimental hepatotoxicity induced by carbon tetrachloride (CCl4). Carbon tetrachloride was administered once and simultaneously suspension of dry fruit powder was prepared in aqueous medium and was daily administered at a dose level of 1mg/kg body weight for 4 days. Silymarin was used as a standard drug for this study. Administration of carbon tetrachloride showed significant changes in the levels of serum amino...

  18. Expression and histopathological correlation of CCR9 and CCL25 in ovarian cancer

    OpenAIRE

    Singh, Rajesh; Cecil R. Stockard; Grizzle, William E.; Lillard, James W.; Singh, Shailesh

    2011-01-01

    Ovarian carcinoma is the most lethal gynecological malignancy among women and its poor prognosis is mainly due to metastasis. Chemokine receptor CCR9 is primarily expressed by a small subset of immune cells. The interactions between CCL25 and CCR9 have been implicated in leukocyte trafficking to the small bowel, a frequent metastatic site for ovarian cancer cells. We have previously shown that ovarian cancer cells express CCR9 and play an important role in cell migration, invasion and surviva...

  19. Tumor cell entry into the lymph node is controlled by CCL1 chemokine expressed by lymph node lymphatic sinuses

    OpenAIRE

    Das, Suvendu; Sarrou, Eliana; Podgrabinska, Simona; Cassella, Melanie; Mungamuri, Sathish Kumar; Feirt, Nikki; Gordon, Ronald; Nagi, Chandandeep S.; Wang, YaRong; Entenberg, David; Condeelis, John; Skobe, Mihaela

    2013-01-01

    Lymphatic vessels are thought to contribute to metastasis primarily by serving as a transportation system. It is widely believed that tumor cells enter lymph nodes passively by the flow of lymph. We demonstrate that lymph node lymphatic sinuses control tumor cell entry into the lymph node, which requires active tumor cell migration. In human and mouse tissues, CCL1 protein is detected in lymph node lymphatic sinuses but not in the peripheral lymphatics. CCR8, the receptor for CCL1, is strongl...

  20. CCL2 is transcriptionally controlled by the lysosomal protease cathepsin S in a CD74-dependent manner

    OpenAIRE

    Wilkinson, Richard; Magorrian, Sinead; Williams, Richard; Young, Andrew; Small, Donna; Scott, Christopher; Burden, Roberta

    2015-01-01

    Cathepsins S (CatS) has been implicated in numerous tumourigenic processes and here we document for the first time its involvement in CCL2 regulation within the tumour microenvironment. Analysis of syngeneic tumours highlighted reduced infiltrating macrophages in CatS depleted tumours. Interrogation of tumours and serum revealed genetic ablation of CatS leads to the depletion of several pro-inflammatory chemokines, most notably, CCL2. This observation was validated in vitro, where shRNA deple...

  1. The Protective Effect of Liquorice Plant Extract on CCl4-Induced Hepatotoxicity in Common Carp (Cyprinus carpio

    Directory of Open Access Journals (Sweden)

    Hassan Malekinejad

    2010-12-01

    Full Text Available The protective effect of liquorice plant extract (LPE on CCl4-induced hepatotoxicity in common carp was evaluated using fifty adult carps. The fish were cultured in a standard environment in terms of water flow rate, oxygen, pH, food and temperature. The fish were assigned into 5 groups (N = 10 as control, sham, and tests. The test groups were pre-treated for 3 h with various concentrations of LPE, 3 days before CCl4 exposure. The control and sham groups received normal saline before and after CCl4 exposure. To induce hepatotoxicity, animals in the sham and test groups were exposed against 100 l L-1 CCl4 for 45 min. The fish in all groups 1 h after CCl4 exposure were anesthetized and the blood samples were collected. Immediately the liver specimens were dissected out and were stored in 10 % formalin for further pathological studies. Determination of serum level of ALP and SGOT revealed that acute form of CCl4 exposure elevated significantly (P < 0.05 the serum level of either tested hepatic marker enzymes. While 3 days pretreatment with LPE prevented from ALP and SGOT enhancement. The pathological evaluation revealed that the CCl4 exposure resulted in a minor pathologic manifestation such as slight congestion, which the LPE pretreated groups showed the remarkable improvement. The anti-oxidant capacity of LPE was assayed by FRAP and DPPH methods. Both provided techniques showed that LPE exerts an excellent anti-oxidant effect. This data suggest that LPE exerts protective effect against CCl4-induced hepatotoxicity. Moreover, the hepatoprotective effect of LPE may attribute to its antioxidant capacity.

  2. CCL27: Novel Cytokine with Potential Role in Pathogenesis of Multiple Sclerosis

    Directory of Open Access Journals (Sweden)

    Svetlana F. Khaiboullina

    2015-01-01

    Full Text Available Multiple sclerosis (MS is an autoimmune and neurodegenerative disease of unknown etiology. Leukocyte infiltration of brain tissue and the subsequent inflammation, demyelination, axonal damage, and formation of sclerotic plaques is a hallmark of MS. Upregulation of proinflammatory cytokines has been suggested to play an essential role in regulating lymphocyte migration in MS. Here we present data on serum cytokine expression in MS cases. Increased serum levels of IL-17 and IL-23 were observed, suggesting activation of the Th17 population of immune effector cells. Additionally, increased levels of IL-22 were observed in the serum of those with acute phase MS. Unexpectedly, we observed an upregulation of the serum chemokine CCL27 in newly diagnosed and acute MS cases. CCL27 is an inflammatory chemokine associated with homing of memory T cells to sites of inflammation. Therefore, its upregulation in association with MS suggests a potential role in disease pathogenesis. Our data supports previous reports showing IL-17 and -23 upregulation in association with MS and potentially identify a previously unknown involvement for CCL27.

  3. C-terminal engineering of CXCL12 and CCL5 chemokines: functional characterization by electrophysiological recordings.

    Directory of Open Access Journals (Sweden)

    Antoine Picciocchi

    Full Text Available Chemokines are chemotactic cytokines comprised of 70-100 amino acids. The chemokines CXCL12 and CCL5 are the endogenous ligands of the CXCR4 and CCR5 G protein-coupled receptors that are also HIV co-receptors. Biochemical, structural and functional studies of receptors are ligand-consuming and the cost of commercial chemokines hinders their use in such studies. Here, we describe methods for the expression, refolding, purification, and functional characterization of CXCL12 and CCL5 constructs incorporating C-terminal epitope tags. The model tags used were hexahistidines and Strep-Tag for affinity purification, and the double lanthanoid binding tag for fluorescence imaging and crystal structure resolution. The ability of modified and purified chemokines to bind and activate CXCR4 and CCR5 receptors was tested in Xenopus oocytes expressing the receptors, together with a Kir3 G-protein activated K(+ channel that served as a reporter of receptor activation. Results demonstrate that tags greatly influence the biochemical properties of the recombinant chemokines. Besides, despite the absence of any evidence for CXCL12 or CCL5 C-terminus involvement in receptor binding and activation, we demonstrated unpredictable effects of tag insertion on the ligand apparent affinity and efficacy or on the ligand dissociation. These tagged chemokines should constitute useful tools for the selective purification of properly-folded chemokines receptors and the study of their native quaternary structures.

  4. Ginkgo biloba extract reverses CCl4-induced liver fibrosis in rats

    Institute of Scientific and Technical Information of China (English)

    Yan-Jun Luo; Jie-Ping Yu; Zhao-Hong Shi; Li Wang

    2004-01-01

    AIM: To study the reversing effect of Ginkgo biloba extract (GbE) on established liver fibrosis in rats.METHODS: Following confirmation of CCl4-induced liver fibrosis, GbE or saline was administrated to the rats for 4 weeks. The remaining rats received neither CCl4 nor GbE as normal control. The four groups were compared in terms of serum enzymes, tissue damage, expression of αSMA and tissue inhibitor-1 of metalloproteinase (TIMP-1) and metalloproteinase-1 (MMP-1).RESULTS: Compared with saline-treated group, liver fibrosis rats treated with GbE had decreased serum total bilirubin (P<0.01) and aminotransferase levels (P<0.01) and increased levels of serum albumin (P<0.01). Microscopic studies revealed that the livers of rats receiving GbE showed allieviation in fibrosis (P<0.05) as well as expression of αSMA (P<0.01). The liver collagen and reticulum contents were lower in rats treated with GbE than saline-treated group (P<0.01). RT-PCR revealed that the level of TIMP-1 decreased while the level of MMP-1 increased in GbE group.CONCLUSION: Administration of GbE improved CCl4-induced liver fibrosis. It is possibly attributed to its effect of inhibiting the expression of TIMP-1 and promoting the apoptosis of hepatic stellate cells.

  5. [Triterpenoids from Inonotus obliquus protect mice against oxidative damage induced by CCl4].

    Science.gov (United States)

    Zhao, Fen-Qin; Yan, Lin; Cui, Xian-Hong; Lin, Sheng; Wang, Cong; Zhang, Hui; Kang, Xiao-Yan; Ji, Bian-Sheng

    2012-05-01

    To investigate the effects of lanosterol (1), inotodiol (2) and trametenolic acid (3) from Inonotus obliquus against oxidative damage induced by CCl4 in mice, 1, 2 and 3 (20, 10 and 5 mg x kg(-1)) were respectively administered to mice, once a day for 3 days. Then the mice were induced to oxidative damage by CCl4 on the third day 30 min after the administration. The activities of superoxide dismutase (SOD), catalase (CAT), glutathione peroxidase (GSH-PX) and the content of malondialdehyde (MDA) and reductive glutathione (GSH) in serum and liver homogenate were determined. And the levels of alanine aminotransferase (ALT) and aspartate aminotransferase (AST) and interleukin-6 (IL-6) concentration in serum were detected. The results showed that treatment with compound 1, 2 and 3 could significantly increase the activities of SOD, CAT and GSH-PX in serum and liver homogenate. Furthermore, the content of GSH in serum and liver homogenate increased and MDA content decreased markedly. In addition, compound 1, 2 and 3 could significantly inhibit the activities of ALT and AST in serum, and decrease the IL-6 concentration in serum remarkably. So, compound 1, 2 and 3 can protect mice against oxidative stress injury induced by CCl4. Furthermore, compound 1, 2 and 3 can protect cells from damage through inhibition on ALT, AST and the expression of IL-6. PMID:22812017

  6. Analysis of radiorespirometric pattern in rats bearing liver injury treated with CCl4

    International Nuclear Information System (INIS)

    Respirometric pattern in rats during the recovery from liver injury treated with 20% CCl4 for radioactivity from glucose (U-14C) was studied associating with the changes in transaminase and glycolytic enzyme activities. The results were as follows: (1) In radiorespirometry, peak time (PT) was delayed about 10 minutes over as compared with control, hastened markedly at 3rd day, and thereafter become to be normal level. On the other hand, peak height (PH) and yield value (YV) which decreased at 1st day were represented the values at 3rd day before the treatment of CCl4. (2) Transaminase, glutamic oxalacetic transaminase (GOT), and glutamic pyruvic transaminase (GPT) activities were both increased immediately after the treatment of CCl4 on the basis of liver cell destruction and reached at maximum between 1st and 2nd day. At 3rd day, these activities were become to decrease and shown normal levels at 4th day. (3) Glycolytic enzyme, pyruvate kinase (PK), hexokinase (HK), and glucose-6-phosphate dehydrogenase (G-6-PD) were markedly activated at 3rd day and thereafter shown normal level. (4) These radiorespirometric pattern reflected well the physiological or biochemical states in rats. As the results of this study, radiorespirometry can be useful method for clinical diagnosis of liver disease. (author)

  7. Attenuation of CCl4-Induced Oxidative Stress and Hepatonephrotoxicity by Saudi Sidr Honey in Rats

    Directory of Open Access Journals (Sweden)

    Mohammed Al-Yahya

    2013-01-01

    Full Text Available The present study was undertaken to investigate the possible protective effect of Saudi Sidr honey (SSH on carbon tetrachloride (CCl4 induced oxidative stress and liver and kidney damage in rat. Moreover, the antioxidant activity and the phenolic and flavonoidal contents were determined. The hepatorenal protective activity of the SSH was determined by assessing biochemical, hematological, and histological parameters. Serum transaminases, ALP, GGT, creatinine, bilirubin urea, uric acid, and MDA level in liver and kidney tissues were significantly elevated, and the antioxidant status of nonprotein sulfhydryls, albumin, and total protein levels in liver and kidney were declined significantly in CCl4 alone treated animals. Pretreatment with SSH and silymarin prior to the administration of CCl4 significantly prevented the increase of the serum levels of enzyme markers and reduced oxidative stress. SSH also exhibited a significant lipid-lowering effect and caused an HDL-C enhanced level in serum. The histopathological evaluation of the liver and kidney also revealed that honey protected incidence of both liver and kidney lesions. Moreover, SSH showed a strong antioxidant activity in DPPH and β-carotene-linoleic acid assays. SSH was found to contain phenolic compounds. Additionally, the SSH supplementation restored the hepatocytes viability against 2′,7′-dichlorofluorescein (DCF toxicity in ex vivo test.

  8. Visfatin Mediates SCLC Cells Migration across Brain Endothelial Cells through Upregulation of CCL2

    Directory of Open Access Journals (Sweden)

    Tingting Liu

    2015-05-01

    Full Text Available Small-cell lung cancer (SCLC is characterized as an aggressive tumor with brain metastasis. Although preventing SCLC metastasis to the brain is immensely important for survival, the molecular mechanisms of SCLC cells penetrating the blood–brain barrier (BBB are largely unknown. Recently, visfatin has been considered as a novel pro-inflammatory adipocytokine involved in various cancers. Herein, we present evidence that elevated levels of visfatin in the serum of SCLC patients were associated with brain metastasis, and visfain was increased in NCI-H446 cells, a SCLC cell line, during interacting with human brain microvascular endothelial cells (HBMEC. Using in vitro BBB model, we found that visfatin could promote NCI-H446 cells migration across HBMEC monolayer, while the effect was inhibited by knockdown of visfatin. Furthermore, our findings indicated that CC chemokine ligand 2 (CCL2 was involved in visfatin-mediated NCI-H446 cells transendothelial migtation. Results also showed that the upregulation of CCL2 in the co-culture system was reversed by blockade of visfatin. In particular, visfatin-induced CCL2 was attenuated by specific inhibitor of PI3K/Akt signaling in NCI-H446 cells. Taken together, we demonstrated that visfatin was a prospective target for SCLC metastasis to brain, and understanding the molecular mediators would lead to effective strategies for inhibition of SCLC brain metastasis.

  9. Structures of Trichloromethyl Thiocyanate, CCl3 SCN, in Gaseous and Crystalline State.

    Science.gov (United States)

    Berrueta Martínez, Yanina; Rodríguez Pirani, Lucas S; Erben, Mauricio F; Boese, Roland; Reuter, Christian G; Vishnevskiy, Yury V; Mitzel, Norbert W; Della Védova, Carlos O

    2016-05-18

    Trichloromethyl thiocyanate, CCl3 SCN, was structurally studied in both the gas and crystal phases by means of gas electron diffraction (GED) and single-crystal X-ray diffraction (XRD), respectively. Both experimental studies and quantum chemical calculations indicate a staggered orientation of the CCl3 group relative to the SCN group. This conclusion is supported by the similarity of the C-SCN bond length to that of the anti-structure of CH2 ClSCN (Berrueta Martínez et al. Phys. Chem. Chem. Phys. 2015, 17, 15805-15812). Bond lengths and angles are similar for gas and crystal CCl3 SCN structures; however, the crystal structure presents different intermolecular interactions. These include halogen and chalcogen type interactions, the geometry of which was studied. Characteristic C-Y⋅⋅⋅N angles (Y=Cl or S) close to 180° provide evidence for typical σ-hole interactions along the halogen/chalcogen-carbon bond in N⋅⋅⋅Cl and N⋅⋅⋅S, intermolecular units. PMID:26865044

  10. Design and Analysis of Vacuum Pumping Systems for SNS DTL and CCL Linac

    International Nuclear Information System (INIS)

    The mechanical design of the vacuum pumping systems for SNS DTL (Drift Tube Linac) and CCL (Cavity Coupled Linac) linac systems is summarized. Both vacuum systems were modeled to select the optimal pump configuration. The pressure history in up to 182 sub-volumes was analyzed in detail. Included in the model are time-dependent outgassing rates and pressure-dependent pump speeds for a variety of gas species. With this information, we solved for the pressure history during roughing and with turbo and ion pumps. The number and size of each pump were optimized to achieve the desired pressure with minimal costs. In the optimized design, directly mounted ion pumps were provided for six DTL tanks. For four CCL modules (each in length of 12-15 m), ion pumps with manifolds were selected. With all metallic surface outgassing, seal leakage and expected gas loads from all diagnostic devices taken into account, the designed systems can provide operating drift-tube pressure below 1.8 x 10-7 Torr and CCL beamline pressures below 9.2 x 10-8 Torr even under abnormal conditions. Details of the design and the modeling results are presented

  11. Compartmentalized production of CCL17 in vivo: strong inducibility in peripheral dendritic cells contrasts selective absence from the spleen.

    Science.gov (United States)

    Alferink, Judith; Lieberam, Ivo; Reindl, Wolfgang; Behrens, Andrea; Weiss, Susanne; Hüser, Norbert; Gerauer, Klaus; Ross, Ralf; Reske-Kunz, Angelika B; Ahmad-Nejad, Parviz; Wagner, Hermann; Förster, Irmgard

    2003-03-01

    Dendritic cells (DCs)(*) fulfill an important regulatory function at the interface of the innate and adaptive immune system. The thymus and activation-regulated chemokine (TARC/CCL17) is produced by DCs and facilitates the attraction of activated T cells. Using a fluorescence-based in vivo reporter system, we show that CCL17 expression in mice is found in activated Langerhans cells and mature DCs located in various lymphoid and nonlymphoid organs, and is up-regulated after stimulation with Toll-like receptor ligands. DCs expressing CCL17 belong to the CD11b(+)CD8(-)Dec205(+) DC subset, including the myeloid-related DCs located in the subepithelial dome of Peyer's patches. CCL17-deficient mice mount diminished T cell-dependent contact hypersensitivity responses and display a deficiency in rejection of allogeneic organ transplants. In contrast to lymphoid organs located at external barriers of the skin and mucosa, CCL17 is not expressed in the spleen, even after systemic microbial challenge or after in vitro stimulation. These findings indicate that CCL17 production is a hallmark of local DC stimulation in peripheral organs but is absent from the spleen as a filter of blood-borne antigens. PMID:12615900

  12. Bone marrow cells ameliorate liver fibrosis and express albumin after transplantation in CCl 4 -induced fibrotic liver

    Directory of Open Access Journals (Sweden)

    Gibran Ali

    2012-01-01

    Full Text Available Background/Aim: We investigated the effect of bone marrow-derived stem cell (BMSC transplantation on carbon tetrachloride (CCl 4 -induced liver fibrosis. Patients and Methods: BMSCs of green fluorescent protein (GFP mice were transplanted into 4-week CCl 4 -treated C57BL/6 mice directly to the liver, and the mice were treated for 4 more weeks with CCl 4 (total, 8 weeks. After sacrificing the animals, quantitative data of percentage fibrosis area and the number of cells expressing albumin was obtained. One-way analysis of variance was applied to calculate the significance of the data. Results: GFP expressing cells clearly indicated migrated BMSCs with strong expression of albumin after 28 days post-transplantation shown by anti-albumin antibody. Double fluorescent immunohistochemistry showed reduced expression of αSMA on GFP-positive cells. Four weeks after BMSC transplantation, mice had significantly reduced liver fibrosis as compared with that of mice treated with CCl 4 assessed by Sirius red staining. Conclusion: Mice with BMSC transplantation with continuous CCl 4 injection had reduced liver fibrosis and a significantly improved expression of albumin compared with mice treated with CCl 4 alone. These findings strengthen the concept of cellular therapy in liver fibrosis.

  13. Ovarian cancer stem-like cells differentiate into endothelial cells and participate in tumor angiogenesis through autocrine CCL5 signaling.

    Science.gov (United States)

    Tang, Shu; Xiang, Tong; Huang, Shuo; Zhou, Jie; Wang, Zhongyu; Xie, Rongkai; Long, Haixia; Zhu, Bo

    2016-06-28

    Cancer stem cells (CSCs) are well known for their self-regeneration and tumorigenesis potential. In addition, the multi-differentiation potential of CSCs has become a popular issue and continues to attract increased research attention. Recent studies demonstrated that CSCs are able to differentiate into functional endothelial cells and participate in tumor angiogenesis. In this study, we found that ovarian cancer stem-like cells (CSLCs) activate the NF-κB and STAT3 signal pathways through autocrine CCL5 signaling and mediate their own differentiation into endothelial cells (ECs). Our data demonstrate that CSLCs differentiate into ECs morphologically and functionally. Anti-CCL5 antibodies and CCL5-shRNA lead to markedly inhibit EC differentiation and the tube formation of CSLCs, both in vitro and in vivo. Recombinant human-CCL5 significantly promotes ovarian CSLCs that differentiate into ECs and form microtube network. The CCL5-mediated EC differentiation of CSLCs depends on binding to receptors, such as CCR1, CCR3, and CCR5. The results demonstrated that CCL5-CCR1/CCR3/CCR5 activates the NF-κB and STAT3 signal pathways, subsequently mediating the differentiation of CSLCs into ECs. Therefore, this study was conducted based on the theory that CSCs improve tumor angiogenesis and provides a novel strategy for anti-angiogenesis in ovarian cancer. PMID:27033454

  14. The Increased Expression of CCL20 and CCR6 in Rectal Mucosa Correlated to Severe Inflammation in Pediatric Ulcerative Colitis

    Directory of Open Access Journals (Sweden)

    Keiichi Uchida

    2015-01-01

    Full Text Available Background/Aims. The aim of this study is to clarify the differences of CCL20 and CCR6 expression, chemokine correlated to intestinal homeostasis, between pediatric and adult ulcerative colitis (UC patients. Methods. Onehundred forty-one patients who underwent proctocolectomy were divided to two groups including childhood-onset UC (CUC, <16 years old, n=24 and adult-onset UC (AUC, ≧16 years old, n=117. A total of 141 formalin-fixed, paraffin-embedded tissue samples of rectum were obtained from these patients. Histological inflammation of rectum in resected specimen was evaluated by using Geboes histological assessment. In immunohistochemistry study, the CCL20 expression was evaluated by intensity and the stained area, and the CCR6 expression was evaluated by lymphocytes infiltration pattern. Results. CCL20 score and CCR6 positive lymphocytes infiltration pattern were statistically significantly correlated with histological inflammation severity of UC in all patients (P<0.05. CCL20 and CCR6 expression in CUC were statistically significantly higher than that in AUC in all or pathologically severe cases (P<0.05. Conclusions. CCL20 and CCR6 may play a significant role in local damage and pathological changes in UC especially pediatric patients. In the future, our understanding of the differences in CCL-CCR6 interaction between adults and children may lead to the pathogenesis of IBD.

  15. Protective effect of Tetracera scandens L.leaf extract against CCl4-induced acute liver injury in rats

    Institute of Scientific and Technical Information of China (English)

    Tung; Bui; Thanh; Hai; Nguyen; Thanh; Hue; Pham; Thi; Minh; Huong; Le-Thi-Thu; Huong; Duong; Thi; Ly; Loi; Vu; Duc

    2015-01-01

    Objective:To investigate the protective potential of ethanolic extracts of Tetracera scandens L.(T.scandens) against CCl4 induced oxidative stress in liver tissues.Methods:Dried leaf powder of T.scandens was extracted with ethanol and concentrated to yield a dry residue.Rats were administered with 100 mg/kg of ethanolic extracts orally once daily for one week.Animals were subsequently administered with a single dose of CCl4(I mL/kg body weight,intraperitoneal injection).Various assays,such as serum levels of alanine aminotransferase,aspartate aminotransferase,lipid peroxidation,protein oxidation(carbonyl protein group),tumor necrosis factor alpha,catalase,superoxide dismutase,and glutathione peroxidase,were used to assess damage caused by CCl4 and the protective effects of the ethanol extract on liver tissues.Results:Hepatotoxicity induced by CCl4 was evidenced by a significant increase in serum aspartate aminotransferase and alanine aminotransferase level,lipid peroxidation,protein carbonyl group,and tumor necrosis factor alpha,as well as decreased activity of the hepatic antioxidant enzymes(catalase.superoxide dismutase.and glutathione peroxidase).Treatment with ethanolic T.scandens extracts prevented all of these typically observed changes in CCl4-treated rats.Conclusions:Our findings indicate that T.scandens has a significant protective effect against CCl4 induced hepatotoxicity in rat.which may be due to its antioxidant properties.

  16. Emodin protects rat liver from CCl-induced fibrogenesis via inhibition of hepatic stellate cells activation

    Directory of Open Access Journals (Sweden)

    Miao-Xian Dong, Yan Jia, Ying-Bo Zhang, Cheng-Chong Li, Yu-Tao Geng, Li Zhou, Xue-Yan Li, Ji-Cheng Liu, Ying-Cai Niu

    2009-10-01

    Full Text Available AIM: To investigate the role of emodin in protecting the liver against fibrogenesis caused by carbon tetrachloride (CCl4 in rats and to further explore the underlying mechanisms.METHODS: Rat models of experimental hepatic fibrosis were established by injection with CCl4; the treated rats received emodin via oral administration at a dosage of 20 mg/kg twice a week at the same time. Rats injected with olive oil served as a normal group. Histopathological changes were observed by hematoxylin and eosin staining. The activities of alanine aminotransferase (ALT and aspartate aminotransferase (AST in serum and hepatic hydroxyproline content were assayed by biochemical analyses. The mRNA and protein relevant to hepatic stellate cell (HSC activation in the liver were assessed using real-time reverse transcription-polymerase chain reaction (RT-PCR, immunohistochemistry, western blotting and enzyme-linked immunosorbent assay.RESULTS: The degree of hepatic fibrosis increased markedly in the CCl4 group compared to the normal group (P < 0.01, and decreased markedly in the emodin group compared to the CCl4 group according to METAVIR scale (P < 0.01 compared with those in the normal control group (51.02 ± 10.64 IU/L and 132.28 ± 18.14 IU/L. The activities of serum ALT and AST were significantly higher in rats injected with CCl4 (289.25 ± 68.84 IU/L and 423.89 ± 35.67 IU/L, both P < 0.05. The activities of serum ALT and AST were significantly reduced by administration of emodin (176.34 ± 47.29 IU/L and 226.1 ± 44.52 IU/L, both P < 0.05. Compared with the normal controls (54.53 ± 13.46 mg/g, hepatic hydroxyproline content was significantly higher in rats injected with CCl4 (120.27 ± 28.47 mg/g, P < 0.05. Hepatic hydroxyproline content was significantly reduced in the rats treated with emodin at 20 mg/kg (71.25 ± 17.02 mg/g, P < 0.05. Emodin significantly protected the liver from injury by reducing serum AST and ALT activities and reducing hepatic

  17. Intestinal permeability assessed by 51Cr-EDTA in rats with CCl4 - induced cirrhosis Permeabilidade intestinal ao 51-Cr-EDTA em ratos com cirrose induzida por CCl4

    Directory of Open Access Journals (Sweden)

    Ana Regina L. Ramos

    2010-06-01

    Full Text Available CONTEXT: The straight relationship between cirrhosis and impaired intestinal barrier has not been elucidated yet. OBJECTIVES: To verify 51Cr-EDTA-intestinal permeability in rats with CCl4-induced cirrhosis and controls. METHOD: Fifty male Wistar rats weighing 150-180 g were separated in three groups: 25 animals received CCl4 0.25 mL/kg with olive oil by gavage with 12 g/rat/day food restriction for 10 weeks (CCl4-induced cirrhosis; 12 received the same food restriction for 10 weeks (CCl4-non exposed. Other 13 rats received indomethacin 15 mg/kg by gavage as positive control of intestinal inflammation. RESULTS: The median (25-75 interquartile range 51Cr-EDTA-IP values of cirrhotic and CCl4-non exposed rats were 0.90% (0.63-1.79 and 0.90% (0.60-1.52 respectively, without significant difference (P = 0.65. Animals from indomethacin group showed 51Cr-EDTA-IP, median 7.3% (5.1-14.7, significantly higher than cirrhotic and CCl4-non exposed rats (PCONTEXTO: A relação direta entre cirrose e alterações na barreira intestinal ainda não foi devidamente esclarecida. OBJETIVO: Verificar a permeabilidade intestinal ao 51Cr-EDTA em ratos com cirrose induzida por tetracloreto de carbono (CCl4 e controles. MÉTODO: Cinquenta ratos Wistar machos pesando 150-180 g foram separados em três grupos: 25 animais receberam CCl4 0,25 mL/kg diluído em óleo de oliva por gavagem com restrição dietética de 12 g/rato/dia por 10 semanas (grupo cirrose induzida por CCl4; 12 receberam a mesma restrição dietética por 10 semanas (grupo não exposto ao CCl4. Outros 13 ratos receberam indometacina 15 mg/kg por gavagem como controle positivo de inflamação intestinal. RESULTADOS: A mediana (intervalo interquartil 25-75 dos valores de permeabilidade intestinal ao 51Cr-EDTA dos grupos cirrose induzida por CCl4 e não exposto ao CCl4 foram 0,90% (0,63-1,79 e 0,90% (0,60-1,52, respectivamente, sem significância estatística (P = 0,65. Os animais do grupo indometacina

  18. Global CFC-11 (CCl3F and CFC-12 (CCl2F2 measurements with the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS: retrieval, climatologies and trends

    Directory of Open Access Journals (Sweden)

    A. Linden

    2012-12-01

    Full Text Available Vertical profiles of CFC-11 (CCl3F and CFC-12 (CCl2F2 have been measured with the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS with global coverage under daytime and nighttime conditions. The profile retrieval is based on constrained nonlinear least squares fitting of measured limb spectral radiance to modeled spectra. CFC-11 is measured in its ν4-band at 850 cm−1, and CFC-12 is analyzed in its ν6-band at 922 cm−1. To stabilize the retrievals, a Tikhonov-type smoothing constraint is applied. Main retrieval error sources are measurement noise and elevation pointing uncertainties. The estimated CFC-11 retrieval errors including noise and parameter errors but excluding spectroscopic data uncertainties are below 10 pptv in the middle stratosphere, depending on altitude, the MIPAS measurement mode and the actual atmospheric situation. For CFC-12 the total retrieval errors are below 28 pptv at an altitude resolution varying from 3 to 5 km. Time series of altitude/latitude bins were fitted by a simple parametric approach including constant and linear terms, a quasi-biennial oscillation (QBO proxy and sine and cosine terms of several periods. In the time series from 2002 to 2011, quasi-biennial and annual oscillations are clearly visible. A decrease of stratospheric CFC mixing ratios in response to the Montreal Protocol is observed for most altitudes and latitudes. However, the trends differ from the trends measured in the troposphere, they are even positive at some latitudes and altitudes, and can in some cases only be explained by decadal changes in atmospheric age of air spectra or vertical mixing patterns.

  19. Prenatal fat-rich diet exposure alters responses of embryonic neurons to the chemokine, CCL2, in the hypothalamus.

    Science.gov (United States)

    Poon, K; Abramova, D; Ho, H T; Leibowitz, S

    2016-06-01

    Maternal consumption of a high-fat diet (HFD) during pregnancy is found to stimulate the genesis of hypothalamic orexigenic peptide neurons in the offspring, while HFD intake in adult animals produces a systemic low-grade inflammation which increases neuroimmune factors that may affect neurogenesis and neuronal migration. Building on this evidence and our recent study showing that the inflammatory chemokine, CCL2, stimulates the migration of hypothalamic neurons and expression of orexigenic neuropeptides, we tested here the possibility that prenatal exposure to a HFD in rats affects this chemokine system, both CCL2 and its receptors, CCR2 and CCR4, and alters its actions on hypothalamic neurons, specifically those expressing the neuropeptides, enkephalin (ENK) and galanin (GAL). Using primary dissociated hypothalamic neurons extracted from embryos on embryonic day 19, we found that prenatal HFD exposure compared to chow control actually reduces the expression of CCL2 in these hypothalamic neurons, while increasing CCR2 and CCR4 expression, and also reduces the sensitivity of hypothalamic neurons to CCL2. The HFD abolished the dose-dependent, stimulatory effect of CCL2 on the number of migrated neurons and even shifted its normal stimulatory effect on migrational velocity and distance traveled by control neurons to an inhibition of migration. Further, it abolished the dose-dependent, stimulatory effect of CCL2 on neuronal expression of ENK and GAL. These results demonstrate that prenatal HFD exposure greatly disturbs the functioning of the CCL2 chemokine system in embryonic hypothalamic neurons, reducing its endogenous levels and ability to promote the migration of neurons and their expression of orexigenic peptides. PMID:26979053

  20. Recruitment of CCR6-expressing Th17 cells by CCL20 secreted from plasmin-stimulated macrophages

    Institute of Scientific and Technical Information of China (English)

    Qun Li; Yves Laumonnier; Tatiana Syrovets; Thomas Simmet

    2013-01-01

    In the present study,monocyte-derived human macrophages were differentiated from buffy coats.Na(i)ve CD4+ T-cells enriched from peripheral blood mononuclear cells using anti-CD4 magnetic beads and the autoMACS separation system were polarized under T-helper 17 (Th17)-promoting conditions for 6 days to get Th17 cells.The frequency of Th17 cell differentiation and the expression of C-C chemokine receptor type 6 (CCR6) on Th17 cells were investigated by flow cytometry.Plasmin-triggered induction of macrophage inflammatory protein-3alpha/C-C chemokine ligand 20 (CCL20) genes in macrophages was assessed by reverse transcription-polymerase chain reaction,and secreted protein levels were measured by enzymelinked immunosorbent assay.Th17 cell migration induced by CCL20 secreted from plasmin-stimulated macrophages was tested in vitro by chemotaxis using a transwell system.These results demonstrate that plasmin triggers the expression of chemokine CCL20 messenger RNA and the release of CCL20 protein in human monocyte-derived macrophages,which critically depend on the proteolytic activity of plasmin and activation of p38 mitogen-activated protein kinase and nuclear factor-kappaB signaling pathways.Expression of CCR6 was detected on 87.23 ± 8.6% of Th17 cells in vitro.Similar to chemotaxis triggered by recombinant human CCL20,supernatants collected from plasmin-stimulated macrophage-induced chemotactic migration of Th17 cells,which could be inhibited by an anti-CCL20 neutralizing antibody.These results suggest that plasmin generated in inflamed tissues might elicit production of chemokine CCL20 by human macrophages leading to the recruitmentof CCR6 positive Th17 cells to the inflammatory sites.

  1. Acute desipramine restores presynaptic cortical defects in murine experimental autoimmune encephalomyelitis by suppressing central CCL5 overproduction

    Science.gov (United States)

    Di Prisco, Silvia; Merega, Elisa; Lanfranco, Massimiliano; Casazza, Simona; Uccelli, Antonio; Pittaluga, Anna

    2014-01-01

    Background and Purpose Altered glutamate exocytosis and cAMP production in cortical terminals of experimental autoimmune encephalomyelitis (EAE) mice occur at the early stage of disease (13 days post-immunization, d.p.i.). Neuronal defects were paralleled by overexpression of the central chemokine CCL5 (also known as RANTES), suggesting it has a role in presynaptic impairments. We propose that drugs able to restore CCL5 content to physiological levels could also restore presynaptic defects. Because of its efficacy in controlling CCL5 overexpression, desipramine (DMI) appeared to be a suitable candidate to test our hypothesis. Experimental Approach Control and EAE mice at 13 d.p.i. were acutely or chronically administered DMI and monitored for behaviour and clinical scores. Noradrenaline and glutamate release, cAMP, CCL5 and TNF-α production were quantified in cortical synaptosomes and homogenates. Peripheral cytokine production was also determined. Key Results Noradrenaline exocytosis and α2-adrenoeceptor-mediated activity were unmodified in EAE mice at 13 d.p.i. when compared with control. Acute, but not chronic, DMI reduced CCL5 levels in cortical homogenates of EAE mice at 13 d.p.i., but did not affect peripheral IL-17 and TNF-α contents or CCL5 plasma levels. Acute DMI caused a long-lasting restoration of glutamate exocytosis, restored endogenous cAMP production and impeded the shift from inhibition to facilitation of the CCL5-mediated control of glutamate exocytosis. Finally, DMI ameliorated anxiety-related behaviour but not motor activity or severity of clinical signs. Conclusions We propose DMI as an add-on therapy to normalize neuropsychiatric symptoms in multiple sclerosis patients at the early stage of the disease. PMID:24528439

  2. Increased CCL24/eotaxin-2 with postnatal ozone exposure in allergen-sensitized infant monkeys is not associated with recruitment of eosinophils to airway mucosa

    International Nuclear Information System (INIS)

    Epidemiology supports a causal link between air pollutant exposure and childhood asthma, but the mechanisms are unknown. We have previously reported that ozone exposure can alter the anatomic distribution of CD25+ lymphocytes in airways of allergen-sensitized infant rhesus monkeys. Here, we hypothesized that ozone may also affect eosinophil trafficking to allergen-sensitized infant airways. To test this hypothesis, we measured blood, lavage, and airway mucosa eosinophils in 3-month old monkeys following cyclical ozone and house dust mite (HDM) aerosol exposures. We also determined if eotaxin family members (CCL11, CCL24, CCL26) are associated with eosinophil location in response to exposures. In lavage, eosinophil numbers increased in animals exposed to ozone and/or HDM. Ozone + HDM animals showed significantly increased CCL24 and CCL26 protein in lavage, but the concentration of CCL11, CCL24, and CCL26 was independent of eosinophil number for all exposure groups. In airway mucosa, eosinophils increased with exposure to HDM alone; comparatively, ozone and ozone + HDM resulted in reduced eosinophils. CCL26 mRNA and immunofluorescence staining increased in airway mucosa of HDM alone animals and correlated with eosinophil volume. In ozone + HDM animal groups, CCL24 mRNA and immunofluorescence increased along with CCR3 mRNA, but did not correlate with airway mucosa eosinophils. Cumulatively, our data indicate that ozone exposure results in a profile of airway eosinophil migration that is distinct from HDM mediated pathways. CCL24 was found to be induced only by combined ozone and HDM exposure, however expression was not associated with the presence of eosinophils within the airway mucosa. -- Highlights: ► Ozone can modulate the localization of eosinophils in infant allergic airways. ► Expression of eotaxins within the lung is affected by ozone and allergen exposure. ► CCL24 induction by ozone and allergen exposure is not linked to eosinophilia.

  3. Increased CCL24/eotaxin-2 with postnatal ozone exposure in allergen-sensitized infant monkeys is not associated with recruitment of eosinophils to airway mucosa

    Energy Technology Data Exchange (ETDEWEB)

    Chou, Debbie L.; Gerriets, Joan E. [California National Primate Research Center, UC Davis, Davis, CA 95616 (United States); Schelegle, Edward S.; Hyde, Dallas M. [California National Primate Research Center, UC Davis, Davis, CA 95616 (United States); Department of Anatomy, Physiology, and Cell Biology, UC Davis School of Veterinary Medicine, Davis, CA 95616 (United States); Miller, Lisa A., E-mail: lmiller@ucdavis.edu [California National Primate Research Center, UC Davis, Davis, CA 95616 (United States); Department of Anatomy, Physiology, and Cell Biology, UC Davis School of Veterinary Medicine, Davis, CA 95616 (United States)

    2011-12-15

    Epidemiology supports a causal link between air pollutant exposure and childhood asthma, but the mechanisms are unknown. We have previously reported that ozone exposure can alter the anatomic distribution of CD25+ lymphocytes in airways of allergen-sensitized infant rhesus monkeys. Here, we hypothesized that ozone may also affect eosinophil trafficking to allergen-sensitized infant airways. To test this hypothesis, we measured blood, lavage, and airway mucosa eosinophils in 3-month old monkeys following cyclical ozone and house dust mite (HDM) aerosol exposures. We also determined if eotaxin family members (CCL11, CCL24, CCL26) are associated with eosinophil location in response to exposures. In lavage, eosinophil numbers increased in animals exposed to ozone and/or HDM. Ozone + HDM animals showed significantly increased CCL24 and CCL26 protein in lavage, but the concentration of CCL11, CCL24, and CCL26 was independent of eosinophil number for all exposure groups. In airway mucosa, eosinophils increased with exposure to HDM alone; comparatively, ozone and ozone + HDM resulted in reduced eosinophils. CCL26 mRNA and immunofluorescence staining increased in airway mucosa of HDM alone animals and correlated with eosinophil volume. In ozone + HDM animal groups, CCL24 mRNA and immunofluorescence increased along with CCR3 mRNA, but did not correlate with airway mucosa eosinophils. Cumulatively, our data indicate that ozone exposure results in a profile of airway eosinophil migration that is distinct from HDM mediated pathways. CCL24 was found to be induced only by combined ozone and HDM exposure, however expression was not associated with the presence of eosinophils within the airway mucosa. -- Highlights: Black-Right-Pointing-Pointer Ozone can modulate the localization of eosinophils in infant allergic airways. Black-Right-Pointing-Pointer Expression of eotaxins within the lung is affected by ozone and allergen exposure. Black-Right-Pointing-Pointer CCL24 induction by

  4. A novel role of Yin-Yang-1 in pulmonary tuberculosis through the regulation of the chemokine CCL4.

    Science.gov (United States)

    Rangel-Santiago, Jesus F; Baay-Guzman, Guillermina J; Duran-Padilla, Marco A; Lopez-Bochm, Karla A; Garcia-Romero, Beatriz L; Hernandez-Cueto, Daniel D; Pantoja-Escobar, Gerardo; Vega, Mario I; Hernandez-Pando, Rogelio; Huerta-Yepez, Sara

    2016-01-01

    Mycobacterium tuberculosis (M. tb) is the etiological agent of pulmonary tuberculosis (TB); this disease remains a worldwide health problem. Yin-Yang-1 (YY1) plays a major role in the maintenance and progression of some pulmonary diseases, including pulmonary fibrosis. However, the role of YY1 in TB remains unknown. The aim of this study was to elucidate the role of YY1 in the regulation of CCL4 and its implication in TB. We determined whether YY1 regulates CCL4 using reporter plasmids, ChIP and siRNA assays. Immunohistochemistry and digital pathology were used to measure the expression of YY1 and CCL4 in a mouse model of TB. A retrospective comparison of patients with TB and control subjects was used to measure the expression of YY1 and CCL4 using tissue microarrays. Our results showed that YY1 regulates the transcription of CCL4; moreover, YY1, CCL4 and TGF-β were overexpressed in the lung tissues of mice with TB during the late stages of the disease and the tissues of TB patients. The expression of CCL4 and TGF-β correlated with YY1 expression. In conclusion, YY1 regulates CCL4 transcription; moreover, YY1 is overexpressed in experimental and human TB and is positively correlated with CCL4 and TGF-β expression. Therefore, treatments that decrease YY1 expression may be a new therapeutic strategy against TB. PMID:26786659

  5. The influence of carbohydrates in the interaction of Paracoccidioides brasiliensis with CCL-6 cells in vitro

    Directory of Open Access Journals (Sweden)

    Francisco Laurindo da Silva

    2012-12-01

    Full Text Available INTRODUCTION: Little is known about the early events in the interaction between Paracoccidioides brasiliensis and its host. To understand the effect of carbohydrates in the interaction between the fungus and epithelial cell in culture, we analyzed the influence of different carbohydrate solutions on the adhesion of P. brasiliensis yeast cells to CCL-6 cells in culture. METHODS: Fungal cells were cultivated with the epithelial cell line, and different concentrations of D-fucose, N-acetyl-glucosamine, D-mannose, D-glucosamine, D-galactosamine, sorbitol and fructose were added at the beginning of the experiment. Six hours after the treatment, the cells were fixed and observed by light microscopy. The number of P. brasiliensis cells that were adhered to the CCL-6 monolayer was estimated. RESULTS: The number of adhesion events was diminished following treatments with D-fucose, N-acetyl-glucosamine, D-mannose, D-glucosamine and D-galactosamine as compared to the untreated controls. Sorbitol and fructose-treated cells had the same adhesion behavior as the observed in the control. P. brasiliensis propagules were treated with fluorescent lectins. The FITC-labeled lectins WGA and Con-A bound to P. brasiliensis yeast cells, while SBA and PNA did not. CONCLUSIONS: The perceptual of adhesion between P. brasiliensis and CCL-6 cells decreased with the use of D-mannose, N-acetyl-glucosamine and D-glucosamine. The assay using FITC-labeled lectins suggests the presence of N-acetyl-glucosamine, α-mannose and α-glucose on the P. brasiliensis cell surface. An enhanced knowledge of the mediators of adhesion on P. brasiliensis could be useful in the future for the development of more efficient and less harmful methods for disease treatment and control.

  6. The Plastic and Liquid Phases of CCl$_3$Br Studied by Molecular Dynamics Simulations

    CERN Document Server

    Caballero, Nirvana; Carignano, Marcelo; Serra, Pablo

    2013-01-01

    We present a molecular dynamics study of the liquid and plastic crystalline phases of CCl$_3$Br. We investigated the short-range orientational order using a recently developed classification method and we found that both phases behave in a very similar way. The only differences occur at very short molecular separations, which are shown to be very rare. The rotational dynamics was explored using time correlation functions of the molecular bonds. We found that the relaxation dynamics corresponds to an isotropic diffusive mode for the liquid phase, but departs from this behavior as the temperature is decreased and the system transitions into the plastic phase.

  7. Studies of Coupled Cavity Linac (CCL) Accelerating Structures with 3-D Codes

    OpenAIRE

    Spalek, G.; Christiansen, D. W.; Smith, P D; Greninger, P. T.; Charman, C. M.

