WorldWideScience

Sample records for castor ricinus communis

  1. Growth response of Ricinus communis L (castor oil) in spent ...

    African Journals Online (AJOL)

    The growth response of castor oil plant, Ricinus communis, in spent lubricating oil (SLO) was investigated using 1-6% w/w SLO and a control. The result showed that highest percent germination of approximately 92, was obtained in control and the least in 5% w/w. The early germination obtained in this study was significant ...

  2. EFFECT OF CASTOR BEAN (Ricinus communis L.) AQUEOUS ...

    African Journals Online (AJOL)

    User

    EFFECT OF CASTOR BEAN (Ricinus communis L.) AQUEOUS. EXTRACTS ON THE PERFORMANCE OF ROOT-KNOT. NEMATODES (Meloidogyne spp.) ON TOMATO. (Solanum lycopersicum L.) J. Adomako1 and C. K. Kwoseh2. 1. Plant Health Division, CSIR-Crops Research Institute, Fumesua, Kumasi. 2. Department ...

  3. Discovery and Characterization of Novel Signatures from the Ricinus communis L. (Castor Bean) Genome

    National Research Council Canada - National Science Library

    O'Connell, Kevin P; Skowronski, Evan W; Dretchen, Kenneth L; Leshin, Jonathan A; Weeks, Andrea

    2006-01-01

    Given the infamous toxicity of ricin and the industrial usefulness of castor oil, there is a surprising lack of information about the genetic diversity of the species that produces both, the castor bean plant (Ricinus communis L...

  4. Effect of copper on castor bean (Ricinus communis L.) growth

    Energy Technology Data Exchange (ETDEWEB)

    Chaves, Lucia Helena Garofalo; Cunha, Tassio Cavalcanti da Silva; Lima, Vinicius Mota; Cabral, Paulo Cesar Pinto; Barros Junior, Genival; Lacerda, Rogerio Dantas de [Universidade Federal de Campina Grande (UAEAg/UFCG), PB (Brazil). Unidade Academica de Engenharia Agricola

    2008-07-01

    Castor beans crop (Ricinus communis L.) is raising attention as an alternative crop for oil and biodiesel production. Despite the mineral fertilization is an important factor for increasing castor yield, few research has been made on this issue, mainly on the use de copper. In order to evaluate the effects of copper on growth of this plant an experiment was carried out in a greenhouse, in Campina