    2000-01-01

    The cw CCL being designed for the Accelerator Production of Tritium (APT) project accelerates protons from 96MeV to 211MeV. It consists of 99 segments each containing up to seven accelerating cavities. Segments are coupled by intersegment coupling cavities and grouped into supermodules. The design method needs to address not only basic cavity sizing for a given coupling and pi/2 mode frequency, but also the effects of high power densities on the cavity frequency, mechanical stresses, and the ...

  8. Tumour necrosis factor α enhances CCL2 and ICAM-1 expression in peripheral nerve microvascular endoneurial endothelial cells

    Directory of Open Access Journals (Sweden)

    Evan B. Stubbs

    2013-02-01

    Full Text Available Recruitment and trafficking of autoreactive leucocytes across the BNB (blood–nerve barrier is an early pathological insult in GBS (Guillain-Barré syndrome, an aggressive autoimmune disorder of the PNS (peripheral nervous system. Whereas the aetiology and pathogenesis of GBS remain unclear, pro-inflammatory cytokines, including TNFα (tumour necrosis factor α, are reported to be elevated early in the course of GBS and may initiate nerve injury by activating the BNB. Previously, we reported that disrupting leucocyte trafficking in vivo therapeutically attenuates the course of an established animal model of GBS. Here, PNMECs (peripheral nerve microvascular endothelial cells that form the BNB were harvested from rat sciatic nerves, immortalized by SV40 (simian virus 40 large T antigen transduction and subsequently challenged with TNFα. Relative changes in CCL2 (chemokine ligand 2 and ICAM-1 (intercellular adhesion molecule 1 expression were determined. We report that TNFα elicits marked dose- and time-dependent increases in CCL2 and ICAM-1 mRNA and protein content and promotes secretion of functional CCL2 from immortalized and primary PNMEC cultures. TNFα-mediated secretion of CCL2 promotes, in vitro, the transendothelial migration of CCR2-expressing THP-1 monocytes. Increased CCL2 and ICAM-1 expression in response to TNFα may facilitate recruitment and trafficking of autoreactive leucocytes across the BNB in autoimmune disorders, including GBS.

  9. Protective Effect of γ-Irradiated Dried Powder of Artichoke Leaves against CCl4 Oxidative Stress Induced in Rat Liver

    International Nuclear Information System (INIS)

    Liver injuries are one of the most degenerative worldwide diseases and can lead to different complications. Artichoke (Cynara scolymus L.) is full of natural antioxidants and has hepato protective effect against liver toxicity. Gamma irradiation has been widely used as a first choice sterilization method of raw medicinal plants to be used in the phytotherapic industry worldwide .This study was designed to investigate the effect of dietary supplementation with γ- irradiated artichoke against carbon tetrachloride (CCl4)-induced oxidative stress and hepatotoxicity. The results of high performance liquid chromatography (HPLC) analysis of artichoke leaves indicated that the value of some of the main phenolic constituents was elevated under the effect of γ-irradiation (10 KGy). CCl4 administration resulted in significant increase in the activity of serum alkaline phosphatase, gamma glutamyl transferase and transaminase in addition to an increase in the level of total bilirubine, malondialdehyde (MDA), glucose and the concentration of some lipid contents. Furthermore, CCl4 administration reduced glutathione content, superoxides dismutase (SOD) and catalase (CAT) activity as well as a remarkable decrease in the level of insulin and high density lipoprotein-cholesterol was observed. In CCl4-treated rats dietary supplemented with either raw or γ-irradiated artichoke, a significant amelioration was observed on the adverse effects of the above mentioned parameters induced by CCl4 administration. The present findings concluded that artichoke may be useful, as dietary supplement and possess phenolic compounds, for the prevention of oxidative stress-induced hepatotoxicity

  10. Genetic polymorphism of CCL2-2510 and susceptibility to enterovirus 71 encephalitis in a Chinese population.

    Science.gov (United States)

    Han, Zhen-liang; Li, Ji-an; Chen, Zong-bo

    2014-09-01

    The study was performed in 36 Chinese patients with enterovirus 71 (EV71) encephalitis and 141 patients with EV71-related hand, foot and mouth disease (HFMD) without encephalitis. Genotyping was done by the polymerase chain reaction-restriction fragment length polymorphism technique. Patients with EV71 encephalitis had a significantly higher frequency of the CCL2-2510GG genotypes when compared to patients with EV71-related HFMD without encephalitis (66.7% vs. 41.8%, p=0.028). The frequency of CCL2-2510G alleles was also significantly higher among the patients with EV71 encephalitis than among patients with EV71-related HFMD without encephalitis (79.2% vs. 64.9%, OR=2.1, 95% CI=1.1-3.8, P=0.023). Significant differences were found in gender, age, fever days, white blood cell count, C-reactive protein level, blood glucose concentration, and CCL2 level among genotypes of CCL2-2510A/G in EV71-infected patients, but no significant differences were found in alanine aminotransferase, aspartate aminotransferase, or creatine kinase myocardial isozyme levels or in cerebrospinal fluid evaluations (except monocytes) in patients with EV71 encephalitis. These findings suggest that the CCL2-2510G allele is associated with susceptibility to EV71 encephalitis in Chinese patients. PMID:24788844

  11. ACKR4 on Stromal Cells Scavenges CCL19 To Enable CCR7-Dependent Trafficking of APCs from Inflamed Skin to Lymph Nodes.

    Science.gov (United States)

    Bryce, Steven A; Wilson, Ruairi A M; Tiplady, Eleanor M; Asquith, Darren L; Bromley, Shannon K; Luster, Andrew D; Graham, Gerard J; Nibbs, Robert J B

    2016-04-15

    Dermal dendritic cells and epidermal Langerhans cells are APCs that migrate from skin to draining lymph nodes (LN) to drive peripheral tolerance and adaptive immunity. Their migration requires the chemokine receptor CCR7, which directs egress from the skin via dermal lymphatic vessels and extravasation into the LN parenchyma from lymph in the subcapsular sinus. CCR7 is activated by two chemokines: CCL19 and CCL21. CCL21 alone is sufficient for the migration of APCs from skin to LN. CCL19 and CCL21 also bind atypical chemokine receptor (ACKR) 4. ACKR4-mediated CCL21 scavenging by lymphatic endothelial cells lining the subcapsular sinus ceiling stabilizes interfollicular CCL21 gradients that direct lymph-borne CCR7(+)APCs into the parenchyma of mouse LN. In this study, we show that ACKR4 also aids APC egress from mouse skin under steady-state and inflammatory conditions. ACKR4 plays a particularly prominent role during cutaneous inflammation when it facilitates Langerhans cell egress from skin and enables the accumulation of dermal dendritic cells in skin-draining LN. Stromal cells in mouse skin, predominantly keratinocytes and a subset of dermal lymphatic endothelial cells, express ACKR4 and are capable of ACKR4-dependent chemokine scavenging in situ. ACKR4-mediated scavenging of dermal-derived CCL19, rather than CCL21, is critical during inflammation, because the aberrant trafficking of skin-derived APCs inAckr4-deficient mice is completely rescued by genetic deletion ofCcl19 Thus, ACKR4 on stromal cells aids the egress of APCs from mouse skin, and, during inflammation, facilitates CCR7-dependent cell trafficking by scavenging CCL19. PMID:26976955

  12. Hepatoprotective effects of solanum nigrum extracts on carbon tetrachloride (CCl4) induced hepatotoxicity in rats

    International Nuclear Information System (INIS)

    Effects of aqueous and alcoholic extracts of Solanum nigrum were investigated against CCl4 induced hepatic damage in male albino rats of Sprague Dowley Strain. Enzymatic activities i.e. Aspartate Transaminase, Alanine Transaminase and Alkaline Phosphatase, and gross microscopic appearance of liver were used as parameters and hepato protective studies were performed. In case of hepato protective study i.e. pre-treatment of rats with aqueous extracts of plant (500 mg orally, two doses with 24 hours interval) prevented (p <0.001) CCl4 induced rise in activity of serum Transaminases (ALT and AST) and ALP, whereas the alcoholic extract did not prevent the rise of same enzymes, compared to the sham control group in which liver was damaged by CCI4, no treatment given. Histological examination of the liver of animals treated with aqueous extract of plant showed that change in fatty acids was less in comparison to the sham control group. In the treated group, reduction in body-weight was minimal and liver enlargement was also less, as compared to the animals in sham control group. These results indicate that only aqueous extract of Solanum nigrum exhibits hepatoprotective effects, at least within the parameters of the present study. (author)

  13. Peripheral Neuropathic Facial/Trigeminal Pain and RANTES/CCL5 in Jawbone Cavitation

    Directory of Open Access Journals (Sweden)

    Johann Lechner

    2015-01-01

    Full Text Available Introduction. In this study, we elucidate the possible causative role of chronic subclinical inflammation in jawbone of patients with atypical facial pain (AFP and trigeminal neuralgia (TRN in the local overexpression of the chemokine regulated on activation and normal T-cell expressed and secreted (RANTES/C-C motif ligand 5 CCL5. Neurons contain opioid receptors that transmit antipain reactions in the peripheral and central nervous system. Proinflammatory chemokines like RANTES/CCL5 desensitize μ-opioid receptors in the periphery sensory neurons and it has been suggested that RANTES modifies the nociceptive reaction. Materials and Methods. In 15 patients with AFP/TRN, we examined fatty degenerated jawbone (FDOJ samples for the expression of seven cytokines by multiplex analysis and compared these results with healthy jawbones. Results. Each of these medullary jawbone samples exhibited RANTES as the only highly overexpressed cytokine. The FDOJ cohort with AFP/TRN showed a mean 30-fold overexpression of RANTES compared to healthy jawbones. Conclusions. To the best of our knowledge, no other research has identified RANTES overexpression in silent inflamed jawbones as a possible cause for AFP/TRN. Thus, we hypothesize that the surgical clearing of FDOJ might diminish RANTES signaling pathways in neurons and contribute to resolving chronic neurological pain in AFP/TRN patients.

  14. Leakage Performance of the GM + CCL Liner System for the MSW Landfill

    Directory of Open Access Journals (Sweden)

    Fan Jingjing

    2014-01-01

    Full Text Available The contaminants in the landfill leachate press pose a grave threat to environment of the soil and the groundwater beneath the landfill. Despite there being strict requirements in relevant provisions of both domestic and foreign countries for the design of the bottom liner system. Pollution of the soil and the groundwater still took place in a number of landfills because of the leakage. To investigate the leakage rate of the liner systems, the minimum design requirements of the liner systems are summarized according to the provisions of four countries, including China, USA, Germany, and Japan. Comparative analyses using one-dimensional transport model are conducted to study the leakage performance of these liner systems composed of geomembrance (GM and compacted clay layer (CCL meeting the relevant minimum design requirements. Then parametric analyses are conducted to study the effects of the hydraulic head, the thickness of GM, the hydraulic conductivity of CCL, and so forth on the leakage performance of the liner system. It is concluded that the liner system designed according to the minimum design requirements of Germany provide the best antileakage performance, while that of Japan performs the lowest. The key parameters affecting the failure time of the liner system are summarized. Finally, some suggestions for the design of the liner systems are made according to the analyses.

  15. Leakage performance of the GM + CCL liner system for the MSW landfill.

    Science.gov (United States)

    Jingjing, Fan

    2014-01-01

    The contaminants in the landfill leachate press pose a grave threat to environment of the soil and the groundwater beneath the landfill. Despite there being strict requirements in relevant provisions of both domestic and foreign countries for the design of the bottom liner system. Pollution of the soil and the groundwater still took place in a number of landfills because of the leakage. To investigate the leakage rate of the liner systems, the minimum design requirements of the liner systems are summarized according to the provisions of four countries, including China, USA, Germany, and Japan. Comparative analyses using one-dimensional transport model are conducted to study the leakage performance of these liner systems composed of geomembrance (GM) and compacted clay layer (CCL) meeting the relevant minimum design requirements. Then parametric analyses are conducted to study the effects of the hydraulic head, the thickness of GM, the hydraulic conductivity of CCL, and so forth on the leakage performance of the liner system. It is concluded that the liner system designed according to the minimum design requirements of Germany provide the best antileakage performance, while that of Japan performs the lowest. The key parameters affecting the failure time of the liner system are summarized. Finally, some suggestions for the design of the liner systems are made according to the analyses. PMID:24719569

  16. Protein profiles of CCL5, HPGDS, and NPSR1 in plasma reveal association with childhood asthma.

    Science.gov (United States)

    Hamsten, C; Häggmark, A; Grundström, J; Mikus, M; Lindskog, C; Konradsen, J R; Eklund, A; Pershagen, G; Wickman, M; Grunewald, J; Melén, E; Hedlin, G; Nilsson, P; van Hage, M

    2016-09-01

    Asthma is a common chronic childhood disease with many different phenotypes that need to be identified. We analyzed a broad range of plasma proteins in children with well-characterized asthma phenotypes to identify potential markers of childhood asthma. Using an affinity proteomics approach, plasma levels of 362 proteins covered by antibodies from the Human Protein Atlas were investigated in a total of 154 children with persistent or intermittent asthma and controls. After screening, chemokine ligand 5 (CCL5) hematopoietic prostaglandin D synthase (HPGDS) and neuropeptide S receptor 1 (NPSR1) were selected for further investigation. Significantly lower levels of both CCL5 and HPGDS were found in children with persistent asthma, while NPSR1 was found at higher levels in children with mild intermittent asthma compared to healthy controls. In addition, the protein levels were investigated in another respiratory disease, sarcoidosis, showing significantly higher NPSR1 levels in sera from sarcoidosis patients compared to healthy controls. Immunohistochemical staining of healthy tissues revealed high cytoplasmic expression of HPGDS in mast cells, present in stroma of both airway epithelia, lung as well as in other organs. High expression of NPSR1 was observed in neuroendocrine tissues, while no expression was observed in airway epithelia or lung. In conclusion, we have utilized a broad-scaled affinity proteomics approach to identify three proteins with altered plasma levels in asthmatic children, representing one of the first evaluations of HPGDS and NPSR1 protein levels in plasma. PMID:27145233

  17. Effects of Lawsonia inermis L. (Henna Leaves' Methanolic Extract on CCl4-induced Hepatotoxicity in Rats

    Directory of Open Access Journals (Sweden)

    Musab Awad Mohamed

    2016-03-01

    Background: Natural products with therapeutic properties such as plants, minerals and animal products, for many years, were the main sources of drugs for treatment of numerous diseases; hence selection of Lawsonia inermis L. (Henna in order to study its hepatoprotective activity was considered. Objectives: This was an attempt to evaluate the hepatoprotective effect of Lawsonia inermis leaves' methanolic extract on CCl4-induced hepatotoxicity in rats. Methods: The L. inermis leaves' methanolic extract, which obtained by maceration, was orally administered in doses of 100mg/kg and 200mg/kg to the tested animals in order to assess it's effects on serum levels of hepatotoxicity parameters, alanine aminotransferase (ALT, aspartate aminotransferase (AST, alkaline phosphatase (ALP, bilirubin and total proteins along with histopathological liver sections examination, while silymarin (25mg/kg, a potent hepatoprotective drug, was used as standard control. Results: The two doses of the plant extract showed dose-dependent hepatoprotective effect, as evident by the significant reduction (P < 0.05 in serum levels of AST, ALT, ALP and bilirubin along with the improvement in histopathological liver sections compared to CCl4-only treated animals. Conclusion: As experimentally evident, it could be concluded that, this plant material could provide a hepatoprotective effect which could be attributed to its antioxidant properties. [J Intercult Ethnopharmacol 2016; 5(1.000: 22-26

  18. Myeloid IKKβ promotes antitumor immunity by modulating CCL11 and the innate immune response.

    Science.gov (United States)

    Yang, Jinming; Hawkins, Oriana E; Barham, Whitney; Gilchuk, Pavlo; Boothby, Mark; Ayers, Gregory D; Joyce, Sebastian; Karin, Michael; Yull, Fiona E; Richmond, Ann

    2014-12-15

    Myeloid cells are capable of promoting or eradicating tumor cells and the nodal functions that contribute to their different roles are still obscure. Here, we show that mice with myeloid-specific genetic loss of the NF-κB pathway regulatory kinase IKKβ exhibit more rapid growth of cutaneous and lung melanoma tumors. In a BRAF(V600E/PTEN(-/-)) allograft model, IKKβ loss in macrophages reduced recruitment of myeloid cells into the tumor, lowered expression of MHC class II molecules, and enhanced production of the chemokine CCL11, thereby negatively regulating dendritic-cell maturation. Elevated serum and tissue levels of CCL11 mediated suppression of dendritic-cell differentiation/maturation within the tumor microenvironment, skewing it toward a Th2 immune response and impairing CD8(+) T cell-mediated tumor cell lysis. Depleting macrophages or CD8(+) T cells in mice with wild-type IKKβ myeloid cells enhanced tumor growth, where the myeloid cell response was used to mediate antitumor immunity against melanoma tumors (with less dependency on a CD8(+) T-cell response). In contrast, myeloid cells deficient in IKKβ were compromised in tumor cell lysis, based on their reduced ability to phagocytize and digest tumor cells. Thus, mice with continuous IKKβ signaling in myeloid-lineage cells (IKKβ(CA)) exhibited enhanced antitumor immunity and reduced melanoma outgrowth. Collectively, our results illuminate new mechanisms through which NF-κB signaling in myeloid cells promotes innate tumor surveillance. PMID:25336190

  19. Antioxidant Potential of Plumieride against CCl4-Induced Peroxidative Damage in Rats

    Directory of Open Access Journals (Sweden)

    Dharmendra Singh

    2014-11-01

    Full Text Available In search of a new potent as an antioxidant from natural sources, plumieride—an iridoid isolated from the methanol extract of the bark of Plumeria bicolor (family Apocynaceae was evaluated for its antioxidant potential against CCl4-induced peroxidative damage in liver of rats. The antioxidant potential was evaluated by using hepatic tissue for SOD (superoxide dismutase, CAT (catalase, GSH (reduced glutathione, GPx (glutathione peroxidase, GR (glutathione reductase and LPO (lipid peroxidation alongwith the concomitant blood serum for AST & ALT (aspartate and alanine transaminases, GGT (gamma glutamyl transpeptidase, ALP (alkaline phosphatase, total bilirubin and total protein contents. All the biochemical parameters were significantly (p ≤ 0.001 altered by CCl4 (0.3 mL/kg body weight/twice a week, intra-peritoneally for 30 days. Simultaneously, oral treatment with plumieride (5, 10 and 20 mg/kg body weight/day for 30 days, restored all the parameters towards a normal level, remarkably. The histological findings of liver sections further corroborated the antioxidant potential of plumieride compared with standard drug-silymarin. In conclusion, plumieride consists of sugar molecules, which have alcoholic groups. Therefore, the alcoholic groups of sugar increase its antioxidant potential through intermolecular hydrogen bonding along with the thiol(SH group of non-protein thiols and enzymes resulting in the restoration of the antioxidant system. Therefore, it might be considered a natural antioxidant against peroxidative damage in rats.

  20. Neferine inhibits the upregulation of CCL5 and CCR5 in vascular endothelial cells during chronic high glucose treatment.

    Science.gov (United States)

    Li, Guilin; Zhu, Gaochun; Gao, Yun; Xiao, Wen; Xu, Hong; Liu, Shuangmei; Tu, Guihua; Peng, Haiying; Zheng, Chaoran; Liang, Shangdong; Li, Guodong

    2013-04-01

    We investigated whether the expressions of CCL5 and CCR5 participate in dysfunctional changes in human umbilical vein endothelial cells (HUVECs) induced by chronic high glucose treatment and examined whether neferine exerts its therapeutic effects by blocking the development of dysfunctional vascular endothelium. HUVECs were cultured with control or high concentrations of glucose in the absence or presence of neferine for 5 days. Nitric acid reductase method was used to detect the concentration of nitric oxide (NO) released into culture media. The level of intracellular reactive oxygen species (ROS) was measured by fluorescent DCFH-DA probe. The expressions of 84 genes related to endothelial cell biology were assessed by Human Endothelial Cell Biology RT(2) Profiler PCR Array. The expressions of the chemokine CCL5 and its receptor CCR5 were further determined by real-time RT-PCR and western blotting. PCR array indicated that CCL5 was the most significantly upregulated when HUVECs were exposed to chronic high glucose; the intracellular ROS level and the expressions of CCL5 and CCR5 at both mRNA and protein levels were significantly increased, whereas NO production was decreased simultaneously. The increased level of ROS and elevated expressions of CCL5 and CCR5 at high glucose were significantly inhibited by neferine; meanwhile the decreased NO production upon chronic high glucose treatment was relieved. An antioxidant (vitamin E) exerted similar beneficial effects. These data indicate that neferine can reduce the upregulation of CCL5 and CCR5 of vascular endothelium exposure to chronic high glucose and prevent or inhibit subsequent occurrence of inflammation in blood vessels possibly through antioxidation. PMID:23053727

  1. Protection of the liver against CCl-induced injury by intramuscular electrotransfer of a kallistatin-encoding plasmid

    Directory of Open Access Journals (Sweden)

    Yong Diao, Xiao-Feng Zhao, Jun-Sheng Lin, Qi-Zhao Wang, Rui-An Xu

    2011-01-01

    Full Text Available AIM: To investigate the effect of transgenic expression of kallistatin (Kal on carbon tetrachloride (CCl4-induced liver injury by intramuscular (im electrotransfer of a Kal-encoding plasmid formulated with poly-L-glutamate (PLG.METHODS: The pKal plasmid encoding Kal gene was formulated with PLG and electrotransferred into mice skeletal muscle before the administration of CCl4. The expression level of Kal was measured. The serum biomarker levels of alanine aminotransferase (ALT, aspartate aminotransferase (AST, malonyldialdehyde (MDA, and tumor necrosis factor (TNF-α were monitored. The extent of CCl4-induced liver injury was analyzed histopathologically.RESULTS: The transgene of Kal was sufficiently expressed after an im injection of plasmid formulated with PLG followed by electroporation. In the Kal gene-transferred mice, protection against CCl4-induced liver injury was reflected by significantly decreased serum ALT, AST, MDA and TNF-α levels compared to those in control mice (P < 0.01 to 0.05 in a dose-dependent manner. Histological observations also revealed that hepatocyte necrosis, hemorrhage, vacuolar change and hydropic degeneration were apparent in mice after CCl4 administration. In contrast, the damage was markedly attenuated in the Kal gene-transferred mice. The expression of hepatic fibrogenesis marker transforming growth factor-β1 was also reduced in the pKal transferred mice.CONCLUSION: Intramuscular electrotransfer of plasmid pKal which was formulated with PLG significantly alleviated the CCl4-induced oxidative stress and inflammatory response, and reduced the liver damage in a mouse model.

  2. Raloxifene suppresses experimental autoimmune encephalomyelitis and NF-κB-dependent CCL20 expression in reactive astrocytes.

    Directory of Open Access Journals (Sweden)

    Rui Li

    Full Text Available Recent clinical data have led to the consideration of sexual steroids as new potential therapeutic tools for multiple sclerosis. Selective estrogen receptor modulators can exhibit neuroprotective effects like estrogen, with fewer systemic estrogen side effects than estrogen, offering a more promising therapeutic modality for multiple sclerosis. The important role of astrocytes in a proinflammatory effect mediated by CCL20 signaling on inflammatory cells has been documented. Their potential contribution to selective estrogen receptor modulator-mediated protection is still unknown. Using a mouse model of chronic neuroinflammation, we report that raloxifene, a selective estrogen receptor modulator, alleviated experimental autoimmune encephalomyelitis-an animal model of multiple sclerosis-and decreased astrocytic production of CCL20. Enzyme-linked immunosorbent assay, immunohistochemistry imaging and transwell migration assays revealed that reactive astrocytes express CCL20, which promotes Th17 cell migration. In cultured rodent astrocytes, raloxifene inhibited IL-1β-induced CCL20 expression and chemotaxis ability for Th17 migration, whereas the estrogen receptor antagonist ICI 182,780 blocked this effect. Western blotting further indicated that raloxifene suppresses IL-1β-induced NF-κB activation (phosphorylation of p65 and translocation but does not affect phosphorylation of IκB. In conclusion, these data demonstrate that raloxifene provides robust neuroprotection against experimental autoimmune encephalomyelitis, partially via an inhibitory action on CCL20 expression and NF-κB pathways in reactive astrocytes. Our results contribute to a better understanding of the critical roles of raloxifene in treating experimental autoimmune encephalomyelitis and uncover reactive astrocytes as a new target for the inhibitory action of estrogen receptors on chemokine CCL20 expression.

  3. Effect of aqueous extract of Tinospora cordifolia on functions of peritoneal macrophages isolated from CCl4 intoxicated male albino mice

    Directory of Open Access Journals (Sweden)

    Sharma Gauri D

    2011-10-01

    Full Text Available Abstract Background The current practice of ingesting phytochemicals for supporting the immune system or fighting infections is based on centuries-old tradition. Macrophages are involved at all the stages of an immune response. The present study focuses on the immunostimulant properties of Tinospora cordifolia extract that are exerted on circulating macrophages isolated from CCl4 (0.5 ml/kg body weight intoxicated male albino mice. Methods Apart from damaging the liver system, carbon tetrachloride also inhibits macrophage functions thus, creating an immunocompromised state, as is evident from the present study. Such cell functions include cell morphology, adhesion property, phagocytosis, enzyme release (myeloperoxidase or MPO, nitric oxide (NO release, intracellular survival of ingested bacteria and DNA fragmentation in peritoneal macrophages isolated from these immunocompromised mice. T. cordifolia extract was tested for acute toxicity at the given dose (150 mg/kg body weight by lactate dehydrogenase (LDH assay. Results The number of morphologically altered macrophages was increased in mice exposed to CCl4. Administration of CCl4 (i.p. also reduced the phagocytosis, cell adhesion, MPO release, NO release properties of circulating macrophages of mice. The DNA fragmentation of peritoneal macrophages was observed to be higher in CCl4 intoxicated mice. The bacterial killing capacity of peritoneal macrophages was also adversely affected by CCl4. However oral administration of aqueous fraction of Tinospora cordifolia stem parts at a dose of 40 mg/kg body weight (in vivo in CCl4 exposed mice ameliorated the effect of CCl4, as the percentage of morphologically altered macrophages, phagocytosis activity, cell adhesion, MPO release, NO release, DNA fragmentation and intracellular killing capacity of CCl4 intoxicated peritoneal macrophages came closer to those of the control group. No acute toxicity was identified in oral administration of the aqueous

  4. Impulse Breakdown Characteristics and Cost/Benefit Analysis of $SF_6/CCL_2F_2/C0_2$ Mixtures

    OpenAIRE

    Raghavender, D; Naidu, MS

    1989-01-01

    A comprehensive study has been carried out in $SF_6/CCL_2F_2/C0_2$ mixtures to measure 50% breakdown voltages $(V_5_0)$ using both positive and negative polarity lightning impulse (1.2/50 $\\mu$s) voltages under non-uniform fields (5 mm. rod – 230 mm plane electrode) over a pressure range of 0.1 to 0.5 HPa for a gap spacing of 20 mm. The sum of $SF_6$,and $CCL_2F_2$ concentrations in the mixture was always maintained in the range of 21 to 40%, rest being $CO_2$. Among the different sets of $SF...

  5. TWEAK activates the non-canonical NFkappaB pathway in murine renal tubular cells: modulation of CCL21.

    Directory of Open Access Journals (Sweden)

    Ana B Sanz

    Full Text Available TWEAK is a member of the TNF superfamily of cytokines that contribute to kidney tubulointerstitial injury. It has previously been reported that TWEAK induces transient nuclear translocation of RelA and expression of RelA-dependent cytokines in renal tubular cells. Additionally, TWEAK induced long-lasting NFkappaB activation suggestive of engagement of the non-canonical NFkappaB pathway. We now explore TWEAK-induced activation of NFkappaB2 and RelB, as well as expression of CCL21, a T-cell chemotactic factor, in cultured murine tubular epithelial cells and in healthy kidneys in vivo. In cultured tubular cells, TWEAK and TNFalpha activated different DNA-binding NFkappaB complexes. TWEAK-induced sustained NFkappaB activation was associated with NFkappaB2 p100 processing to p52 via proteasome and nuclear translocation and DNA-binding of p52 and RelB. TWEAK, but not TNFalpha used as control, induced a delayed increase in CCL21a mRNA (3.5+/-1.22-fold over control and CCL21 protein (2.5+/-0.8-fold over control, which was prevented by inhibition of the proteasome, or siRNA targeting of NIK or RelB, but not by RelA inhibition with parthenolide. A second NFkappaB2-dependent chemokine, CCL19, was upregulates by TWEAK, but not by TNFalpha. However, both cytokines promoted chemokine RANTES expression (3-fold mRNA at 24 h. In vivo, TWEAK induced nuclear NFkappaB2 and RelB translocation and CCL21a mRNA (1.5+/-0.3-fold over control and CCL21 protein (1.6+/-0.5-fold over control expression in normal kidney. Increased tubular nuclear RelB and tubular CCL21 expression in acute kidney injury were decreased by neutralization (2+/-0.9 vs 1.3+/-0.6-fold over healthy control or deficiency of TWEAK (2+/-0.9 vs 0.8+/-0.6-fold over healthy control. Moreover, anti-TWEAK treatment prevented the recruitment of T cells to the kidney in this model (4.1+/-1.4 vs 1.8+/-1-fold over healthy control. Our results thus identify TWEAK as a regulator of non-canonical NFkappa

  6. Theory and computational science

    International Nuclear Information System (INIS)

    The theoretical and computational science carried out at the Daresbury Laboratory in 1984/5 is detailed in the Appendix to the Daresbury Annual Report. The Theory, Computational Science and Applications Groups, provide support work for the experimental projects conducted at Daresbury. Use of the FPS-164 processor is also described. (U.K.)

  7. HYDROMECHANICS LABORATORY

    Data.gov (United States)

    Federal Laboratory Consortium — Naval Academy Hydromechanics Laboratory The Naval Academy Hydromechanics Laboratory (NAHL) began operations in Rickover Hall in September 1976. The primary purpose...

  8. CCL21 Facilitates Chemoresistance and Cancer Stem Cell-Like Properties of Colorectal Cancer Cells through AKT/GSK-3β/Snail Signals

    Directory of Open Access Journals (Sweden)

    Lin-Lin Lu

    2016-01-01

    Full Text Available Some evidence indicated that chemoresistance associates with the acquisition of cancer stem-like properties. Recent studies suggested that chemokines can promote the chemoresistance and stem cell properties in various cancer cells, while the underling mechanism is still not completely illustrated. In our study, we found that CCL21 can upregulate the expression of P-glycoprotein (P-gp and stem cell property markers such as Bmi-1, Nanog, and OCT-4 in colorectal cancer (CRC HCT116 cells and then improve the cell survival rate and mammosphere formation. Our results suggested that Snail was crucial for CCL21-mediated chemoresistance and cancer stem cell property in CRC cells. Further, we observed that CCL21 treatment increased the protein but not mRNA levels of Snail, which suggested that CCL21 upregulates Snail via posttranscriptional ways. The downstream signals AKT/GSK-3β mediated CCL21 induced the upregulation of Snail due to the fact that CCL21 treatment can obviously phosphorylate both AKT and GSK-3β. The inhibitor of PI3K/Akt, LY294002 significantly abolished CCL21 induced chemoresistance and mammosphere formation of HCT116 cells. Collectively, our results in the present study revealed that CCL21 can facilitate chemoresistance and stem cell property of CRC cells via the upregulation of P-gp, Bmi-1, Nanog, and OCT-4 through AKT/GSK-3β/Snail signals, which suggested a potential therapeutic approach to CRC patients.

  9. CCL21 Facilitates Chemoresistance and Cancer Stem Cell-Like Properties of Colorectal Cancer Cells through AKT/GSK-3β/Snail Signals.

    Science.gov (United States)

    Lu, Lin-Lin; Chen, Xiao-Hui; Zhang, Ge; Liu, Zong-Cai; Wu, Nong; Wang, Hao; Qi, Yi-Fei; Wang, Hong-Sheng; Cai, Shao Hui; Du, Jun

    2016-01-01

    Some evidence indicated that chemoresistance associates with the acquisition of cancer stem-like properties. Recent studies suggested that chemokines can promote the chemoresistance and stem cell properties in various cancer cells, while the underling mechanism is still not completely illustrated. In our study, we found that CCL21 can upregulate the expression of P-glycoprotein (P-gp) and stem cell property markers such as Bmi-1, Nanog, and OCT-4 in colorectal cancer (CRC) HCT116 cells and then improve the cell survival rate and mammosphere formation. Our results suggested that Snail was crucial for CCL21-mediated chemoresistance and cancer stem cell property in CRC cells. Further, we observed that CCL21 treatment increased the protein but not mRNA levels of Snail, which suggested that CCL21 upregulates Snail via posttranscriptional ways. The downstream signals AKT/GSK-3β mediated CCL21 induced the upregulation of Snail due to the fact that CCL21 treatment can obviously phosphorylate both AKT and GSK-3β. The inhibitor of PI3K/Akt, LY294002 significantly abolished CCL21 induced chemoresistance and mammosphere formation of HCT116 cells. Collectively, our results in the present study revealed that CCL21 can facilitate chemoresistance and stem cell property of CRC cells via the upregulation of P-gp, Bmi-1, Nanog, and OCT-4 through AKT/GSK-3β/Snail signals, which suggested a potential therapeutic approach to CRC patients. PMID:27057280

  10. The CCL3L1-CCR5 genotype influences the development of AIDS, but not HIV susceptibility or the response to HAART

    Energy Technology Data Exchange (ETDEWEB)

    Bhattacharya, Tanmoy [Los Alamos National Laboratory; Stanton, Jennifer [NORTHWESTERN UNIV; Kim, Eun - Young [NORTHWESTERN UNIV; Kunstman, Kevin [NORTHWESTERN UNIV; Phair, John [NORTHWESTERN UNIV; Jacobson, Lisa P [JOHNS HOPKINS UNIV; Wolinsky, Steven M [NORTHWESTERN UNIV

    2008-01-01

    A selective advantage against infectious diseases such as HIV/AIDS is associated with differences in the genes relevant to immunity and virus replication. The CC chemokine receptor 5 (CCR5), the principal coreceptor for HIV, and its chemokine ligands, including CCL3L1, influences the CD4+ target cells susceptibility to infection. The CCL3L1 gene is in a region of segmental duplication on the q-arm of human chromosome 17. Increased numbers of CCL3L1 gene copies that affect the gene expression phenotype might have substantial protective effects. Here we show that the population-specific CCL3L1 gene copy number and the CCR5 {Delta}32 protein-inactivating deletion that categorizes the CCL3L1-CCR5 genotype do not influence HIV/AIDS susceptibility or the robustness of immune recovery after the initiation of highly active antiretroviral therapy (HAART).

  11. Distinct Upstream Role of Type I IFN Signaling in Hematopoietic Stem Cell-Derived and Epithelial Resident Cells for Concerted Recruitment of Ly-6Chi Monocytes and NK Cells via CCL2-CCL3 Cascade.

    Directory of Open Access Journals (Sweden)

    Erdenebileg Uyangaa

    Full Text Available Type I interferon (IFN-I-dependent orchestrated mobilization of innate cells in inflamed tissues is believed to play a critical role in controlling replication and CNS-invasion of herpes simplex virus (HSV. However, the crucial regulators and cell populations that are affected by IFN-I to establish the early environment of innate cells in HSV-infected mucosal tissues are largely unknown. Here, we found that IFN-I signaling promoted the differentiation of CCL2-producing Ly-6Chi monocytes and IFN-γ/granzyme B-producing NK cells, whereas deficiency of IFN-I signaling induced Ly-6Clo monocytes producing CXCL1 and CXCL2. More interestingly, recruitment of Ly-6Chi monocytes preceded that of NK cells with the levels peaked at 24 h post-infection in IFN-I-dependent manner, which was kinetically associated with the CCL2-CCL3 cascade response. Early Ly-6Chi monocyte recruitment was governed by CCL2 produced from hematopoietic stem cell (HSC-derived leukocytes, whereas NK cell recruitment predominantly depended on CC chemokines produced by resident epithelial cells. Also, IFN-I signaling in HSC-derived leukocytes appeared to suppress Ly-6Ghi neutrophil recruitment to ameliorate immunopathology. Finally, tissue resident CD11bhiF4/80hi macrophages and CD11chiEpCAM+ dendritic cells appeared to produce initial CCL2 for migration-based self-amplification of early infiltrated Ly-6Chi monocytes upon stimulation by IFN-I produced from infected epithelial cells. Ultimately, these results decipher a detailed IFN-I-dependent pathway that establishes orchestrated mobilization of Ly-6Chi monocytes and NK cells through CCL2-CCL3 cascade response of HSC-derived leukocytes and epithelium-resident cells. Therefore, this cascade response of resident-to-hematopoietic-to-resident cells that drives cytokine-to-chemokine-to-cytokine production to recruit orchestrated innate cells is critical for attenuation of HSV replication in inflamed tissues.

  12. 核苷酸补偿对CCl_4致肝纤维化大鼠血清蛋白和尿酸水平的影响

    Institute of Scientific and Technical Information of China (English)

    朱善良

    2012-01-01

    本研究以添加核苷酸的日粮饲喂四氯化碳(CCl4)致肝纤维化大鼠,测定大鼠血清蛋白和尿酸等生化指标变化,以探讨外源核苷酸对CCl4致肝纤维化的干预作用.结果表明,CCl4组大鼠体重均低于或显著低于C组和CCl4+NTs组;CCl4组血清总蛋白含量显著低于CCl4+NTs组和C组,而CCl4+NTs组与C组之间差异不显著.C组、CCl4组和CCl4+NTs组之间的血清A含量存在显著差异,其中C组最高,CCl4+NTs组次之,CCl4组最低.CCl4组和CCl4+NTs组的血清G含量显著高于与C组,而CCl4+NTs组显著高于CCl4组.CCl4+NTs组和CCl4组的A/G比值显著低于C组,而CCl4组与CCl4+NTs组间无显著差异.CCl4组血清UA水平显著低于CCl4+NTs组和C组,而CCl4+NTs组与C组UA水平基本持平.结果提示,日粮补偿核苷酸引起CCl4致肝纤维化大鼠的血清白蛋白、球蛋白和尿酸等生化指标发生了明显变化,这可能是外源核苷酸干预肝纤维化损伤的重要机制之一.

  13. Copy number variation of CCL3-like genes affects rate of progression to simian-AIDS in Rhesus Macaques (Macaca mulatta.

    Directory of Open Access Journals (Sweden)

    Jeremiah D Degenhardt

    2009-01-01

    Full Text Available Variation in genes underlying host immunity can lead to marked differences in susceptibility to HIV infection among humans. Despite heavy reliance on non-human primates as models for HIV/AIDS, little is known about which host factors are shared and which are unique to a given primate lineage. Here, we investigate whether copy number variation (CNV at CCL3-like genes (CCL3L, a key genetic host factor for HIV/AIDS susceptibility and cell-mediated immune response in humans, is also a determinant of time until onset of simian-AIDS in rhesus macaques. Using a retrospective study of 57 rhesus macaques experimentally infected with SIVmac, we find that CCL3L CNV explains approximately 18% of the variance in time to simian-AIDS (p<0.001 with lower CCL3L copy number associating with more rapid disease course. We also find that CCL3L copy number varies significantly (p<10(-6 among rhesus subpopulations, with Indian-origin macaques having, on average, half as many CCL3L gene copies as Chinese-origin macaques. Lastly, we confirm that CCL3L shows variable copy number in humans and chimpanzees and report on CCL3L CNV within and among three additional primate species. On the basis of our findings we suggest that (1 the difference in population level copy number may explain previously reported observations of longer post-infection survivorship of Chinese-origin rhesus macaques, (2 stratification by CCL3L copy number in rhesus SIV vaccine trials will increase power and reduce noise due to non-vaccine-related differences in survival, and (3 CCL3L CNV is an ancestral component of the primate immune response and, therefore, copy number variation has not been driven by HIV or SIV per se.

  14. Effect of Misgurnus anguillicaudatus Lyophilized Power on Liver Fibrosis Induced by CCl 4 in Mice%泥鳅冻干粉抗CCl4小鼠肝纤维化作用

    Institute of Scientific and Technical Information of China (English)

    张倩; 商萌萌; 凌去非; 刘春宇

    2014-01-01

    To study the effect of Misgurnus anguillicaudatus lyophilized power on liver fibrosis, the model in mice was established by using CCl4. Given different doses of Misgurnus anguillicaudatus lyophilized power, the serum ALT and AST activities and tissue Hyp content were detected. The pathological changes of liver were observed. Results showed that the AST and ALT activities and Hyp levels were significantly decreased (P<0.05) in three doses groups of Misgurnus Anguillicaudatus lyophilized power, compared with the model group. The pathological improvements were observed. The fibrogenesis in liver tissues were markedly reduced and the formation of liver pseudoluboli was alleviated. The Misgurnus anguillicaudatus lyophilized power can prevent the formation of liver fibrosis induced by CCl4 in mice.%采用CCl4小鼠肝纤维化模型,给予不同剂量泥鳅冻干粉,检测小鼠血清中ALT、AST活性及肝组织中羟脯氨酸(Hyp)含量,并观察肝组织病理变化,探讨泥鳅冻干粉抗CCl4小鼠肝纤维化作用。结果表明,与模型组相比,泥鳅粉冻干粉明显降低CCl4诱导的肝纤维化小鼠血清ALT、AST活性,显著降低肝组织Hyp含量(P<0.05)。病理学观察结果,泥鳅粉冻干粉给药组小鼠胶原纤维沉积明显减轻,假小叶结构明显减少。泥鳅冻干粉能预防小鼠肝纤维化的形成,具有抗肝纤维化作用。

  15. CpG-ODNs induces up-regulated expression of chemokine CCL9 in mouse macrophages and microglia

    Digital Repository Service at National Institute of Oceanography (India)

    Ravindran, C.; Cheng, Y.-C.; Liang, S.-M.

    with a variety of CpG-ODN sequences. The CpG-ODNs-mediated induction of CCL9 was TLR9/MyD88 dependent and associated with activation of stress kinases, particularly ERK, p38 MAPK and PI3K. The expression of CCR1 was also significantly increased by Cp...

  16. Dramatic Substituent Effect on the CCL-catalyzed Kinetic Resolution of 1-Aryl-2,3-allenols

    Institute of Scientific and Technical Information of China (English)

    XU, Dai-Wang(徐代旺); LI, Zu-Yi(李祖义); MA, Sheng-Ming(麻生明)

    2004-01-01

    Optically active 1-aryl-2,3-allenols were obtained via CCL-mediated kinetic resolution of the racemic allenols. The substitution pattern of the aromatic ring, regarding to both the type of the substituent and its position on the aromatic ring, was found to be critical for the kinetic resolution of 1-aryl-2,3-allenols.

  17. RNA Sequencing of Tumor-Associated Microglia Reveals Ccl5 as a Stromal Chemokine Critical for Neurofibromatosis-1 Glioma Growth

    Directory of Open Access Journals (Sweden)

    Anne C. Solga

    2015-10-01

    Full Text Available Solid cancers develop within a supportive microenvironment that promotes tumor formation and growth through the elaboration of mitogens and chemokines. Within these tumors, monocytes (macrophages and microglia represent rich sources of these stromal factors. Leveraging a genetically engineered mouse model of neurofibromatosis type 1 (NF1 low-grade brain tumor (optic glioma, we have previously demonstrated that microglia are essential for glioma formation and maintenance. To identify potential tumor-associated microglial factors that support glioma growth (gliomagens, we initiated a comprehensive large-scale discovery effort using optimized RNA-sequencing methods focused specifically on glioma-associated microglia. Candidate microglial gliomagens were prioritized to identify potential secreted or membrane-bound proteins, which were next validated by quantitative real-time polymerase chain reaction as well as by RNA fluorescence in situ hybridization following minocycline-mediated microglial inactivation in vivo. Using these selection criteria, chemokine (C-C motif ligand 5 (Ccl5 was identified as a chemokine highly expressed in genetically engineered Nf1 mouse optic gliomas relative to nonneoplastic optic nerves. As a candidate gliomagen, recombinant Ccl5 increased Nf1-deficient optic nerve astrocyte growth in vitro. Importantly, consistent with its critical role in maintaining tumor growth, treatment with Ccl5 neutralizing antibodies reduced Nf1 mouse optic glioma growth and improved retinal dysfunction in vivo. Collectively, these findings establish Ccl5 as an important microglial growth factor for low-grade glioma maintenance relevant to the development of future stroma-targeted brain tumor therapies.

  18. CCl4 induces tissue-type plasminogen activator in rat brain; protective effects of oregano, rosemary or vitamin E.

    Science.gov (United States)

    Lavrentiadou, Sophia N; Tsantarliotou, Maria P; Zervos, Ioannis A; Nikolaidis, Efstathios; Georgiadis, Marios P; Taitzoglou, Ioannis A

    2013-11-01

    The high metabolic rate and relatively low antioxidant defenses of the lipid-rich brain tissue render it highly susceptible to reactive oxygen species (ROS) and oxidative stress, whereas the implication of ROS in the pathogenesis of several diseases in the central nervous system is well-established. The plasminogen activator (PA) system is a key modulator of extracellular proteolysis, extracellular matrix remodeling and neuronal cell signaling and has been implicated in the pathogenesis of these diseases. This study evaluates the role of tissue-type PA (t-PA) in oxidative stress and the protective role of dietary antioxidants in the rat brain. We used the CCl4 experimental model of ROS-induced lipid peroxidation and evaluated the antioxidant effect of oregano, rosemary or vitamin E. CCl4-treated Wistar rats exhibited elevated brain t-PA activity, which was decreased upon long-term administration of oregano, rosemary or vitamin E. PA inhibitor-1 (PAI-1) activity was also slightly elevated by CCl4, but this increase was not affected by the antioxidants. We hypothesize that the CCl4-induced t-PA activity indicates extracellular proteolytic activity that may be linked to neuronal cell death and brain damage. Vitamin E or antioxidants present in oregano or rosemary are effective in inhibiting t-PA elevation and can be considered as a potential protection against neuronal damage. PMID:23831191

  19. Comparative Study of Decomposition of CCl4 in Different Atmosphere Thermal Plasmas

    Institute of Scientific and Technical Information of China (English)

    HUANG Jianjun; GUO Wenkang; XU Ping

    2007-01-01

    Decomposition of carbon tetrachloride was studied theoretically in the most commonly used thermal plasma atmosphere such as H2, N2, O2 and water steam. A code developed by the National Aeronautics and Space Administration (NASA) was adopted to calculate the chemical equilibrium distribution and energy consumption of the decomposition of CCl4 in the H2, N2, O2 and water steam atmosphere thermal plasma respectively, with a temperature range of 500 K to 5000 K. In the neutral condition (H2, N2, atmosphere) formation of solid carbon was observed and in the oxygen-atmosphere (O2 and water steam) solid carbon formation disappeared through controlling the ratio of C/O. This indicates that the formation of polycyclic aromatic hydrocarbons (PAHs) is impossible theoretically. The energy consumption in the N2 atmosphere was much higher than that in the H2, O2 and water steam atmosphere at 1500 K.

  20. PROTECTIVE ABILITY OF MOMORDICA CHARANTIA L AGAINST CCL4 INDUCED HEPATIC DAMAGE IN RATS

    Directory of Open Access Journals (Sweden)

    Pingale Shirish S

    2010-12-01

    Full Text Available The aim of this study is to evaluate the efficacy of Momordica charantia on the experimental hepatotoxicity induced by carbon tetrachloride (CCl4. Carbon tetrachloride was administered once and simultaneously suspension of dry fruit powder was prepared in aqueous medium and was daily administered at a dose level of 1mg/kg body weight for 4 days. Silymarin was used as a standard drug for this study. Administration of carbon tetrachloride showed significant changes in the levels of serum aminotransferase, alkaline phosphatase, bilirubin and total proteins levels, however necrosis, collagen deposition and altered hepatic architecture were also observed. Markers of liver injury, altered aminotransferase, alkaline phosphatase, bilirubin etc. and morphological changes such as necrosis and collagen deposition were significantly decreased in the rats treated with Momordica charantia fruit powder. These results suggest that the Momordica charantia showed hepatoprotective effect on carbon tetrachloride induced hepatic damage and may be a potential clinical application for treatment of liver diseases.

  1. Crystal structure of erbium trichloroacetate Er(CCl3COO)·2H2O

    International Nuclear Information System (INIS)

    X-ray structure study of Er(CCl3COO)3x2H2O crystals is conducted (SYNTEX P21 autodiffractometer, MoKα-radiation). The crystals are of triclinic syngony: a11.697 (4), b=12.790 (4), c=15223 (4) A, α=70.67 (3), β=77.80 (3), γ=6561 (3)deg; space group P1, Z=4. There are two crystallographically independent types of erbium atoms with coordination numbers 7 and 8, respectively, in the unit cell. These atoms are linked by tetra- and double-carboxylated cross-links in the endless chains, while water molecules complete the metal coordination polyhedron is within 2.259-2.393 A interval, while in seven-coordination - within 2.229-2.267 A interval. Er-H2O distances constitute 2.389-2.534 A

  2. MIPAS IMK/IAA CFC-11 (CCl3F) and CFC-12 (CCl2F2) measurements: accuracy, precision and long-term stability

    Science.gov (United States)

    Eckert, E.; Laeng, A.; Lossow, S.; Kellmann, S.; Stiller, G.; von Clarmann, T.; Glatthor, N.; Höpfner, M.; Kiefer, M.; Oelhaf, H.; Orphal, J.; Funke, B.; Grabowski, U.; Haenel, F.; Linden, A.; Wetzel, G.; Woiwode, W.; Bernath, P. F.; Boone, C.; Dutton, G. S.; Elkins, J. W.; Engel, A.; Gille, J. C.; Kolonjari, F.; Sugita, T.; Toon, G. C.; Walker, K. A.

    2015-07-01

    Profiles of CFC-11 (CCl3F) and CFC-12 (CCl2F2) of the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS) abord the European satellite Envisat have been retrieved from versions MIPAS/4.61-MIPAS/4.62 and MIPAS/5.02-MIPAS/5.06 level-1b data using the scientific level-2 processor run by Karlsruhe Institute of Technology (KIT), Institute of Meteorology and Climate Research (IMK) and Consejo Superior de Investigaciones Científicas (CSIC), Instituto de Astrofísica de Andalucía (IAA). These profiles have been compared to measurements taken by the balloon borne Cryosampler, Mark IV (MkIV) and MIPAS-Balloon (MIPAS-B), the airborne MIPAS stratospheric aircraft (MIPAS-STR), the satellite borne Atmospheric Chemistry Experiment Fourier transform spectrometer (ACE-FTS) and the High Resolution Dynamic Limb Sounder (HIRDLS) as well as the ground based Halocarbon and other Atmospheric Trace Species (HATS) network for the reduced spectral resolution period (RR: January 2005-April 2012) of MIPAS Envisat. ACE-FTS, MkIV and HATS also provide measurements during the high spectral resolution period (FR: July 2002-March 2004) and were used to validate MIPAS Envisat CFC-11 and CFC-12 products during that time, as well as ILAS-II profiles. In general, we find that MIPAS Envisat shows slightly higher values for CFC-11 at the lower end of the profiles (below ~ 15 km) and in a comparison of HATS ground-based data and MIPAS Envisat measurements at 3 km below the tropopause. Differences range from approximately 10-50 pptv (~ 5-20 %) during the RR period. In general, differences are slightly smaller for the FR period. An indication of a slight high-bias at the lower end of the profile exists for CFC-12 as well, but this bias is far less pronounced than for CFC-11, so that differences at the lower end of the profile (below ~ 15 km) and in the comparison of HATS and MIPAS Envisat measurements taken at 3 km below the tropopause mainly stay within 10-50 pptv (~ 2-10 %) for the RR and

  3. Chemokine CCL2 and its receptor CCR2 in the medullary dorsal horn are involved in trigeminal neuropathic pain

    Directory of Open Access Journals (Sweden)

    Zhang Zhi-Jun

    2012-07-01

    Full Text Available Abstract Background Neuropathic pain in the trigeminal system is frequently observed in clinic, but the mechanisms involved are largely unknown. In addition, the function of immune cells and related chemicals in the mechanism of pain has been recognized, whereas few studies have addressed the potential role of chemokines in the trigeminal system in chronic pain. The present study was undertaken to test the hypothesis that chemokine C-C motif ligand 2 (CCL2-chemokine C-C motif receptor 2 (CCR2 signaling in the trigeminal nucleus is involved in the maintenance of trigeminal neuropathic pain. Methods The inferior alveolar nerve and mental nerve transection (IAMNT was used to induce trigeminal neuropathic pain. The expression of ATF3, CCL2, glial fibrillary acidic protein (GFAP, and CCR2 were detected by immunofluorescence histochemical staining and western blot. The cellular localization of CCL2 and CCR2 were examined by immunofluorescence double staining. The effect of a selective CCR2 antagonist, RS504393 on pain hypersensitivity was checked by behavioral testing. Results IAMNT induced persistent (>21 days heat hyperalgesia of the orofacial region and ATF3 expression in the mandibular division of the trigeminal ganglion. Meanwhile, CCL2 expression was increased in the medullary dorsal horn (MDH from 3 days to 21 days after IAMNT. The induced CCL2 was colocalized with astroglial marker GFAP, but not with neuronal marker NeuN or microglial marker OX-42. Astrocytes activation was also found in the MDH and it started at 3 days, peaked at 10 days and maintained at 21 days after IAMNT. In addition, CCR2 was upregulated by IAMNT in the ipsilateral medulla and lasted for more than 21 days. CCR2 was mainly colocalized with NeuN and few cells were colocalized with GFAP. Finally, intracisternal injection of CCR2 antagonist, RS504393 (1, 10 μg significantly attenuated IAMNT-induced heat hyperalgesia. Conclusion The data suggest that CCL2-CCR

  4. HEPATOPROTECTIVE EFFECT OF METHANOLIC EXTRACT OF HEDYOTIS HERBACEA LINN IN CCl4 TREATED MALE RATS

    Directory of Open Access Journals (Sweden)

    Sharma Naveen

    2012-10-01

    Full Text Available To evaluate the hepatoprotective effect of methanolic extract of Hedyotis herbacea Linn in rats treated with CCl4. In Hepatotoxic rats, liver damage was studied by assessing parameters such as aspartate amino transferase (AST, alanine amino transferase (ALT, alkaline phosphate transferase (ALP and gamma glutamyl transpeptidase (GGT in serum and concentration of total proteins, total lipids, phospholipids, triglycerides and cholesterol in both serum and liver. The effect of co-administration of Methanolic extract of Hedyotis herbacea on the above parameters was further investigated. Histopathological study of the liver was also undertaken. A rise in the level of AST, ALT, ALP & GGT in serum evidence as hepatic damage and also changes in other biochemical parameters observed in serum and liver showed a tendency to attain near normalcy in animals co-administration with Methanolic extract of Hedyotis herbacea. The normal value for AST – 25.25 IU/L, ALP – 73.02 IU/L, Protein - 6.62 IU/L, Total lipid – 133.45 gm/100 ml. Were found to alter towards value AST – 34.51 IU/L, ALP – 130.15 IU/L, Protein – 3.42 IU/L, Total lipid – 270.82 gm/100 ml in Hepatoprotective rats. These parameters attained near normal values. AST – 24.82 IU/L, ALP – 85.15 IU/L, Protein – 5.98 IU/L, Total lipid – 151.24 gm/100 ml in Methanolic extract of Hedyotis herbacea co-administrated rats. Profound steatosis- Ballooning degeneration and nodule formation observed in the hepatic architecture of CCl4 treated rats were found to acquire near normalcy in drug co-administration rats thus corroborating the biochemical observations. The study substantiates the Hepatoprotective potential of Methanolic extract of Hedyotis herbacea.

  5. Polyphenolic screening and protective properties of some vegetables against CCl4 liver damage

    International Nuclear Information System (INIS)

    In the present study, we screened for the polyphenolic compounds present in some selected tropical vegetables and the protective effect of the vegetable extract against CCl4-induced hepatotoxicity in rats as a way of evaluating their medicinal potential in addition to their nutritional values. The use of HPLC/DAD/MS revealed the presence of some phenolic compounds in the studied vegetables. Crassocephalum crepidioides; caffeoyl derivatives, Talinum triangulare; rutin and kaempferol derivatives, Amaranthus hybridus; caffeoyl derivative, rutin and kaempferol derivative, Hibiscus esculentus; caffeoyl derivative, quercetin derivative and an unidentified flavonoid, Xanthosoma mafaffa; six unidentified flavonoids with similar absorption maximum at different retention times) and Celocia argentia (luteolin derivative and four unidentified flavonoids. Carbon tetrachloride at a dose of 0.5ml/kg body weight (b.w) produced liver damage in rats as manifested by the rise in the levels of ALT (IU/l), AST (IU/l) and total protein (g/l) in the serum (40.60 ± 3.50, 80.60 ± 5.10, 73.20 ± 1.87), in the liver homogenate (1300.00 ± 7.38, 1660.00 ± 13.69, 250.00 ± 7.51) and MDA content (nmol TBARS/mg Liver Protein) in the liver homogenate (82.00 ± 0.02, 82.00 ± 0.07) compared to the control. The result revealed a reduction of the serum marker enzymes (ALT, AST and Total protein), compared with the CCl4 treated group after the administration of the various polyphenolic extract. In a similar manner, the extract brings about a reduction of the MDA content. It could be concluded that the protective properties exhibited by the vegetables could be amongst other factor due to the presence of some polyphenols. (author)

  6. Attenuation of CCl4-induced hepatic fibrosis in mice by vaccinating against TGF-β1.

    Directory of Open Access Journals (Sweden)

    Xiaobao Fan

    Full Text Available Transforming growth factor β1 (TGF-β1 is the pivotal pro-fibrogenic cytokine in hepatic fibrosis. Reducing the over-produced expression of TGF-β1 or blocking its signaling pathways is considered to be a promising therapeutic strategy for hepatic fibrosis. In this study, we evaluated the feasibility of attenuating hepatic fibrosis by vaccination against TGF-β1 with TGF-β1 kinoids. Two TGF-β1 kinoid vaccines were prepared by cross-linking TGF-β1-derived polypeptides (TGF-β1(25-[41-65] and TGF-β1(30-[83-112] to keyhole limpet hemocyanin (KLH. Immunization with the two TGF-β1 kinoids efficiently elicited the production of high-levels of TGF-β1-specific antibodies against in BALB/c mice as tested by enzyme-linked immunosorbent assay (ELISA and Western blotting. The antisera neutralized TGF-β1-induced growth-inhibition on mink lung epithelial cells (Mv1Lu and attenuated TGF-β1-induced Smad2/3 phosphorylation, α-SMA, collagen type 1 alpha 2 (COL1A2, plasminogen activator inhibitor-1 (PAI-1 and tissue inhibitor of metalloproteinase-1 (TIMP-1 expression in the rat hepatic stellate cell (HSC line, HSC-T6. Vaccination against TGF-β1 with the kinoids significantly suppressed CCl4-induced collagen deposition and the expression of α-SMA and desmin, attenuated hepatocyte apoptosis and accelerated hepatocyte proliferation in BALB/c mice. These results demonstrated that immunization with the TGF-β1 kinoids efficiently attenuated CCl4-induced hepatic fibrosis and liver injury. Our study suggests that vaccination against TGF-β1 might be developed into a feasible therapeutic approach for the treatment of chronic fibrotic liver diseases.

  7. Macrophage Inflammatory Protein-3 Alpha (MIP-3α)/CCL20 in HIV-1-Infected Individuals

    Science.gov (United States)

    Aziz, Najib; Detels, Roger; Chang, L Cindy; Butch, Anthony W

    2016-01-01

    Objective Uncontrolled HIV infection progresses to the depletion of systemic and mucosal CD4 and AIDS. Early HIV infection may be associated with increases in the concentration of MIP-3α in the blood and gut fluids. MIP-3α/CCL20 is the only chemokine known to interact with CCR6 receptors which are expressed on immature dendritic cells and both effector and memory CD8+ and CD4+ T cells. The role and prognostic value of blood levels of MIP-3α in HIV-infected individuals has yet to be described. Methods We determined the serum levels of MIP-3α, and IFN-γ, in 167 HIV-1-infected and 27 HIV-1-uninfected men participating in the Multicenter AIDS Cohort Study (MACS). The blood biomarkers were measured using enzyme-linked immunosorbent assays (ELISA) and the cell phenotypes using flow cytometry. Results Median serum levels of MIP-3α in HIV-1-infected and uninfected men was significantly different (pabsolute number of CD4+ T cell (p=0.01) and were positively correlated with CD38 molecules on CD8+ T cells (p=0.0002) and with serum levels of IFN-γ (0.006). Conclusion Serum levels of MIP-3α concomitantly increase with plasma levels of IFN-γ, CD38 expression on CD8+ T cells, and decreased of absolute CD4+ T cells in HIV-1-infected men. A higher blood level of MIP-3α may be representation of locally high level of MIP-3α and more recruitment of immature dendritic cell at site of infection. Involvement of CCR6/CCL20 axis and epithelial cells at the recto-colonel level may enhance sexual transmission of HIV-1 in MSM and may be useful as a prognostic marker in HIV-1-infection and AIDS.

  8. Superconducting Super Collider Laboratory coupled-cavity linac mechanical design

    International Nuclear Information System (INIS)

    A collaboration between the Superconducting Super Collider Laboratory (SSCL) and the Los Alamos National Laboratory (LANL) for the engineering and mechanical design of the SSCL Coupled-Cavity Linac (CCL) has yielded an innovative example of the well known side coupled-cavity type of linear accelerator. The SSCL CCL accelerates an H- beam from 70 MeV to 600 MeV with an rf cavity structure consisting of eight tanks in each of nine modules for a total length of about 112 meters. Magnetically-coupled bridge couplers transfer power from tank to tank within a module. A single rf power input is located at the center bridge coupler of each module. The bridge couplers permit placement along the beam line of combined function focusing/steering electromagnets and diagnostic pods for beam instrumentation. Each tank and bridge coupler is rf frequency stabilized, nominally to 1,283 MHz, by water pumped through integral water passages. Air isolation grooves surround the water passages at each braze joint so that water-to-vacuum interfaces are avoided. Each tank is supported by adjustable spherical bearing rod end struts to permit alignment and accommodate thermal expansion and contraction of the rf structure. Tank struts, electromagnet/diagnostic pod support frames, vacuum manifolds and utilities are all mounted to a girder-and-leg support stand running the full length of the CCL. (Author) tab., fig

  9. Inhibitory effects of saikosaponin-d on CCl4-induced hepatic fibrogenesis in rats

    Institute of Scientific and Technical Information of China (English)

    Shuang-Suo Dang; Bao-Feng Wang; Yan-An Cheng; Ping Song; Zhen-Guo Liu; Zong-Fang Li

    2007-01-01

    AIM: To investigate the suppressive effect of saikosaponin-d (SSd) on hepatic fibrosis in rats induced by CCl4 injections in combination with alcohol and high fat, low protein feeding and its relationship with the expression of nuclear factor-κB (NF-κB), tumor necrosis factor-alpha (TNF-α) and interleukins-6 (IL-6).METHODS: Hepatic fibrosis models were induced by subcutaneous injection of CCl4 at a dosage of 3 mL/kg in rats. At the same time, rats in treatment groups were injected intraperitoneally with SSd at different doses (1.0,1.5 and 2.0 mg/kg) once daily for 6 wk in combination with CCl4, while the control group received olive oil instead of CCl4. At the end of the experiment, rats were anesthetized and killed (except for 8 rats which died during the experiment; 2 from the model group, 3 in high-dose group, 1 in medium-dose group and 2 in lowdose group). Hematoxylin and eosin (HE) staining and Van Gieson staining were used to examine the changes in liver pathology. The levels of alanine aminotransferase (ALT), triglyeride (TG), albumin (ALB), globulin (GLB),hyaluronic acid (HA) and laminin (LN) in serum and the content of hydroxyproline (HYP) in liver were measured by biochemical examinations and radioimmuneoassay,respectively. In addition, the expression of TNF-α and IL-6 in liver homogenate was evaluated by enzymelinked immunosorbent assay (ELISA) and the levels of NF-κBp65 and I-κBα in liver tissue were analyzed by Western blotting.RESULTS: Both histological examination and Van Gieson staining demonstrated that SSd could attenuate the area and extent of necrosis and reduce the scores of liver fibrosis. Similarly, the levels of ALT, TG, GLB, HA, and LN in serum, and the contents of HYP, TNF-α and IL-6 in liver were all significantly increased in model group in comparison with those in control group. Whereas,the treatment with SSd markedly reduced all the above parameters compared with the model group, especially in the medium group (ALT: 412 ± 94

  10. Age- and light-dependent development of localised retinal atrophy in CCL2(-/-CX3CR1(GFP/GFP mice.

    Directory of Open Access Journals (Sweden)

    Mei Chen

    Full Text Available Previous studies have shown that CCL2/CX3CR1 deficient mice on C57BL/6N background (with rd8 mutation have an early onset (6 weeks of spontaneous retinal degeneration. In this study, we generated CCL2(-/-CX3CR1(GFP/GFP mice on the C57BL/6J background. Retinal degeneration was not detected in CCL2(-/-CX3CR1(GFP/GFP mice younger than 6 months. Patches of whitish/yellowish fundus lesions were observed in 17∼60% of 12-month, and 30∼100% of 18-month CCL2(-/-CX3CR1(GFP/GFP mice. Fluorescein angiography revealed no choroidal neovascularisation in these mice. Patches of retinal pigment epithelium (RPE and photoreceptor damage were detected in 30% and 50% of 12- and 18-month CCL2(-/-CX3CR1(GFP/GFP mice respectively, but not in wild-type mice. All CCL2(-/-CX3CR1(GFP/GFP mice exposed to extra-light (∼800lux, 6 h/day, 6 months developed patches of retinal atrophy, and only 20-25% of WT mice which underwent the same light treatment developed atrophic lesions. In addition, synaptophysin expression was detected in the outer nucler layer (ONL of area related to photoreceptor loss in CCL2(-/-CX3CR1(GFP/GFP mice. Markedly increased rhodopsin but reduced cone arrestin expression was observed in retinal outer layers in aged CCL2(-/-CX3CR1(GFP/GFP mice. GABA expression was reduced in the inner retina of aged CCL2(-/-CX3CR1(GFP/GFP mice. Significantly increased Müller glial and microglial activation was observed in CCL2(-/-CX3CR1(GFP/GFP mice compared to age-matched WT mice. Macrophages from CCL2(-/-CX3CR1(GFP/GFP mice were less phagocytic, but expressed higher levels of iNOS, IL-1β, IL-12 and TNF-α under hypoxia conditions. Our results suggest that the deletions of CCL2 and CX3CR1 predispose mice to age- and light-mediated retinal damage. The CCL2/CX3CR1 deficient mouse may thus serve as a model for age-related atrophic degeneration of the RPE, including the dry type of macular degeneration, geographic atrophy.

  11. Fast food diet with CCl4 micro-dose induced hepatic-fibrosis –a novel animal model

    Science.gov (United States)

    2014-01-01

    Background Non-alcoholic fatty liver disease (NAFLD) is defined as a spectrum of conditions ranging from hepatocellular steatosis to steatohepatitis and fibrosis, progressing to cirrhosis, which occur in the absence of excessive alcohol use. Several animal models capture aspects of NAFLD but are limited either in their representation of the disease stages or use for development of therapeutics due to the extended periods of time required to develop full histological features. Methods Here, we report the development of a novel rat model for NAFLD that addresses some of these limitations. We used a fast food diet (FFD) and a CCl4 micro dose (0.5 ml/kg B.wt) for 8 weeks in Wistar rats. Serological analyses, gene expression profiling and liver histology studies were conducted to investigate the development of steatosis, steatohepatitis and fibrosis in the FFD-CCl4 model when compared to the individual effects of a FFD or a micro dose of CCl4 in rats. Results The serum biochemical profile of the FFD-CCl4 model showed an increase in liver injury and fibrosis. This was also accompanied by a significant increase in liver triglycerides (TG), inflammation and oxidative stress. Importantly, we observed extensive fibrosis confirmed by: i) increased gene expression of fibrosis markers and, ii) moderate to severe collagen deposition seen as perisinusoidal and bridging fibrosis using H&E, Trichome and Sirius Red staining. Conclusions In summary, we find that the FFD-CCl4 rat model developed NAFLD histological features including, steatosis, inflammation and fibrosis in 8 weeks showing promise as a model that can be used to develop NAFLD therapeutics and liver anti-fibrotics. PMID:24884574

  12. The protective effect of silymarin on the carbon tetrachloride (CCl4)-induced liver injury in common carp (Cyprinus carpio).

    Science.gov (United States)

    Jia, Rui; Cao, Liping; Du, Jinliang; Xu, Pao; Jeney, Galina; Yin, Guojun

    2013-03-01

    Silymarin, a mixture of bioactive flavonolignans from the milk thistle (Silybum marianum), is traditionally used in herbal medicine to defend against various hepatotoxic agents. The aim of the present study was to evaluate the protective effect of silymarin against carbon tetrachloride (CCl4)-induced liver injury in fish. Common carp, with an average initial weight of 17.0 ± 1.1 g, were fed diet containing four doses of silymarin (0, 0.1, 0.5, and 1 g/kg diet) for 60 d. Fish were then given an intraperitoneal injection of CCl4 (30% in arachis oil) at a dose of 0.5 ml/kg body weight. At 72 h after CCl4 injection, blood and liver samples were collected for the analyses of serum biochemical parameters, liver index, peroxidation product, glutathione, and antioxidant enzyme activities. The results showed that administration of silymarin at 0.5 and 1 g/kg diet for 60 d prior to CCl4 intoxication significantly reduced the elevated activities of glutamate pyruvate transaminase, glutamate oxalate transaminase, lactate dehydrogenase (LDH), and increased the reduced levels of total protein and albumin in the serum. The reduced levels of liver index, superoxide dismutase, glutathione peroxidase, catalase, glutathione, and total antioxidant capacity were markedly increased, and malondialdehyde formation was significantly restrained in the liver. However, these parameters, except LDH, were not significantly changed in fish fed with silymarin at 0.1 g/kg diet. Based on the results, it can be concluded that silymarin has protective effect against CCl4-induced hepatotoxicity in fish. It is suggested that silymarin may be used as a hepatoprotective agent to prevent liver diseases in fish. PMID:23435858

  13. Amniotic fluid stem cells inhibit the progression of bleomycin-induced pulmonary fibrosis via CCL2 modulation in bronchoalveolar lavage.

    Directory of Open Access Journals (Sweden)

    Orquidea Garcia

    Full Text Available The potential for amniotic fluid stem cell (AFSC treatment to inhibit the progression of fibrotic lung injury has not been described. We have previously demonstrated that AFSC can attenuate both acute and chronic-fibrotic kidney injury through modification of the cytokine environment. Fibrotic lung injury, such as in Idiopathic Pulmonary Fibrosis (IPF, is mediated through pro-fibrotic and pro-inflammatory cytokine activity. Thus, we hypothesized that AFSC treatment might inhibit the progression of bleomycin-induced pulmonary fibrosis through cytokine modulation. In particular, we aimed to investigate the effect of AFSC treatment on the modulation of the pro-fibrotic cytokine CCL2, which is increased in human IPF patients and is correlated with poor prognoses, advanced disease states and worse fibrotic outcomes. The impacts of intravenous murine AFSC given at acute (day 0 or chronic (day 14 intervention time-points after bleomycin injury were analyzed at either day 3 or day 28 post-injury. Murine AFSC treatment at either day 0 or day 14 post-bleomycin injury significantly inhibited collagen deposition and preserved pulmonary function. CCL2 expression increased in bleomycin-injured bronchoalveolar lavage (BAL, but significantly decreased following AFSC treatment at either day 0 or at day 14. AFSC were observed to localize within fibrotic lesions in the lung, showing preferential targeting of AFSC to the area of fibrosis. We also observed that MMP-2 was transiently increased in BAL following AFSC treatment. Increased MMP-2 activity was further associated with cleavage of CCL2, rendering it a putative antagonist for CCL2/CCR2 signaling, which we surmise is a potential mechanism for CCL2 reduction in BAL following AFSC treatment. Based on this data, we concluded that AFSC have the potential to inhibit the development or progression of fibrosis in a bleomycin injury model during both acute and chronic remodeling events.

  14. Regulation of the CCL2 gene in pancreatic β-cells by IL-1β and glucocorticoids: role of MKP-1.

    Directory of Open Access Journals (Sweden)

    Susan J Burke

    Full Text Available Release of pro-inflammatory cytokines from both resident and invading leukocytes within the pancreatic islets impacts the development of Type 1 diabetes mellitus. Synthesis and secretion of the chemokine CCL2 from pancreatic β-cells in response to pro-inflammatory signaling pathways influences immune cell recruitment into the pancreatic islets. Therefore, we investigated the positive and negative regulatory components controlling expression of the CCL2 gene using isolated rat islets and INS-1-derived β-cell lines. We discovered that activation of the CCL2 gene by IL-1β required the p65 subunit of NF-κB and was dependent on genomic response elements located in the -3.6 kb region of the proximal gene promoter. CCL2 gene transcription in response to IL-1β was blocked by pharmacological inhibition of the IKKβ and p38 MAPK pathways. The IL-1β-mediated increase in CCL2 secretion was also impaired by p38 MAPK inhibition and by glucocorticoids. Moreover, multiple synthetic glucocorticoids inhibited the IL-1β-stimulated induction of the CCL2 gene. Induction of the MAP Kinase Phosphatase-1 (MKP-1 gene by glucocorticoids or by adenoviral-mediated overexpression decreased p38 MAPK phosphorylation, which diminished CCL2 gene expression, promoter activity, and release of CCL2 protein. We conclude that glucocorticoid-mediated repression of IL-1β-induced CCL2 gene transcription and protein secretion occurs in part through the upregulation of the MKP-1 gene and subsequent deactivation of the p38 MAPK. Furthermore, the anti-inflammatory actions observed with MKP-1 overexpression were obtained without suppressing glucose-stimulated insulin secretion. Thus, MKP-1 is a possible target for anti-inflammatory therapeutic intervention with preservation of β-cell function.

  15. NF-kappaB-driven STAT2 and CCL2 expression in astrocytes in response to brain injury

    DEFF Research Database (Denmark)

    Khorooshi, Reza; Babcock, Alicia A; Owens, Trevor

    2008-01-01

    induces glial response. Astrocytes are the major glial population in the CNS. We examined expression of STATs and the chemokine CCL2 and their relationship to astroglial NF-kappaB signaling in the CNS following axonal transection. Double labeling with Mac-1/CD11b and glial fibrillary acidic protein...... revealed that STAT2 up-regulation and phosphorylation colocalized exclusively to astrocytes, suggesting the involvement of STAT2 activating signals selectively in astroglial response to injury. STAT1 was also up-regulated and phosphorylated but not exclusively in astrocytes. Both STAT2 up-regulation and...... phosphorylation were NF-kappaB -dependent since they did not occur in the lesion-reactive hippocampus of transgenic mice with specific inhibition of NF-kappaB activation in astrocytes. We further showed that lack of NF-kappaB signaling significantly reduced injury-induced CCL2 expression as well as leukocyte...

  16. Direct and indirect pharmacological modulation of CCL2/CCR2 pathway results in attenuation of neuropathic pain - In vivo and in vitro evidence.

    Science.gov (United States)

    Piotrowska, Anna; Kwiatkowski, Klaudia; Rojewska, Ewelina; Slusarczyk, Joanna; Makuch, Wioletta; Basta-Kaim, Agnieszka; Przewlocka, Barbara; Mika, Joanna

    2016-08-15

    The repeated administration of microglial inhibitor (minocycline) and CCR2 antagonist (RS504393) attenuated the neuropathic pain symptoms in rats following chronic constriction injury of the sciatic nerve, which was associated with decreased spinal microglia activation and the protein level of CCL2 and CCR2. Furthermore, in microglia primary cell cultures minocycline downregulated both CCL2 and CCR2 protein levels after lipopolysaccharide-stimulation. Additionally, in astroglia primary cell cultures minocycline decreased the expression of CCL2, but not CCR2. Our results provide new evidence that modulation of CCL2/CCR2 pathway by microglial inhibitor as well as CCR2 antagonist is effective for neuropathic pain development in rats. PMID:27397071

  17. Volumetric Properties of the Mixture Tetrachloromethane CCl4 + C16H34 Hexadecane (VMSD1141, LB3350_V)

    Science.gov (United States)

    Cibulka, I.; Fontaine, J.-C.; Sosnkowska-Kehiaian, K.; Kehiaian, H. V.

    This document is part of Subvolume B 'Binary Liquid Systems of Nonelectrolytes II' of Volume 26 'Heats of Mixing, Vapor-Liquid Equilibrium, and Volumetric Properties of Mixtures and Solutions' of Landolt-Börnstein Group IV 'Physical Chemistry'. It contains the Chapter 'Volumetric Properties of the Mixture Tetrachloromethane CCl4 + C16H34 Hexadecane (VMSD1141, LB3350_V)' providing data from direct measurement of mass density at variable pressure and constant temperature and mole fraction.

  18. Volumetric Properties of the Mixture Tetrachloromethane CCl4 + C16H34 Hexadecane (VMSD1342, LB3352_V)

    Science.gov (United States)

    Cibulka, I.; Fontaine, J.-C.; Sosnkowska-Kehiaian, K.; Kehiaian, H. V.

    This document is part of Subvolume B 'Binary Liquid Systems of Nonelectrolytes II' of Volume 26 'Heats of Mixing, Vapor-Liquid Equilibrium, and Volumetric Properties of Mixtures and Solutions' of Landolt-Börnstein Group IV 'Physical Chemistry'. It contains the Chapter 'Volumetric Properties of the Mixture Tetrachloromethane CCl4 + C16H34 Hexadecane (VMSD1342, LB3352_V)' providing data by calculation of isothermal compressibility from direct measurements of mass densities at variable pressure and constant temperature and mole fraction.

  19. Volumetric Properties of the Mixture Tetrachloromethane CCl4 + C16H34 Hexadecane (VMSD1242, LB3379_V)

    Science.gov (United States)

    Cibulka, I.; Fontaine, J.-C.; Sosnkowska-Kehiaian, K.; Kehiaian, H. V.

    This document is part of Subvolume B 'Binary Liquid Systems of Nonelectrolytes II' of Volume 26 'Heats of Mixing, Vapor-Liquid Equilibrium, and Volumetric Properties of Mixtures and Solutions' of Landolt-Börnstein Group IV 'Physical Chemistry'. It contains the Chapter 'Volumetric Properties of the Mixture Tetrachloromethane CCl4 + C16H34 Hexadecane (VMSD1242, LB3379_V)' providing data by calculation of molar excess volume from density measurements at variable pressure and constant temperature and mole fraction.

  20. Oligonol Ameliorates CCl4-Induced Liver Injury in Rats via the NF-Kappa B and MAPK Signaling Pathways

    Directory of Open Access Journals (Sweden)

    Jeonghyeon Bak

    2016-01-01

    Full Text Available Oxidative stress is thought to be a key risk factor in the development of hepatic diseases. Blocking or retarding the reactions of oxidation and the inflammatory process by antioxidants could be a promising therapeutic intervention for prevention or treatment of liver injuries. Oligonol is a low molecular weight polyphenol containing catechin-type monomers and oligomers derived from lychee fruit. In this study, we investigated the anti-inflammatory effect of oligonol on carbon tetrachloride- (CCl4- induced acute hepatic injury in rats. Oral administration of oligonol (10 or 50 mg/kg reduced CCl4-induced abnormalities in liver histology and serum AST and serum ALT levels. Oligonol treatment attenuated the CCl4-induced production of inflammatory mediators, including TNF-α, IL-1β, cyclooxygenase-2 (COX-2, and inducible nitric oxide synthase (iNOS mRNA levels. Western blot analysis showed that oligonol suppressed proinflammatory nuclear factor-kappa B (NF-κB p65 activation, phosphorylation of extracellular signal-regulated kinase (ERK, c-Jun NH2-terminal kinase (JNK, and p38 mitogen-activated protein kinases (MAPKs as well as Akt. Oligonol exhibited strong antioxidative activity in vitro and in vivo, and hepatoprotective activity against t-butyl hydroperoxide-induced HepG2 cells. Taken together, oligonol showed antioxidative and anti-inflammatory effects in CCl4-intoxicated rats by inhibiting oxidative stress and NF-κB activation via blockade of the activation of upstream kinases including MAPKs and Akt.

  1. Effect of aqueous extract of Tinospora cordifolia on functions of peritoneal macrophages isolated from CCl4 intoxicated male albino mice

    OpenAIRE

    Sharma Gauri D; Sengupta Mahuya; Chakraborty Biswajit

    2011-01-01

    Abstract Background The current practice of ingesting phytochemicals for supporting the immune system or fighting infections is based on centuries-old tradition. Macrophages are involved at all the stages of an immune response. The present study focuses on the immunostimulant properties of Tinospora cordifolia extract that are exerted on circulating macrophages isolated from CCl4 (0.5 ml/kg body weight) intoxicated male albino mice. Methods Apart from damaging the liver system, carbon tetrach...

  2. Re-evaluation of the lifetimes of the major CFCs and CH3CCl3 using atmospheric trends

    Directory of Open Access Journals (Sweden)

    J. W. Elkins

    2012-09-01

    Full Text Available Since the Montreal Protocol on substances that deplete the ozone layer and its amendments came into effect, growth rates of the major ozone depleting substances (ODS, particularly CFC-11, -12 and -113 and CH3CCl3, have declined markedly, paving the way for global stratospheric ozone recovery. Emissions have now fallen to relatively low levels, therefore the rate at which this recovery occurs will depend largely on the atmospheric lifetime of these compounds. The first ODS measurements began in the early 1970s along with the first lifetime estimates calculated by considering their atmospheric trends. We now have global mole fraction records spanning multiple decades, prompting this lifetime re-evaluation. Using surface measurements from the Advanced Global Atmospheric Gases Experiment (AGAGE and the National Oceanic and Atmospheric Administration Global Monitoring Division (NOAA GMD from 1978 to 2011, we estimated the lifetime of CFC-11, CFC-12, CFC-113 and CH3CCl3 using a multi-species inverse method. The CFC-11 lifetime of 45 yr, currently recommended in the World Meteorological Organisation (WMO Scientific Assessment of Ozone Depletion, lies at the lower uncertainty bound of our estimates which are 524066 yr (1-sigma uncertainty when AGAGE data were used, and 504066 yr when the NOAA network data were used. Our derived lifetime for CFC-113 is higher than the WMO estimates of 85 yr (10488123 using AGAGE, 10387122 using NOAA. Our estimates of the lifetime of CFC-12 and CH3CCl3 agree well with other recent estimates being 10885137 and 10484135 yr (CFC-12, AGAGE and NOAA, respectively and 5.24.85.6 and 5.24.85.7 yr (CH3CCl3, AGAGE and NOAA, respectively.

  3. Hepatoprotective and Antioxidant Effect of Hibiscus Polyphenol Rich Extract (HPE) Against Carbon Tetrachloride (CCL4) - Induced Damage in Rats

    OpenAIRE

    Adetutu, Adewale; Owoade, Abiodun O.

    2013-01-01

    Aims: Hibiscus sabdariffa is a medicinal plant that is consumed for its health benefits in Africa. The study was designed to investigate the hepatoprotective potentials of Hibiscus polyphenolic rich extract (HPE), (a group of phenolic compounds occurring in the dried calyx of Hibiscus sabdariffa) against CCl4-induced damaged in rats. Place and Duration of Study: Department of Biochemistry, Ladoke Akintola University of Technology, Ogbomosho, Nigeria, between January 2011 and June 2012. Method...

  4. PARC/CCL18 Is a Plasma CC Chemokine with Increased Levels in Childhood Acute Lymphoblastic Leukemia

    OpenAIRE

    Struyf, Sofie; Schutyser, Evemie; Gouwy, Mieke; Gijsbers, Klara; Proost, Paul; Benoit, Yves; Opdenakker, Ghislain; Van Damme, Jo; Laureys, Geneviève

    2003-01-01

    Chemokines play an important role in leukocyte mobilization, hematopoiesis, and angiogenesis. Tissue-specific expression of particular chemokines also influences tumor growth and metastasis. Here, the CC chemokine pulmonary and activation-regulated chemokine (PARC)/CCL18 was measured in pediatric patients with acute lymphoblastic leukemia (ALL) or acute myeloid leukemia (AML). Surprisingly, PARC immunoreactivity was consistently detected in plasma from healthy donors. After purification to ho...

  5. MicroRNA-200c Represses IL-6, IL-8, and CCL-5 Expression and Enhances Osteogenic Differentiation

    Science.gov (United States)

    Sharp, Thad; Khorsand, Behnoush; Fischer, Carol; Eliason, Steven; Salem, Ali; Akkouch, Adil; Brogden, Kim; Amendt, Brad A.

    2016-01-01

    MicroRNAs (miRs) regulate inflammation and BMP antagonists, thus they have potential uses as therapeutic reagents. However, the molecular function of miR-200c in modulating proinflammatory and bone metabolic mediators and osteogenic differentiation is not known. After miR-200c was transduced into a human embryonic palatal mesenchyme (HEPM) (a cell line of preosteoblasts), using lentiviral vectors, the resulting miR-200c overexpression increased osteogenic differentiation biomarkers, including osteocalcin (OCN) transcripts and calcium content. miR-200c expression also down-regulated interleukin (IL)-6, IL-8, and chemokine (C-C motif) ligand (CCL)-5 under lipopolysaccharide (LPS) stimulation and increased osteoprotegerin (OPG) in these cells. miR-200c directly regulates the expression of IL-6, IL-8 and CCL-5 transcripts by binding to their 3’UTRs. A plasmid-based miR-200c inhibitor effectively reduces their binding activities. Additionally, miR-200c delivered using polyethylenimine (PEI) nanoparticles effectively inhibits IL-6, IL-8 and CCL-5 in primary human periodontal ligament fibroblasts and increases the biomarkers of osteogenic differentiation in human bone marrow mesenchymal stem cells (MSCs), including calcium content, ALP, and Runx2. These data demonstrate that miR-200c represses IL-6, IL-8 and CCL-5 and improves osteogenic differentiation. miR-200c may potentially be used as an effective means to prevent periodontitis-associated bone loss by arresting inflammation and osteoclastogenesis and enhancing bone regeneration. PMID:27529418

  6. Re-evaluation of the lifetimes of the major CFCs and CH3CCl3 using atmospheric trends

    Directory of Open Access Journals (Sweden)

    M. Rigby

    2013-03-01

    Full Text Available Since the Montreal Protocol on Substances that Deplete the Ozone Layer and its amendments came into effect, growth rates of the major ozone depleting substances (ODS, particularly CFC-11, -12 and -113 and CH3CCl3, have declined markedly, paving the way for global stratospheric ozone recovery. Emissions have now fallen to relatively low levels, therefore the rate at which this recovery occurs will depend largely on the atmospheric lifetime of these compounds. The first ODS measurements began in the early 1970s along with the first lifetime estimates calculated by considering their atmospheric trends. We now have global mole fraction records spanning multiple decades, prompting this lifetime re-evaluation. Using surface measurements from the Advanced Global Atmospheric Gases Experiment (AGAGE and the National Oceanic and Atmospheric Administration Global Monitoring Division (NOAA GMD from 1978 to 2011, we estimated the lifetime of CFC-11, CFC-12, CFC-113 and CH3CCl3 using a multi-species inverse method. A steady-state lifetime of 45 yr for CFC-11, currently recommended in the most recent World Meteorological Organisation (WMO Scientific Assessments of Ozone Depletion, lies towards the lower uncertainty bound of our estimates, which are 544861 yr (1-sigma uncertainty when AGAGE data were used and 524561 yr when the NOAA network data were used. Our derived lifetime for CFC-113 is significantly higher than the WMO estimates of 85 yr, being 10999121 (AGAGE and 10997124 (NOAA. New estimates of the steady-state lifetimes of CFC-12 and CH3CCl3 are consistent with the current WMO recommendations, being 11195132 and 11295136 yr (CFC-12, AGAGE and NOAA respectively and 5.044.925.20 and 5.044.875.23 yr (CH3CCl3, AGAGE and NOAA respectively.

  7. Re-evaluation of the lifetimes of the major CFCs and CH3CCl3 using atmospheric trends

    Science.gov (United States)

    Rigby, M.; Prinn, R. G.; O'Doherty, S.; Montzka, S. A.; McCulloch, A.; Harth, C. M.; Mühle, J.; Salameh, P. K.; Weiss, R. F.; Young, D.; Simmonds, P. G.; Hall, B. D.; Dutton, G. S.; Nance, D.; Mondeel, D. J.; Elkins, J. W.; Krummel, P. B.; Steele, L. P.; Fraser, P. J.

    2013-03-01

    Since the Montreal Protocol on Substances that Deplete the Ozone Layer and its amendments came into effect, growth rates of the major ozone depleting substances (ODS), particularly CFC-11, -12 and -113 and CH3CCl3, have declined markedly, paving the way for global stratospheric ozone recovery. Emissions have now fallen to relatively low levels, therefore the rate at which this recovery occurs will depend largely on the atmospheric lifetime of these compounds. The first ODS measurements began in the early 1970s along with the first lifetime estimates calculated by considering their atmospheric trends. We now have global mole fraction records spanning multiple decades, prompting this lifetime re-evaluation. Using surface measurements from the Advanced Global Atmospheric Gases Experiment (AGAGE) and the National Oceanic and Atmospheric Administration Global Monitoring Division (NOAA GMD) from 1978 to 2011, we estimated the lifetime of CFC-11, CFC-12, CFC-113 and CH3CCl3 using a multi-species inverse method. A steady-state lifetime of 45 yr for CFC-11, currently recommended in the most recent World Meteorological Organisation (WMO) Scientific Assessments of Ozone Depletion, lies towards the lower uncertainty bound of our estimates, which are 544861 yr (1-sigma uncertainty) when AGAGE data were used and 524561 yr when the NOAA network data were used. Our derived lifetime for CFC-113 is significantly higher than the WMO estimates of 85 yr, being 10999121 (AGAGE) and 10997124 (NOAA). New estimates of the steady-state lifetimes of CFC-12 and CH3CCl3 are consistent with the current WMO recommendations, being 11195132 and 11295136 yr (CFC-12, AGAGE and NOAA respectively) and 5.044.925.20 and 5.044.875.23 yr (CH3CCl3, AGAGE and NOAA respectively).

  8. Spiral ligament fibrocyte-derived MCP-1/CCL2 contributes to inner ear inflammation secondary to nontypeable H. influenzae-induced otitis media

    Directory of Open Access Journals (Sweden)

    Lim David J

    2010-10-01

    Full Text Available Abstract Background Otitis media (OM, one of the most common pediatric infectious diseases, causes inner ear inflammation resulting in vertigo and sensorineural hearing loss. Previously, we showed that spiral ligament fibrocytes (SLFs recognize OM pathogens and up-regulate chemokines. Here, we aim to determine a key molecule derived from SLFs, contributing to OM-induced inner ear inflammation. Methods Live NTHI was injected into the murine middle ear through the tympanic membrane, and histological analysis was performed after harvesting the temporal bones. Migration assays were conducted using the conditioned medium of NTHI-exposed SLFs with and without inhibition of MCP-1/CCL2 and CCR2. qRT-PCR analysis was performed to demonstrate a compensatory up-regulation of alternative genes induced by the targeting of MCP-1/CCL2 or CCR2. Results Transtympanic inoculation of live NTHI developed serous and purulent labyrinthitis after clearance of OM. THP-1 cells actively migrated and invaded the extracellular matrix in response to the conditioned medium of NTHI-exposed SLFs. This migratory activity was markedly inhibited by the viral CC chemokine inhibitor and the deficiency of MCP-1/CCL2, indicating that MCP-1/CCL2 is a main attractant of THP-1 cells among the SLF-derived molecules. We further demonstrated that CCR2 deficiency inhibits migration of monocyte-like cells in response to NTHI-induced SLF-derived molecules. Immunolabeling showed an increase in MCP-1/CCL2 expression in the cochlear lateral wall of the NTHI-inoculated group. Contrary to the in vitro data, deficiency of MCP-1/CCL2 or CCR2 did not inhibit OM-induced inner ear inflammation in vivo. We demonstrated that targeting MCP-1/CCL2 enhances NTHI-induced up-regulation of MCP-2/CCL8 in SLFs and up-regulates the basal expression of CCR2 in the splenocytes. We also found that targeting CCR2 enhances NTHI-induced up-regulation of MCP-1/CCL2 in SLFs. Conclusions Taken together, we suggest that

  9. Pseudogenization of the MCP-2/CCL8 chemokine gene in European rabbit (genus Oryctolagus, but not in species of Cottontail rabbit (Sylvilagus and Hare (Lepus

    Directory of Open Access Journals (Sweden)

    van der Loo Wessel

    2012-08-01

    Full Text Available Abstract Background Recent studies in human have highlighted the importance of the monocyte chemotactic proteins (MCP in leukocyte trafficking and their effects in inflammatory processes, tumor progression, and HIV-1 infection. In European rabbit (Oryctolagus cuniculus one of the prime MCP targets, the chemokine receptor CCR5 underwent a unique structural alteration. Until now, no homologue of MCP-2/CCL8a, MCP-3/CCL7 or MCP-4/CCL13 genes have been reported for this species. This is interesting, because at least the first two genes are expressed in most, if not all, mammals studied, and appear to be implicated in a variety of important chemokine ligand-receptor interactions. By assessing the Rabbit Whole Genome Sequence (WGS data we have searched for orthologs of the mammalian genes of the MCP-Eotaxin cluster. Results We have localized the orthologs of these chemokine genes in the genome of European rabbit and compared them to those of leporid genera which do (i.e. Oryctolagus and Bunolagus or do not share the CCR5 alteration with European rabbit (i.e. Lepus and Sylvilagus. Of the Rabbit orthologs of the CCL8, CCL7, and CCL13 genes only the last two were potentially functional, although showing some structural anomalies at the protein level. The ortholog of MCP-2/CCL8 appeared to be pseudogenized by deleterious nucleotide substitutions affecting exon1 and exon2. By analyzing both genomic and cDNA products, these studies were extended to wild specimens of four genera of the Leporidae family: Oryctolagus, Bunolagus, Lepus, and Sylvilagus. It appeared that the anomalies of the MCP-3/CCL7 and MCP-4/CCL13 proteins are shared among the different species of leporids. In contrast, whereas MCP-2/CCL8 was pseudogenized in every studied specimen of the Oryctolagus - Bunolagus lineage, this gene was intact in species of the Lepus - Sylvilagus lineage, and was, at least in Lepus, correctly transcribed. Conclusion The biological function of a gene was often

  10. Downregulation of MIP-1α/CCL3 with praziquantel treatment in Schistosoma haematobium and HIV-1 co-infected individuals in a rural community in Zimbabwe

    Directory of Open Access Journals (Sweden)

    Ullum H

    2009-10-01

    Full Text Available Abstract Background Chemokines have been reported to play an important role in granulomatous inflammation during Schistosoma mansoni infection. However there is less information on their role in Schistosoma haematobium infection, or on the effect of concurrent HIV-1 infection, as a potential modifying influence. Methods To determine levels of MIP-1α/CCL3 chemokine in plasma of S. haematobium and HIV-1 co-infected and uninfected individuals in a rural black Zimbabwean community. A cohort was established of HIV-1 and schistosomiasis infection and co-infection comprising 379 participants. Outcome measures consisted of HIV-1 and schistosomiasis status and levels of MIP-1α/CCL3 in plasma at baseline and three months post treatment. An association was established between MIP-1α/CCL3 plasma levels with HIV-1 and S. haematobium infections. Results A total of 379 adults formed the established cohort comprising 76 (20% men and 303 (80% women. Mean age was 33.25, range 17 - 62 years. The median MIP-1α/CCL3 plasma concentration was significantly higher in S. haematobium infected compared with uninfected individuals (p = 0.029. In contrast, there was no difference in the median MIP-1α/CCL3 levels between HIV-1 positive and negative individuals (p = 0.631. MIP-1α/CCL3 concentration in plasma was significantly reduced at three months after treatment with praziquantel (p = 000. Conclusion The results of our study show that the MIP-1α/CCL3 levels were positively associated with S. haematobium egg counts at baseline but not with HIV-1 infection status. MIP-1α/CCL3 levels were significantly reduced at three months post treatment with praziquantel. We therefore conclude that MIP-1α/CCL3 is produced during infection with S haematobium. S. haematobium infection is associated with increased MIP-1α/CCL3 levels in an egg intensity-dependent manner and treatment of S. haematobium is associated with a reduction in MIP-1α/CCL3.

  11. Ab initio ro-vibronic spectroscopy of SiCCl (X{sup ~2}Π)

    Energy Technology Data Exchange (ETDEWEB)

    Brites, Vincent [Université d’Evry Val d’Essonne, Laboratoire Analyse et Modélisation pour la Biologie et l’Environnement, LAMBE CNRS UMR 8587, Boulevard F. Mitterrand, 91025 Evry Cedex (France); Mitrushchenkov, Alexander O.; Léonard, Céline, E-mail: celine.leonard@u-pem.fr [Université Paris-Est, Laboratoire Modélisation et Simulation Multi Echelle, MSME UMR 8208 CNRS, 5 bd Descartes, 77454 Marne-la-Vallée (France); Peterson, Kirk A. [Department of Chemistry, Washington State University, Pullman, Washington 99164 (United States)

    2014-07-21

    The full dimensional potential energy surfaces of the {sup 2}A{sup ′} and {sup 2}A{sup ′′} electronic components of X{sup ~2}Π SiCCl have been computed using the explicitly correlated coupled cluster method, UCCSD(T)-F12b, combined with a composite approach taking into account basis set incompleteness, core-valence correlation, scalar relativity, and higher order excitations. The spin-orbit and dipole moment surfaces have also been computed ab initio. The ro-vibronic energy levels and absorption spectrum at 5 K have been determined from variational calculations. The influence of each correction on the fundamental frequencies is discussed. An assignment is proposed for bands observed in the LIF experiment of Smith et al. [J. Chem. Phys. 117, 6446 (2002)]. The overall agreement between the experimental and calculated ro-vibronic levels is better than 7 cm{sup −1} which is comparable with the 10–20 cm{sup −1} resolution of the emission spectrum.

  12. Studies of Coupled Cavity Linac (CCL) Accelerating Structures with 3-D Codes

    CERN Document Server

    Spalek, G; Smith, P D; Greninger, P T; Charman, C M

    2000-01-01

    The cw CCL being designed for the Accelerator Production of Tritium (APT) project accelerates protons from 96MeV to 211MeV. It consists of 99 segments each containing up to seven accelerating cavities. Segments are coupled by intersegment coupling cavities and grouped into supermodules. The design method needs to address not only basic cavity sizing for a given coupling and pi/2 mode frequency, but also the effects of high power densities on the cavity frequency, mechanical stresses, and the structure's stop band during operation. On the APT project, 3-D RF (Ansoft Corp.'s HFSS) and coupled RF/structural (Ansys Inc.'s ANSYS) codes are being used to develop tools to address the above issues and guide cooling channel design. The code's predictions are being checked against available low power Aluminum models. Stop band behavior under power will be checked once the tools are extended to CCDTL structures that have been tested at high power. A summary of calculations made to date and agreement with measured result...

  13. Extreme 13C depletion of CCl2F2 in firn air samples from NEEM, Greenland

    Directory of Open Access Journals (Sweden)

    T. Blunier

    2012-07-01

    Full Text Available A series of 12 high volume air samples collected from the S2 firn core during the North Greenland Eemian Ice Drilling (NEEM 2009 campaign have been measured for mixing ratio and stable carbon isotope composition of the chlorofluorocarbon CFC-12 (CCl2F2. While the mixing ratio measurements compare favorably to other firn air studies, the isotope results show extreme 13C depletion at the deepest measurable depth (65 m, to values lower than δ13C = −80‰ vs. VPDB (the international stable carbon isotope scale, compared to present day surface tropospheric measurements near −40‰. Firn air modeling was used to interpret these measurements. Reconstructed atmospheric time series indicate even larger depletions (to −120‰ near 1950 AD, with subsequent rapid enrichment of the atmospheric reservoir of the compound to the present day value. Mass-balance calculations show that this change must have been caused by a large change in the isotopic composition of anthropogenic CFC-12 emissions, probably due to technological changes in the CFC production process over the last 80 yr. Propagating the mass-balance calculations into the future demonstrates that as emissions decrease to zero, isotopic fractionation by the stratospheric sinks will lead to continued 13C enrichment in atmospheric CFC-12.

  14. Extreme 13C depletion of CCl2F2 in firn air samples from NEEM, Greenland

    Directory of Open Access Journals (Sweden)

    T. Blunier

    2013-01-01

    Full Text Available A series of 12 high volume air samples collected from the S2 firn core during the North Greenland Eemian Ice Drilling (NEEM 2009 campaign have been measured for mixing ratio and stable carbon isotope composition of the chlorofluorocarbon CFC-12 (CCl2F2. While the mixing ratio measurements compare favorably to other firn air studies, the isotope results show extreme 13C depletion at the deepest measurable depth (65 m, to values lower than δ13C = −80‰ vs. VPDB (the international stable carbon isotope scale, compared to present day surface tropospheric measurements near −40‰. Firn air modeling was used to interpret these measurements. Reconstructed atmospheric time series indicate even larger depletions (to −120‰ near 1950 AD, with subsequent rapid enrichment of the atmospheric reservoir of the compound to the present day value. Mass-balance calculations show that this change is likely to have been caused by a large change in the isotopic composition of anthropogenic CFC-12 emissions, probably due to technological advances in the CFC production process over the last 80 yr, though direct evidence is lacking.

  15. Studies of coupled cavity LINAC (CCL) accelerating structures with 3-D codes

    International Nuclear Information System (INIS)

    The cw CCL being designed for the Accelerator Production of Tritium (APT) project accelerates protons from 96 MeV to 211 MeV. It consists of 99 segments each containing up to seven accelerating cavities. Segments are coupled by intersegment coupling cavities and grouped into supermodules. The design method needs to address not only basic cavity sizing for a given coupling and pi/2 mode frequency, but also the effects of high power densities on the cavity frequency, mechanical stresses, and the structure's stop band during operation. On the APT project, 3-D RF (Ansoft Corp.'s HFSS) and coupled RF/structural (Ansys Inc.'s ANSYS) codes are being used. to develop tools to address the above issues and guide cooling channel design. The code's predictions are being checked against available low power Aluminum models. Stop band behavior under power will be checked once the tools are extended to CCDTL structures that have been tested at high power. A summary of calculations made to date and agreement with measured results will be presented

  16. Human breast cancer-derived soluble factors facilitate CCL19-induced chemotaxis of human dendritic cells.

    Science.gov (United States)

    Hwang, Hyundoo; Shin, Changsik; Park, Juhee; Kang, Enoch; Choi, Bongseo; Han, Jae-A; Do, Yoonkyung; Ryu, Seongho; Cho, Yoon-Kyoung

    2016-01-01

    Breast cancer remains as a challenging disease with high mortality in women. Increasing evidence points the importance of understanding a crosstalk between breast cancers and immune cells, but little is known about the effect of breast cancer-derived factors on the migratory properties of dendritic cells (DCs) and their consequent capability in inducing T cell immune responses. Utilizing a unique 3D microfluidic device, we here showed that breast cancers (MCF-7, MDA-MB-231, MDA-MB-436 and SK-BR-3)-derived soluble factors increase the migration of DCs toward CCL19. The enhanced migration of DCs was mainly mediated via the highly activated JNK/c-Jun signaling pathway, increasing their directional persistence, while the velocity of DCs was not influenced, particularly when they were co-cultured with triple negative breast cancer cells (TNBCs or MDA-MB-231 and MDA-MB-436). The DCs up-regulated inflammatory cytokines IL-1β and IL-6 and induced T cells more proliferative and resistant against activation-induced cell death (AICD), which secret high levels of inflammatory cytokines IL-1β, IL-6 and IFN-γ. This study demonstrated new possible evasion strategy of TNBCs utilizing their soluble factors that exploit the directionality of DCs toward chemokine responses, leading to the building of inflammatory milieu which may support their own growth. PMID:27451948

  17. Association of -1382A>G CCL11 gene variant with ischemic stroke, its subtypes and hemorrhagic stroke in a South Indian population

    OpenAIRE

    Sitara Roy; Satrupa Das; Anjana Munshi; Subhash Kaul; Akka Jyothy

    2014-01-01

    Background: CCL11 (Eotaxin-1) is an important inflammatory cytokine belonging to the CC family of chemokines associated with a number of infection or inflammation-related diseases such as atherosclerosis and stroke. We investigated the association of CCL11 gene polymorphism rs4795895-1382A>G with ischemic and hemorrhagic stroke. Materials and Methods: Six hundred and twenty ischemic stroke patients, 620 age- and sex-matched healthy controls, and 220 hemorrhagic stroke patients, 220 age- and s...

  18. Hepatoprotective and cytoprotective properties of Hyptis suaveolens against oxidative stress-induced damage by CCl4 and H2O2

    Institute of Scientific and Technical Information of China (English)

    Hadi Ghaffari; Behrouz Jalali Ghassam; HS Prakash

    2012-01-01

    Objective:To investigate capacity of Hyptis suaveolens (H. suaveolens) methanol extract as an antioxidant to protect against carbon tetrachloride (CCl4)-induced oxidative stress, hepatotoxicity in Albino Wistar rats and cytoprotective effect of hydrogen peroxide (H2O2) induced cell death in HepG2 cell line. Methods: Two different doses of methanol extract of H. suaveolens were evaluated for the hepatoprotective activity against carbon tetrachloride (CCl4) induced hepatotoxicity in rats. Animals in Group I: served as control, group II:H. suaveolens (100 mL/kg b.w), group III:H. suaveolens (50 mL/kg b.w) + CCl4 (1 mg/kg), group IV:H. suaveolens (100 mL/kg b.w) + CCl4 (1 mL/kg) and group V: CCl4 (1 mL/kg). Histopathologic changes of liver were also evaluated. Cytotoxicity was also determined by 3, (4,5-dimethylthiazol-2-yl)2,5-diphenyl-tetrazolium bromide (MTT) assay. Results:Oral sigle dose treatment of CCl4 produced a marked elevation in the serum levels of aspartate transaminase (AST), alanine transaminase (ALT), alkaline phosphatase (ALP) and Lactate dehydrogenase (LDH). Histopathological analysis of the liver of CCl4-induced rats revealed marked liver cell necrosis with inflammatory collections that were conformed to increase in the levels of SOD, GSH, GST, GR and LPO. Treatment with H2O2 significantly induced death of HepG2 cell. Pretreatment with H. suaveolens methanol extract inhibited or attenuated H2O2 induced cytotoxicity. Conclusions: This study shows that H. suaveolens methanol extract can be proposed to protect the liver against CCl4-induced oxidative damage in rats and protect the cells against H2O2-induced oxidative damage in HepG2 cells. The hepatoprotective and cytoprotective effects might be correlated with its antioxidant and free radical scavenger effects.

  19. Dual blockade of the pro-inflammatory chemokine CCL2 and the homeostatic chemokine CXCL12 is as effective as high dose cyclophosphamide in murine proliferative lupus nephritis.

    Science.gov (United States)

    Devarapu, Satish Kumar; Kumar Vr, Santhosh; Rupanagudi, Khader Valli; Kulkarni, Onkar P; Eulberg, Dirk; Klussmann, Sven; Anders, Hans-Joachim

    2016-08-01

    Induction therapy of proliferative lupus nephritis still requires the use of unselective immunosuppressive drugs with significant toxicities. In search of more specific drugs with equal efficacy but fewer side effects we considered blocking pro-inflammatory chemokine monocyte chemoattractant protein-1 (MCP-1/CCL2) and homeostatic chemokine stromal cell-derived factor-1 (SDF-1/CXCL12), which both contribute to the onset and progression of proliferative lupus nephritis yet through different mechanisms. We hypothesized that dual antagonism could be as potent on lupus nephritis as the unselective immunosuppressant cyclophosphamide (CYC). We estimated serum levels of CCL2 and CXCL12 in patients with SLE (n=99) and compared the results with healthy individuals (n=21). In order to prove our hypothesis we used l-enantiomeric RNA Spiegelmer® chemokine antagonists, i.e. the CCL2-specific mNOX-E36 and the CXCL12-specific NOX-A12 to treat female MRL/lpr mice from week 12 to 20 of age with either anti-CXCL12 or anti-CCL2 alone or both. SLE patients showed elevated serum levels of CCL2 but not of CXCL12. Female MRL/lpr mice treated with dual blockade showed significantly more effective than either monotherapy in preventing proteinuria, immune complex glomerulonephritis, and renal excretory failure and the results are at par with CYC treatment. Dual blockade reduced leukocyte counts and renal IL-6, IL-12p40, CCL-5, CCL-2 and CCR-2 mRNA expression. Dual blockade of CCL2 and CXCL12 can be as potent as CYC to suppress the progression of proliferative lupus nephritis probably because the respective chemokine targets mediate different disease pathomechanisms, i.e. systemic autoimmunity and peripheral tissue inflammation. PMID:27392463

  20. A Novel Role for CCL3 (MIP-1α) in Myeloma-induced Bone Disease via Osteocalcin Downregulation and Inhibition of Osteoblast Function

    OpenAIRE

    Vallet, Sonia; Pozzi, Samantha; Patel, Kishan; Vaghela, Nileshwari; Fulciniti, Mariateresa; Veiby, Petter; Hideshima, Teru; Santo, Loredana; Cirstea, Diana; Scadden, David T.; Anderson, Kenneth C.; Raje, Noopur

    2011-01-01

    Upregulation of cytokines and chemokines is a frequent finding in multiple myeloma (MM). CCL3 (also known as MIP-1α) is a pro-inflammatory chemokine whose levels in the MM microenvironment correlate with osteolytic lesions and tumor burden. CCL3 and its receptors, CCR1 and CCR5, contribute to the development of bone disease in MM by supporting tumor growth and regulating osteoclast (OC) differentiation. Here, we identify inhibition of osteoblast (OB) function as an additional pathogenic mecha...

  1. Hepatoprotective effect of manual acupuncture at acupoint GB34 against CCl4-induced chronic liver damage in rats

    Institute of Scientific and Technical Information of China (English)

    Yun-Kyoung Yim; Hyun Lee; Kwon-Eui Hong; Young-Il Kim; Byung-Ryul Lee; Tae-Han Kim; Ji-Young Yi

    2006-01-01

    AIM: To investigate the hepatoprotective effect of manual acupuncture at Yanglingquan (GB34) on CCl4-induced chronic liver damage in rats.METHODS: Rats were injected intraperitoneally with CCl4 (1 mL/kg) and treated with manual acupuncture using reinforcing manipulation techniques at left GB34(Yanglingquan) 3 times a week for 10 wk. A nonacupoint in left gluteal area was selected as a sham point. To estimate the hepatoprotective effect of manual acupuncture at GB34, measurement of liver index,biochemical assays including serum ALT, AST, ALP and total cholesterol, histological analysis and blood cell counts were conducted.RESULTS: Manual acupuncture at GB34 reduced the liver index, serum ALT, AST, ALP and total cholesterol levels as compared with the control group and the sham acupuncture group. It also increased and normalized the populations of WBC and lymphocytes.CONCLUSION: Manual acupuncture with reinforcing manipulation techniques at left GB34 reduces liver toxicity, protects liver function and liver tissue, and normalizes immune activity in CCl4-intoxicated rats.

  2. PARC/CCL18 Is a Plasma CC Chemokine with Increased Levels in Childhood Acute Lymphoblastic Leukemia

    Science.gov (United States)

    Struyf, Sofie; Schutyser, Evemie; Gouwy, Mieke; Gijsbers, Klara; Proost, Paul; Benoit, Yves; Opdenakker, Ghislain; Van Damme, Jo; Laureys, Geneviève

    2003-01-01

    Chemokines play an important role in leukocyte mobilization, hematopoiesis, and angiogenesis. Tissue-specific expression of particular chemokines also influences tumor growth and metastasis. Here, the CC chemokine pulmonary and activation-regulated chemokine (PARC)/CCL18 was measured in pediatric patients with acute lymphoblastic leukemia (ALL) or acute myeloid leukemia (AML). Surprisingly, PARC immunoreactivity was consistently detected in plasma from healthy donors. After purification to homogeneity, the presence of intact PARC (1–69) and processed PARC (1–68) in normal human plasma was confirmed by sequence and mass spectrometry analysis. Furthermore, PARC serum levels were significantly increased in children with T-ALL and prepreB-ALL compared to control serum samples, whereas serum levels in AML and preB-ALL patients were not significantly different from controls. In contrast, the hemofiltrate CC chemokine-1 (HCC-1)/CCL14 was not found to be a biomarker in any of these patients’ strata, whereas the cytokine interleukin-6 (IL-6) was significantly decreased in AML and prepreB-ALL. Stimulated leukocytic cell lines or lymphoblasts from patients produced IL-8/CXCL8 or macrophage inflammatory protein-1α (MIP-1α/CCL3) but not PARC, not even after IL-4 or IL-10 treatment. However, PARC was produced by superantigen or IL-4 stimulated monocytes co-cultured with lymphocytes or lymphoblastic cells. Serum PARC levels thus constitute a novel leukemia marker, possibly reflecting tumor/host cell interactions in the circulation. PMID:14578205

  3. Red Sea Suberea mollis Sponge Extract Protects against CCl4-Induced Acute Liver Injury in Rats via an Antioxidant Mechanism

    Directory of Open Access Journals (Sweden)

    Aymn T. Abbas

    2014-01-01

    Full Text Available Recent studies have demonstrated that marine sponges and their active constituents exhibited several potential medical applications. This study aimed to evaluate the possible hepatoprotective role as well as the antioxidant effect of the Red Sea Suberea mollis sponge extract (SMSE on carbon tetrachloride- (CCl4- induced acute liver injury in rats. In vitro antioxidant activity of SMSE was evaluated by 2,2-diphenyl-1-picryl-hydrazyl-hydrate (DPPH assay. Rats were orally administered three different concentrations (100, 200, and 400 mg/kg of SMSE and silymarin (100 mg/kg along with CCl4 (1 mL/kg, i.p., every 72 hr for 14 days. Plasma aspartate aminotransferase (AST, alanine aminotransferase (ALT, alkaline phosphatase (ALP, and total bilirubin were measured. Hepatic malondialdehyde (MDA, reduced glutathione (GSH, nitric oxide (NO, superoxide dismutase (SOD, glutathione peroxidase (GPx, and catalase (CAT were also measured. Liver specimens were histopathologically examined. SMSE showed strong scavenging activity against free radicals in DPPH assay. SMSE significantly reduced liver enzyme activities. Moreover, SMSE significantly reduced hepatic MDA formation. In addition, SMSE restored GSH, NO, SOD, GPx, and CAT. The histopathological results confirmed these findings. The results of this study suggested a potent protective effect of the SMSE against CCl4-induced hepatic injury. This may be due to its antioxidant and radical scavenging activity.

  4. In-Vivo Antioxidant activity of ethanolic extract of Mentha pulegium leaf against CCl4 induced toxicity in rats

    Institute of Scientific and Technical Information of China (English)

    Sachin Jain; Dinesh Kumar Jain; Neelam Balekar

    2012-01-01

    Objective: To evaluate the in-vivo antioxidant potential of ethanolic extract of Mentha Pulegium against CCl4 induced toxicity in rats. Methods: Animals were treated with plant extract for 7 days and then toxicity was induced with a single CCl4 intraperitoneal injection. Pre-treatment with 600 mg/kg (p.o.) of ethanolic extract of Mentha Pulegium improved the glutathione, SOD, catalase, and peroxidase levels significantly as compared to control group. Results: The present studies revealed that Mentha Pulegium has significant in-vivo antioxidant activity and can be used to protect tissue from oxidative stress. The result showed that the activities of glutathione, SOD, catalase and peroxidase in group treated with CCl4 declined significantly than that of normal group. Conclusion: Ethanolic extract of Mentha Pulegium in the dose of 600 mg/kg, p.o., has improved the glutathione, SOD, catalase, and peroxidase levels significantly, which were comparable with Liv 52. Based on this study we conclude that Ethanolic extract of MenthaPulegium possesses in vivo antioxidant activity and can be employed in protecting tissue from oxidative stress.

  5. Immunotherapeutic effects of cytokine-induced killer cells combined with CCL21/IL15 armed oncolytic adenovirus in TERT-positive tumor cells.

    Science.gov (United States)

    Ye, Jun-Feng; Lin, Yuan-Qiang; Yu, Xiu-Hua; Liu, Ming-Yuan; Li, Yang

    2016-09-01

    The effective antitumor immune responses are dependent on coordinate interaction of various effector cells. Thus, the combination of adoptive immunotherapy and target gene therapy is capable of efficiently generating a productive antitumor immune response. We investigated whether combination of cytokine-induced killer (CIK) cells adoptive immunotherapy and CCL21/IL15 armed oncolytic adenovirus could induce the enhanced antitumor activity. The CCL21/IL15 co-expression oncolytic adenoviruses were constructed by using the AdEasy system, which uses homologous recombination with shuttle plasmids and full length Ad backbones. This conditionally replicating adenoviruses CRAd-CCL21-IL15 could induce apoptosis in TERTp-positive tumor cells for viral propagation, but do not replicate efficiently in normal cells, because the E1A promoter was replaced by telomerase reverse transcriptase promoter (TERTp). Our results showed that the combination of CIK cells and CRAd-CCL21-IL15 could induce higher antitumor activity than either CIK cells or CRAd-CCL21-IL15 alone. This combined treatment could induce the tumor specific cytotoxicity of CTLs (cytotoxic T lymphocytes) in vitro. Moreover, the treatment of established tumors with the combined therapy of CIK cells and CRAd-CCL21-IL15 resulted in tumor regression. This study suggests that the combined treatment by adoptive immunotherapy and gene therapy is a promising strategy for the therapy of tumor. PMID:27380620

  6. Up-regulation of chemokine C-C ligand 2 (CCL2) and C-X-C chemokine 8 (CXCL8) expression by monocytes in chronic idiopathic urticaria.

    Science.gov (United States)

    Santos, J C; de Brito, C A; Futata, E A; Azor, M H; Orii, N M; Maruta, C W; Rivitti, E A; Duarte, A J S; Sato, M N

    2012-01-01

    The disturbed cytokine-chemokine network could play an important role in the onset of diseases with inflammatory processes such as chronic idiopathic urticaria (CIU). Our main objectives were to evaluate the relation between proinflammatory chemokine serum levels from CIU patients and their response to autologous skin test (ASST) and basophil histamine release (BHR). We also aimed to assess the chemokine secretion by peripheral blood mononuclear cells (PBMC) upon polyclonal stimulus and to evaluate chemokine C-C ligand 2/C-X-C chemokine 8 (CCL2/CXCL8) and Toll-like receptor-4 (TLR-4) expression in monocytes. We observed significantly higher serum levels of the CXCL8, CXCL9, CXCL10 and CCL2 in CIU patients compared to the healthy group, regardless of the BHR or ASST response. The basal secretion of CCL2 by PBMC or induced by Staphylococcus aureus enterotoxin A (SEA) was higher in CIU patients than in the control group, as well as for CXCL8 and CCL5 secretions upon phytohaemagglutinin stimulation. Also, up-regulation of CCL2 and CXCL8 mRNA expression was found in monocytes of patients upon SEA stimulation. The findings showed a high responsiveness of monocytes through CCL2/CXCL8 expression, contributing to the creation of a proinflammatory environment in CIU. PMID:22132892

  7. Small interfering RNA-mediated suppression of Ccl2 in Müller cells attenuates microglial recruitment and photoreceptor death following retinal degeneration

    Directory of Open Access Journals (Sweden)

    Rutar Matt

    2012-09-01

    Full Text Available Abstract Background The recruitment and activation of inflammatory cells is thought to exacerbate photoreceptor death in retinal degenerative conditions such as age-related macular degeneration (AMD. We investigated the role of Müller cell-derived chemokine (C-C motif ligand (Ccl2 expression on monocyte/microglia infiltration and photoreceptor death in light-mediated retinal degeneration, using targeted small interfering (siRNA. Methods Adult Sprague–Dawley rats were injected intravitreally with 1 μg of either Ccl2 siRNA or scrambled siRNA, and were then exposed to 1000 lux of light for a period of 24 hours. The mice were given an overdose of barbiturate, and the retinas harvested and evaluated for the effects of bright-light exposure. Ccl2 expression was assessed by quantitative PCR, immunohistochemistry, and in situ hybridization. Monocytes/microglia were counted on retinal cryostat sections immunolabeled with the markers ED1 and ionized calcium binding adaptor (IBA1, and photoreceptor apoptosis was assessed using terminal dUTP nick end labeling. Results Intravitreal injection of Ccl2 siRNA significantly reduced the expression of Ccl2 following light damage to 29% compared with controls. In retinas injected with Ccl2 siRNA, in situ hybridization and immunohistochemistry on retinal cryostat sections showed a substantial decrease in Ccl2 within Müller cells. Cell counts showed significantly fewer ED1-positive and IBA1-positive cells in the retinal vasculature and outer nuclear layer of Ccl2 siRNA-injected retinas, compared with controls. Moreover, there was significantly less photoreceptor apoptosis in Ccl2 siRNA-injected retinas compared with controls. Conclusions Our data indicate that Ccl2 expression by Müller cells promotes the infiltration of monocytes/microglia, thereby contributing to the neuroinflammatory response and photoreceptor death following retinal injury. Modulation of exaggerated chemokine responses using siRNA may have

  8. Analytical Laboratories

    Data.gov (United States)

    Federal Laboratory Consortium — NETL’s analytical laboratories in Pittsburgh, PA, and Albany, OR, give researchers access to the equipment they need to thoroughly study the properties of materials...

  9. National laboratories

    International Nuclear Information System (INIS)

    The foundation of a 'National Laboratory' which would support a Research center in synchrotron radiation applications is proposed. The essential features of such a laboratory differing of others centers in Brazil are presented. (L.C.)

  10. Laboratory Tests

    Science.gov (United States)

    Laboratory tests check a sample of your blood, urine, or body tissues. A technician or your doctor ... compare your results to results from previous tests. Laboratory tests are often part of a routine checkup ...

  11. Computational Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — This laboratory contains a number of commercial off-the-shelf and in-house software packages allowing for both statistical analysis as well as mathematical modeling...

  12. Transport properties of stage-1 CucCo1-cCl2 graphite intercalation compounds

    International Nuclear Information System (INIS)

    Stage-1 CucCo1-cCl2 graphite intercalation compounds approximate quasi-two-dimensional (2D) random spin systems with competing ferromagnetic and antiferromagnetic intraplanar exchange interactions. The temperature dependence of the in-plane electrical resistivity of these compounds has been measured near critical temperatures. The magnetic resistivity ζmag consists of the long-range spin-order part ζLS and the spin-fluctuation part ζSF. For 0≤c≤0.2 the long-range spin-order part ζLS is dominant: the temperature dependence of ζLS is described by a smeared power law with an exponent 2β, where β is the critical exponent of staggered magnetization. For 0.3≤c≤0.4 the spin-fluctuation part ζSF becomes larger than ζLS. For 0.5≤c≤0.95 no appreciable magnetic resistivity is observed. For c=1 the derivative -dζmag/dT shows a small peak at around 67 K due to the growth of short-range spin order which is characteristic of the 2D Heisenberg antiferromagnet. The critical behaviour of the in-plane resistivity can be explained in terms of a model based on π-d exchange interactions between π-electrons in the graphite layers and magnetic spins in the intercalate layers. The π-electrons are scattered by spins of a virtual antiferromagnetic in-plane spin configuration arising from the superposition of two ferromagnetic in-plane structures with spin directions antiparallel to each other. The π- d exchange interactions of these compounds are also discussed. (author)

  13. CCL3L1 gene copy number in individuals with and without HIV-associated neurocognitive disorder

    Directory of Open Access Journals (Sweden)

    Brown A

    2012-01-01

    Full Text Available Amanda Brown1, Ned Sacktor1, Karen Marder2, Bruce Cohen3, Giovanni Schifitto4, Richard L Skolasky1, Jason Creighton1, Liping Guo1, Justin C McArthur11Department of Neurology, Johns Hopkins University School of Medicine, Baltimore, MD, 2Department of Neurology, Psychiatry, Sergievsky Center and Taub Institute on Alzheimers Disease and the Aging Brain, New York Presbyterian Hospital, Columbia University College of Physicians and Surgeons, New York, NY, 3Department of Neurology, Northwestern University Feinberg School of Medicine, Chicago, IL, 4Department of Neurology, University of Rochester, School of Medicine and Dentistry, Rochester, NY, USABackground: CCL3L1 copy number variation has been implicated as a marker for susceptibility and immunity to human immunodeficiency virus (HIV-1 infection and its pathogenic sequelae. Some of these findings have been confirmed in several, but not all, subsequent independent cohort studies. A three-fold risk for the development of HIV-associated dementia was reported in individuals possessing a CCL3L1 copy number below the ethnic group median combined with a detrimental CCR5 genotype. With the availability of antiretroviral therapy since 1996, there has been a significant decline in HIV-associated dementia, and milder forms of HIV-associated neurocognitive impairment (HAND are now most prevalent. Moreover, patients are living longer with HIV-1 infection and it is recognized that aging may be a contributory factor to the development of cognitive disorder. Thus, the need for biomarkers that can be used in clinical practice to identify and provide optimal treatment for those at increased risk for HAND is great. HAND affects 20%–30% of HIV-infected individuals, and several genetic loci which have been shown to confer susceptibility to HIV infection may also modulate the development of neurocognitive disorder. The aim of this study was to determine whether CCL3L1 chemokine gene copy number in self-defined ethnic

  14. CCR9-CCL25 interactions promote cisplatin resistance in breast cancer cell through Akt activation in a PI3K-dependent and FAK-independent fashion

    Directory of Open Access Journals (Sweden)

    Lillard James W

    2011-05-01

    Full Text Available Abstract Background Chemotherapy heavily relies on apoptosis to kill breast cancer (BrCa cells. Many breast tumors respond to chemotherapy, but cells that survive this initial response gain resistance to subsequent treatments. This leads to aggressive cell variants with an enhanced ability to migrate, invade and survive at secondary sites. Metastasis and chemoresistance are responsible for most cancer-related deaths; hence, therapies designed to minimize both are greatly needed. We have recently shown that CCR9-CCL25 interactions promote BrCa cell migration and invasion, while others have shown that this axis play important role in T cell survival. In this study we have shown potential role of CCR9-CCL25 axis in breast cancer cell survival and therapeutic efficacy of cisplatin. Methods Bromodeoxyuridine (BrdU incorporation, Vybrant apoptosis and TUNEL assays were performed to ascertain the role of CCR9-CCL25 axis in cisplatin-induced apoptosis of BrCa cells. Fast Activated Cell-based ELISA (FACE assay was used to quantify In situ activation of PI3Kp85, AktSer473, GSK-3βSer9 and FKHRThr24 in breast cancer cells with or without cisplatin treatment in presence or absence of CCL25. Results CCR9-CCL25 axis provides survival advantage to BrCa cells and inhibits cisplatin-induced apoptosis in a PI3K-dependent and focal adhesion kinase (FAK-independent fashion. Furthermore, CCR9-CCL25 axis activates cell-survival signals through Akt and subsequent glycogen synthase kinase-3 beta (GSK-3β and forkhead in human rhabdomyosarcoma (FKHR inactivation. These results show that CCR9-CCL25 axis play important role in BrCa cell survival and low chemotherapeutic efficacy of cisplatin primarily through PI3K/Akt dependent fashion.

  15. Directional secretory response of double stranded RNA-induced thymic stromal lymphopoetin (TSLP and CCL11/eotaxin-1 in human asthmatic airways.

    Directory of Open Access Journals (Sweden)

    Gustavo Nino

    Full Text Available BACKGROUND: Thymic stromal lymphoproetin (TSLP is a cytokine secreted by the airway epithelium in response to respiratory viruses and it is known to promote allergic Th2 responses in asthma. This study investigated whether virally-induced secretion of TSLP is directional in nature (apical vs. basolateral and/or if there are TSLP-mediated effects occurring at both sides of the bronchial epithelial barrier in the asthmatic state. METHODS: Primary human bronchial epithelial cells (HBEC from control (n = 3 and asthmatic (n = 3 donors were differentiated into polarized respiratory tract epithelium under air-liquid interface (ALI conditions and treated apically with dsRNA (viral surrogate or TSLP. Sub-epithelial effects of TSLP were examined in human airway smooth muscle cells (HASMC from normal (n = 3 and asthmatic (n = 3 donors. Clinical experiments examined nasal airway secretions obtained from asthmatic children during naturally occurring rhinovirus-induced exacerbations (n = 20 vs. non-asthmatic uninfected controls (n = 20. Protein levels of TSLP, CCL11/eotaxin-1, CCL17/TARC, CCL22/MDC, TNF-α and CXCL8 were determined with a multiplex magnetic bead assay. RESULTS: Our data demonstrate that: 1 Asthmatic HBEC exhibit an exaggerated apical, but not basal, secretion of TSLP after dsRNA exposure; 2 TSLP exposure induces unidirectional (apical secretion of CCL11/eotaxin-1 in asthmatic HBEC and enhanced CCL11/eotaxin-1 secretion in asthmatic HASMC; 3 Rhinovirus-induced asthma exacerbations in children are associated with in vivo airway secretion of TSLP and CCL11/eotaxin-1. CONCLUSIONS: There are virally-induced TSLP-driven secretory immune responses at both sides of the bronchial epithelial barrier characterized by enhanced CCL11/eotaxin-1 secretion in asthmatic airways. These results suggest a new model of TSLP-mediated eosinophilic responses in the asthmatic airway during viral-induced exacerbations.

  16. Accuracy and differential bias in copy number measurement of CCL3L1 in association studies with three auto-immune disorders

    Directory of Open Access Journals (Sweden)

    Carpenter Danielle

    2011-08-01

    Full Text Available Abstract Background Copy number variation (CNV contributes to the variation observed between individuals and can influence human disease progression, but the accurate measurement of individual copy numbers is technically challenging. In the work presented here we describe a modification to a previously described paralogue ratio test (PRT method for genotyping the CCL3L1/CCL4L1 copy variable region, which we use to ascertain CCL3L1/CCL4L1 copy number in 1581 European samples. As the products of CCL3L1 and CCL4L1 potentially play a role in autoimmunity we performed case control association studies with Crohn's disease, rheumatoid arthritis and psoriasis clinical cohorts. Results We evaluate the PRT methodology used, paying particular attention to accuracy and precision, and highlight the problems of differential bias in copy number measurements. Our PRT methods for measuring copy number were of sufficient precision to detect very slight but systematic differential bias between results from case and control DNA samples in one study. We find no evidence for an association between CCL3L1 copy number and Crohn's disease, rheumatoid arthritis or psoriasis. Conclusions Differential bias of this small magnitude, but applied systematically across large numbers of samples, would create a serious risk of false positive associations in copy number, if measured using methods of lower precision, or methods relying on single uncorroborated measurements. In this study the small differential bias detected by PRT in one sample set was resolved by a simple pre-treatment by restriction enzyme digestion.

  17. Comparative Evaluation of Hepatoprotective Activities of Geniposide, Crocins and Crocetin by CCl4-Induced liver Injury in Mice

    OpenAIRE

    Chen, Ping; Chen, Yang; Wang, YaRong; Cai, Shining; Deng, Liang; Liu, Jia; Zhang, Hao

    2016-01-01

    Iridoid glycosides (mainly geniposide) and crocetin derivatives (crocins) are the two major active constituents in Gardenia jasminoides Ellis. In the present study, geniposide, crocins, crocin-1 and crocetin were separated from gardenia chromatographically. Then, mice were orally administrated with geniposide (400 mg/kg b.w.), crocins (400 mg/kg b.w.), crocin-1 (400 mg/kg b.w.) and crocetin (140 mg/kg b.w.) once daily for 7 days with CCl4. Hepatoprotective properties were evaluated by biochem...

  18. CCL8/MCP-2 is a target for mir-146a in HIV-1-infected human microglial cells

    OpenAIRE

    Rom, Slava; Rom, Inna; Passiatore, Giovanni; Pacifici, Marco; Radhakrishnan, Sujatha; Del Valle, Luis; Piña-Oviedo, Sergio; Khalili, Kamel; Eletto, Davide; Peruzzi, Francesca

    2010-01-01

    MicroRNA-mediated regulation of gene expression appears to be involved in a variety of cellular processes, including development, differentiation, proliferation, and apoptosis. Mir-146a is thought to be involved in the regulation of the innate immune response, and its expression is increased in tissues associated with chronic inflammation. Among the predicted gene targets for mir-146a, the chemokine CCL8/MCP-2 is a ligand for the CCR5 chemokine receptor and a potent inhibitor of CD4/CCR5-medi...

  19. Linearization of calibration curves by aerosol carrier effect of CCl4 vapor in electrothermal vaporization inductively coupled plasma mass spectrometry

    International Nuclear Information System (INIS)

    Carbon tetrachloride vapor as gaseous phase modifier in a graphite furnace electrothermal vaporizer (GFETV) converts heavy volatile analyte forms to volatile and medium volatile chlorides and produces aerosol carrier effect, the latter being a less generally recognized benefit. However, the possible increase of polyatomic interferences in inductively coupled plasma mass spectrometry (GFETV-ICP-MS) by chlorine and carbon containing species due to CCl4 vapor introduction has been discouraging with the use of low resolution, quadrupole type MS equipment. Being aware of this possible handicap, it was aimed at to investigate the feasibility of the use of this halogenating agent in ICP-MS with regard of possible hazards to the instrument, and also to explore the advantages under these specific conditions. With sample gas flow (inner gas flow) rate not higher than 900 ml min-1 Ar in the torch and 3 ml min-1 CCl4 vapor flow rate in the furnace, the long-term stability of the instrument was ensured and the following benefits by the halocarbon were observed. The non-linearity error (defined in the text) of the calibration curves (signal versus mass functions) with matrix-free solution standards was 30-70% without, and 1-5% with CCl4 vapor introduction, respectively, at 1 ng mass of Cu, Fe, Mn and Pb analytes. The sensitivity for these elements increased by 2-4-fold with chlorination, while the relative standard deviation (RSD) was essentially the same (2-5%) for the two cases in comparison. A vaporization temperature of 2650 deg. C was required for Cr in Ar atmosphere, while 2200 deg. C was sufficient in Ar + CCl4 atmosphere to attain complete vaporization. Improvements in linear response and sensitivity were the highest for this least volatile element. The pyrolytic graphite layer inside the graphite tube was protected by the halocarbon, and tube life time was further increased by using traces of hydrocarbon vapor in the external sheath gas of the graphite furnace. Details

  20. Peptidyl arginine deiminase inhibitor effect on hepatic fibrogenesis in a CCl4 pre-clinical model of liver fibrosis

    DEFF Research Database (Denmark)

    Vassiliadis, E.; Veidal, Sanne Skovgård; Kristiansen, M. N.; Hansen, C.; Jorgensen, M.; Leeming, D. J.; Karsdal, M.

    2013-01-01

    Having previously shown that levels of the citrullinated vimentin peptide VICM are raised in liver fibrosis in rats, we aimed to investigate whether inhibition of citrullination as measured by VICM levels could affect fibrogenesis. METHODS: Fibrogenesis was evaluated by quantitative histology and...... same period, with N-a-benzoyl-N5-(2 Chloro-1-iminoethyl)-L-Ornithine amide, a known PAD inhibitor. RESULTS: All 40 CCl4 treated animals showed a statistically significant increase in total collagen (p0.05). In PAD-treated animals VICM levels were 51% (P...

  1. Rapamycin ameliorates CCl4-induced liver fibrosis in mice through reciprocal regulation of the Th17/Treg cell balance.

    Science.gov (United States)

    Gu, Lei; Deng, Wen-Sheng; Sun, Xiao-Fei; Zhou, Hong; Xu, Qing

    2016-08-01

    Previous investigations have suggested that the activation of Th17 cells and/or deficiency of regulatory T cells (Tregs) are involved in the pathogenesis of liver fibrosis. The aim of the present study was to investigate the effect of rapamycin on immune responses in a carbon tetrachloride (CCl4)-induced murine liver fibrosis model. Liver fibrosis was induced by intraperitoneal administration with CCl4. Following injection of CCl4, the mice were treated intraperitoneally with rapamycin (1.25 mg/kg/day) for 8 weeks. Hematoxylin and eosin staining and Masson's trichrome staining were used for histological examination. The protein levels of forkhead/winged helix transcription factor P3, retinoic-acid-related orphan receptor (ROR)‑γt in liver tissue were determined by western blotting, the frequency of Th17 and Treg cells in the liver was evaluated by flow cytometry, and a suppression assay was measured by incorporating [3H]‑thymidine. In addition, to explore the effect of Tregs expanded with rapamycin on hepatic stellate cells (HSC), HSCs were co‑cultured with Tregs from rapamycin or phosphate‑buffered saline‑treated mice. It was found that rapamycin treatment led to a significant reduction in the number of Th17 cells and in the expression levels of ROR‑γt in the liver tissues. Simultaneously, the results of the present study showed a significant increase in the frequency of Tregs and a marked enhancement in the expression of forkhead/winged helix transcription factor P3 in the rapamycin‑treated mice. Furthermore, the Tregs in rapamycin‑treated mice had significantly higher suppressive effects, compared with the cells from mice treated with phospphate‑buffered saline. Consequently, rapamycin treatment prevented the development of CCl4-induced hepatic fibrosis, which was shown by its histological appearances. These results suggested that the immunosuppressive effect of rapamycin on liver fibrosis was associated with the suppression of hepatic

  2. Recombinant VP1, an Akt inhibitor, suppresses progression of hepatocellular carcinoma by inducing apoptosis and modulation of CCL2 production.

    Directory of Open Access Journals (Sweden)

    Tai-An Chen

    Full Text Available BACKGROUND: The application of viral elements in tumor therapy is one facet of cancer research. Recombinant capsid protein VP1 (rVP1 of foot-and-mouth disease virus has previously been demonstrated to induce apoptosis in cancer cell lines. Here, we aim to further investigate its apoptotic mechanism and possible anti-metastatic effect in murine models of hepatocellular carcinoma (HCC, one of the most common human cancers worldwide. METHODOLOGY/PRINCIPAL FINDINGS: Treatment with rVP1 inhibited cell proliferation in two murine HCC cell lines, BNL and Hepa1-6, with IC₅₀ values in the range of 0.1-0.2 µM. rVP1 also induced apoptosis in these cells, which was mediated by Akt deactivation and dissociation of Ku70-Bax, and resulted in conformational changes and mitochondrial translocation of Bax, leading to the activation of caspases-9, -3 and -7. Treatment with 0.025 µM rVP1, which did not affect the viability of normal hepatocytes, suppressed cell migration and invasion via attenuating CCL2 production. The production of CCL2 was modulated by Akt-dependent NF-κB activation that was decreased after rVP1 treatment. The in vivo antitumor effects of rVP1 were assessed in both subcutaneous and orthotopic mouse models of HCC in immune-competent BALB/c mice. Intratumoral delivery of rVP1 inhibited subcutaneous tumor growth as a result of increased apoptosis. Intravenous administration of rVP1 in an orthotopic HCC model suppressed tumor growth, inhibited intra-hepatic metastasis, and prolonged survival. Furthermore, a decrease in the serum level of CCL2 was observed in rVP1-treated mice. CONCLUSIONS/SIGNIFICANCE: The data presented herein suggest that, via inhibiting Akt phosphorylation, rVP1 suppresses the growth, migration, and invasion of murine HCC cells by inducing apoptosis and attenuating CCL2 production both in vitro and in vivo. Recombinant protein VP1 thus has the potential to be developed as a new therapeutic agent for HCC.

  3. Social stress-enhanced severity of Citrobacter rodentium-induced colitis is CCL2-dependent and attenuated by probiotic Lactobacillus reuteri.

    Science.gov (United States)

    Mackos, A R; Galley, J D; Eubank, T D; Easterling, R S; Parry, N M; Fox, J G; Lyte, M; Bailey, M T

    2016-03-01

    Psychological stressors are known to affect colonic diseases but the mechanisms by which this occurs, and whether probiotics can prevent stressor effects, are not understood. Because inflammatory monocytes that traffic into the colon can exacerbate colitis, we tested whether CCL2, a chemokine involved in monocyte recruitment, was necessary for stressor-induced exacerbation of infectious colitis. Mice were exposed to a social disruption stressor that entails repeated social defeat. During stressor exposure, mice were orally challenged with Citrobacter rodentium to induce a colonic inflammatory response. Exposure to the stressor during challenge resulted in significantly higher colonic pathogen levels, translocation to the spleen, increases in colonic macrophages, and increases in inflammatory cytokines and chemokines. The stressor-enhanced severity of C. rodentium-induced colitis was not evident in CCL2(-/-) mice, indicating the effects of the stressor are CCL2-dependent. In addition, we tested whether probiotic intervention could attenuate stressor-enhanced infectious colitis by reducing monocyte/macrophage accumulation. Treating mice with probiotic Lactobacillus reuteri reduced CCL2 mRNA levels in the colon and attenuated stressor-enhanced infectious colitis. These data demonstrate that probiotic L. reuteri can prevent the exacerbating effects of stressor exposure on pathogen-induced colitis, and suggest that one mechanism by which this occurs is through downregulation of the chemokine CCL2. PMID:26422754

  4. Effect of 3 amino 1,2,4 triazole administration on the early CCl4-induced ultrastructural alterations in rat liver.

    Science.gov (United States)

    Bernacchi, A. S.; de Castro, C. R.; de Ferreyra, E. C.; de Fenos, O. M.; Castro, J. A.

    1982-01-01

    CCl4 administration to rats caused at 3 and 6 h intense effects on the liver-cell endoplasmic reticulum such as dilatation, disorganization, detachment of ribosomes, development of extensive areas of smooth component (SER) and formation of myelin figures. 3 Amino 1,2,4 triazole administration (AT) at 3 and 6 h led to the formation of round small vesicles from the rough endoplasmic reticulum (RER), detachment of ribosomes, appearance of extensive areas of SER, appearance of elongated and distorted mitochondria with an increase in the number of peroxisomes. The administration of CCl4 to AT-pretreated animals led to a mutual cancellation of the effects on the RER, particularly remarkable at 3 h but still evident at 6 h; also, the formation of myelin figures was prevented. The other effects on cell ultrastructure exerted either by CCl4 or by AT were also observed with the combination of both chemicals. These observations reinforce the hypothesis about the need of either covalent binding of CCl4 metabolites to cellular constituents or lipid peroxidation, or both, in the origin of CCl4-induced alterations. Images Fig. 1 Fig. 2 Fig. 3 Fig. 4 Fig. 5 Fig. 6 Fig. 7 Fig. 8 Fig. 9 Fig. 10 PMID:7066182

  5. Hepatoprotective and antioxidant properties of marine halophyte Luminetzera racemosa bark extract in CCL4 induced hepatotoxicity

    Institute of Scientific and Technical Information of China (English)

    MurugesanGnanadesigan; SundaramRavikumar; SamuelJacobInbaneson

    2011-01-01

    Objective:To identify the hepatoprotective and antioxidant activity of Luminetzera racemosa (L. racemosa )bark extract. Methods:Wistar albino rats were divided into 6 groups:Group 1 served as control;Group 2 served as hepatotoxin (CCL4 treated) group;Group 3 served as positive control (Silymarin) treated groups;Group 4, 5 and 6 served as (100, 200 and 300 mg/kg bw p.o.) L. racemosa bark extract treated groups. Moreover, in vitro antioxidant indexes, including DPPH, hydroxyl radical scavenging activity (HRSA), NO, ferric reducing antioxidant power (FRAP), lipid hydroperoxide (LPO) and super oxide dismutase (SOD) were also analyzed in the bark extract. Results:The results suggested that, the level of serum glutamate oxyloacetic transaminase (SGOT), serum glutamic pyruvic transaminase (SGPT), alkaline phosphatise (ALP), bilurubin, cholesterol, sugar and lactate dehydrogenase (LDH) were significantly (P<0.05) increased in hepatotoxin treated rats when compared with the control group. But, the maximum reduction of SGOT [(225.36±13.65) IU/L], SGPT [(96.85±17.36) IU/L], ALP [(315.37±17.16) IU/L], bilirubin [(2.97±0.46) mg/dL], cholesterol [(163.73±17.54) mg/dL], sugar [(127.35±27.35) mg/dL] and LDH [(1 784.00±268.36) IU/L] were observed with 300 mg/kg bw of bark extract treated rats. Histopathological scores showed that, no visible changes were observed with high dose (300 mg/kg bw) of bark extract treated rats except mild fatty changes. The in vitro antioxidant assays showed that, the IC50 values were observed as (44.17±6.87)μg/mL, (42.45±2.81)μg/mL, (62.37±3.98)μg/mL, (54.24±3.09)μg/mL, (87.25±5.90)μg/mL and (71.54±5.42)μg/mL for DPPH, HRSA, NO, FRAP, LPO and SOD radical scavenging activities, respectively. Conclusions:The hepatoprotective and antioxidant activities of the bark extract might be to the presence of unique chemical classes such as flavonoids, alkaloids and polyphenols.

  6. Suppressive effects of 17β-estradiol on hepatic fibrosis in CCl4-induced rat model

    Institute of Scientific and Technical Information of China (English)

    Qing-Hua Liu; Ding-Guo Li; Xin Huang; Chun-Hua Zong; Qin-Fang Xu; Han-Ming Lu

    2004-01-01

    AIM: To investigate the pathway via which 17β-estradiol (β-Est) exerts suppressive effects on rat hepatic fibrosis.METHODS: In vivo study was done in CCl4-induced female hepatofibrotic rats. Fibrosis-suppressive effect of β-Est rat models. Six weeks after the treatment, all the rats were sacrificed and specimens of serum or liver tissue were collected for the studies. Serum liver enzymes,fibrosis markers and estradiol levels were determined by standard enzymatic methods, ELISA and RIA, respectively.Degrees of fibrosis and areas of hepatic stellate cells (HSCs) positive for alpha-smooth muscle actin (α-SMA) in the liver were determined by van Gieson (VG) stain and immunohistochemistry.In vitro studies, HSCs were isolated by a combination of pronase-collagenase perfusion and density gradient centrifugation. First-passage HSCs were randomly divided into 10 groups, and different concentrations of β-Est, 2-hydroxyestradiol (2OHE) or 2-methoxyestradiol (2MeOE) were separately added to the cell groups. After incubation for 72 h, the degree of cell proliferation, collagen production, α-SMA or estrogen receptor (ER) expression was determined by MTT assay, ELISA and immunohistochemistry,respectively.RESULTS: β-Est treatment reduced aspartate aminotransferase (AST), alanine aminotransferase (ALT), hyaluronic acid (HA) and type Ⅳ collagen (C Ⅳ) in sera, suppressed hepatic collagen content, decreased the areas of HSCs positive for α-SMA significantly in both intact and ovariectomized female hepatofibrotic rats. There was a negative correlation between the percentage of fibrotic area of liver tissue and the serum estradiol level; the calculated correlation coefficient was -0.57 (P<0.01). β-Est and its metabolites concentration-dependently (10-9 mol/L-10-7 mol/L) inhibited HSC proliferation and collagen synthesis. At the concentration of 10-7 mol/L, they could inhibit α-SMA expression. The order of potency was 2MeOE>2OHE>β-Est.CONCLUSION: β-Est may suppress

  7. Laboratory Building.

    Energy Technology Data Exchange (ETDEWEB)

    Herrera, Joshua M. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2015-03-01

    This report is an analysis of the means of egress and life safety requirements for the laboratory building. The building is located at Sandia National Laboratories (SNL) in Albuquerque, NM. The report includes a prescriptive-based analysis as well as a performance-based analysis. Following the analysis are appendices which contain maps of the laboratory building used throughout the analysis. The top of all the maps is assumed to be north.

  8. Visualization Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — FUNCTION: Evaluates and improves the operational effectiveness of existing and emerging electronic warfare systems. By analyzing and visualizing simulation results...

  9. Dynamics Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — The Dynamics Lab replicates vibration environments for every Navy platform. Testing performed includes: Flight Clearance, Component Improvement, Qualification, Life...

  10. Chemistry Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — Purpose: To conduct fundamental studies of highway materials aimed at understanding both failure mechanisms and superior performance. New standard test methods are...

  11. Colonic Pro-inflammatory Macrophages Cause Insulin Resistance in an Intestinal Ccl2/Ccr2-Dependent Manner.

    Science.gov (United States)

    Kawano, Yoshinaga; Nakae, Jun; Watanabe, Nobuyuki; Kikuchi, Tetsuhiro; Tateya, Sanshiro; Tamori, Yoshikazu; Kaneko, Mari; Abe, Takaya; Onodera, Masafumi; Itoh, Hiroshi

    2016-08-01

    High-fat diet (HFD) induces low-grade chronic inflammation and insulin resistance. However, little is known about the mechanism underlying HFD-induced chronic inflammation in peripheral insulin-responsive tissues. Here, we show that colonic pro-inflammatory macrophages regulate insulin sensitivity under HFD conditions. To investigate the pathophysiological role of colonic macrophages, we generated macrophage-specific chemokine (C-C Motif) receptor 2 (Ccr2) knockout (M-Ccr2KO) and intestinal epithelial cell-specific tamoxifen-inducible Ccl2 knockout (Vil-Ccl2KO) mice. Both strains exhibited similar body weight to control under HFD. However, they exhibited decreased infiltration of colonic pro-inflammatory macrophages, decreased intestinal permeability, and inactivation of the colonic inflammasome. Interestingly, they showed significantly improved glucose tolerance and insulin sensitivity with decreased chronic inflammation of adipose tissue. Therefore, inhibition of pro-inflammatory macrophage infiltration prevents HFD-induced insulin resistance and could be a novel therapeutic approach for type 2 diabetes. PMID:27508875

  12. Accelerated CCl4-induced liver fibrosis in Hjv-/- mice, associated with an oxidative burst and precocious profibrogenic gene expression.

    Directory of Open Access Journals (Sweden)

    Giada Sebastiani

    Full Text Available Hereditary hemochromatosis is commonly associated with liver fibrosis. Likewise, hepatic iron overload secondary to chronic liver diseases aggravates liver injury. To uncover underlying molecular mechanisms, hemochromatotic hemojuvelin knockout (Hjv-/- mice and wild type (wt controls were intoxicated with CCl(4. Hjv-/- mice developed earlier (by 2-4 weeks and more acute liver damage, reflected in dramatic levels of serum transaminases and ferritin and the development of severe coagulative necrosis and fibrosis. These responses were associated with an oxidative burst and early upregulation of mRNAs encoding α1-(I-collagen, the profibrogenic cytokines TGF-β1, endothelin-1 and PDGF and, notably, the iron-regulatory hormone hepcidin. Hence, CCl4-induced liver fibrogenesis was exacerbated and progressed precociously in Hjv-/- animals. Even though livers of naïve Hjv-/- mice were devoid of apparent pathology, they exhibited oxidative stress and immunoreactivity towards α-SMA antibodies, a marker of hepatic stellate cells activation. Furthermore, they expressed significantly higher (2-3 fold vs. wt, p<0.05 levels of α1-(I-collagen, TGF-β1, endothelin-1 and PDGF mRNAs, indicative of early fibrogenesis. Our data suggest that hepatic iron overload in parenchymal cells promotes oxidative stress and triggers premature profibrogenic gene expression, contributing to accelerated onset and precipitous progression of liver fibrogenesis.

  13. Protective effect of red-stemmed type of Ipomoea aquatica Forsk against CCl4-induced oxidative damage in mice.

    Science.gov (United States)

    Hirai, Shizuka; Ishibuchi, Toyohito; Watabe, Shinpei; Makita, Miki; Kishida, Chiaki; Takagaki, Michiko; Kurauchi, Nobuyuki; Egashira, Yukari

    2011-01-01

    Water spinach (Ipomoea aquatica Forsk; I. aquatica) of the green-stemmed type (green type) is widely consumed, but there also exists a red-stemmed variety (red type). In the present study, the antioxidant capacity of the red type was compared to that of the green type in carbon tetrachloride (CCl(4))-treated mice. CCl(4)-induced thiobarbituric acid reactive substrate (TBARS) formation in the liver was significantly suppressed in mice fed 5% red-type I. aquatica, while the green type showed no effect. Hydrophobic oxygen radical absorbance capacity (H-ORAC(FL)) in the red type showed a lower level than that in the green type; however, lipophilic ORAC (L-ORAC(FL)) and total-ORAC(FL) levels were significantly higher in the red type than in the green type. α-Tocopherol, anthocyanidin/proanthocyanidin, and β-carotene contents were all significantly higher in the red type than in the green type. These results suggest that the wild red-type I. aquatica contains certain lipophilic components that exert antioxidant capacities not only in vitro but also in vivo. Such effective components in the red type would be beneficial phytochemicals for suppressing several diseases related to oxidative stress. PMID:22041914

  14. Smac Mimetic-Induced Upregulation of CCL2/MCP-1 Triggers Migration and Invasion of Glioblastoma Cells and Influences the Tumor Microenvironment in a Paracrine Manner

    Directory of Open Access Journals (Sweden)

    Carina Lindemann

    2015-06-01

    Full Text Available Second mitochondria-derived activator of caspase (Smac mimetics are considered as promising anticancer therapeutics that are currently under investigation in early clinical trials. They induce apoptosis by antagonizing inhibitor of apoptosis proteins, which are frequently overexpressed in cancer. We previously reported that Smac mimetics, such as BV6, additionally exert non-apoptotic functions in glioblastoma (GBM cells by stimulating migration and invasion in a nuclear factor kappa B (NF-κB-dependent manner. Because NF-κB target genes mediating these effects are largely unknown, we performed whole-genome expression analyses. Here, we identify chemokine (C-C motif ligand 2 (CCL2 as the top-listed NF-κB-regulated gene being upregulated upon BV6 treatment in GBM cells. BV6-induced upregulation and secretion of CCL2 are required for migration and invasion of GBM cells because knockdown of CCL2 in GBM cells abolishes these effects. Co-culture experiments of GBM cells with non-malignant astroglial cells reveal that BV6-stimulated secretion of CCL2 by GBM cells into the supernatant triggers migration of astroglial cells toward GBM cells because CCL2 knockdown in BV6-treated GBM cells impedes BV6-stimulated migration of astroglial cells. In conclusion, we identify CCL2 as a BV6-induced NF-κB target gene that triggers migration and invasion of GBM cells and exerts paracrine effects on the GBM's microenvironment by stimulating migration of astroglial cells. These findings provide novel insights into the biological functions of Smac mimetics with important implications for the development of Smac mimetics as cancer therapeutics.

  15. Comparative Study of Circulating MMP-7, CCL18, KL-6, SP-A, and SP-D as Disease Markers of Idiopathic Pulmonary Fibrosis

    OpenAIRE

    Hamai, Kosuke; Iwamoto, Hiroshi; Ishikawa, Nobuhisa; Horimasu, Yasushi; Masuda, Takeshi; Miyamoto, Shintaro; Nakashima, Taku; Ohshimo, Shinichiro; Fujitaka, Kazunori; Hamada, Hironobu; Hattori, Noboru; Kohno, Nobuoki

    2016-01-01

    Background. Recent reports indicate that matrix metalloproteinase-7 (MMP-7) and CC-chemokine ligand 18 (CCL18) are potential disease markers of idiopathic pulmonary fibrosis (IPF). The objective of this study was to perform direct comparisons of these two biomarkers with three well-investigated serum markers of IPF, Krebs von den Lungen-6 (KL-6), surfactant protein-A (SP-A), and SP-D. Methods. The serum levels of MMP-7, CCL18, KL-6, SP-A, and SP-D were evaluated in 65 patients with IPF, 31 pa...

  16. Cultured Mycelium Cordyceps sinensis allevi¬ates CCl4-induced liver inflammation and fibrosis in mice by activating hepatic natural killer cells

    OpenAIRE

    Peng, Yuan; Huang, Kai; Shen, Li; Tao, Yan-Yan; Liu, Cheng-Hai

    2015-01-01

    Aim: Recent evidence shows that cultured mycelium Cordyceps sinensis (CMCS) effectively protects against liver fibrosis in mice. Here, we investigated whether the anti-fibrotic action of CMCS was related to its regulation of the activity of hepatic natural killer (NK) cells in CCl4-treated mice. Methods: C57BL/6 mice were injected with 10% CCl4 (2 mL/kg, ip) 3 times per week for 4 weeks, and received CMCS (120 mg·kg−1·d−1, ig) during this period. In another part of experiments, the mice were ...

  17. CCL21/CCR7 up-regulate vascular endothelial growth factor-D expression via ERK pathway in human non-small cell lung cancer cells

    OpenAIRE

    Sun, Limei; Zhang, Qingfu; LI Yang; Tang, Na; Qiu, Xueshan

    2015-01-01

    Lymphangiogenesis has received considerable attention and become a new research hotspot of tumor metastasis. Recently, C-C chemokine receptor 7 (CCR7) is known to promote metastasis of non-small cell lung cancer (NSCLC) cells into lymph nodes. In this study, we investigated the relationship between CCL21/CCR7 and the lymphangiogenic factor vascular endothelial growth factor (VEGF)-D in human lung cancer cells and its impact on patients’ prognosis. We found that CCL21/CCR7 increase the express...

  18. The fate of atmospheric phosgene and the stratospheric chlorine loadings of its parent compounds: CCl4, C2Cl4, C2HCL3, CH3CCl3, and CHCl3

    Science.gov (United States)

    Kindler, T. P.; Chameides, W. L.; Wine, P. H.; Cunnold, D. M.; Alyea, F. N.; Franklin, J. A.

    1995-01-01

    A study of the tropospheric and stratospheric cycles of phosgene is carried out to determine its fate and ultimate role in controlling the ozone depletion potentials of its parent compounds. Tropospheric phosgene is produced from the OH-initiated oxidation of C2Cl4, CH3CCl3, CHCl3, and C2HCl3. Simulations using a two-dimensional model indicate that these processes produce about 90 pptv/yr of tropospheric phosgene with an average concentration of about 18 pptv, in reasonable agreement with observations. We estimate a residence time of about 70 days for tropospheric phosgene, with the vast majority being removed by hydrolysis in cloudwater. Only about 0.4% of the phosgene produced in the troposphere avoids wet removal and is transported to the stratosphere, where its chlorine can be released to participate in the catalytic destruction of ozone. Stratospheric phosgene is produced from the photochemical degradation of CCl4, C2Cl4, CHCl3, and CH3CCl3 and is removed by photolysis and downward transport to the troposphere. Model calculations, in good agreement with observations, indicate that these processes produce a peak stratospheric concentration of about 25-30 pptv at an altitude of about 25 km. In contrast to tropospheric phosgene, stratospheric phosgene is found to have a lifetime against photochemical removal of the order of years. As a result, a significant portion of the phosgene that is produced in the stratosphere is ultimately returned to the troposphere, where it is rapidly removed by clouds. This phenomenon effectively decreases the amount of reactive chlorine injected into the stratosphere and available for ozone depletion from phosgene's parent compounds. A similar phenomenon due to the downward transport of stratospheric COFCl produced from CFC-11 is estimated to cause a 7% decrease in the amount of reactive chlorine injected into the stratosphere from this compound. Our results are potentially sensitive to a variety of parameters, most notably the rate

  19. Laboratory Tests

    Science.gov (United States)

    ... Medical Devices Radiation-Emitting Products Vaccines, Blood & Biologics Animal & ... or conditions. What are lab tests? Laboratory tests are medical procedures that involve testing samples of blood, urine, or other tissues or ...

  20. 131I治疗前后Graves病患者CXCL10、CCL22水平表达变化的研究%Changes of CXCL10 and CCL22 in patients with Graves' disease after radioactive iodine therapy

    Institute of Scientific and Technical Information of China (English)

    谭淑君; 李春北; 李铭

    2014-01-01

    Objective To detect the changes of CXCL10 and CCL22 in patients with Graves' disease (GD) after radioactive iodine therapy. Methods Forty-six patients with GD were enrolled into our study (GD group). An-other 40 healthy people were used as normal controls (control group). CXCL10 and CCL22 were detected by ELIAS. Th1 and Th2 cells was detected by flow cytometry. Results The expression levels of CXCL10 and CCL22 was (16.8±6.3) ng/L and (150.4±22.6) ng/L in control group, (62.4±13.2) ng/L and (161.3±25.4) ng/L in GD group (P0.05)。两组之间CXCL10/CCL22比值差异也有统计学意义(P0.05)。两组之间Th1/Th2比值差异也有统计学意义(P<0.05)。结论 Graves病患者中存在CXCL10和CCL22表达水平的升高,131I治疗后可降低CXCL10和CCL22表达水平,调节Th1/Th2细胞的失衡,CXCL10和CCL22因子的检测有可能作为131I治疗反应性的一个指标。

  1. CCR4 C1014T and CCL22 C16A genetic variations in the Iranian patients with colorectal adenocarcinoma.

    Directory of Open Access Journals (Sweden)

    Nasrollah Erfani

    2014-12-01

    Full Text Available C-C motif chemokine 22 (CCL22 C16A genetic variation (rs4359426 and C-C chemokine receptor type 4 (CCR4 C1014T variation (rs2228428 have been suggested to affect the expression level of the cognate proteins. Here we tried to investigate the plausible association of these polymorphisms with development of colorectal cancer. 165 patients with colorectal adenocarcinoma (age 54.4±13.4 and 150 age- and sex-matched healthy individuals were enrolled. Genotyping was performed by PCR-RFLP methods. Results indicated the frequency of 16A allele in CCL22 gene to be 31/330(9.4% and 33/300(11% in patients and controls, respectively (p=0.59. The frequencies of CC, CA, and AA genotypes at this locus were not significantly different between patients and controls (135/165; 81.8%, 29/165; 17.6%, 1/165; 0.6% in the patients and 121/150; 80.1%, 25/150; 16.6% and 4/150; 2.6% in the control group, p= 0.34. At the locus 1014 in CCR4, T allele was observed with the frequency of 107/330 (32.4% and 83/300 (27.7% in patients and controls, respectively (p=0.22. Analyses indicated no significant differences in the frequencies of CC, CT and TT genotypes at this locus between patients and controls (77/165; 46.7%, 69/165; 41.8% and 19/165; 11.5%; versus 83/150; 55.0%, 51/150; 33.8% and 16/150; 10.6%, respectively, p= 0.29. The presence of individual genotypes was not associated with clinicopathological characteristics of the disease, including tumor size, tumor grade and LN involvement (all with p<0.05. These findings collectively suggested that CCR4 C1014T and CCL22 C16A genetic variations were neither associated with the risk, nor with the progression of colorectal cancer in Iranian population.

  2. Tumor-derived CCL-2 and CXCL-8 as possible prognostic markers of breast cancer: correlation with estrogen and progestrone receptor phenotyping.

    Science.gov (United States)

    Ghoneim, H M; Maher, Sara; Abdel-Aty, Asmaa; Saad, A; Kazem, A; Demian, S R

    2009-01-01

    Prognosis of breast cancer is believed to be a multifactorial process best achieved by complex factors including host and tumor-derived biomarkers together with traditional clinicopathological parameters and tumor histologic markers. The present study aimed at evaluating the prognostic significance of chemokine ligand-2 (CCL-2) and interleukin-8 (CXCL-8) expression in extracts of breast carcinomas through correlation with clinicopathological aspects as well as estrogen receptor (ER) and progesterone receptor (PR) phenotyping. The study was conducted on 30 Egyptian breast cancer patients diagnosed by fine needle aspiration cytology (FNAC) and subjected to modified radical mastectomy. Excised tissues were used to prepare tissue sections and extracts for histopathological and immunohistochemical studies. Expression of CCL-2 and CXCL-8 was determined by enzyme-linked immunosorbent assay (ELISA). 26 patients had invasive ductal carcinoma, grades II and III with metastasis to axillary lymph nodes and ER and PR positive phenotype. Expression of CCL-2 and CXCL-8 was significantly influenced by patient's age, menopausal status, nodal involvement, tumor grade and the ER phenotype. In contrast, it was not affected by either tumor size or PR staining pattern. Both chemokines correlated positively to each other and to tumor grade and negatively to age, menopausal status of patients and ER phenotyping. It is concluded that the angiogenic chemokine CXCL-8 and the macrophage chemoattractant CCL-2 might be useful prognostic markers where their routine follow up might be of importance in assessment of tumor aggressiveness in clinical settings. PMID:22059352

  3. Evaluation of the Effects of Some Brazilian Medicinal Plants on the Production of TNF-α and CCL2 by THP-1 Cells

    Directory of Open Access Journals (Sweden)

    Grasielle S. Gusman

    2015-01-01

    Full Text Available Several plant species are traditionally used in Brazil to treat various inflammatory diseases. Tumor necrosis factor- (TNF- α and chemokine (C-C motif ligand 2 (CCL2 are key inflammatory mediators in diseases like rheumatoid arthritis and atherosclerosis, respectively; nevertheless, only a few extracts have been assayed against these targets. We herein report the effect of 19 plant extracts on TNF-α and CCL2 release by lipopolysaccharide- (LPS- stimulated THP-1 cells, a human monocytic leukemia cell line, along with their radical scavenging activity on DPPH. The extracts of Caryocar brasiliense, Casearia sylvestris, Coccoloba cereifera, and Terminalia glabrescens inhibited TNF-α production in a concentration-dependent manner. Fractionation of these extracts potentiated the anti-TNF-α effect, which was shown to concentrate in polar fractions, mainly composed by polyphenols. Significant CCL2 inhibition was elicited by Lippia sidoides and Terminalia glabrescens extracts, whose fractionation resulted in highly active low polar fractions. All assayed extracts showed strong radical scavenging activity, but antioxidant activity did not correlate with inhibition of TNF-α or CCL2 production. Our results allowed identifying extracts with selective capacity to block cytokine production; therefore, further purification of these extracts may yield molecules that could be useful in the treatment of chronic inflammatory diseases.

  4. Effect of pumpkin seed (Cucurbita pepo) protein isolate on the activity levels of certain plasma enzymes in CCl4-induced liver injury in low-protein fed rats.

    Science.gov (United States)

    Nkosi, C Z; Opoku, A R; Terblanche, S E

    2005-04-01

    The effects of pumpkin seed (Cucurbita pepo) protein isolate on the activity levels of lactate dehydrogenase (LD), alanine transaminase (ALT), aspartate transaminase (AST) and alkaline phosphatase (ALP) against carbon tetrachloride (CCl4)-induced acute liver injury in low-protein fed rats were investigated. A group of male Sprague-Dawley rats maintained on a low-protein diet for 5 days were divided into three subgroups. Two subgroups were injected with carbon tetrachloride and the other group with an equivalent amount of olive oil. Two hours after CCl4 intoxication one of the two subgroups was administered with pumpkin seed protein isolate. All three subgroups of rats were maintained on the low-protein diet for the duration of the investigation. Groups of rats from the different subgroups were killed at 24, 48 and 72 h after their respective treatments. After 5 days on the low-protein diet the activity levels of all four enzymes were significantly higher than their counterparts on a normal balanced diet. CCl4 intoxication resulted in significant increases in the activity levels of all four enzymes investigated. The administration of pumpkin seed protein isolate after CCl4 intoxication resulted in significantly reduced activity levels of all four enzymes. It is concluded that pumpkin seed protein isolate administration was effective in alleviating the detrimental effects associated with protein malnutrition. PMID:16041732

  5. Glutamine inhibits CCl4 induced liver fibrosis in mice and TGF-β1 mediated epithelial-mesenchymal transition in mouse hepatocytes.

    Science.gov (United States)

    Shrestha, Nirajan; Chand, Lokendra; Han, Myung Kwan; Lee, Seung Ok; Kim, Chan Young; Jeong, Yeon Jun

    2016-07-01

    Glutamine, traditionally a non-essential amino acid, now has been considered as essential in serious illness and injury. It is a major precursor for glutathione synthesis. However, the anti-fibrotic effect of glutamine and its molecular mechanism in experimental liver fibrosis have not been explored. In the present study we aimed to examine the potential role of glutamine in carbon tetrachloride (CCl4) induced liver fibrosis and TGF-β1 mediated epithelial mesenchymal transition (EMT) and apoptosis in mouse hepatocytes. Liver fibrosis was induced by intraperitoneal injection of CCl4 three times a week for 10 weeks. Glutamine treatment effectively attenuated liver injury and oxidative stress. Collagen content was significantly decreased in liver sections of glutamine treated mice compared to CCl4 model mice. Furthermore, glutamine decreased expression level of α-SMA and TGF-β in liver tissue. Our in vitro study showed that TGF-β1 treatment in hepatocytes resulted in loss of E-cadherin and increased expression of mesenchymal markers and EMT related transcription factor. In addition, TGF-β1 increased the expression of apoptotic markers. However, glutamine interestingly suppressed TGF-β1 mediated EMT and apoptosis. In conclusion, our results suggest that glutamine ameliorates CCl4 induced liver fibrosis and suppresses TGF-β1 induced EMT progression and apoptosis. PMID:27137983

  6. In vivo antioxidant and hepatoprotective potential of Glycyrrhiza glabra extract on carbon tetra chloride (CCl4 induced oxidative-stress mediated hepatotoxicity

    Directory of Open Access Journals (Sweden)

    Varsha Sharma

    2014-02-01

    Results: The results suggest that, the crude extract of root of G. glabra at the doses of 300 and 600mg/kg body wt. expressed significant hepatoprotective potential against CCl4 induced oxidative stress mediated hepatotoxicity in student ‘t’ test (p [Int J Res Med Sci 2014; 2(1.000: 314-320

  7. Essential roles of the interaction between cancer cell-derived chemokine, CCL4, and intra-bone CCR5-expressing fibroblasts in breast cancer bone metastasis.

    Science.gov (United States)

    Sasaki, Soichiro; Baba, Tomohisa; Nishimura, Tatsunori; Hayakawa, Yoshihiro; Hashimoto, Shin-Ichi; Gotoh, Noriko; Mukaida, Naofumi

    2016-08-01

    From a murine breast cancer cell line, 4T1, we established a subclone, 4T1.3, which consistently metastasizes to bone upon its injection into the mammary fat pad. 4T1.3 clone exhibited similar proliferation rate and migration capacity as the parental clone. However, the intra-bone injection of 4T1.3 clone caused larger tumors than that of the parental cells, accompanied with increases in fibroblast, but not osteoclast or osteoblast numbers. 4T1.3 clone displayed an enhanced expression of a chemokine, CCL4, but not its specific receptor, CCR5. CCL4 shRNA-transfection of 4T1.3 clone had few effects on its in vitro properties, but reduced the tumorigenicity arising from the intra-bone injection. Moreover, intra-bone injection of 4T1.3 clone caused smaller tumors in mice deficient in CCR5 or those receiving CCR5 antagonist than in wild-type mice. The reduced tumor formation was associated with attenuated accumulation of CCR5-positive fibroblasts expressing connective tissue growth factor (CTGF)/CCN2. Tumor cell-derived CCL4 could induce fibroblasts to express CTGF/CCN2, which could support 4T1.3 clone proliferation under hypoxic culture conditions. Thus, the CCL4-CCR5 axis can contribute to breast cancer metastasis to bone by mediating the interaction between cancer cells and fibroblasts in bone cavity. PMID:27177471

  8. Quantum yield of Cl∗ (21/2) production in the gas phase photolysis of CCl4 in the ultraviolet

    Indian Academy of Sciences (India)

    Manish Tak; Manabendra Chandra; Dulal Senapati; Puspendu K Das

    2006-07-01

    In this paper, we have probed the dynamics of chlorine atom production from the gas phase photodissociation of carbon tetrachloride at 222 and 235 nm. The quantum yield, * of Cl∗ (21/2) production has been determined by probing the nascent concentrations of both excited (21/2) and ground state (23/2) chlorine atoms by suitable resonance-enhanced multiphoton ionization (REMPI) detection schemes. Although at the photolysis wavelengths the absorption of carbon tetrachloride is weak, significant amounts of Cl∗ are produced. Surprisingly, the quantum yield of Cl∗ production does not follow the absorption spectrum closely, which gives rise to the possibility of an indirect dissociation mechanism present in CCl4 along with direct dissociation at these ultraviolet wavelengths.

  9. Dynamics of intermolecular interactions in CCl4via the isotope effect by femtosecond time-resolved spectroscopy.

    Science.gov (United States)

    Konarska, Jadwiga; Gadomski, Wojciech; Ratajska-Gadomska, Bożena; Polok, Kamil; Pudłowski, Grzegorz; Kardaś, Tomasz M

    2016-06-21

    We report our study on the ultrafast dynamics of intermolecular interactions in liquid CCl4. A transient transmission time domain signal, obtained in the 40 ps delay range, exhibits beating at the difference frequency of the totally symmetric stretching vibrations of the tetrachloride isotopologues. We show that the spectra obtained as the windowed Fourier transform of different parts of the time domain signal in the range of this totally symmetric vibration, split due to the isotope effect, carry the information about the dynamics of the coherently excited, coupled molecules. We use a simple theoretical model in order to prove that the intermolecular interaction influences the relative amplitudes of the isotopologue peaks in the spectrum. Moreover, we demonstrate that the pump induced coherence in the system leads to additional strengthening of the interaction, which can be observed in the spectra obtained from the experimental time domain signal. PMID:27244535

  10. Effects of Biphenyldimethyl-dicarboxylate Administration Alone or Combined with Silymarin in the CCL4 Model of Liver Fibrosis in Rats

    Directory of Open Access Journals (Sweden)

    Omar M. E. Abdel-Salam

    2007-01-01

    Full Text Available The effect of biphenyldimethyldicarboxylate (DDB, a synthetic compound, in use for the treatment of chronic hepatitis was studied on hepatic injury caused in rats by administration of carbon tetrachloride (CCl4. Starting at time of administration of the first dose of CCl4, rats received DDB at four dose levels (3, 15, 75 or 375 mg/kg, silymarin (22 mg/kg, a combination of DDB (75 mg/kg and silymarin (22 mg/kg or saline (control once orally daily for 30 days. The administration of DDB in CCl4-treated rats at 75 or 375 mg/kg resulted in 61.2-76.2% decrease in alanine aminotransferase (ALT and 46.9-60.8% decrease in aspartate aminotransferase (AST, respectively compared with the CCl4 control group. Silymarin treatment resulted in 34.6 and 30% decrease in ALT and AST, while DDB (75 mg/kg combined with silymarin (22 mg/kg resulted in 58.2 and 31% decrease in ALT and AST, respectively. Serum creatinine increased by 50% by DDB at 375 mg/kg. After treatment with DDB at 75 or 375 mg/kg or DDB combined with silymarin, the development of liver necrosis and fibrosis caused by CCl4 was markedly reduced, while after DDB combined with silymarin no DNA aneuploid cells could be observed. The decrease in glycogen and protein contents in hepatocytes caused by CCl4 was markedly prevented by co-treatment with DDB at 75 or 375 mg/kg or DDB combined with silymarin. It is concluded that in the model of hepatic injury caused by chronic administration of CCl4 in rats, the synthetic compound DDB, limits hepatocellular injury and exerts antifibrotic effect. Better improvement in protein, DNA, mucopolysaccharide content was seen after both DDB and silymarin compared to DDB alone. It is suggested, therefore, that DDB alone or in combination with silymarin might prove of benefit in the therapy of chronic liver disease. Monitoring of kidney functions in patients taking DDB is warranted.

  11. Role of estrogen receptor β selective agonist in ameliorating portal hypertension in rats with CCl4-induced liver cirrhosis

    Science.gov (United States)

    Zhang, Cheng-Gang; Zhang, Bin; Deng, Wen-Sheng; Duan, Ming; Chen, Wei; Wu, Zhi-Yong

    2016-01-01

    AIM: To investigate the role of diarylpropionitrile (DPN), a selective agonist of estrogen receptor β (ERβ), in liver cirrhosis with portal hypertension (PHT) and isolated hepatic stellate cells (HSCs). METHODS: Female Sprague-Dawley rats were ovariectomized (OVX), and liver cirrhosis with PHT was induced by CCl4 injection. DPN and PHTPP, the selective ERβ agonist and antagonist, were used as drug interventions. Liver fibrosis was assessed by hematoxylin and eosin (HE) and Masson’s trichrome staining and by analyzing smooth muscle actin expression. Hemodynamic parameters were determined in vivo using colored microspheres technique. Protein expression and phosphorylation were determined by immunohistochemical staining and Western blot analysis. Messenger RNA levels were analyzed by quantitative real-time polymerase chain reaction (qRT-PCR). Collagen gel contraction assay was performed using gel lattices containing HSCs treated with DPN, PHTPP, or Y-27632 prior to ET-1 addition. RESULTS: Treatment with DPN in vivo greatly lowered portal pressure and improved hemodynamic parameters without affecting mean arterial pressure, which was associated with the attenuation of liver fibrosis and intrahepatic vascular resistance (IHVR). In CCl4-treated rat livers, DPN significantly decreased the expression of RhoA and ROCK II, and even suppressed ROCK II activity. Moreover, DPN remarkedly increased the levels of endothelial nitric oxide synthase (eNOS) and phosphorylated eNOS, and promoted the activities of protein kinase G (PKG), which is an NO effector in the liver. Furthermore, DPN reduced the contractility of activated HSCs in the 3-dimensional stress-relaxed collagen lattices, and decreased the ROCK II activity in activated HSCs. Finally, in vivo/in vitro experiments demonstrated that MLC activity was inhibited by DPN. CONCLUSION: For OVX rats with liver cirrhosis, DPN suppressed liver RhoA/ROCK signal, facilitated NO/PKG pathways, and decreased IHVR, giving rise to

  12. [Pharmacokinetics of lidocaine and its metabolites in dog. Comparison between normal and CCl4-induced hepatic lesion].

    Science.gov (United States)

    Yamane, J

    1989-09-01

    Pharmacokinetic analysis of lidocaine (Lid) and its metabolites, monoethylglycinexylidide (MEGX) and glycinexylidide (GX), was performed in a dog bearing carbon tetrachloride (CCl4, 0.75 ml/kg ip)-induced acute hepatitis. Following pentobarbital sodium (25 mg/kg iv) anesthesia, lidocaine hydrochloride (2.5 mg/kg iv) was given and arterial blood was drawn 2, 5, 10, 15, 30, 45, 60, 90, and 120 min after administration. Lid and its metabolites in plasma were extracted with chloroform-hexane-isopropanol (60 : 30 : 10), and organic layer was dried down at 50 degrees C under N2. The residue was dissolved in 50mM phosphoric acid and subjected to HPLC analysis. 4-compartment model was introduced to analyze pharmacokinetic parameters, and which gave the most reasonable fit with actual results. Control experiment was carried out using identical dog with acute hepatitis. The following results were given: 1) Elimination of Lid was slightly depressed, but T1/2 was not altered. Plasma level of Lid was kept higher. 2) As for MEGX, the formation was depressed, and upto 23 min after Lid administration, MEGX concentration in the dog with acute hepatitis was lower than that of control, but after 23 min it was vice versa. 3) As for GX, the formation was depressed, but the elimination was not affected. In the dog with CCl4-induced hepatitis, metabolism of Lid was suppressed, and which resulted in maintaining a relatively higher levels of Lid and MEGX concentration in plasma. These results suggested that care should be taken to avoid acute poisoning with Lid especially in patients with acute hepatitis. PMID:2489793

  13. CH3Cl, CH2Cl2, CHCl3, and CCl4: Infrared spectra, radiative efficiencies, and global warming potentials

    Science.gov (United States)

    Wallington, Timothy J.; Pivesso, Bruno Pasquini; Lira, Alane Moura; Anderson, James E.; Nielsen, Claus Jørgen; Andersen, Niels Højmark; Hodnebrog, Øivind

    2016-05-01

    Infrared spectra for the title compounds were measured experimentally in 700 Torr of air at 295 K and systematically modeled in B3LYP, M06-2X and MP2 calculations employing various basis sets. Calibrated infrared spectra over the wavenumber range 600-3500 cm-1 are reported and combined with literature data to provide spectra for use in experimental studies and radiative transfer calculations. Integrated absorption cross sections are (units of cm-1 molecule-1): CH3Cl, 660-780 cm-1, (3.89±0.19)×10-18; CH2Cl2, 650-800 cm-1, (2.16±0.11)×10-17; CHCl3, 720-810 cm-1, (4.08±0.20)×10-17; and CCl4, 730-825 cm-1, (6.30±0.31)×10-17. CH3Cl, CH2Cl2, CHCl3, and CCl4 have radiative efficiencies of 0.004, 0.028, 0.070, and 0.174 W m-2 ppb-1 and global warming potentials (100 year horizon) of 5, 8, 15, and 1775, respectively. Quantum chemistry calculations generally predict larger band intensities than the experimental values. The best agreement with experiments is obtained in MP2(Full) calculations employing basis sets of at least triple-zeta quality augmented by diffuse functions. The B3LYP functional is found ill-suited for calculating vibrational frequencies and infrared intensities of halocarbons.

  14. CCL2-2518 A/G and CCR2 190 A/G do not influence the outcome of hepatitis C virus infection in the Spanish population

    Institute of Scientific and Technical Information of China (English)

    MA Montes-Cano; JR García-Lozano; J Aguilar-Reina; M Romero-Gómez; N Barroso; A Nú(n)ez-Roldán; MF González-Escribano

    2007-01-01

    AIM: To assess whether CCL2 or interactions between this chemokine and its receptor (CCR2) are associated with outcomes of chronic hepatitis C and with responses to antiviral therapy.METHODS: Two hundred and eighty-four patients with chronic hepatitis C and 193 non-infected matched controls were included in this study. Patients were categorized according to their Scheuer score of hepatic fibrosis as F0-F2 (n = 202) or F3-F4 (n = 82) and according to their response to anti-Hepatitis C virus (HCV) therapy as sustained response (SR, n = 101) or non-sustained response (NSR, n = 98). Genotyping of the -2518 (A/G) CCL2 was performed using PCR-RFLP,genotyping of the 190 (A/G) CCR2 using a PCR-ARMS system, and genotyping of the rs3138042 (G/A) CCR2 using Taqman probes.RESULTS: Univariate analyses identified 4 parameters (infection duration time, viral genotype, gender and AST levels) that tended to influence fibrosis and 7 parameters (CCL2G, CCL2ACCR2A, viremia levels, fibrosis stage, viral genotype, infection duration time and AST levels) that significantly influenced or tended to influence response to treatment. Multivariate analysis identified gender and AST levels as parameters that independently influenced fibrosis stage and viral genotype and infection duration time were the two parameters that independently influenced response to treatment.CONCLUSION: Our results indicate that the mutations studied in the gene pair CCL2/CCR2 do not play a major role in the outcome and response to treatment for HCV infection in the Spanish population.

  15. HIV-1 efficient entry in inner foreskin is mediated by elevated CCL5/RANTES that recruits T cells and fuels conjugate formation with Langerhans cells.

    Directory of Open Access Journals (Sweden)

    Zhicheng Zhou

    2011-06-01

    Full Text Available Male circumcision reduces acquisition of HIV-1 by 60%. Hence, the foreskin is an HIV-1 entry portal during sexual transmission. We recently reported that efficient HIV-1 transmission occurs following 1 h of polarized exposure of the inner, but not outer, foreskin to HIV-1-infected cells, but not to cell-free virus. At this early time point, Langerhans cells (LCs and T-cells within the inner foreskin epidermis are the first cells targeted by the virus. To gain in-depth insight into the molecular mechanisms governing inner foreskin HIV-1 entry, foreskin explants were inoculated with HIV-1-infeceted cells for 4 h. The chemokine/cytokine milieu secreted by the foreskin tissue, and resulting modifications in density and spatial distribution of T-cells and LCs, were then investigated. Our studies show that in the inner foreskin, inoculation with HIV-1-infected cells induces increased CCL5/RANTES (1.63-fold and decreased CCL20/MIP-3-alpha (0.62-fold secretion. Elevated CCL5/RANTES mediates recruitment of T-cells from the dermis into the epidermis, which is blocked by a neutralizing CCL5/RANTES Ab. In parallel, HIV-1-infected cells mediate a bi-phasic modification in the spatial distribution of epidermal LCs: attraction to the apical surface at 1 h, followed by migration back towards the basement membrane later on at 4 h, in correlation with reduced CCL20/MIP-3-alpha at this time point. T-cell recruitment fuels the continuous formation of LC-T-cell conjugates, permitting the transfer of HIV-1 captured by LCs. Together, these results reveal that HIV-1 induces a dynamic process of immune cells relocation in the inner foreskin that is associated with specific chemokines secretion, which favors efficient HIV-1 entry at this site.

  16. Critical role of CCL22/CCR4 axis in the maintenance of immune homeostasis during apoptotic cell clearance by splenic CD8α(+) CD103(+) dendritic cells.

    Science.gov (United States)

    Hao, Shengyu; Han, Xiaolei; Wang, Dan; Yang, Yang; Li, Qiuting; Li, Xiangzhi; Qiu, Chun-Hong

    2016-06-01

    Macrophages and dendritic cells (DCs) in murine spleen are essential for the maintenance of immune homeostasis by elimination of blood-borne foreign particles and organisms. It has been reported that splenic DCs, especially CD8α(+) CD103(+) DCs, are responsible for tolerance to apoptosis-associated antigens. However, the molecular mechanism by which these DCs maintain immune homeostasis by blood-borne apoptotic cell clearance remains elusive. Here, we found that the CCL22/CCR4 axis played a critical role in the maintenance of immune homeostasis during apoptotic cell clearance by splenic CD8α(+) CD103(+) DCs. The present results revealed that systemic administration of apoptotic cells rapidly induced a large number of CCL22 and CCR4(+) regulatory T (Treg) cells in the spleen of C57BL/6J mice. Further study demonstrated that CD8α(+) CD103(+) DCs dominantly produce much higher CCL22 than CD8α(+) CD103(-) DCs. Moreover, the transient deletion of CD8α(+) CD103(+) DCs caused a decrease in CCL22 levels together with CCR4(+) Treg cell percentage. Subsequently, the levels of some pro-inflammatory cytokines, such as interleukin-17 and interferon-γ in the spleen with the absence of CD8α(+) CD103(+) DCs increased in response to the administration of apoptotic cells. Hence, intravenous injection of apoptotic cells induced a subsequent increase in CCL22 expression and CCR4(+) Treg cells, which contribute to the maintenance of immune homeostasis at least partially by splenic CD8α(+) CD103(+) DCs. PMID:26868141

  17. FT-IR study on interactions between medroxyprogesterone acetate and solvent in CHCl3/cyclo-C6H12 and CCl4/cyclo-C6H12 binary solvent systems

    Science.gov (United States)

    Shi, Jie-hua; Fan, Chun-hui

    2012-09-01

    The intermolecular interactions between medroxyprogesterone acetate (MPA) and CHCl3 and CCl4 solvent in CHCl3/cyclo-C6H12 and CCl4/cyclo-C6H12 binary solvent systems have been studied by Fourier transform infrared spectroscopy (FT-IR). The experimental results showed that there are hydrogen bonding interactions between oxygen atoms of all carbonyl groups in MPA and hydrogen atom of CHCl3 so as to form 1:3 complex of MPA with CHCl3 and produce three new absorption bands at 1728.9-1736.1, 1712.7-1717.4 and 1661.9-1673.8 cm-1, respectively. And, 1:1 complex of MPA with CCl4 is formed in CCl4/cyclo-C6H12 binary solvent as a result of hydrogen bonding interaction between C3 carbonyl group and empty d-orbital in chlorine atom of CCl4 leading to producing new absorption band at 1673.2-1674.2 cm-1. However, all free carbonyl and associated carbonyl stretching vibrations of MPA in CHCl3/cyclo-C6H12 and CCl4/cyclo-C6H12 binary solvent systems shift to lower wavenumbers with the increasing of volume fraction of CHCl3 and CCl4 in binary solvent systems owing to the dipole-dipole interaction and the dipole-induced dipole interaction between MPA and solvents.

  18. Saxton Transportation Operations Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — The Saxton Transportation Operations Laboratory (Saxton Laboratory) is a state-of-the-art facility for conducting transportation operations research. The laboratory...

  19. Virtual Laboratories

    CERN Document Server

    Hut, P

    2006-01-01

    At the frontier of most areas in science, computer simulations play a central role. The traditional division of natural science into experimental and theoretical investigations is now completely outdated. Instead, theory, simulation, and experimentation form three equally essential aspects, each with its own unique flavor and challenges. Yet, education in computational science is still lagging far behind, and the number of text books in this area is minuscule compared to the many text books on theoretical and experimental science. As a result, many researchers still carry out simulations in a haphazard way, without properly setting up the computational equivalent of a well equipped laboratory. The art of creating such a virtual laboratory, while providing proper extensibility and documentation, is still in its infancy. A new approach is described here, Open Knowledge, as an extension of the notion of Open Source software. Besides open source code, manuals, and primers, an open knowledge project provides simul...

  20. Laboratory investigations

    International Nuclear Information System (INIS)

    Our task is to design mined-repository systems that will adequately secure high-level nuclear waste for at least 10,000 yr and that will be mechanically stable for 50 to 100-yr periods of retrievability during which mistakes could be corrected and a valuable source of energy could be reclaimed, should national policy on the reprocessing of spent fuel ever change. The only credible path for the escape of radionuclides from the repository to the biosphere is through ground-water, and in hard rock, bulk permeability is largely governed by natural and artificial fracture systems. Catastrophic failure of an excavation in hard rock is likely to occur at the weakest links - the discontinuities in the rock mass that is perturbed first by mining and then by radiogenic heating. The laboratory can contribute precise measurements of the pertinent thermomechanical, hydrological and chemical properties and improve our understanding of the fundamental processes through careful experiments under well controlled conditions that simulate the prototype environment. Thus laboratory investigations are necessary, but they are not sufficient, for conventional sample sizes are small relative to natural defects like joints - i.e., the rock mass is not a continuum - and test durations are short compared to those that predictive modeling must take into account. Laboratory investigators can contribute substantially more useful data if they are provided facilities for testing large specimens(say one cubic meter) and for creep testing of all candidate host rocks. Even so, extrapolations of laboratory data to the field in neither space nor time are valid without the firm theoretical foundations yet to be built. Meanwhile in-situ measurements of structure-sensitive physical properties and access to direct observations of rock-mass character will be absolutely necessary

  1. Culham Laboratory

    International Nuclear Information System (INIS)

    The report contains summaries of work carried out under the following headings: fusion research experiments; U.K. contribution to the JET project; supporting studies; theoretical plasma physics, computational physics and computing; fusion reactor studies; engineering and technology; contract research; external relations; staff, finance and services. Appendices cover main characteristics of Culham fusion experiments, staff, extra-mural projects supported by Culham Laboratory, and a list of papers written by Culham staff. (U.K.)

  2. Validation of ACE-FTS v2.2 measurements of HCl, HF, CCl3F and CCl2F2 using space-, balloon- and ground-based instrument observations

    Directory of Open Access Journals (Sweden)

    C. Servais

    2008-10-01

    Full Text Available Hydrogen chloride (HCl and hydrogen fluoride (HF are respectively the main chlorine and fluorine reservoirs in the Earth's stratosphere. Their buildup resulted from the intensive use of man-made halogenated source gases, in particular CFC-11 (CCl3F and CFC-12 (CCl2F2, during the second half of the 20th century. It is important to continue monitoring the evolution of these source gases and reservoirs, in support of the Montreal Protocol and also indirectly of the Kyoto Protocol. The Atmospheric Chemistry Experiment Fourier Transform Spectrometer (ACE-FTS is a space-based instrument that has been performing regular solar occultation measurements of over 30 atmospheric gases since early 2004. In this validation paper, the HCl, HF, CFC-11 and CFC-12 version 2.2 profile data products retrieved from ACE-FTS measurements are evaluated. Volume mixing ratio profiles have been compared to observations made from space by MLS and HALOE, and from stratospheric balloons by SPIRALE, FIRS-2 and Mark-IV. Partial columns derived from the ACE-FTS data were also compared to column measurements from ground-based Fourier transform instruments operated at 12 sites. ACE-FTS data recorded from March 2004 to August 2007 have been used for the comparisons. These data are representative of a variety of atmospheric and chemical situations, with sounded air masses extending from the winter vortex to summer sub-tropical conditions. Typically, the ACE-FTS products are available in the 10–50 km altitude range for HCl and HF, and in the 7–20 and 7–25 km ranges for CFC-11 and -12, respectively. For both reservoirs, comparison results indicate an agreement generally better than 5–10% above 20 km altitude, when accounting for the known offset affecting HALOE measurements of HCl and HF. Larger positive differences are however found for comparisons with single profiles from FIRS-2 and SPIRALE. For CFCs, the few coincident measurements available suggest that the differences

  3. Validation of ACE-FTS v2.2 measurements of HCl, HF, CCl3F and CCl2F2 using space-, balloon- and ground-based instrument observations

    Directory of Open Access Journals (Sweden)

    C. Tétard

    2008-02-01

    Full Text Available Hydrogen chloride (HCl and hydrogen fluoride (HF are respectively the main chlorine and fluorine reservoirs in the Earth's stratosphere. Their buildup resulted from the intensive use of man-made halogenated source gases, in particular CFC-11 (CCl3F and CFC-12 (CCl2F2, during the second half of the 20th century. It is important to continue monitoring the evolution of these source gases and reservoirs, in support of the Montreal Protocol and also indirectly of the Kyoto Protocol. The Atmospheric Chemistry Experiment Fourier Transform Spectrometer (ACE-FTS is a space-based instrument that has been performing regular solar occultation measurements of over 30 atmospheric gases since early 2004. In this validation paper, the HCl, HF, CFC-11 and CFC-12 version 2.2 profile data products retrieved from ACE-FTS measurements are evaluated. Volume mixing ratio profiles have been compared to observations made from space by MLS and HALOE, and from stratospheric balloons by SPIRALE, FIRS-2 and Mark-IV. Partial columns derived from the ACE-FTS data were also compared to column measurements from ground-based Fourier transform instruments operated at 12 sites. ACE-FTS data recorded from March 2004 to August 2007 have been used for the comparisons. These data are representative of a variety of atmospheric and chemical situations, with sounded air masses extending from the winter vortex to summer sub-tropical conditions. Typically, the ACE-FTS products are available in the 10–50 km altitude range for HCl and HF, and in the 7–20 and 7–25 km ranges for CFC-11 and CFC-12, respectively. For both reservoirs, comparison results indicate an agreement generally better than 5–10%, when accounting for the known offset affecting HALOE measurements of HCl and HF. Larger positive differences are however found for comparisons with single profiles from FIRS-2 and SPIRALE. For CFCs, the few coincident measurements available suggest that the differences probably remain

  4. Solvent effects on infrared spectra of methyl 4-hydroxybenzoate in pure organic solvents and in ethanol/CCl 4 binary solvents

    Science.gov (United States)

    Liu, Qing; Fang, Danjun; Zheng, Jianping

    2004-06-01

    Infrared spectroscopy studies of methyl 4-hydroxybenzoate (MHB) in 17 different organic solvents and in ethanol/CCl 4 binary solvent were undertaken to investigate the solvent-solute interactions. The frequencies of carbonyl stretching vibration ν(CO) of MHB in single solvents were correlated with the solvent acceptor number (AN) and the linear solvation energy relationships (LSER). The assignments of the two bands of ν(CO) of MHB in alcohols and the single one of that in non-alcoholic solvents were discussed. The shifts of ν(CO) of MHB in ethanol/CCl 4 binary solvents showed that several kinds of solute-solvent hydrogen bonding interactions coexisted in the mixture solvents, with a change in the mole fraction of ethanol in the binary solvents.

  5. S-wave threshold in electron attachment - observations and cross sections in CCl4 and SF6 at ultralow electron energies

    International Nuclear Information System (INIS)

    The threshold photoionization method was used to study low-energy electron attachment phenomena in and cross sections of CCl4 and SF6 compounds, which have applications in the design of gaseous dielectrics and diffuse discharge opening switches. Measurements were made at electron energies from below threshold to 140 meV at resolutions of 6 and 8 meV. A narrow resolution-limited structure was observed in electron attachment to CCl4 and SF6 at electron energies below 10 meV, which is attributed to the divergence of the attachment cross section in the limit epsilon, l approaches zero. The results are compared with experimental collisional-ionization results, electron-swarm unfolded cross sections, and earlier threshold photoionization data. 34 refs

  6. s-wave threshold in electron attachment - Observations and cross sections in CCl4 and SF6 at ultralow electron energies

    Science.gov (United States)

    Chutjian, A.; Alajajian, S. H.

    1985-01-01

    The threshold photoionization method was used to study low-energy electron attachment phenomena in and cross sections of CCl4 and SF6 compounds, which have applications in the design of gaseous dielectrics and diffuse discharge opening switches. Measurements were made at electron energies from below threshold to 140 meV at resolutions of 6 and 8 meV. A narrow resolution-limited structure was observed in electron attachment to CCl4 and SF6 at electron energies below 10 meV, which is attributed to the divergence of the attachment cross section in the limit epsilon, l approaches zero. The results are compared with experimental collisional-ionization results, electron-swarm unfolded cross sections, and earlier threshold photoionization data.

  7. Pengaruh Ekstrak Metanol Daun Suren (Toona sureni Bl Merr) Terhadap Fungsi Hati dan Nilai Darah (Rattus norvegicus L.) Jantan yang Dipapari Karbon Tetraklorida (CCl4)

    OpenAIRE

    Simatupang, Sera Wida

    2016-01-01

    The effect of methanol extract of suren leaves (Toona sureni BL Merr) on the function of liver, erythrocyte count and haemoglobin level in male rat (Rattus norvegicus) induced by carbon tetracloride (CCl4) had been studied from April to November 2015. This research performed with completely randomized design and treatment was divided into 8 groups: 2 groups of positive control, 2 groups of solvent control, normal control, and 3 groups of extract concentration (100, 150 and 200 mg/kg/bw). The ...

  8. PLAG (1-Palmitoyl-2-Linoleoyl-3-Acetyl-rac-Glycerol) Modulates Eosinophil Chemotaxis by Regulating CCL26 Expression from Epithelial Cells

    OpenAIRE

    Jeong, Jinseon; Kim, Young-Jun; Yoon, Sun Young; Kim, Yong-Jae; Kim, Joo Heon; Sohn, Ki-Young; Kim, Heung-Jae; Han, Yong-Hae; Chong, Saeho; Kim, Jae Wha

    2016-01-01

    Increased number of eosinophils in the circulation and sputum is associated with the severity of asthma. The respiratory epithelium produces chemokine (C-C motif) ligands (CCL) which recruits and activates eosinophils. A chemically synthesized monoacetyl-diglyceride, PLAG (1-palmitoyl-2-linoleoyl-3-acetyl-rac-glycerol) is a major constituent in the antlers of Sika deer (Cervus nippon Temminck) which has been used in oriental medicine. This study was aimed to investigate the molecular mechanis...

  9. Oxymatrine attenuates CCl4-induced hepatic fibrosis via modulation of TLR4-dependent inflammatory and TGF-β1 signaling pathways.

    Science.gov (United States)

    Zhao, Hong-Wei; Zhang, Zhen-Fang; Chai, Xuan; Li, Guang-Quan; Cui, He-Rong; Wang, Hong-Bo; Meng, Ya-Kun; Liu, Hui-Min; Wang, Jia-Bo; Li, Rui-Sheng; Bai, Zhao-Fang; Xiao, Xiao-He

    2016-07-01

    Oxymatrine (OMT) is able to effectively protect against hepatic fibrosis because of its anti-inflammatory property, while the underlying mechanism remains incompletely understood. In this study, forty rats were randomly divided into five groups: control group, model group (carbon tetrachloride, CCl4) and three OMT treatment groups (30, 60, 120mg/kg). After CCl4 alone, the fibrosis score was 20.2±0.8, and the level of alanine aminotransferase (ALT), aspartate aminotransferase (AST), hydroxyproline content, and collagen I expression was elevated, but OMT blunted these parameters. Treatment with OMT prevented CCl4-induced increases in expression of pro-inflammatory and pro-fibrotic cytokines interleukin (IL)-6 and tumor necrosis factor (TNF)-α, meanwhile OMT promoted the expression of anti-inflammatory and anti-fibrotic factors such as interleukin (IL)-10 and bone morphogenetic protein and activin membrane-bound inhibitor (Bambi). Moreover, lipopolysaccharides (LPS) and high mobility group box-1 (HMGB1), which activates Toll-like receptor 4 (TLR4) and modulate hepatic fibrogenesis through hepatic stellate cells (HSCs) or Kupffer cells, were significantly decreased by OMT treatment. These results were further supported by in vitro data. First, OMT suppressed the expression of TLR4 and its downstream pro-inflammatory cytokines, lowered the level of HMGB1, TGF-β1 in macrophages. Then, OMT promoted Bambi expression and thereby inhibited activation of HSCs mediated by transforming growth factor (TGF)-β1. In conclusion, this study showed that OMT could effectively attenuate the CCl4-induced hepatic fibrosis, and this effect may be due to modulation of TLR4-dependent inflammatory and TGF-β1 signaling pathways. PMID:27179304

  10. Effect of 3 amino 1,2,4 triazole administration on the early CCl4-induced ultrastructural alterations in rat liver.

    OpenAIRE

    Bernacchi, A. S.; de Castro, C. R.; de Ferreyra, E. C.; de Fenos, O. M.; Castro, J.A.

    1982-01-01

    CCl4 administration to rats caused at 3 and 6 h intense effects on the liver-cell endoplasmic reticulum such as dilatation, disorganization, detachment of ribosomes, development of extensive areas of smooth component (SER) and formation of myelin figures. 3 Amino 1,2,4 triazole administration (AT) at 3 and 6 h led to the formation of round small vesicles from the rough endoplasmic reticulum (RER), detachment of ribosomes, appearance of extensive areas of SER, appearance of elongated and disto...

  11. Re-evaluation of the lifetimes of the major CFCs and CH3CCl3 using atmospheric trends

    OpenAIRE

    J. W. Elkins; Krummel, P.B.; Mondeel, D. J.; D. Nance; G. S. Dutton; Hall, B D; P. G. Simmonds; Young, D.; Weiss, R. F.; P. K. Salameh; Mühle, J.; C. M. Harth; McCulloch, A; Montzka, S. A.; S. O'Doherty

    2012-01-01

    Since the Montreal Protocol on substances that deplete the ozone layer and its amendments came into effect, growth rates of the major ozone depleting substances (ODS), particularly CFC-11, -12 and -113 and CH3CCl3, have declined markedly, paving the way for global stratospheric ozone recovery. Emissions have now fallen to relatively low levels, therefore the rate at which this recovery occurs will depend largely on the atmospheric lifetime of these compounds. The first ODS measurements beg...

  12. Re-evaluation of the lifetimes of the major CFCs and CH[subscript 3]CCl[subscript 3] using atmospheric trends

    OpenAIRE

    Rigby, M.; R. G. Prinn; S. O'Doherty; Montzka, S. A.; McCulloch, A; C. M. Harth; Mühle, J.; P. K. Salameh; Weiss, R. F.; Young, D.; P. G. Simmonds; Hall, B D; G. S. Dutton; D. Nance; Mondeel, D. J.

    2013-01-01

    Since the Montreal Protocol on Substances that Deplete the Ozone Layer and its amendments came into effect, growth rates of the major ozone depleting substances (ODS), particularly CFC-11, -12 and -113 and CH3CCl3, have declined markedly, paving the way for global stratospheric ozone recovery. Emissions have now fallen to relatively low levels, therefore the rate at which this recovery occurs will depend largely on the atmospheric lifetime of these compounds. The first ODS measurements began ...

  13. Concentration of CCL11, CXCL8 and TNF-alpha in sputum and plasma of patients undergoing asthma or chronic obstructive pulmonary disease exacerbation

    Directory of Open Access Journals (Sweden)

    M.B. Daldegan

    2005-09-01

    Full Text Available Asthma and chronic obstructive pulmonary disease (COPD are common respiratory illnesses characterized by chronic inflammation of the airways. The characterization of induced or spontaneously produced sputum is a useful technique to assess airway inflammation. In the present study, we compared the concentrations of CCL2, CCL11, CXCL8, and tumor necrosis factor-alpha (TNF-alpha in plasma and induced sputum of patients with severe asthma or COPD and correlated the levels of these mediators with inflammatory cells in sputum. Asthmatic patients had elevated levels of eosinophils (40.1 ± 6.24% in sputum whereas neutrophils (63.3 ± 4.66% predominated in COPD patients. The levels of the chemokine CCL11 were markedly increased in sputum (708.7 ± 330.7 pg/ml and plasma (716.6 ± 162.2 pg/ml of asthmatic patients and correlated with the percentage of eosinophils in induced sputum. The concentrations of CXCL8 (817.0 ± 105.2 pg/ml and TNF-alpha (308.8 ± 96.1 pg/ml were higher in sputum of COPD patients and correlated with the percentage of neutrophils in induced sputum. There was also an increase in the concentrations of CXCL8 (43.2 ± 6.8 pg/ml in sputum of asthmatic patients. These results validate that sputum is a suitable method to assess chemokines and cytokines associated with asthma and COPD. Moreover, the mechanisms involved in the synthesis of CCL11 and CXCL8/TNF-alpha would be helpful to better understand the inflammatory profile associated with asthma and COPD, respectively.

  14. Hepatoprotective effect ofSolanum xanthocarpum fruit extract against CCl4 induced acute liver toxicity in experimental animals

    Institute of Scientific and Technical Information of China (English)

    Ramesh K Gupta; Talib Hussain; G Panigrahi; Avik Das; Gireesh Narayan Singh; K Sweety; Md Faiyazuddin; Chandana Venkateswara Rao

    2011-01-01

    Objective:To investigate the hepatoprotective potential ofSolanum xanthocarpum (Solanaceae) (S. xanthocarpum) in experimental rats to validate its traditional claim.Methods: 50%ethanolic fruit extract ofS. xanthocarpum (SXE, 100, 200or400 mg/kg body weight) was administered daily for14days in experimental animals. Liver injury was induced chemically, byCCl4administration (1 mL/kg i.p.).The hepatoprotective activity was assessed using various biochemical parameters like aspartate aminotransferase (AST), alanine aminotransferase(ALT), Serum alkaline phosphatise (SALP) and total bilirubin. Meanwhile, in vivo antioxidant activities as lipid peroxidation (LPO), reduced glutathione(GSH), superoxide dismutase(SOD) and catalase(CAT) were screened along with histopathological studies.Results: Obtained results demonstrated that the treatment with SXE significantly (P<0.05- <0.001) and dose-dependently prevented chemically induced increase in serum levels of hepatic enzymes. Furthermore,SXE significantly (up toP<0.001) reduced the lipid peroxidation in the liver tissue and restored activities of defence antioxidant enzymes GSH, SOD and catalase towards normal levels. Histopathology of the liver tissue showed thatSXE attenuated the hepatocellular necrosis and led to reduction of inflammatory cells inflltration. Conclusions: The results of this study strongly indicate the protective effect ofSXE against acute liver injury which may be attributed to its hepatoprotective activity, and there by scientifically support its traditional use.

  15. Complex permittivity of FeCl3/AOT/CCl4 microemulsions probed by AC impedance spectroscopy.

    Science.gov (United States)

    Calandra, Pietro; Ruggirello, Angela; Turco Liveri, Vincenzo

    2009-09-01

    The complex permittivity of FeCl(3)/AOT/CCl(4) microemulsions in the 1-10(5) Hz frequency range has been measured by the conventional AC complex impedance technique. Measurements as a function of the volume fraction of the dispersed phase (FeCl(3)+AOT) and temperature at fixed salt-to-AOT molar ratio (R, R = 0.5) show that the entrapment of FeCl(3) clusters significantly enhances the local permittivity of the AOT reverse micelles and the number density of charge carriers resulting from the peculiar state of the confined inorganic salt. An estimate of the apparent static permittivity of the FeCl(3) ionic clusters entrapped in the core of AOT reverse micelles gives the very high and quite surprisingly value of about 237. Moreover, a thorough analysis of conductivity data and of their temperature dependence strongly supports the hypothesis that the charge transport in these systems is mainly sustained by a mechanism of hopping consisting in the continuous jumping of charged species within supra-micellar aggregates of AOT reverse micelles whose aggregation is driven by fluctuating opposite charges on contacting micelles. PMID:19481764

  16. Anti-apoptotic effect of San Huang Shel Shin Tang cyclodextrin complex (SHSSTc) on CCl4 -induced hepatotoxicity in rats.

    Science.gov (United States)

    Yang, Cheng-Hsun; Ting, Wei-Jen; Shen, Chia-Yao; Hsu, Hsi-Hsien; Lin, Yueh-Min; Kuo, Chia-Hua; Tsai, Fuu-Jen; Tsai, Chang-Hai; Tsai, Yuhsin; Huang, Chih-Yang

    2016-06-01

    The metabolic loading is heavier in liver especially when injured or inflammation. San Huang Shel Shin Tang (SHSST) was an old traditional herbal decoction, which composed with Rheum officinale Baill, Scutellaria baicalnsis Geprgi and Coptis chinensis Franch (1:1:2 in weight), can provide a liver protection effects. We used a beta-cyclodextrin (β-CD) drug modification method in reduce of the necessary dose of the SHSST. As the results, the FAS-FADD expressions leaded apoptosis in CCl4 intraperitoneal (IP) injection induced acute liver injury in rats. Silymarin, baicalein, SHSST, and SHSST β-CD complex (SHSSTc) pretreatments protected liver through the decreasing of the expressions of FAS-FADD and downstream caspase-3 and caspase-8. Particularly, SHSSTc (30 mg/kg day) treatment enhanced cell survival pathway activation through the PI3K, Akt and Bad phosphorylation. Compared with SHSST as well as silymarin and baicalein, SHSSTc provided a magnificent liver protection effect, especially in survival pathway activation/TUNEL-apoptotic cell reduction/serum cholesterol level suppression. All these data suggested that β-CD complex modified the SHSST and promoted the bioavailability and liver protection effects. © 2014 Wiley Periodicals, Inc. Environ Toxicol 31: 663-670, 2016. PMID:25447754

  17. Effectiveness of xenotransplantation of human fetal hepatocytes in spleen of rats with acute liver failure induced by CCL4

    Directory of Open Access Journals (Sweden)

    Abdukhakim Khadjibaev

    2013-04-01

    Full Text Available Human’s fetal hepatocytes (HFH were intrasplenic transplanted white non-pedigree rats with acute liver failure (ALF challenged by single per oral administration of hepatotropic toxin diluted in oil ССl4 at a dose 10 ml/kg (volumetric correlation 1:1 (10 mL/kg body weight as a 1:1 mixture of CCl4 and mineral oil. Transplantation had positive effect on all biochemical blood parameters of the studying animals. Morphologic study showed that reparative-restorative processes were arising in hepatic parenchyma after administration of HFH into splenic pulp of rats with model of ALF on days 14-21. Substantial and main factor in restoration of parenchyma was restoration of micro topographic interrelations in acinus as well as polyploidy of hepatic cells expressed in increase of hepatocytes’ nuclei sizes and hypertrophy of cells themselves. It is an indirect confirmation of engraftment of HFH in liver of rats with model of ALF.

  18. Role of Dehydroepiandrosterone on Oxidative Stress Bio markers in CCl4 Induced Acute Liver Injury in Rats

    International Nuclear Information System (INIS)

    Liver disease has become one of the serious health problems which threaten human as it is exposed to many kinds of xenobiotics and therapeutic agents. Moreover, the rapid growing morbidity and mortality from liver disease are attributed to the increasing number of chemical compounds and environmental pollution. Unfortunately, in the modern era of medicine, there is no specific treatment to counter the menacing impact of these dreaded diseases. Dehydroepiandrosterone (DHEA) is a widely studied steroid hormone with multi-functional properties. Reports suggested that some of the many activities of DHEA are due to its protective effect against lipid peroxidation. Nevertheless, the antioxidant properties of DHEA are still the subject of debate. In the current study, a significant decrease was occurred in liver glutathione (GSH), glutathione peroxidase (GPx), superoxide dismutase (SOD) and catalase (CAT) as a result of carbon tetrachloride (CCl4) administration. On the other hand, significant elevations in hepatic enzymes (ALT and AST), total lipids, cholesterol, MDA, tumor necrosis factor-γ, total oxidant capacity and poly (ADP-ribose) polymerase were recorded. These disturbances in all the studied parameters were ameliorated after the toxicated rats were treated with 100/ mg/100 g/day DEHA which depend on the time of treatment (1 and 2 weeks). These findings are consistent with the concept that DHEA is an antioxidant agent

  19. HIV-1 Tat-mediated induction of CCL5 in astrocytes involves NF-κB, AP-1, C/EBPα and C/EBPγ transcription factors and JAK, PI3K/Akt and p38 MAPK signaling pathways.

    Directory of Open Access Journals (Sweden)

    Anantha R Nookala

    Full Text Available The incidence of HIV-associated neurological disorders (HAND has increased during recent years even though the highly active antiretroviral therapy (HAART has significantly curtailed the virus replication and increased the life expectancy among HIV-1 infected individuals. These neurological deficits have been attributed to HIV proteins including HIV-1 Tat. HIV-1 Tat is known to up-regulate CCL5 expression in mouse astrocytes, but the mechanism of up-regulation is not known. The present study was undertaken with the objective of determining the mechanism(s underlying HIV-1 Tat-mediated expression of CCL5 in astrocytes. SVGA astrocytes were transiently transfected with a plasmid encoding Tat, and expression of CCL5 was studied at the mRNA and protein levels using real time RT-PCR and multiplex cytokine bead array, respectively. HIV-1 Tat showed a time-dependent increase in the CCL5 expression with peak mRNA and protein levels, observed at 1 h and 48 h post-transfection, respectively. In order to explore the mechanism(s, pharmacological inhibitors and siRNA against different pathway(s were used. Pre-treatment with SC514 (NF-κB inhibitor, LY294002 (PI3K inhibitor, AG490 (JAK2 inhibitor and Janex-1 (JAK3 inhibitor showed partial reduction of the Tat-mediated induction of CCL5 suggesting involvement of JAK, PI3K/Akt and NF-κB in CCL5 expression. These results were further confirmed by knockdown of the respective genes using siRNA. Furthermore, p38 MAPK was found to be involved since the knockdown of p38δ but not other isoforms showed partial reduction in CCL5 induction. This was further confirmed at transcriptional level that AP-1, C/EBPα and C/EBPγ were involved in CCL5 up-regulation.

  20. Effect of chain length on aggregation of n-alkanes in CCl3F matrices at 77 K. Further ESR evidence for the occurrence of hydrogen and/or proton transfer between higher alkanes and their cations

    International Nuclear Information System (INIS)

    After γ-irradiation of hexane and decane at low concentration in CCl3F at 77 K only the ESR spectrum of the corresponding radical cations is observed. At higher concentrations (from about 3 mol% hexane and 0.5 mol% decane), the spectra of alkyl radicals also appear. The signal intensity and relative contribution of these alkyl radicals to the observed ESR spectra increases with increasing alkane solute concentration. In contrast, alkane radical cations but no alkyl radicals are observed after irradiation of hexane and decane in CCl3CF3 and other matrices at concentrations where alkyl radicals are already quite prominent in CCl3F. This contrast is especially pronounced in the case of decane, the signal intensity and relative contribution of alkyl radicals in the ESR spectrum of irradiated CCl3F-decane systems being much higher than in irradiated CCl3F-hexane systems. Most of the alkane radical cations observed possess the extended structure, resulting in a triplet with substructure for hexane and a broad singlet for decane, but different conformers are also observed, viz. for hexane in CCl3CF3 and for decane in CCl3F. The results provide conclusive evidence for the occurrence of hydrogen and/or proton transfer between C6 (only weakly) and C10 (very pronounced) n-alkanes and their cations. They show further that in CCl3F at 77 K alkanes are present as small aggregates to which hole transfer still occurs efficiently and, in conjunction with other data, indicate that the extent of such aggregation increases with increasing chain length of the alkane solute. (Author)

  1. The Macrophage Inflammatory Proteins MIP1α (CCL3 and MIP2α (CXCL2 in Implant-Associated Osteomyelitis: Linking Inflammation to Bone Degradation

    Directory of Open Access Journals (Sweden)

    Ulrike Dapunt

    2014-01-01

    Full Text Available Bacterial infections of bones remain a serious complication of endoprosthetic surgery. These infections are difficult to treat, because many bacterial species form biofilms on implants, which are relatively resistant towards antibiotics. Bacterial biofilms elicit a progressive local inflammatory response, resulting in tissue damage and bone degradation. In the majority of patients, replacement of the prosthesis is required. To address the question of how the local inflammatory response is linked to bone degradation, tissue samples were taken during surgery and gene expression of the macrophage inflammatory proteins MIP1α (CCL3 and MIP2α (CXCL2 was assessed by quantitative RT-PCR. MIPs were expressed predominantly at osteolytic sites, in close correlation with CD14 which was used as marker for monocytes/macrophages. Colocalisation of MIPs with monocytic cells could be confirmed by histology. In vitro experiments revealed that, aside from monocytic cells, also osteoblasts were capable of MIP production when stimulated with bacteria; moreover, CCL3 induced the differentiation of monocytes to osteoclasts. In conclusion, the multifunctional chemokines CCL3 and CXCL2 are produced locally in response to bacterial infection of bones. In addition to their well described chemokine activity, these cytokines can induce generation of bone resorbing osteoclasts, thus providing a link between bacterial infection and osteolysis.

  2. Marsdenia tenacissima extract suppresses A549 cell migration through regulation of CCR5-CCL5 axis, Rho C, and phosphorylated FAK.

    Science.gov (United States)

    Lin, Sen-Sen; Li, Fang-Fang; Sun, Li; Fan, Wei; Gu, Ming; Zhang, Lu-Yong; Qin, Song; Yuan, Sheng-Tao

    2016-03-01

    Marsdenia tenacissima, a traditional Chinese medicine, is long been used to treat various diseases including asthma, cancer, trachitis, tonsillitis, pharyngitis, cystitis, and pneumonia. Although Marsdenia tenacissima has been demonstrated to have strong anti-tumor effects against primary tumors, its effect on cancer metastasis remains to be defined, and the molecular mechanism underlying the anti-metastatic effect is unknown. In the present study, we investigated the effects of XAP (an extract of Marsdenia tenacissima) on A549 lung cancer cell migration and explored the role of CCR5-CCL5 axis in the anti-metastatic effects of XAP. Our resutls showed that XAP inhibited A549 lung cancer cell migration and invasion in a dose-dependent manner. The protein levels of CCR5, but not CCR9 and CXCR4, were decreased by XAP. The secretion of CCL5, the ligand of CCR5, was reduced by XAP. XAP down-regulated Rho C expression and FAK phosphorylation. In conclusion, XAP inhibited A549 cell migration and invasion through down-regulation of CCR5-CCL5 axis, Rho C, and FAK. PMID:27025367

  3. Compositional characterisation of soluble apple polysaccharides, and their antioxidant and hepatoprotective effects on acute CCl4-caused liver damage in mice.

    Science.gov (United States)

    Yang, Xingbin; Yang, Su; Guo, Yurong; Jiao, Yadong; Zhao, Yan

    2013-06-01

    Water-soluble apple peel polysaccharides (APP) and apple flesh polysaccharides (AFP) were isolated from Pink Lady fruits, and their in vitro antioxidant capacities were characterised by DPPH(), HO(), and O(2)(-) systems, and ferric-reducing antioxidant power assay. Oral administration of APP at 250 and 500 mg/kg bw in mice was shown to be as effective as AFP in lowering the CCl(4)-caused increases of serum alanine aminotransferase, aspartate aminotransferase and lactic dehydrogenase activities, and hepatic malondialdehyde level, and antagonising the decreases in antioxidant superoxide dismutase and glutathione peroxidase activities caused by CCl(4) (p<0.05). Histopathological examinations further confirmed that both APP and AFP could protect the liver from CCl(4)-induced histological alteration. HPLC analysis also showed similar profiles of monosaccharide composition for APP and AFP with arabinose, galactose and galacturonic acid being main component monosaccharides. All of these findings demonstrate that the extracts of both APP and AFP possess antioxidant and hepatoprotective potential. PMID:23411241

  4. «Evaluation of the anti-icterus effect of crude powdered leaf of Argemone mexicana L. (Papaveraceae against CCl4-induced liver injury in rats».

    Directory of Open Access Journals (Sweden)

    T.S. SOURABIE

    2012-10-01

    Full Text Available Leaves of Argemone mexicana L. (Papaveraceae are used in the folk medicine of Burkina Faso (West Africa to treat a variety of illness. Aqueous decoction of the drug is indicated in the treatment of malaria fever, abdominal pains, and jaundice. A preliminary study led by the authors showed a good anti-icterus (hepatoprotective activity of leaves extracts on intoxicated Wistar rats. The aim of the present investigation was to evaluate the anti-icterus activity of crude leaf powder against CCl4 induced hepatotoxicity in rats. Liver functions were assessed by the activities of liver marker enzymes, ASAT/GOT, ALAT/GPT, ALP, Total Bilirubin (TBIL and Direct Bilirubin (DBIL.A crude powdered leaf suspended in acacia gum solution (2% p/w was administered orally to the animal at doses of 125, 250 and 500 mg/kg attenuated significantly (p<0,05 the elevation of serum enzymes level and bilirubin (total and direct if compared to the CCl4 treated groups. Silymarin (100 mg/kg, p.o., a known antihepatoprotective drug was used as reference. The results showed a dose-dependent anti-hepatotoxic effect against liver injury induced by CCl4 in rats. These findings give an opportunity for a future elaboration of galenic formulation as phytomedicament.

  5. Application of IL-36 receptor antagonist weakens CCL20 expression and impairs recovery in the late phase of murine acetaminophen-induced liver injury.

    Science.gov (United States)

    Scheiermann, Patrick; Bachmann, Malte; Härdle, Lorena; Pleli, Thomas; Piiper, Albrecht; Zwissler, Bernhard; Pfeilschifter, Josef; Mühl, Heiko

    2015-01-01

    Overdosing of the analgesic acetaminophen (APAP, paracetamol) is a major cause of acute liver injury. Whereas toxicity is initiated by hepatocyte necrosis, course of disease is regulated by mechanisms of innate immunity having the potential to serve in complex manner pathogenic or pro-regenerative functions. Interleukin (IL)-36γ has been identified as novel IL-1-like cytokine produced by and targeting epithelial (-like) tissues. Herein, we investigated IL-36γ in acute liver disease focusing on murine APAP-induced hepatotoxicity. Enhanced expression of hepatic IL-36γ and its prime downstream chemokine target CCL20 was detected upon liver injury. CCL20 expression coincided with the later regeneration phase of intoxication. Primary murine hepatocytes and human Huh7 hepatocellular carcinoma cells indeed displayed enhanced IL-36γ expression when exposed to inflammatory cytokines. Administration of IL-36 receptor antagonist (IL-36Ra) decreased hepatic CCL20 in APAP-treated mice. Unexpectedly, IL-36Ra likewise increased late phase hepatic injury as detected by augmented serum alanine aminotransferase activity and histological necrosis which suggests disturbed tissue recovery upon IL-36 blockage. Finally, we demonstrate induction of IL-36γ in inflamed livers of endotoxemic mice. Observations presented introduce IL-36γ as novel parameter in acute liver injury which may contribute to the decision between unleashed tissue damage and initiation of liver regeneration during late APAP toxicity. PMID:25687687

  6. Efficacy of a traditional unani formulation Jawarish-e-Amla Sada against CCl 4 induced liver toxicity in Albino Wistar rats: Comparison with silymarin treatment

    Directory of Open Access Journals (Sweden)

    Sunita Shailajan

    2015-01-01

    Full Text Available Background: Jawarish-e-Amla Sada (JAS; a polyherbal Unani formulation, is claimed as a potential hepatoprotective agent in traditional Unani medicine treatise. Aims and Objectives: Though, JAS has its composition recorded in ancient Unani texts, there have been minimal attempts to scientifically validate its hepatoprotective potential. The present work is an attempt to evaluate the hepatoprotective activity of JAS in vivo. Materials and Methods: CCl 4 intoxicated Albino Wistar rats were used to evaluate the hepatoprotective activity of JAS (0.7 g/kg and 1.0 g/kg, p.o. and the results were compared with, silymarin. The efficacy was established on the basis of altered levels of biochemical markers and histopathological analysis of the liver tissue. Results and Discussion: Treatment with the aqueous slurry of JAS significantly reduced the level of biochemical markers in CCl 4 intoxicated rats. These findings were well-supported by the histopathological analysis of liver tissue. The effect shown by JAS was found to be at par with silymarin treatment. Conclusion: This study suggests that CCl 4 induced liver damage can be ameliorated by traditional Unani formulation JAS. This justifies the traditional claim of JAS being a hepatoprotective agent.

  7. HIV-1 Nef Induces CCL5 production in astrocytes through p38-MAPK and PI3K/Akt pathway and utilizes NF-kB, CEBP and AP-1 transcription factors

    Science.gov (United States)

    Liu, Xun; Shah, Ankit; Gangwani, Mohitkumar R.; Silverstein, Peter S.; Fu, Mingui; Kumar, Anil

    2014-03-01

    The prevalence of HIV-associated neurocognitive disorders (HAND) remains high in patients infected with HIV-1. The production of pro-inflammatory cytokines by astrocytes/microglia exposed to viral proteins is thought to be one of the mechanisms leading to HIV-1- mediated neurotoxicity. In the present study we examined the effects of Nef on CCL5 induction in astrocytes. The results demonstrate that CCL5 is significantly induced in Nef-transfected SVGA astrocytes. To determine the mechanisms responsible for the increased CCL5 caused by Nef, we employed siRNA and chemical antagonists. Antagonists of NF-κB, PI3K, and p38 significantly reduced the expression levels of CCL5 induced by Nef transfection. Furthermore, specific siRNAs demonstrated that the Akt, p38MAPK, NF-κB, CEBP, and AP-1 pathways play a role in Nef-mediated CCL5 expression. The results demonstrated that the PI3K/Akt and p38 MAPK pathways, along with the transcription factors NF-κB, CEBP, and AP-1, are involved in Nef-induced CCL5 production in astrocytes.

  8. An adaptable computer control system for the Daresbury recoil separator

    International Nuclear Information System (INIS)

    This paper describes a computer system for the setting and control of all the magnets and high voltage supplies of a many element spectrometer using an LSI11/23 running RT11 with CAMAC input/output. Magnetic field strengths are measured by an inexpensive and easily constructed system of Hall probes and temperature transducers. The software calculates the field strength in each magnet by applying a temperature correction and a quadratic calibration to the measured Hall voltage. Keyboard commands to the system provide many facilities for setting up and control of the separator. Communication with a remote processor via an X25 link is also described. (orig.)

  9. RANTES/CCL5 and risk for coronary events: results from the MONICA/KORA Augsburg case-cohort, Athero-Express and CARDIoGRAM studies.

    Directory of Open Access Journals (Sweden)

    Christian Herder

    Full Text Available BACKGROUND: The chemokine RANTES (regulated on activation, normal T-cell expressed and secreted/CCL5 is involved in the pathogenesis of cardiovascular disease in mice, whereas less is known in humans. We hypothesised that its relevance for atherosclerosis should be reflected by associations between CCL5 gene variants, RANTES serum concentrations and protein levels in atherosclerotic plaques and risk for coronary events. METHODS AND FINDINGS: We conducted a case-cohort study within the population-based MONICA/KORA Augsburg studies. Baseline RANTES serum levels were measured in 363 individuals with incident coronary events and 1,908 non-cases (mean follow-up: 10.2±4.8 years. Cox proportional hazard models adjusting for age, sex, body mass index, metabolic factors and lifestyle factors revealed no significant association between RANTES and incident coronary events (HR [95% CI] for increasing RANTES tertiles 1.0, 1.03 [0.75-1.42] and 1.11 [0.81-1.54]. None of six CCL5 single nucleotide polymorphisms and no common haplotype showed significant associations with coronary events. Also in the CARDIoGRAM study (>22,000 cases, >60,000 controls, none of these CCL5 SNPs was significantly associated with coronary artery disease. In the prospective Athero-Express biobank study, RANTES plaque levels were measured in 606 atherosclerotic lesions from patients who underwent carotid endarterectomy. RANTES content in atherosclerotic plaques was positively associated with macrophage infiltration and inversely associated with plaque calcification. However, there was no significant association between RANTES content in plaques and risk for coronary events (mean follow-up 2.8±0.8 years. CONCLUSIONS: High RANTES plaque levels were associated with an unstable plaque phenotype. However, the absence of associations between (i RANTES serum levels, (ii CCL5 genotypes and (iii RANTES content in carotid plaques and either coronary artery disease or incident coronary events in

  10. Antioxidative effects of pumpkin seed (Cucurbita pepo) protein isolate in CCl4-induced liver injury in low-protein fed rats.

    Science.gov (United States)

    Nkosi, C Z; Opoku, A R; Terblanche, S E

    2006-11-01

    The effects of pumpkin seed (Cucurbita pepo) protein isolate on the plasma activity levels of catalase (CA), superoxide dismutase (SOD), glutathione peroxidase (GSHpx) and total antioxidant capacity (TAC) as well as glucose-6-phosphatase (G6Pase) in liver homogenates and lipid peroxidation (LPO-malondialdehyde-MDA) levels in liver homogenates and liver microsomal fractions against carbon tetrachloride (CCl(4))-induced acute liver injury in low-protein fed Sprague-Dawley rats (Rattus norvegicus) were investigated. A group of male Sprague-Dawley rats maintained on a low-protein diet for 5 days were divided into three subgroups. Two subgroups were injected with carbon tetrachloride and the other group with an equivalent amount of olive oil. Two hours after CCl(4) intoxication one of the two subgroups was administered with pumpkin seed protein isolate and thereafter switched onto a 20% pumpkin seed protein isolate diet. The other two groups of rats were maintained on the low-protein diet for the duration of the investigation. Groups of rats from the different subgroups were killed at 24, 48 and 72 h after their respective treatments. After 5 days on the low-protein diet the activity levels of all the enzymes as well as antioxidant levels were significantly lower than their counterparts on a normal balanced diet. However, a low-protein diet resulted in significantly increased levels of lipid peroxidation. The CCl(4) intoxicated rats responded in a similar way, regarding all the variables investigated, to their counterparts on a low-protein diet. The administration of pumpkin seed protein isolate after CCl(4) intoxication resulted in significantly increased levels of all the variables investigated, with the exception of the lipid peroxidation levels which were significantly decreased. From the results of the present study it is concluded that pumpkin seed protein isolate administration was effective in alleviating the detrimental effects associated with protein

  11. TGF-β1 blockade of microglial chemotaxis toward Aβ aggregates involves SMAD signaling and down-regulation of CCL5

    Directory of Open Access Journals (Sweden)

    Huang Fong-Lee

    2010-04-01

    Full Text Available Abstract Background Overactivated microglia that cluster at neuritic plaques constantly release neurotoxins, which actively contribute to progressive neurodegeneration in Alzheimer's disease (AD. Therefore, attenuating microglial clustering can reduce focal neuroinflammation at neuritic plaques. Previously, we identified CCL5 and CCL2 as prominent chemokines that mediate the chemotaxis of microglia toward beta-amyloid (Aβaggregates. Although transforming growth factor-β1 (TGF-β1 has been shown to down-regulate the expression of chemokines in activated microglia, whether TGF-β1 can reduce the chemotaxis of microglia toward neuritic plaques in AD remains unclear. Methods In the present study, we investigated the effects of TGF-β1 on Aβ-induced chemotactic migration of BV-2 microglia using time-lapse recording, transwell assay, real-time PCR, ELISA, and western blotting. Results The cell tracing results suggest that the morphological characteristics and migratory patterns of BV-2 microglia resemble those of microglia in slice cultures. Using this model system, we discovered that TGF-β1 reduces Aβ-induced BV-2 microglial clustering in a dose-dependent manner. Chemotactic migration of these microglial cells toward Aβ aggregates was significantly attenuated by TGF-β1. However, these microglia remained actively moving without any reduction in migration speed. Pharmacological blockade of TGF-β1 receptor I (ALK5 by SB431542 treatment reduced the inhibitory effects of TGF-β1 on Aβ-induced BV-2 microglial clustering, while preventing TGF-β1-mediated cellular events, including SMAD2 phosphorylation and CCL5 down-regulation. Conclusions Our results suggest that TGF-β1 reduces Aβ-induced microglial chemotaxis via the SMAD2 pathway. The down-regulation of CCL5 by TGF-β1 at least partially contributes to the clustering of microglia at Aβ aggregates. The attenuating effects of SB431542 upon TGF-β1-suppressed microglial clustering may be

  12. Distributed Energy Technology Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — The Distributed Energy Technologies Laboratory (DETL) is an extension of the power electronics testing capabilities of the Photovoltaic System Evaluation Laboratory...

  13. FOOTWEAR PERFORMANCE LABORATORY

    Data.gov (United States)

    Federal Laboratory Consortium — This laboratory provides biomechanical and physical analyses for both military and commercial footwear. The laboratory contains equipment that is integral to the us...

  14. Bio Engineering Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — Description/History: Chemistry and biology laboratories The Bio Engineering Laboratory (BeL) is theonly full spectrum biotechnology capability within the Department...

  15. Physical Sciences Laboratory (PSL)

    Data.gov (United States)

    Federal Laboratory Consortium — PNNL's Physical Sciences Laboratory (PSL) houses 22 research laboratories for conducting a wide-range of research including catalyst formulation, chemical analysis,...

  16. Co-delivery of GPI-anchored CCL28 and influenza HA in chimeric virus-like particles induces cross-protective immunity against H3N2 viruses.

    Science.gov (United States)

    Mohan, Teena; Kim, Jongrok; Berman, Zachary; Wang, Shelly; Compans, Richard W; Wang, Bao-Zhong

    2016-07-10

    Influenza infection typically initiates at respiratory mucosal surfaces. Induction of immune responses at the sites where pathogens initiate replication is crucial for the prevention of infection. We studied the adjuvanticity of GPI-anchored CCL28 co-incorporated with influenza HA-antigens in chimeric virus-like particles (cVLPs), in boosting strong protective immune responses through an intranasal (i.n.) route in mice. We compared the immune responses to that from influenza VLPs without CCL28, or physically mixed with soluble CCL28 at systemic and various mucosal compartments. The cVLPs containing GPI-CCL28 showed in-vitro chemotactic activity towards spleen and lung cells expressing CCR3/CCR10 chemokine receptors. The cVLPs induced antigen specific endpoint titers and avidity indices of IgG in sera and IgA in tracheal, lung, and intestinal secretions, significantly higher (4-6 fold) than other formulations. Significantly higher (3-5 fold) hemagglutination inhibition titers and high serum neutralization against H3N2 viruses were also detected with CCL28-containing VLPs compared to other groups. The CCL28-containing VLPs showed complete and 80% protection, when vaccinated animals were challenged with A/Aichi/2/1968/H3N2 (homologous) and A/Philippines/2/1982/H3N2 (heterologous) viruses, respectively. Thus, GPI-anchored CCL28 in influenza VLPs act as a strong immunostimulator at both systemic and mucosal sites, boosting significant cross-protection in animals against heterologous viruses across a large distance. PMID:27178810

  17. Chemokine Ligand 5 (CCL5 and chemokine receptor (CCR5 genetic variants and prostate cancer risk among men of African Descent: a case-control study

    Directory of Open Access Journals (Sweden)

    Kidd LaCreis R

    2012-11-01

    Full Text Available Abstract Background Chemokine and chemokine receptors play an essential role in tumorigenesis. Although chemokine-associated single nucleotide polymorphisms (SNPs are associated with various cancers, their impact on prostate cancer (PCA among men of African descent is unknown. Consequently, this study evaluated 43 chemokine-associated SNPs in relation to PCA risk. We hypothesized inheritance of variant chemokine-associated alleles may lead to alterations in PCA susceptibility, presumably due to variations in antitumor immune responses. Methods Sequence variants were evaluated in germ-line DNA samples from 814 African-American and Jamaican men (279 PCA cases and 535 controls using Illumina’s Goldengate genotyping system. Results Inheritance of CCL5 rs2107538 (AA, GA+AA and rs3817655 (AA, AG, AG+AA genotypes were linked with a 34-48% reduction in PCA risk. Additionally, the recessive and dominant models for CCR5 rs1799988 and CCR7 rs3136685 were associated with a 1.52-1.73 fold increase in PCA risk. Upon stratification, only CCL5 rs3817655 and CCR7 rs3136685 remained significant for the Jamaican and U.S. subgroups, respectively. Conclusions In summary, CCL5 (rs2107538, rs3817655 and CCR5 (rs1799988 sequence variants significantly modified PCA susceptibility among men of African descent, even after adjusting for age and multiple comparisons. Our findings are only suggestive and require further evaluation and validation in relation to prostate cancer risk and ultimately disease progression, biochemical/disease recurrence and mortality in larger high-risk subgroups. Such efforts will help to identify genetic markers capable of explaining disproportionately high prostate cancer incidence, mortality, and morbidity rates among men of African descent.

  18. Evaluation of chemopreventive effect ofFumaria indica against N-nitrosodiethylamine and CCl4-induced hepatocellular carcinoma in Wistar rats

    Institute of Scientific and Technical Information of China (English)

    Talib Hussain; Hefazat H Siddiqui; Sheeba Fareed; M Vijayakumar; Chandana V Rao

    2012-01-01

    Objective:To investigation the chemopreventive potential ofFumaria indica (F. indica) extract (FIE) on N-nitrosodiethylamine and CCl4-induced hepatocarcinogenesis in Wistar rats.Methods:The experimental animals were divided into six groups (n=6). Hepatocellular carcinoma was induced by single intraperitoneal injection ofN-nitrosodiethylamine (NDEA) in normal saline at a dose of 200 mg/kg body weight followed by weekly subcutaneous injections of CCl4 (3 mL/kg/week) for 6 weeks, as the promoter of carcinogenic effect. After administration of the carcinogen, 200 and 400 mg/kg of FIE were administered orally once a day throughout the study. At the end of 20 weeks, the body weight, liver weight and relative liver weight were measured. The percentage of nodule incidence and liver cancer markers such as aspartate transaminase (AST), alanine transaminase (ALT), alkaline phosphatase (ALP),γ-glutamyl transferase (γ-GT), total bilirubin level (TBL), α-feto protein (AFP) and carcinoembryonic antigen were estimated along with histopathological investigation in experimental groups of rats. Results: Obtained results demonstrated that the cotreatment with FIE significantly prevented the decrease of the body weight and also increased in relative liver weight caused by NDEA. The treatment with FIE significantly reduced the nodule incidence and nodule multiplicity in the rats after NDEA administration. The levels of liver cancer markers such as AST, ALT, ALP,γ-glutamyl transferase, TBL, AFP and carcinoembryonic antigen were substantially increased by NDEA treatment. However, FIE treatment significantly reduced the liver injury and restored the entire liver cancer markers. Histological observations of liver tissues too correlated with the biochemical observations.Conclusions: These finding powerfully supports thatF. indica exert chemopreventive effect by suppressing the tumor burden and restoring the activities of hepatic cancer marker enzymes on NDEA and CCl4-induced

  19. TGF-β1-induced EMT promotes targeted migration of breast cancer cells through the lymphatic system by the activation of CCR7/CCL21-mediated chemotaxis.

    Science.gov (United States)

    Pang, M-F; Georgoudaki, A-M; Lambut, L; Johansson, J; Tabor, V; Hagikura, K; Jin, Y; Jansson, M; Alexander, J S; Nelson, C M; Jakobsson, L; Betsholtz, C; Sund, M; Karlsson, M C I; Fuxe, J

    2016-02-11

    Tumor cells frequently disseminate through the lymphatic system during metastatic spread of breast cancer and many other types of cancer. Yet it is not clear how tumor cells make their way into the lymphatic system and how they choose between lymphatic and blood vessels for migration. Here we report that mammary tumor cells undergoing epithelial-mesenchymal transition (EMT) in response to transforming growth factor-β (TGF-β1) become activated for targeted migration through the lymphatic system, similar to dendritic cells (DCs) during inflammation. EMT cells preferentially migrated toward lymphatic vessels compared with blood vessels, both in vivo and in 3D cultures. A mechanism of this targeted migration was traced to the capacity of TGF-β1 to promote CCR7/CCL21-mediated crosstalk between tumor cells and lymphatic endothelial cells. On one hand, TGF-β1 promoted CCR7 expression in EMT cells through p38 MAP kinase-mediated activation of the JunB transcription factor. Blockade of CCR7, or treatment with a p38 MAP kinase inhibitor, reduced lymphatic dissemination of EMT cells in syngeneic mice. On the other hand, TGF-β1 promoted CCL21 expression in lymphatic endothelial cells. CCL21 acted in a paracrine fashion to mediate chemotactic migration of EMT cells toward lymphatic endothelial cells. The results identify TGF-β1-induced EMT as a mechanism, which activates tumor cells for targeted, DC-like migration through the lymphatic system. Furthermore, it suggests that p38 MAP kinase inhibition may be a useful strategy to inhibit EMT and lymphogenic spread of tumor cells. PMID:25961925

  20. Hepatoprotective and antioxidant activity of methanolic extract of flowers ofNerium oleander against CCl4-induced liver injury in rats

    Institute of Scientific and Technical Information of China (English)

    Kumar Gaurav Singhal; Ghanshyam Das Gupta

    2012-01-01

    Objective:To investigate the antioxidant and hepatoprotective activity of methanolic flower extract ofNerium oleander againstCCl4-induced hepatotoxicity in rats.Methods:In vitro antioxidant activity of methanolic extract of flowers of Nerium oleander(MENO-F) was evaluated by various assays, including reducing power, lipid peroxidation,DPPH,ABTS, superoxide anion, hydroxyl radicals and metal chelation.The hepatoprotective andin vivo antioxidant activity ofMENO-F were evaluated againstCCl4-induced hepatic damage in rats.TheMENO-F at dose of100,200 and400 mg/kg were administered orally once daily for seven days.Serum enzymatic levels of serum glutamate oxaloacetate transaminase(AST), serum glutamate pyruvate transaminase(ALT), serum alkaline phosphatase(ALP) and total bilirubin were estimated along with estimation of superoxide dismutase(SOD) and malondialdehyde(MDA) levels in liver tissues.Further histopathological examination of the liver sections was carried out to support the induction of hepatotoxicity and hepatoprotective efficacy.Results:The extract showed potent activities on reducing power, lipid peroxide,DPPH,ABTS, superoxide anion, hydroxyl radical and metal chelation.The substantially elevated serum enzymatic levels ofAST,ALT,ALP and total bilirubin were found to be restored towards normalization significantly by theMENO-F in a dose dependent manner with maximum hepatoprotection at400 mg/kg dose level.The histopathological observations supported the biochemical evidences of hepatoprotection.Elevated level ofSOD and decreased level ofMDA further strengthen the hepatoprotective observations.Conclusions:The results of the present study strongly reveal thatMENO-F has potent antioxidant activity and hepatoprotective activity againstCCl4-induced hepatic damage in experimental animals.

  1. Adipose derived mesenchymal stem cells transplantation via portal vein improves microcirculation and ameliorates liver fibrosis induced by CCl4 in rats

    Directory of Open Access Journals (Sweden)

    Wang Yu

    2012-06-01

    Full Text Available Abstract Introduction Adipose derived mesenchymal stem cells (ADMSCs, carrying the similar characteristics to bone marrow mesenchymal stem cells, only much more abundant and easier to obtain, may be a promising treatment for liver fibrosis. We aim to investigate the therapeutic potential of ADMSCs transplantation in liver fibrosis caused by carbon tetrachloride (CCl4 in rats as well as its underlying mechanism, and to further explore the appropriate infusion pathway. Methods ADMSCs were isolated, cultured and identified. Placebo and ADMSCs were transplanted via portal vein and tail vein respectively into carbon tetrachloride (CCl4-induced liver fibrosis rats. Computed tomography (CT perfusion scan and microvessel counts were performed to measure the alteration of liver microcirculation after therapy. Liver function tests and histological findings were estimated. Results CT perfusion scan shown significant decrease of hepatic arterial perfusion index, significant increased portal vein perfusion, total liver perfusion in rats receiving ADMSCs from portal vein, and Factor VIII (FVIII immunohistochemical staining shown significant decrease of microvessels in rats receiving ADMSCs from portal vein, indicating microcirculation improvement in portal vein group. Vascular endothelial growth Factor (VEGF was significantly up-regulated in fibrosis models, and decreased after ADMSCs intraportal transplantation. A significant improvement of liver functional test and histological findings in portal vein group were observed. No significance was found in rats receiving ADMSCs from tail vein. Conclusions ADMSCs have a therapeutic effect against CCl4-mediated liver fibrosis. ADMSCs may benefit the fibrotic liver through alteration of microcirculation, evidenced by CT perfusion scan and down-regulation of VEGF. Intraportal transplantation is a better pathway than tail vein transplantation.

  2. 5, 8, 11, 14-eicosatetraynoic acid suppresses CCL2/MCP-1 expression in IFN-γ-stimulated astrocytes by increasing MAPK phosphatase-1 mRNA stability

    Directory of Open Access Journals (Sweden)

    Lee Jee

    2012-02-01

    Full Text Available Abstract Background The peroxisome proliferator-activated receptor (PPAR-α activator, 5,8,11,14-eicosatetraynoic acid (ETYA, is an arachidonic acid analog. It is reported to inhibit up-regulation of pro-inflammatory genes; however, its underlying mechanism of action is largely unknown. In the present study, we focused on the inhibitory action of ETYA on the expression of the chemokine, CCL2/MCP-1, which plays a key role in the initiation and progression of inflammation. Methods To determine the effect of ETYA, primary cultured rat astrocytes and microglia were stimulated with IFN-γ in the presence of ETYA and then, expression of CCL2/MCP-1 and MAPK phosphatase (MKP-1 were determined using RT-PCR and ELISA. MKP-1 mRNA stability was evaluated by treating actinomycin D. The effect of MKP-1 and human antigen R (HuR was analyzed by using specific siRNA transfection system. The localization of HuR was analyzed by immunocytochemistry and subcellular fractionation experiment. Results We found that ETYA suppressed CCL2/MCP-1 transcription and secretion of CCL2/MCP-1 protein through up-regulation of MKP-1mRNA levels, resulting in suppression of c-Jun N-terminal kinase (JNK phosphorylation and activator protein 1 (AP1 activity in IFN-γ-stimulated brain glial cells. Moreover, these effects of ETYA were independent of PPAR-α. Experiments using actinomycin D revealed that the ETYA-induced increase in MKP-1 mRNA levels reflected an increase in transcript stability. Knockdown experiments using small interfering RNA demonstrated that this increase in MKP-1 mRNA stability depended on HuR, an RNA-binding protein known to promote enhanced mRNA stability. Furthermore, ETYA-induced, HuR-mediated mRNA stabilization resulted from HuR-MKP-1 nucleocytoplasmic translocation, which served to protect MKP-1 mRNA from the mRNA degradation machinery. Conclusion ETYA induces MKP-1 through HuR at the post-transcriptional level in a receptor-independent manner. The mechanism

  3. CCL28 Controls Immunoglobulin (Ig)A Plasma Cell Accumulation in the Lactating Mammary Gland and IgA Antibody Transfer to the Neonate

    OpenAIRE

    Wilson, Eric; Butcher, Eugene C.

    2004-01-01

    The accumulation of immunoglobulin (Ig)A antibody-secreting cells (ASCs) in the lactating mammary gland leads to secretion of antibodies into milk and their passive transfer to the suckling newborn. This transfer of IgA from mother to infant provides transient immune protection against a variety of gastrointestinal pathogens. Here we show that the mucosal epithelial chemokine CCL28 is up-regulated in the mammary gland during lactation and that IgA ASCs from this tissue express CCR10 and migra...

  4. Protective effect of Tanreqing injection on acute hepatic injury induced by CCl4 in rats%痰热清注射液对急性肝损伤大鼠的保护作用

    Institute of Scientific and Technical Information of China (English)

    雷扬; 周爱民; 郭涛; 谭烨; 陶艳艳; 刘成海

    2013-01-01

    目的:观察痰热清注射液对四氯化碳(CCl4)诱导大鼠急性肝损伤的保护作用.方法:首先复制CCl4单次染毒模型,100% CCl45mL·kg-1皮下注射,同时设正常对照组,观察染毒3,6h后大鼠肝损伤变化;继而复制CCl4多次染毒肝损伤模型,首次100% CCl45 mL·kg-1,第2次50% CCl4橄榄油溶液2 mL·kg-1,第3次20% CCl4橄榄油溶液2 mL·kg-1皮下注射诱导急性肝损伤模型,首次CCl4染毒6h后分为模型组、甘草酸二铵治疗组、痰热清高、中、低剂量治疗组,连续尾静脉给药7d,同时设正常对照组.观察大鼠体重、肝体比;HE染色观察肝组织炎症病理;试剂盒检测血清丙氨酸氨基转移酶(ALT)、天门冬氨酸氨基转移酶(AST)、总胆红素(T.Bil)、直接胆红素(D.Bil)、胆碱酯酶(CHE)、总胆汁酸(TBA)、γ-氨基酰转肽酶(γ-GT)、白蛋白(Alb).结果:单次染毒模型:CCl4单次皮下注射6h后,大鼠血清AST活性与T.Bil含量明显升高,肝组织小叶结构紊乱、肝细胞肿胀明显,呈现明显肝损伤.多次染毒药效实验结果发现:与正常组相比,模型组的ALT,AST与γ-GT活性明显升高(P<0.05),TBA,T.Bil含量明显增加(P<0.05),CHE含量明显降低(P<0.05);HE染色显示,模型组肝小叶结构排列紊乱,肝细胞气球样变明显.与模型组相比,痰热清高、中剂量组与甘草酸二铵组血清肝功能、肝组织炎症病理明显改善,其中痰热清高、中剂量组优于甘草酸二铵组.结论:痰热清注射液具有显著抗CCl4诱导的大鼠急性肝损伤作用.%Objective:To observe the protective effect of Tanreqing injection(TRQ) on carbon tetrachloride-induced acute hepatic injury in rats.Method:Rats were randomly divided into the normal group and the model group,and injected subcutaneously with 100% CCl4 5 mL · kg-1 to establish the single CCl4 infection model,in order to observe the changes in rat liver injury after 3 h and 6 h.Subsequently,the multiple CCl4

  5. NASA Space Radiation Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — The NASA Space Radiation Laboratory (NSRL) at Brookhaven National Laboratory is a NASA funded facility, delivering heavy ion beams to a target area where scientists...

  6. Lincoln Laboratory Grid

    Data.gov (United States)

    Federal Laboratory Consortium — The Lincoln Laboratory Grid (LLGrid) is an interactive, on-demand parallel computing system that uses a large computing cluster to enable Laboratory researchers to...

  7. Application of gas chromatography to the study of the chemical effects produced by the radiolysis and the 35Cl(n,p)35S reaction on the CCl4

    International Nuclear Information System (INIS)

    In this work the gas radiochromatography, which is essential in the hot atom chemistry is used. By means of this technique the chemical effects of the 35Cl(n,p)35S, and the radiolysis of liquid CCl4 were studied. The samples of liquid CCl4 were capsulated in cuarzo bulbs and were deaereated by several cycles of freeze and pumping in a vacuum line. The sample's irradiation was made in the Triga Mark III Salazar reactor with an approximated flux of 1012n-cm2-s-1 during ten hours. The sample's analysis was made using a gas radiochromatographer composed of a gas chromatographer, proportional flux detector and an adequate electronic system. In this form were obtained the radiochromatographics of the 35S labelled compounds possibly formed by hot atom chemistry and at the same time the hexachloroetane formed by the secondary radiolytic effect of the ionizing radiation on the CCl4 was identified. (author)

  8. Comparative Study of Circulating MMP-7, CCL18, KL-6, SP-A, and SP-D as Disease Markers of Idiopathic Pulmonary Fibrosis.

    Science.gov (United States)

    Hamai, Kosuke; Iwamoto, Hiroshi; Ishikawa, Nobuhisa; Horimasu, Yasushi; Masuda, Takeshi; Miyamoto, Shintaro; Nakashima, Taku; Ohshimo, Shinichiro; Fujitaka, Kazunori; Hamada, Hironobu; Hattori, Noboru; Kohno, Nobuoki

    2016-01-01

    Background. Recent reports indicate that matrix metalloproteinase-7 (MMP-7) and CC-chemokine ligand 18 (CCL18) are potential disease markers of idiopathic pulmonary fibrosis (IPF). The objective of this study was to perform direct comparisons of these two biomarkers with three well-investigated serum markers of IPF, Krebs von den Lungen-6 (KL-6), surfactant protein-A (SP-A), and SP-D. Methods. The serum levels of MMP-7, CCL18, KL-6, SP-A, and SP-D were evaluated in 65 patients with IPF, 31 patients with bacterial pneumonia, and 101 healthy controls. The prognostic performance of these five biomarkers was evaluated in patients with IPF. Results. The serum levels of MMP-7, KL-6, and SP-D in patients with IPF were significantly elevated compared to those in patients with bacterial pneumonia and in the healthy controls. Multivariate survival analysis showed that serum MMP-7 and KL-6 levels were independent predictors in IPF patients. Moreover, elevated levels of both KL-6 and MMP-7 were associated with poorer survival rates in IPF patients, and the combination of both markers provided the best risk discrimination using the C statistic. Conclusions. The present results indicated that MMP-7 and KL-6 were promising prognostic markers of IPF, and the combination of the two markers might improve survival prediction in patients with IPF. PMID:27293304

  9. Cannabinoid receptors are involved in the protective effect of a novel curcumin derivative C66 against CCl4-induced liver fibrosis.

    Science.gov (United States)

    Huang, Si-Si; Chen, Da-Zhi; Wu, He; Chen, Rui-Cong; Du, Shan-Jie; Dong, Jia-Jia; Liang, Guang; Xu, Lan-Man; Wang, Xiao-Dong; Yang, Yong-Ping; Yu, Zhen-Ping; Feng, Wen-Ke; Chen, Yong-Ping

    2016-05-15

    Liver fibrosis is one of the major causes of morbidity and mortality worldwide and lacks efficient therapy. Recent studies suggest the curcumin protects liver from fibrosis. However, curcumin itself is in low bioavailable concentration when administered orally, and the protective mechanism remains poorly understood. The current study aimed to investigate whether a more stable derivative of curcumin, C66, protects against CCl4-inudced liver fibrosis and examine the underlying mechanism involving cannabinoid receptor (CB receptor). At a dose lower than curcumin itself, C66 displayed a superior anti-fibrotic effect. C66 significantly reduced collagen deposition, pro-inflammatory cytokine expression, and liver enzyme activities. Mechanistic study revealed that C66 treatment decreased CCl4-induced cannabinoid receptor 1 (CB1 receptor) expression and increased cannabinoid receptor 2 (CB2 receptor) expression, along with an inhibition of JNK/NF-κB-mediated inflammatory signaling. In conclusion, this curcumin derivative attenuates liver fibrosis likely involving a CB/JNK/NF-κB-mediated pathway. PMID:26945822

  10. Effects of undenatured whey protein supplementation on CXCL12- and CCL21-mediated B and T cell chemotaxis in diabetic mice

    Directory of Open Access Journals (Sweden)

    Badr Gamal

    2011-11-01

    Full Text Available Abstract Background Long and persistent uncontrolled diabetes tends to degenerate the immune system and leads to an increased incidence of infection. Whey proteins (WPs enhance immunity during early life and have a protective role in some immune disorders. In this study, the effects of camel WP on the chemotaxis of B and T cells to CXCL12 and CCL21 in diabetic mice were investigated. Results Flow cytometric analysis of the surface expressions of CXCR4 (CXCL12 receptor and CCR7 (CCL21 receptor on B and T cells revealed that the surface expressions of CXCR4 and CCR7 were not significantly altered in diabetic and WP-supplemented diabetic mice compared with control mice. Nevertheless, B and T lymphocytes from diabetic mice were found to be in a stunned state, with a marked and significant (P Conclusion Our data revealed the benefits of WP supplementation in enhancing cytoskeletal rearrangement and chemotaxis in B and T cells, and subsequently improving the immune response in diabetic mice.

  11. IL-17A synergistically enhances TNFα-induced IL-6 and CCL20 production in 3T3-L1 adipocytes.

    Science.gov (United States)

    Shinjo, Takanori; Iwashita, Misaki; Yamashita, Akiko; Sano, Tomomi; Tsuruta, Mitsudai; Matsunaga, Hiroaki; Sanui, Terukazu; Asano, Tomoichiro; Nishimura, Fusanori

    2016-08-19

    Interleukin-17A (IL-17A) is known to induce inflammatory responses and to be involved in the pathogenesis of not only autoimmune diseases, but also several metabolic and infectious diseases. In this study, IL-17A is shown to induce IL-6 expression in 3T3-L1 mature adipocytes. Interestingly, we found that IL-17A synergistically amplified TNFα-induced secretion of IL-6 and upregulation of IL-17RA expression in 3T3-L1 adipocytes. Its synergistic effects on IL-6 production were inhibited by pre-treatment with inhibitors of IκBα and JNK. Furthermore, IL-17A cooperatively enhanced LPS-mediated IL-6 production in 3T3-L1 adipocytes co-cultured with RAW264.7 macrophages. In addition, IL-17A also enhanced CCL20 production in 3T3-L1 adipocytes stimulated with TNFα or co-cultured with LPS-stimulated RAW macrophages. In high-fat diet-fed mouse epididymal adipose tissues, IL-17RA and RORγt mRNA levels were significantly increased and the serum level of CCL20 was also upregulated. Taken together, these data show that, in adipose tissues, IL-17A contributes to exacerbating insulin resistance-enhancing IL-6 production and promotes the infiltration of Th17 cells in cooperation with TNFα; these findings represent a novel hypothesis for the association between IL-17A-producing cells and type 2 diabetes. PMID:27311858

  12. Evolution of the Copper Surface in the Course of Oxidation by CCl4-L (L=THF, Dmf, Dmso): Scanning Probe Microscope Study

    Science.gov (United States)

    Panteleev, S. V.; Maslennikov, S. V.; Ignatov, S. K.; Spirina, I. V.; Kruglova, M. V.; Gribkov, B. A.; Vdovichev, S. N.

    2013-08-01

    The evolution of compact surface of the 100 nm copper film deposited on the glass-ceramics doped with vanadium coating in the course of the oxidation by the CCl4-L (L = dimethylformamide (DMF), tetrahydrofuran (THF), dimethylsulfoxide (DMSO), CCl4 concentration ≈ 1 mol/L) was studied by atomic force microscopy (AFM) in contact mode. The dynamics of active centers formation and destruction was investigated in the course of the oxidation process. The metallic sample dissolution rate was estimated as a function of the coordinating solvent nature. The development of the metal surface oxidation was established to lead to a significant increase of surface roughness. This phenomenon can be explained by the fact that different parts of the surface react at different rates. Further course of the reaction leads to a significant decrease of the surface roughness of copper films. The amount of the metal reacted has an almost linear dependence on the reaction time. AFM scans indicate that there is the same mechanism of the reaction between copper and carbon tetrachloride for all solvents.

  13. Impact of a CXCL12/CXCR4 Antagonist in Bleomycin (BLM) Induced Pulmonary Fibrosis and Carbon Tetrachloride (CCl4) Induced Hepatic Fibrosis in Mice

    Science.gov (United States)

    Chow, Leola N.; Schreiner, Petra; Ng, Betina Y. Y.; Lo, Bernard; Hughes, Michael R.; Scott, R. Wilder; Gusti, Vionarica; Lecour, Samantha; Simonson, Eric; Manisali, Irina; Barta, Ingrid; McNagny, Kelly M.; Crawford, Jason; Webb, Murray; Underhill, T. Michael

    2016-01-01

    Modulation of chemokine CXCL12 and its receptor CXCR4 has been implicated in attenuation of bleomycin (BLM)-induced pulmonary fibrosis and carbon tetrachloride (CCl4)-induced hepatic injury. In pulmonary fibrosis, published reports suggest that collagen production in the injured lung is derived from fibrocytes recruited from the circulation in response to release of pulmonary CXCL12. Conversely, in hepatic fibrosis, resident hepatic stellate cells (HSC), the key cell type in progression of fibrosis, upregulate CXCR4 expression in response to activation. Further, CXCL12 induces HSC proliferation and subsequent production of collagen I. In the current study, we evaluated AMD070, an orally bioavailable inhibitor of CXCL12/CXCR4 in alleviating BLM-induced pulmonary and CCl4-induced hepatic fibrosis in mice. Similar to other CXCR4 antagonists, treatment with AMD070 significantly increased leukocyte mobilization. However, in these two models of fibrosis, AMD070 had a negligible impact on extracellular matrix deposition. Interestingly, our results indicated that CXCL12/CXCR4 signaling has a role in improving mortality associated with BLM induced pulmonary injury, likely through dampening an early inflammatory response and/or vascular leakage. Together, these findings indicate that the CXCL12-CXCR4 signaling axis is not an effective target for reducing fibrosis. PMID:26998906

  14. Laboratory-acquired brucellosis

    DEFF Research Database (Denmark)

    Fabiansen, C.; Knudsen, J.D.; Lebech, A.M.

    2008-01-01

    Brucellosis is a rare disease in Denmark. We describe one case of laboratory-acquired brucellosis from an index patient to a laboratory technician following exposure to an infected blood culture in a clinical microbiology laboratory Udgivelsesdato: 2008/6/9......Brucellosis is a rare disease in Denmark. We describe one case of laboratory-acquired brucellosis from an index patient to a laboratory technician following exposure to an infected blood culture in a clinical microbiology laboratory Udgivelsesdato: 2008/6/9...

  15. Neural Systems Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — As part of the Electrical and Computer Engineering Department and The Institute for System Research, the Neural Systems Laboratory studies the functionality of the...

  16. Optical Remote Sensing Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — The Optical Remote Sensing Laboratory deploys rugged, cutting-edge electro-optical instrumentation for the collection of various event signatures, with expertise in...

  17. Central Laboratories Services

    Data.gov (United States)

    Federal Laboratory Consortium — The TVA Central Laboratories Services is a comprehensive technical support center, offering you a complete range of scientific, engineering, and technical services....

  18. ANALYTICAL MICROBIOLOGY LABORATORY

    Data.gov (United States)

    Federal Laboratory Consortium — This laboratory contains equipment that performs a broad array of microbiological analyses for pathogenic and spoilage microorganisms. It performs challenge studies...

  19. Environmental Microbiology Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — The Environmental Microbiology Laboratory, located in Bldg. 644 provides a dual-gas respirometer for measurement of oxygen consumption and carbon dioxide evolution...

  20. Vehicle Development Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — FUNCTION: Supports the development of prototype deployment platform vehicles for offboard countermeasure systems. DESCRIPTION: The Vehicle Development Laboratory is...

  1. Intelligent Optics Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — The Intelligent Optics Laboratory supports sophisticated investigations on adaptive and nonlinear optics; advancedimaging and image processing; ground-to-ground and...

  2. Laboratory of Chemical Physics

    Data.gov (United States)

    Federal Laboratory Consortium — Current research in the Laboratory of Chemical Physics is primarily concerned with experimental, theoretical, and computational problems in the structure, dynamics,...

  3. Rapid Prototyping Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — The ARDEC Rapid Prototyping (RP) Laboratory was established in December 1992 to provide low cost RP capabilities to the ARDEC engineering community. The Stratasys,...

  4. Fuels Processing Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — NETL’s Fuels Processing Laboratory in Morgantown, WV, provides researchers with the equipment they need to thoroughly explore the catalytic issues associated with...

  5. Space Weather Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — The Space Weather Computational Laboratory is a Unix and PC based modeling and simulation facility devoted to research analysis of naturally occurring electrically...

  6. Embedded Processor Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — The Embedded Processor Laboratory provides the means to design, develop, fabricate, and test embedded computers for missile guidance electronics systems in support...

  7. Thermogravimetric Analysis Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — At NETL’s Thermogravimetric Analysis Laboratory in Morgantown, WV, researchers study how chemical looping combustion (CLC) can be applied to fossil energy systems....

  8. FOOD SAFETY TESTING LABORATORY

    Data.gov (United States)

    Federal Laboratory Consortium — This laboratory develops screening assays, tests and modifies biosensor equipment, and optimizes food safety testing protocols for the military and civilian sector...

  9. COGNITIVE PERFORMANCE LABORATORY

    Data.gov (United States)

    Federal Laboratory Consortium — This laboratory conducts basic and applied human research studies to characterize cognitive performance as influenced by militarily-relevant contextual and physical...

  10. Atmospheric Measurements Laboratory (AML)

    Data.gov (United States)

    Federal Laboratory Consortium — The Atmospheric Measurements Laboratory (AML) is one of the nation's leading research facilities for understanding aerosols, clouds, and their interactions. The AML...

  11. Virtual Training Devices Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — The Virtual Training Devices (VTD) Laboratory at the Life Cycle Software Engineering Center, Picatinny Arsenal, provides a software testing and support environment...

  12. Engineered Natural Systems Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — With its pressure vessels that simulate the pressures and temperatures found deep underground, NETL’s Engineered Natural Systems Laboratory in Pittsburgh, PA, gives...

  13. Tactical Systems Integration Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — The Tactical Systems Integration Laboratory is used to design and integrate computer hardware and software and related electronic subsystems for tactical vehicles....

  14. [Theme: Using Laboratories.

    Science.gov (United States)

    Pritchard, Jack; Braker, Clifton

    1982-01-01

    Pritchard discusses the opportunities for applied learning afforded by laboratories. Braker describes the evaluation of cognitive, affective, and psychomotor skills in the agricultural mechanics laboratory. (SK)

  15. Synchrotron radiation

    International Nuclear Information System (INIS)

    A detailed account of the research work associated with the Synchrotron Radiation Source at Daresbury Laboratory, United Kingdom, in 1984/85, is presented in the Appendix to the Laboratory's Annual Report. (U.K.)

  16. Laboratory Information Systems.

    Science.gov (United States)

    Henricks, Walter H

    2016-03-01

    Laboratory information systems (LISs) supply mission-critical capabilities for the vast array of information-processing needs of modern laboratories. LIS architectures include mainframe, client-server, and thin client configurations. The LIS database software manages a laboratory's data. LIS dictionaries are database tables that a laboratory uses to tailor an LIS to the unique needs of that laboratory. Anatomic pathology LIS (APLIS) functions play key roles throughout the pathology workflow, and laboratories rely on LIS management reports to monitor operations. This article describes the structure and functions of APLISs, with emphasis on their roles in laboratory operations and their relevance to pathologists. PMID:26851660

  17. Energy Materials Research Laboratory (EMRL)

    Data.gov (United States)

    Federal Laboratory Consortium — The Energy Materials Research Laboratory at the Savannah River National Laboratory (SRNL) creates a cross-disciplinary laboratory facility that lends itself to the...

  18. Association of -1382A>G CCL11 gene variant with ischemic stroke, its subtypes and hemorrhagic stroke in a South Indian population

    Directory of Open Access Journals (Sweden)

    Sitara Roy

    2014-01-01

    Full Text Available Background: CCL11 (Eotaxin-1 is an important inflammatory cytokine belonging to the CC family of chemokines associated with a number of infection or inflammation-related diseases such as atherosclerosis and stroke. We investigated the association of CCL11 gene polymorphism rs4795895-1382A>G with ischemic and hemorrhagic stroke. Materials and Methods: Six hundred and twenty ischemic stroke patients, 620 age- and sex-matched healthy controls, and 220 hemorrhagic stroke patients, 220 age- and sex-matched healthy controls were included in the present study. The CCL11 gene polymorphism rs4795895-1382A>G was determined using PCR-RFLP technique. Results: We found a statistically significant difference in the genotypic distribution between ischemic stroke patients and controls (For GG vs. AA, χ2 = 7.604; P < 0.001, Odds ratio = 2.793; 95% CI = 1.308-5.9. For GG vs. AA + AG, χ2 = 44.8, P < 0.001, Odds ratio = 2.382 (95% CI = 1.842-3.081. A significant difference was observed in the frequency of G and A alleles in patients and controls (For G vs. A, χ2 = 43.26; P < 0.001, Odds ratio = 2.127; 95% CI = 1.693-2.672. Statistically significant difference was observed in the genotypic distribution between hemorrhagic stroke patients and controls (For GG vs. AG, χ2 = 26.78; P = 0.001, Odds ratio = 3.5; 95% CI = 2.162-5.824. A significant difference was observed in the frequency of G and A alleles in patients and controls (For G vs. A, χ2 = 41.98; P = 0.001, Odds ratio = 4.1; 95% CI = 2.61-6.44. Conclusion: The results of the present study show that the GG genotype is a significant risk factor for ischemic as well as hemorrhagic stroke. Further, the frequency of the GG genotype was observed to be higher in hemorrhagic stroke patients in comparison with ischemic stroke. Evaluating the association with ischemic stroke subtypes, a significant association was observed with intracranial large artery atherosclerosis and lacunar stroke.

  19. Prophylactic Subacute Administration of Zinc Increases CCL2, CCR2, FGF2, and IGF-1 Expression and Prevents the Long-Term Memory Loss in a Rat Model of Cerebral Hypoxia-Ischemia

    Directory of Open Access Journals (Sweden)

    Victor Manuel Blanco-Alvarez

    2015-01-01

    Full Text Available Prophylactic subacute administration of zinc decreases lipoperoxidation and cell death following a transient cerebral hypoxia-ischemia, thus suggesting neuroprotective and preconditioning effects. Chemokines and growth factors are also involved in the neuroprotective effect in hypoxia-ischemia. We explored whether zinc prevents the cerebral cortex-hippocampus injury through regulation of CCL2, CCR2, FGF2, and IGF-1 expression following a 10 min of common carotid artery occlusion (CCAO. Male rats were grouped as follows: (1 Zn96h, rats injected with ZnCl2 (one dose every 24 h during four days; (2 Zn96h + CCAO, rats treated with ZnCl2 before CCAO; (3 CCAO, rats with CCAO only; (4 Sham group, rats with mock CCAO; and (5 untreated rats. The cerebral cortex-hippocampus was dissected at different times before and after CCAO. CCL2/CCR2, FGF2, and IGF-1 expression was assessed by RT-PCR and ELISA. Learning in Morris Water Maze was achieved by daily training during 5 days. Long-term memory was evaluated on day 7 after learning. Subacute administration of zinc increased expression of CCL2, CCR2, FGF2, and IGF-1 in the early and late phases of postreperfusion and prevented the CCAO-induced memory loss in the rat. These results might be explained by the induction of neural plasticity because of the expression of CCL2 and growth factors.

  20. Nitrosyl bromo complexes of rhenium: Re(NO)2Br3 and [Re(NO)2Br4]-; crystal structure of PPh4[Re(NO)2Br4] . 2 CCl4

    International Nuclear Information System (INIS)

    PPh4[Re(NO)2Br4] is prepared in the form of dark red-brown powder by the reaction of PPh4[Re(NO)2Cl4] with excess boron tribromide. From a solution of CH2Br2 and CCl4 it crystallizes with two moles CCl4, one of which splits off easily in vacuo. The reaction of aluminium tribromide in CH2Br2 solution leads to a slightly soluble red-brown Re(NO)2Br3 powder. The i.r. spectra indicate cis positions of the covalently bound NO ligands in both complexes. Re(NO)2Br3 is dimeric via bromo bridges. The crystal structure determination of PPh4[Re(NO)2Br4] . 2 CCl4 was solved by X-ray diffraction methods at -115 0C. The complex crystallizes in the monoclinic space group P21/c with four formula units per unit cell (4434 independent reflexions, R = 0.085). The unit cell dimensions are a = 1092.3 pm, b = 2088.0 pm, c = 1657.6 pm, β = 96.100. The structure consists of P(C6H5)4+ cations, [Re(NO)2Br4]- anions and intercalated CCl4 molecules. In the anion the NO groups are covalently bound to the Re atom like Re-=N+=O and they are arranged in cis position to one another. (author)

  1. Pd(OAc)2与PPh3在氯代甲烷中的反应研究%STUDY OF THE REACTION OF Pd(OAc)2 WITH PPh3 IN CCl4

    Institute of Scientific and Technical Information of China (English)

    韦凤萍; 黄永仁; 冯良波; 汪汉卿

    2001-01-01

    The complex Pd(PPh3)2Cl2*CCl4 has been prepared by treatment of Pd(OAc)2 with PPh3 in CCl4. 1H NMR, 31P NMR, data are given. The molecular structure of Pd(PPh3)2Cl2 has been determined by single crystal X-rays diffraction. The reaction mechanism is tentatively proposed and discussed. Radicals were trapped by PBN. This reaction was proved to be a free radical reaction by EPR-ST method. The solvent CCl4 participated in the reaction.%用Pd(OAc)2与PPh3在四氯甲烷中反应,合成了配合物PdCl2(PPh3)2*CCl4,得到单晶,用X-ray衍射确定了单晶结构.应用电子顺磁共振-自旋捕获(EPR-ST)技术研究了其反应的机理.捕获了含碳自由基中间体,提出了反应机理.

  2. Dynamics of heavy-Rydberg ion-pair formation in K(14p,20p)-SF6, CCl4 collisions

    Science.gov (United States)

    Wang, C. H.; Kelley, M.; Buathong, S.; Dunning, F. B.

    2014-06-01

    The dynamics of formation of heavy-Rydberg ion-pair states through electron transfer in K(np)-SF6, CCl4 collisions is examined by measuring the velocity, angular, and binding energy distributions of the product ion pairs. The results are analyzed with the aid of a Monte Carlo collision code that models both the initial electron capture and the subsequent evolution of the ion pairs. The model simulations are in good agreement with the experimental data and highlight the factors such as Rydberg atom size, the kinetic energy of relative motion of the Rydberg atom and target particle, and (in the case of attaching targets that dissociate) the energetics of dissociation that can be used to control the properties of the product ion-pair states.

  3. CX3CL1/CX3CR1 and CCL2/CCR2 Chemokine/Chemokine Receptor Complex in Patients with AMD

    DEFF Research Database (Denmark)

    Falk, Mads Krüger; Singh, Amardeep; Faber, Carsten; Nissen, Mogens Holst; Hviid, Thomas; Sørensen, Torben Lykke

    2014-01-01

    PURPOSE: The chemokine receptors CX3CR1 and CCR2 have been implicated in the development of age-related macular degeneration (AMD). The evidence is mainly derived from experimental cell studies and murine models of AMD. The purpose of this study was to investigate the association between expression...... of CX3CR1 and CCR2 on different leukocyte subsets and AMD. Furthermore we measured the plasma levels of ligands CX3CL1 and CCL2. METHODS: Patients attending our department were asked to participate in the study. The diagnosis of AMD was based on clinical examination and multimodal imaging techniques....... Chemokine plasma level and chemokine receptor expression were measured by flow-cytometry. RESULTS: A total of 150 participants were included. We found a significantly lower expression of CX3CR1 on CD8+ T cells in the neovascular AMD group compared to the control group (p = 0.04). We found a significant...

  4. Biosynthesis of silver nanoparticles from Premna serratifolia L. leaf and its anticancer activity in CCl4-induced hepato-cancerous Swiss albino mice

    Science.gov (United States)

    Arockia John Paul, J.; Karunai Selvi, B.; Karmegam, N.

    2015-11-01

    In this study, we report the biosynthesis of silver nanoparticles using the ethanolic leaf powder extract of Premna serratifolia L. and its anticancer activity in carbon tetra chloride (CCl4)-induced liver cancer in Swiss albino mice (Balb/c). The synthesized silver nanoparticles were characterized by SEM, FTIR and XRD analyses. The Debye-Scherrer equation was used to calculate particle size and the average size of silver nanoparticles synthesized from P. serratifolia leaf extract was 22.97 nm. The typical pattern revealed that the sample contained cubic structure of silver nanoparticles. FTIR analysis confirmed that the bioreduction of silver ions to silver nanoparticles is due to reduction by capping material of the plant extract. The silver nanoparticles of P. serratifolia leaf extract were effective in treating liver cancer in Swiss albino mice when compared with P. serratifolia leaf extract with isoleucine.

  5. CCl0/H2O/CTAB乳状液的稳定性研究%STUDY ON STABILITY OF EMULSION COMPOSED OF CARBON TETRACHLORIDE/WATER/CETYLTRIMETHYLAMMONIUM BROMIDE

    Institute of Scientific and Technical Information of China (English)

    倪良; 蒋文华; 韩世钧

    2001-01-01

    制备了不同组成的CCl4/H2O/十六烷基三甲基溴化铵(CTAB)乳状液,用电导法测定了含与不含添加剂(正已醇和水杨酸钠)条件下,乳状液富油相区不同时间的电导率.为了寻找乳状液的稳定性与电导率之间的关系,提出了富油相增比电导率的概念,并由增比电导率与时间的关系讨论了乳状液的稳定性.

  6. Effects of carbon dioxide and nitrogen on adhesive growth and expressions of E-cadherin and VEGF of human colon cancer cell CCL-228

    Institute of Scientific and Technical Information of China (English)

    Kai-Lin Cai; Guo-Bing Wang; Li-Juan Xiong

    2003-01-01

    AIM: To study the effects of carbon dioxide on the metastatic capability of cancer cells, and to compare them with that of nitrogen.METHODS: The colon cancer cell CCL-228 was treated with 100 % carbon dioxide or nitrogen at different time points and then cultured under normal condition. Twelve hours after the treatment, the survival rates of suspension cells and the expressions of e-cadherin and VEGF were examined.RESULTS: After 60 min of carbon dioxide and longer time of nitrogen treatment, the suspended cells increased and the expression of e-cadherin decreased while the expression of VEGF was enhanced significantly. And the effects of nitrogen were similar to, but weaker than, those of carbon dioxide.CONCLUSION: Carbon dioxide may improve the metastatic capability of cancer cells and its effects are significantly stronger than that of nitrogen. A sequential use of carbon dioxide and nitrogen in pneumoperitoneum may take the advantage of both gases.

  7. PLAG (1-Palmitoyl-2-Linoleoyl-3-Acetyl-rac-Glycerol) Modulates Eosinophil Chemotaxis by Regulating CCL26 Expression from Epithelial Cells.

    Science.gov (United States)

    Jeong, Jinseon; Kim, Young-Jun; Yoon, Sun Young; Kim, Yong-Jae; Kim, Joo Heon; Sohn, Ki-Young; Kim, Heung-Jae; Han, Yong-Hae; Chong, Saeho; Kim, Jae Wha

    2016-01-01

    Increased number of eosinophils in the circulation and sputum is associated with the severity of asthma. The respiratory epithelium produces chemokine (C-C motif) ligands (CCL) which recruits and activates eosinophils. A chemically synthesized monoacetyl-diglyceride, PLAG (1-palmitoyl-2-linoleoyl-3-acetyl-rac-glycerol) is a major constituent in the antlers of Sika deer (Cervus nippon Temminck) which has been used in oriental medicine. This study was aimed to investigate the molecular mechanism of PLAG effect on the alleviation of asthma phenotypes. A549, a human alveolar basal epithelial cell, and HaCaT, a human keratinocyte, were activated by the treatment of interleukin-4 (IL-4), and the expression of chemokines, known to be effective on the induction of eosinophil migration was analyzed by RT-PCR. The expression of IL-4 induced genes was modulated by the co-treatment of PLAG. Especially, CCL26 expression from the stimulated epithelial cells was significantly blocked by PLAG, which was confirmed by ELISA. The transcriptional activity of signal transducer and activator of transcription 6 (STAT6), activated by IL-4 mediated phosphorylation and nuclear translocation, was down-regulated by PLAG in a concentration-dependent manner. In ovalbumin-induced mouse model, the infiltration of immune cells into the respiratory tract was decreased by PLAG administration. Cytological analysis of the isolated bronchoalveolar lavage fluid (BALF) cells proved the infiltration of eosinophils was significantly reduced by PLAG. In addition, PLAG inhibited the migration of murine bone marrow-derived eosinophils, and human eosinophil cell line, EoL-1, which was induced by the addition of A549 culture medium. PMID:27010397

  8. EVALUATION OF HEPATOPROTECTIVE EFFECT OF CALOTROPIS PROCERA (AIT R.BR ROOT EXTRACT AGAINST CCL4 INDUCED HEPATO-OXIDATIVE STRESS IN ALBINO RATS

    Directory of Open Access Journals (Sweden)

    Patil Prakash

    2011-02-01

    Full Text Available In the present study, Calotropis procera (Asclepediaceae was evaluated for its possible hepatoprotective and antioxidant potential. Hepatoprotective activity of the methanol extract (MCP of the root bark was determined using carbon tetrachloride (CCl4 induced liver injury in rats. MCP extract evaluated, at an oral dose of 200 and 400 mg kg1. The animals were weighed each and divided in groups of six. Liver damage was achieved by injecting CCl4 in olive oil (1:1 0.8 mL kg-1. The treatment groups pretreated with above extracts. Silymarin was used as reference standard drug. At the end of 7 days, blood was collected, liver extracted, weighed, processed for histopathological assessments and for antioxidant activity. The MCP exhibited a significant (p<0.05 hepato-protective effect by lowering the elevated serum levels of serum transaminases (AST and ALT, Alkaline phosphatase (ALP, total and direct serum bilirubin, cholesterol and significantly increasing high density lipoprotein (HDL and moderately increasing total protein and albumin. These biochemical observations were supplemented by histopathological examination of liver sections. Further, the effects of the MCP extract on antioxidant enzymes also have been investigated to elucidate the possible mechanism of its hepatoprotective activity. The MCP extract exhibited a significant effect(p<0.05 in a dose dependent manner by modifying the levels of reduced glutathione, super oxide dimutase, catalase activity and malondialdehyde equivalent, an index of lipid peroxidation of the liver. These findings suggest that the MCP extract exhibited a dose dependent significant effect on hepatoprotective and antioxidant potential which revitalidates the use of this plant for the treatment of liver toxicity in oriental traditional medicine.

  9. Geological Services Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — Researchers use computed tomography (CT) scanners at NETL’s Geological Services Laboratory in Morgantown, WV, to peer into geologic core samples to determine how...

  10. High Bay Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — This laboratory is a specially constructed facility with elevated (37 feet) ceilings and an overhead catwalk, and which is dedicated to research efforts in reducing...

  11. Clinical Laboratory Fee Schedule

    Data.gov (United States)

    U.S. Department of Health & Human Services — Outpatient clinical laboratory services are paid based on a fee schedule in accordance with Section 1833(h) of the Social Security Act. The clinical laboratory fee...

  12. Building the Korogwe Laboratory

    DEFF Research Database (Denmark)

    Knudsen, Jakob; von Seidlein, Lorenz; Richard, Jean Pierre

    2011-01-01

    An illustrated description of the building of a biomedical research laboratory in Korogwe, Tanzania.......An illustrated description of the building of a biomedical research laboratory in Korogwe, Tanzania....

  13. Space Systems Laboratory (SSL)

    Data.gov (United States)

    Federal Laboratory Consortium — The Space Systems Laboratory (SSL) is part of the Aerospace Engineering Department and A. James Clark School of Engineering at the University of Maryland in College...

  14. Moriah Wind System Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — Purpose: The Moriah Wind System Laboratory provides in-service support for the more than 50 U.S. Navy, U.S. Coast Guard and Military Sealift Command ships on which...

  15. FLEXIBLE FOOD PACKAGING LABORATORY

    Data.gov (United States)

    Federal Laboratory Consortium — This laboratory contains equipment to fabricate and test prototype packages of many types and sizes (e.g., bags, pouches, trays, cartons, etc.). This equipment can...

  16. Electro-Deposition Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — The electro-deposition laboratory can electro-deposit various coatings onto small test samples and bench level prototypes. This facility provides the foundation for...

  17. Aquatic Research Laboratory (ARL)

    Data.gov (United States)

    Federal Laboratory Consortium — Columbia River and groundwater well water sources are delivered to the Aquatic Research Laboratory (ARL), where these resources are used to conduct research on fish...

  18. Laboratory of Biological Modeling

    Data.gov (United States)

    Federal Laboratory Consortium — The Laboratory of Biological Modeling is defined by both its methodologies and its areas of application. We use mathematical modeling in many forms and apply it to...

  19. Aircraft Fire Protection Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — The Navy Aircraft Protection Laboratory provides complete test support for all Navy air vehicle fire protection systems. The facility allows for the simulation of a...

  20. Energetics Laboratory Facilities

    Data.gov (United States)

    Federal Laboratory Consortium — These energetic materials laboratories are equipped with explosion proof hoods with blow out walls for added safety, that are certified for safe handling of primary...

  1. Laboratory Demographics Lookup Tool

    Data.gov (United States)

    U.S. Department of Health & Human Services — This website provides demographic information about laboratories, including CLIA number, facility name and address, where the laboratory testing is performed, the...

  2. Protective Systems Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — This laboratory is a 40 by 28 by 9 foot facility that is equipped with tools for the development of various items of control technology related to the transmission...

  3. Mechanical Testing Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — NETL’s Mechanical Testing Laboratory in Albany, OR, helps researchers investigate materials that can withstand the heat and pressure commonly found in fossil energy...

  4. EPA Environmental Chemistry Laboratory

    Science.gov (United States)

    1993-01-01

    The Environmental Protection Agency's (EPA) Chemistry Laboratory (ECL) is a national program laboratory specializing in residue chemistry analysis under the jurisdiction of the EPA's Office of Pesticide Programs in Washington, D.C. At Stennis Space Center, the laboratory's work supports many federal anti-pollution laws. The laboratory analyzes environmental and human samples to determine the presence and amount of agricultural chemicals and related substances. Pictured, ECL chemists analyze environmental and human samples for the presence of pesticides and other pollutants.

  5. Laboratory Activities in Israel

    Science.gov (United States)

    Mamlok-Naaman, Rachel; Barnea, Nitza

    2012-01-01

    Laboratory activities have long had a distinctive and central role in the science curriculum, and science educators have suggested that many benefits accrue from engaging students in science laboratory activities. Many research studies have been conducted to investigate the educational effectiveness of laboratory work in science education in…

  6. Skylab mobile laboratory

    Science.gov (United States)

    Primeaux, G. R.; Larue, M. A.

    1975-01-01

    The Skylab mobile laboratory was designed to provide the capability to obtain necessary data on the Skylab crewmen 30 days before lift-off, within 1 hour after recovery, and until preflight physiological baselines were reattained. The mobile laboratory complex consisted of six laboratories that supported cardiovascular, metabolic, nutrition and endocrinology, operational medicine, blood, and microbiology experiments; a utility package; and two shipping containers. The objectives and equipment requirements of the Skylab mobile laboratory and the data acquisition systems are discussed along with processes such as permanently mounting equipment in the individual laboratories and methods of testing and transporting the units. The operational performance, in terms of amounts of data collected, and the concept of mobile laboratories for medical and scientific experiments are evaluated. The Skylab mobile laboratory succeeded in facilitating the data collection and sample preservation associated with the three Skylab manned flights.

  7. Personalized laboratory medicine

    DEFF Research Database (Denmark)

    Pazzagli, M.; Malentacchi, F.; Mancini, I.;

    2015-01-01

    Developments in "omics" are creating a paradigm shift in Laboratory Medicine leading to Personalised Medicine. This allows the increasing in diagnostics and therapeutics focused on individuals rather than populations. In order to investigate whether Laboratory Medicine is able to implement new...... diagnostic tools and expertise and commands proper state-of-the-art knowledge about Personalized Medicine and Laboratory Medicine in Europe, the joint Working Group "Personalized Laboratory Medicine" of the EFLM and ESPT societies compiled and conducted the Questionnaire "Is Laboratory Medicine ready...... for the era of Personalized Medicine?". 48 laboratories from 18 European countries participated at this survey. The answers of the participating Laboratory Medicine professionals indicate that they are aware that Personalized Medicine can represent a new and promising health model. Whereas they are aware...

  8. Optics/Optical Diagnostics Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — The Optics/Optical Diagnostics Laboratory supports graduate instruction in optics, optical and laser diagnostics and electro-optics. The optics laboratory provides...

  9. Heat Flux Instrumentation Laboratory (HFIL)

    Data.gov (United States)

    Federal Laboratory Consortium — Description: The Heat Flux Instrumentation Laboratory is used to develop advanced, flexible, thin film gauge instrumentation for the Air Force Research Laboratory....

  10. Induction of IL-6 and CCL5 (RANTES in human respiratory epithelial (A549 cells by clinical isolates of respiratory syncytial virus is strain specific

    Directory of Open Access Journals (Sweden)

    Levitz Ruth

    2012-09-01

    Full Text Available Abstract Background Respiratory syncytial virus (RSV is the major respiratory pathogen of infants and young children. During each seasonal epidemic, multiple strains of both subgroup A and B viruses circulate in the community. Like other RNA viruses, RSV genome replication is prone to errors that results in a heterogeneous population of viral strains some of which may possess differences in virulence. We sought to determine whether clinical isolates of RSV differ in their capacity to induce inflammatory cytokines IL-6 and CCL5 (previously known as RANTES [regulated upon activation, normal T-cell expressed and secreted protein], which are known to be induced in vitro and in vivo in response to RSV, during infection of A549 cells. Results Screening of subgroup A and B isolates revealed heterogeneity among strains to induce IL-6 and CCL5. We chose two subgroup B strains, New Haven (NH1067 and NH1125, for further analysis because of their marked differences in cytokine inducing properties and because subgroup B strains, in general, are less genetically heterogeneous as compared to subgroup A strains. At 12 and 24 hours post infection RSV strains, NH1067 and NH1125 differed in their capacity to induce IL-6 by an order of magnitude or more. The concentrations of IL-6 and CCL5 were dependent on the dose of infectious virus and the concentration of these cytokines induced by NH1125 was greater than that of those induced by NH1067 when the multiplicity of infection of NH1067 used was as much as 10-fold higher than that of NH1125. The induction of IL-6 was dependent on viable virus as infection with UV-inactivated virus did not induce IL-6. The difference in IL-6 induction most likely could not be explained by differences in viral replication kinetics. The intracellular level of RSV RNA, as determined by quantitative RT-PCR, was indistinguishable between the 2 strains though the titer of progeny virus produced by NH1125 was greater than that produced by

  11. pH-Responsive Tumor-Targetable Theranostic Nanovectors Based on Core Crosslinked (CCL Micelles with Fluorescence and Magnetic Resonance (MR Dual Imaging Modalities and Drug Delivery Performance

    Directory of Open Access Journals (Sweden)

    Sidan Tian

    2016-06-01

    Full Text Available The development of novel theranostic nanovectors is of particular interest in treating formidable diseases (e.g., cancers. Herein, we report a new tumor-targetable theranostic agent based on core crosslinked (CCL micelles, possessing tumor targetable moieties and fluorescence and magnetic resonance (MR dual imaging modalities. An azide-terminated diblock copolymer, N3-POEGMA-b-P(DPA-co-GMA, was synthesized via consecutive atom transfer radical polymerization (ATRP, where OEGMA, DPA, and GMA are oligo(ethylene glycolmethyl ether methacrylate, 2-(diisopropylaminoethyl methacrylate, and glycidyl methacrylate, respectively. The resulting diblock copolymer was further functionalized with DOTA(Gd (DOTA is 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetrakisacetic acid or benzaldehyde moieties via copper(I-catalyzed alkyne-azide cycloaddition (CuAAC chemistry, resulting in the formation of DOTA(Gd-POEGMA-b-P(DPA-co-GMA and benzaldehyde-POEGMA-b-P(DPA-co-GMA copolymers. The resultant block copolymers co-assembled into mixed micelles at neutral pH in the presence of tetrakis[4-(2-mercaptoethoxyphenyl]ethylene (TPE-4SH, which underwent spontaneous crosslinking reactions with GMA residues embedded within the micellar cores, simultaneously switching on TPE fluorescence due to the restriction of intramolecular rotation. Moreover, camptothecin (CPT was encapsulated into the crosslinked cores at neutral pH, and tumor-targeting pH low insertion peptide (pHLIP, sequence: AEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTCG moieties were attached to the coronas through the Schiff base chemistry, yielding a theranostic nanovector with fluorescence and MR dual imaging modalities and tumor-targeting capability. The nanovectors can be efficiently taken up by A549 cells, as monitored by TPE fluorescence. After internalization, intracellular acidic pH triggered the release of loaded CPT, killing cancer cells in a selective manner. On the other hand, the nanovectors labeled with DOTA

  12. Therapeutic efficacy of ethanolic extract of Aerva javanica aerial parts in the amelioration of CCl4-induced hepatotoxicity and oxidative damage in rats

    Science.gov (United States)

    Arbab, Ahmed H.; Parvez, Mohammad K.; Al-Dosari, Mohammed S.; Al-Rehaily, Adnan J.; Ibrahim, Khalid E.; Alam, Perwez; Alsaid, Mansour S.; Rafatullah, Syed

    2016-01-01

    Background Liver diseases, the fifth most common cause of global death, can be metabolic, toxin-induced, or infective. Though approximately 35 Saudi medicinal plants are traditionally used to treat liver disorders, the hepatoprotective potential of Aerva javanica has not been explored. Objective To investigate the antioxidative and hepatoprotective effect of Aerva javanica. Design Total ethanol extract of A. javanica aerial parts was prepared and tested on DCFH-toxicated HepG2 cells ex vivo, and in CCl4-injured Wistar rats in vivo. MTT assay was used to determine cell viability and the serum biochemical markers of liver injury as well as histopathology was performed. In vitro 1,1-diphenyl-2-picrylhydrazyl and β-carotene free-radical scavenging assay and phytochemical screening of the extract were done. Furthermore, A. javanica total extract was standardized and validated by high-performance thin layer chromatographic method. Results MTT assay showed that, while DCFH-injured cells were recovered to ~56.7% by 100 µg/ml of the extract, a 200 µg/ml dose resulted in hepatocytes recovery by ~90.2%. Oral administration of the extract (100 and 200 mg/kg.bw/day) significantly normalized the serum glutamate oxaloacetate transaminase, serum glutamate pyruvate transaminase, gamma-glutamyl transferase, alkaline phosphatase, bilirubin, cholesterol, high-density lipoprotein, low-density lipoprotein, very-low-density lipoprotein, triglyceride, and malondialdehyde levels, including tissue nonprotein sulfhydryl and total protein in CCl4-injured rats. In addition, the histopathology of dissected liver also revealed that A. javanica cured the tissue lesion compared to silymarin treatment. In vitro assays revealed strong free-radical scavenging ability of the extract and presence of alkaloids, flavonoids, tannins, sterols, and saponins where rutin, a well-known antioxidant flavonoid, was identified. Conclusions Our findings demonstrate the potential of A. javanica in the attenuation

  13. Mutant MMP-9 and HGF gene transfer enhance resolution of CCl4-induced liver fibrosis in rats: role of ASH1 and EZH2 methyltransferases repression.

    Directory of Open Access Journals (Sweden)

    Hussein Atta

    Full Text Available Hepatocyte growth factor (HGF gene transfer inhibits liver fibrosis by regulating aberrant cellular functions, while mutant matrix metalloproteinase-9 (mMMP-9 enhances matrix degradation by neutralizing the elevated tissue inhibitor of metalloproteinase-1 (TIMP-1. It was shown that ASH1 and EZH2 methyltransferases are involved in development of liver fibrosis; however, their role in the resolution phase of liver fibrosis has not been investigated. This study evaluated the role of ASH1 and EZH2 in two mechanistically different therapeutic modalities, HGF and mMMP-9 gene transfer in CCl4 induced rat liver fibrosis. Liver fibrosis was induced in rats with twice a week intraperitoneal injection of CCl4 for 8 weeks. Adenovirus vectors encoding mMMP-9 or HGF genes were injected through tail vein at weeks six and seven and were sacrificed one week after the second injection. A healthy animal group was likewise injected with saline to serve as a negative control. Rats treated with mMMP-9 showed significantly lower fibrosis score, less Sirius red stained collagen area, reduced hydroxyproline and ALT concentration, decreased transforming growth factor beta 1 (TGF-β1 mRNA and lower labeling indices of α smooth muscle actin (α-SMA and proliferating cell nuclear antigen (PCNA stained cells compared with HGF- or saline-treated rats. Furthermore, TIMP-1 protein expression in mMMP-9 group was markedly reduced compared with all fibrotic groups. ASH1 and EZH2 protein expression was significantly elevated in fibrotic liver and significantly decreased in mMMP-9- and HGF-treated compared to saline-treated fibrotic livers with further reduction in the mMMP-9 group.Gene transfer of mMMP-9 and HGF reduced liver fibrosis in rats. ASH1 and EZH2 methyltransferases are significantly reduced in mMMP-9 and HGF treated rats which underlines the central role of these enzymes during fibrogenesis. Future studies should evaluate the role of selective pharmacologic inhibitors

  14. Materials Behavior Research Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — The purpose is to evaluate mechanical properties of materials including metals, intermetallics, metal-matrix composites, and ceramic-matrix composites under typical...

  15. Head Impact Laboratory (HIL)

    Data.gov (United States)

    Federal Laboratory Consortium — The HIL uses testing devices to evaluate vehicle interior energy attenuating (EA) technologies for mitigating head injuries resulting from head impacts during mine/...

  16. Free Surface Hydrodynamics Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — FUNCTION: Investigates processes and interactions at the air-sea interface, and compares measurements to numerical simulations and field data. Typical phenomena of...

  17. Laboratory Astrophysics White Paper

    Science.gov (United States)

    Brickhouse, Nancy; Federman, Steve; Kwong, Victor; Salama, Farid; Savin, Daniel; Stancil, Phillip; Weingartner, Joe; Ziurys, Lucy

    2006-01-01

    Laboratory astrophysics and complementary theoretical calculations are the foundations of astronomical and planetary research and will remain so for many generations to come. From the level of scientific conception to that of the scientific return, it is our understanding of the underlying processes that allows us to address fundamental questions regarding the origins and evolution of galaxies, stars, planetary systems, and life in the cosmos. In this regard, laboratory astrophysics is much like detector and instrument development at NASA and NSF; these efforts are necessary for the astronomical research being funded by the agencies. The NASA Laboratory Astrophysics Workshop met at the University of Nevada, Las Vegas (UNLV) from 14-16 February, 2006 to identify the current laboratory data needed to support existing and future NASA missions and programs in the Astrophysics Division of the Science Mission Directorate (SMD). Here we refer to both laboratory and theoretical work as laboratory astrophysics unless a distinction is necessary. The format for the Workshop involved invited talks by users of laboratory data, shorter contributed talks and poster presentations by both users and providers that highlighted exciting developments in laboratory astrophysics, and breakout sessions where users and providers discussed each others' needs and limitations. We also note that the members of the Scientific Organizing Committee are users as well as providers of laboratory data. As in previous workshops, the focus was on atomic, molecular, and solid state physics.

  18. Shallow Water Acoustic Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — FUNCTION: Supports experimental research where high-frequency acoustic scattering and surface vibration measurements of fluid-loaded and non-fluid-loaded structures...

  19. Virtual Reality Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — FUNCTION: Performs basic and applied research in interactive 3D computer graphics, including visual analytics, virtual environments, and augmented reality (AR). The...

  20. Applied Neuroscience Laboratory Complex

    Data.gov (United States)

    Federal Laboratory Consortium — Located at WPAFB, Ohio, the Applied Neuroscience lab researches and develops technologies to optimize Airmen individual and team performance across all AF domains....

  1. High Temperature Materials Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — The High Temperature Materials Lab provides the Navy and industry with affordable high temperature materials for advanced propulsion systems. Asset List: Arc Melter...

  2. Biochemical Neuroscience Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — This biochemistry lab is set up for protein analysis using Western blot, enzyme linked immunosorbent assays, immunohistochemistry, and bead-based immunoassays. The...

  3. Flying Electronic Warfare Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — FUNCTION: Provides NP-3D aircraft host platforms for Effectiveness of Navy Electronic Warfare Systems (ENEWS) Program antiship missile (ASM) seeker simulators used...

  4. Metallurgical Research Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — The purpose is to increase basic knowledge of metallurgical processing for controlling the microstructure and mechanical properties of metallic aerospace alloys and...

  5. Porphyromonas gingivalis-induced production of reactive oxygen species, tumor necrosis factor-α, interleukin-6, CXCL8 and CCL2 by neutrophils from localized aggressive periodontitis and healthy donors

    DEFF Research Database (Denmark)

    Damgaard, C; Kantarci, A; Holmstrup, P; Hasturk, H; Nielsen, Claus Henrik; Van Dyke, T E

    2016-01-01

    BACKGROUND AND OBJECTIVES: Porphyromonas gingivalis is regarded as a significant contributor in the pathogenesis of periodontitis and certain systemic diseases, including atherosclerosis. P. gingivalis occasionally translocates from periodontal pockets into the circulation, where it adheres to red...... (ROS) in response to challenge with P. gingivalis. In addition, the impact of RBC interaction with P. gingivalis was investigated. The actions of resolvin E1 (RvE1), a known regulator of P. gingivalis induced neutrophil responses, on the cytokine and ROS responses elicited by P. gingivalis in cultures...... of neutrophils were investigated. RESULTS: Upon stimulation with P. gingivalis, neutrophils from subjects with LAgP and healthy controls released similar quantities of IL-6, TNF-α, CXCL8, CCL2 and intracellular ROS. The presence of RBCs amplified the release of IL-6, TNF-α and CCL2 statistically...

  6. DA-9601, a standardized extract of Artemisia asiatica, blocks TNF-α-induced IL-8 and CCL20 production by inhibiting p38 kinase and NF-κB pathways in human gastric epithelial cells

    Institute of Scientific and Technical Information of China (English)

    Suck-Chei Choi; Kang-Min Lee; Won-Jung Lee; Jae-Sik Park; Chang-Yell Shin; Tae-Young Oh; Chang-Duk Jun; Eun-Ju Choi; Hyun-Mee Oh; SungGa Lee; Jeong-Kun Lee; Meung-Su Lee; Yong-Il Shin; Suck-Jun Choi; Jeong-Ryong Chae

    2006-01-01

    AIM: To investigate whether, or how, DA-9601, which is a new gastroprotective agent, inhibits TNF-α-induced inflammatory signals in gastric epithelial AGS cells. METHODS: Cell viability was determined by MTT assay. IL-8 and CCL20 promoter activities were determined by a luciferease reporter gene assay. NF-κB-dependent transcriptional activity was determined by I-κBα degradation, NF-κB p65 nuclear translocation and a luciferase activity assay. IL-8 and CCL20 gene expression and protein secretion were determined by RT-PCR and an enzymelinked immunosorbent assay (ELISA). Total and phosphorylated forms of mitogen-activated protein kinases (MAPKs) were determined by Western blot. RESULTS: Treatment of AGS cells with DA-9601 reduced TNF-α-induced IL-8 and CCL20 promoter activities, as well as their gene expression and protein release. TNF-α also induced NF-κB-dependent transcriptional activity in AGS cells. In contrast, in cells treated with DA-9601, TNF-α-induced NF-κB activity was significantly blocked. Although all three MAP kinase family members were phosphorylated in response to TNF-α, a selective inhibitor of p38 kinase SB203580 only could inhibit both NF κB-dependent transcriptional activity and IL-8 and CCL20 production, suggesting a potential link between p38 kinase and NF-κB-dependent pathways in AGS cells. Interestingly, DA-9601 also selectively inhibited p38 kinase phosphorylation induced by TNF-α.CONCLUSION: DA-9601 blocked TNF-α-mediated inflammatory signals by potentially modulating the p38 kinase pathway and/or a signal leading to NF-κB dependent pathways in gastric epithelial cells.

  7. Kinetics of the gas-phase reactions of chlorine atoms with CH2F2, CH3CCl3 and CF3CFH2 over the temperature range 253 – 551 K

    DEFF Research Database (Denmark)

    Nilsson, Elna Johanna Kristina; Johnson, Matthew Stanley; Nielsen, Ole John;

    2009-01-01

    Relative rate techniques were used to study the title reactions in 930–1200 mbar of N2 diluent. The reaction rate coefficients measured in the present work are summarized by the expressions k(Cl+CH2F2) = 1.19×10-17 T 2 exp(-1023/T ) cm3 molecule-1 s-1 (253– 553 K), k(Cl+CH3CCl3) = 2.41×10-12 exp(...

  8. The Virtual Robotics Laboratory

    International Nuclear Information System (INIS)

    The growth of the Internet has provided a unique opportunity to expand research collaborations between industry, universities, and the national laboratories. The Virtual Robotics Laboratory (VRL) is an innovative program at Oak Ridge National Laboratory (ORNL) that is focusing on the issues related to collaborative research through controlled access of laboratory equipment using the World Wide Web. The VRL will provide different levels of access to selected ORNL laboratory equipment to outside universities, industrial researchers, and elementary and secondary education programs. In the past, the ORNL Robotics and Process Systems Division (RPSD) has developed state-of-the-art robotic systems for the Army, NASA, Department of Energy, Department of Defense, as well as many other clients. After proof of concept, many of these systems sit dormant in the laboratories. This is not out of completion of all possible research topics, but from completion of contracts and generation of new programs. In the past, a number of visiting professors have used this equipment for their own research. However, this requires that the professor, and possibly his students, spend extended periods at the laboratory facility. In addition, only a very exclusive group of faculty can gain access to the laboratory and hardware. The VRL is a tool that enables extended collaborative efforts without regard to geographic limitations

  9. Biotechnology Laboratory Methods.

    Science.gov (United States)

    Davis, Robert H.; Kompala, Dhinakar S.

    1989-01-01

    Describes a course entitled "Biotechnology Laboratory" which introduces a variety of laboratory methods associated with biotechnology. Describes the history, content, and seven experiments of the course. The seven experiments are selected from microbiology and molecular biology, kinetics and fermentation, and downstream processing-bioseparations.…

  10. The Virtual Robotics Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Kress, R.L.; Love, L.J.

    1999-09-01

    The growth of the Internet has provided a unique opportunity to expand research collaborations between industry, universities, and the national laboratories. The Virtual Robotics Laboratory (VRL) is an innovative program at Oak Ridge National Laboratory (ORNL) that is focusing on the issues related to collaborative research through controlled access of laboratory equipment using the World Wide Web. The VRL will provide different levels of access to selected ORNL laboratory secondary education programs. In the past, the ORNL Robotics and Process Systems Division has developed state-of-the-art robotic systems for the Army, NASA, Department of Energy, Department of Defense, as well as many other clients. After proof of concept, many of these systems sit dormant in the laboratories. This is not out of completion of all possible research topics. but from completion of contracts and generation of new programs. In the past, a number of visiting professors have used this equipment for their own research. However, this requires that the professor, and possibly his/her students, spend extended periods at the laboratory facility. In addition, only a very exclusive group of faculty can gain access to the laboratory and hardware. The VRL is a tool that enables extended collaborative efforts without regard to geographic limitations.

  11. Quality in Teaching Laboratories.

    Science.gov (United States)

    Stubington, John F.

    1995-01-01

    Describes a Japanese process-oriented approach called KAIZEN for improving the quality of existing teaching laboratories. It provides relevant quality measurements and indicates how quality can be improved. Use of process criteria sidesteps the difficulty of defining quality for laboratory experiments and allows separation of student assessment…

  12. NVLAP calibration laboratory program

    Energy Technology Data Exchange (ETDEWEB)

    Cigler, J.L.

    1993-12-31

    This paper presents an overview of the progress up to April 1993 in the development of the Calibration Laboratories Accreditation Program within the framework of the National Voluntary Laboratory Accreditation Program (NVLAP) at the National Institute of Standards and Technology (NIST).

  13. ELECTROPNEUMATIC AUTOMATION EDUCATIONAL LABORATORY

    OpenAIRE

    Dolgorukov, S. O.; National Aviation University; Roman, B. V.; National Aviation University

    2013-01-01

    The article reflects current situation in education regarding mechatronics learning difficulties. Com-plex of laboratory test benches on electropneumatic automation are considered as a tool in advancing through technical science. Course of laboratory works developed to meet the requirement of efficient and reliable way of practical skills acquisition is regarded the simplest way for students to learn the ba-sics of mechatronics.

  14. Rainbow trout CK9, a CCL25-like ancient chemokine that attracts and regulates B cells and macrophages, the main antigen presenting cells in fish

    Science.gov (United States)

    Aquilino, Carolina; Granja, Aitor G.; Castro, Rosario; Wang, Tiehui; Abos, Beatriz; Parra, David; Secombes, Christopher J.; Tafalla, Carolina

    2016-01-01

    CK9 is a rainbow trout (Oncorhynchus mykiss) CC chemokine phylogenetically related to mammalian CCL25. Although CK9 is known to be transcriptionally regulated in response to inflammation particularly in mucosal tissues, its functionality has never been revealed. In the current work, we have demonstrated that CK9 is chemoattractant for antigen presenting cells (APCs) expressing major histocompatibility complex class II (MHC II) on the cell surface. Among these APCs, CK9 has a strong chemotactic capacity for both B cells (IgM+ and IgT+) and macrophages. Along with its chemotactic capacities, CK9 modulated the MHC II turnover of B lymphocytes and up-regulated the phagocytic capacity of both IgM+ cells and macrophages. Although CK9 had no lymphoproliferative effects, it increased the survival of IgT+ lymphocytes. Furthermore, we have established that the chemoattractant capacity of CK9 is strongly increased after pre-incubation of leukocytes with a T-independent antigen, whereas B cell receptor (BCR) cross-linking strongly abrogated their capacity to migrate to CK9, indicating that CK9 preferentially attracts B cells at the steady state or under BCR-independent stimulation. These results point to CK9 being a key regulator of B lymphocyte trafficking in rainbow trout, able to modulate innate functions of teleost B lymphocytes and macrophages. PMID:27003360

  15. SHSST Cyclodextrin Complex Prevents the Fibrosis Effect on CCl4-Induced Cirrhotic Cardiomyopathy in Rats through TGF-β Pathway Inhibition Effects

    Directory of Open Access Journals (Sweden)

    Cheng-Hsun Yang

    2014-05-01

    Full Text Available Patients with liver cirrhosis also have subtle cardiac structure or function abnormalities. This cardiac dysfunction commonly occurs in 56% of waiting orthotopic liver transplantation (OLT patients and is defined as cirrhotic cardiomyopathy (CCM. Up to now, there is no standard treatment because CCM does not have a solidly established diagnosis and is based on high clinical suspicion. The liver function of CCM is particularly limited, making patients vulnerable to more drug treatments. Here, we use silymarin (100 mg/kg/day, baicalein (30 mg/kg/day, San Huang Shel Shin Tang (SHSST, 30 mg/kg/day and β-cyclodextrin modified SHSST (SHSSTc, 30 and 300 mg/kg/day treatments for a CCl4-induced CCM rat model. The results show that silymarin, baicalein and SHSST treatments can only slightly reduce the collagen accumulation in CCM rat hearts. However, SHSSTc treatment protects the heart in CCM and significantly inhibits collagen acumination and the fibrosis regulating transforming growth factor-β (TGF-β pathway expression. SHSSTc treatments further reduced the heart weight and the ratio between left ventricular weight (LVW and tibia length (TL. This experimental data show that water solubility improved β-cyclodextrin modified Chinese herbal medicine formula (SHSSTc can provide an excellent heart protection effect through TGF-β pathway inhibition.

  16. Application of a new statistical mechanical model for calculating Kirkwood factors in self associating liquid systems to alkanol + CCl4 mixtures.

    Science.gov (United States)

    Vasiltsova, Tatiana; Heintz, Andreas; Nadolny, Holger; Weingärtner, Hermann

    2009-04-14

    A recently developed statistical-mechanical model for calculating Kirkwood correlation factors g(K) in self associating liquids and liquid mixtures has been applied for the simultaneous description of g(K) derived from dielectric constant data, the molar enthalpy of mixing H, and the infrared absorbtion of monomeric alcoholic species as function of the composition in alkanol + CCl(4) mixtures. The alkanols are methanol, ethanol, propanol, butan-1-ol, pentan-1-ol, hexan-1-ol, octan-1-ol, sec-butanol, tert-butanol and pentan-3-ol. The majority of parameters involved in the theory are obtained by independent quantum mechanical ab initio calculations of molecular clusters consisting of up to four alcohol molecules. As a consequence only two parameters have to be adjusted freely to each binary system, a third parameter responsible for the non-specific intermolecular dispersion interaction has been adjusted within a limited range of possible values given by physical arguments. Excellent agreement between theory and experimental data for g(K), H and IR absorbance is obtained covering the whole range of concentration. The theory also rationalizes the temperature dependence of these properties without adjusting further parameters. The Kirkwood correlation factor g(K) turns out to be a sensitive response to peculiarities of the molecular structure of hydrogen-bonded systems in the condensed liquid state. PMID:19325973

  17. The Effects of Taoren-Honghua Herb Pair on Pathological Microvessel and Angiogenesis-Associated Signaling Pathway in Mice Model of CCl4-Induced Chronic Liver Disease

    Directory of Open Access Journals (Sweden)

    Shengyan Xi

    2016-01-01

    Full Text Available Chronic liver disease is one of the most common diseases that threaten human health. Effective treatment is still lacking in western medicine. Semen Persicae (Taoren and Flos Carthami (Honghua are known to relieve acute hepatic injury and inflammation, improve microcirculation, and reduce tissue fiber. The aim of our study is to investigate the potential mechanisms of Taoren-Honghua Herb Pair (THHP in murine model of chronic liver disease caused by Carbon Tetrachloride (CCl4. Mice were randomly divided into seven groups: (1 blank, (2 model, (3 control (colchicine, 0.1 mg/kg, (4 THHP (5.53, 2.67, and 1.33 g/kg, and (5 Tao Hong Siwu Decoction (THSWD (8.50 g/kg. Histological change and microvessels density were examined by microscopy. Hepatic function, serum fibrosis related factors, and hepatic vascular endothelial growth factor (VEGF were measured with ELISA. VEGF, kinase insert domain-containing receptor (KDR, Flt-1, and Akt mRNA expression in hepatic tissue were determined with PCR. Tissues of Akt, pAkt, KDR, and Flt-1 were measured with western blotting. Data from this study showed that THHP improved hepatic function and restrained the hepatic inflammation and fibrosis. Its role in inhibiting pathological angiogenesis and hepatic fibrogenesis may be through affecting the angiogenesis-associated VEGF and its upstream and downstream signaling pathways.

  18. Preparation of ThO2-UO3 sols with uranium contents of 0 approx 35 % for gelation into microspheres in CCl4-ammonia media

    International Nuclear Information System (INIS)

    The conditions for producing mixed ThO2-UO3 sols with 0 ∼ 40 % U by neutralizing nitrate solutions with ammonia solution under pH control are studied. With 0 ∼ 35 % U, good source sols for gelation in CCl4-ammonia media are obtained. Colloid fraction of U in producible stable sols is lower than that of Th. The former, moreover, decreases considerably with increase in U content while the latter does only a little; this results abrupt decrease in their colloid fraction of (Th + U) with increase in U content. Whether gelation behavior of such sols is good or not depends on fraction of 4.1 nm or larger colloids, and on U content. The minimum value of the colloid fractions resulting no gel-sphere failure also decreases with increase in U content. The gel-sphere failure is a crack for lower U content and a hole like a dimple or a navel for higher one. The difference is also discussed. (author)

  19. Possible atmospheric lifetimes and chemical reaction mechanisms for selected HCFCs, HFCs, CH3CCl3, and their degradation products against dissolution and/or degradation in seawater and cloudwater

    Science.gov (United States)

    Wine, P. H.; Chameides, W. L.

    1990-01-01

    For a wide variety of atmospheric species including CO2, HNO3, and SO2, dissolution in seawater or cloudwater followed by hydrolysis or chemical reaction represents a primary pathway for removal from the atmosphere. In order to determine if this mechanism can also remove significant amounts of atmospheric chlorofluorocarbons (HCFC's), fluorocarbons (HFC's), and their degradation products, an investigation was undertaken as part of the Alternative Fluorocarbons Environmental Acceptability Study (AFEAS). In this investigation, the rates at which CHCl2CF3 (HCFC-123), CCl2FCH3 (HCFC-141b), CClF2CH3 (HCFC-142b), CHClF2 (HCFC-22), CHClFCF3 (HCFC-124) CH2FCF3 (HFC-134a) CHF2CH3 (HFC-152a), CHF2CF3 (HFC-125), and CH3CCl3 can be dissolved in the oceans and in cloudwater were estimated from the species' thermodynamic and chemical properties using simple mathematical formulations to simulate the transfer of gases from the atmosphere to the ocean or cloudwater. The ability of cloudwater and rainwater to remove gas phase degradation products of these compounds was also considered as was the aqueous phase chemistry of the degradation products. The results of this investigation are described.

  20. Adiponectin-induced secretion of interleukin-6 (IL-6, monocyte chemotactic protein-1 (MCP-1, CCL2 and interleukin-8 (IL-8, CXCL8 is impaired in monocytes from patients with type I diabetes

    Directory of Open Access Journals (Sweden)

    Maier Kevin

    2006-08-01

    Full Text Available Abstract Background Systemic adiponectin is reduced in patients with cardiovascular disease (CVD and low adiponectin may contribute to the pathogenesis of atherosclerosis. However, circulating adiponectin is elevated in type 1 diabetes (T1D patients, who have also a higher incidence to develop CVD. Because monocytes play an important role in atherosclerosis, we analysed the influence of adiponectin on cytokine and chemokine release in monocytes from T1D patients and controls. Methods Systemic adiponectin was determined in the plasma and the high-molecular weight (HMW form of adiponectin was analysed by immunoblot. Monocytes were isolated from T1D patients and controls and the adiponectin-stimulated release of interleukin-6 (IL-6, monocyte chemotactic protein-1 (MCP-1, CCL2 and interleukin-8 (IL-8, CXCL8 was analysed. Results Systemic adiponectin was higher in T1D patients. Immunoblot analysis of the plasma indicate abundance of HMW adiponectin in T1D patients and controls. IL-6, CCL2 and CXCL8 secretion in response to adiponectin were found induced in monocytes from controls whereas only IL-6 was upregulated in T1D cells. The induction of IL-6 by adiponectin was abrogated by an inhibitor of the NFκB pathway. Conclusion These data indicate that adiponectin-mediated induction of IL-6, CCL2 and CXCL8 is disturbed in monocytes from T1D patients and therefore elevated systemic adiponectin in T1D patients may be less protective when compared to controls.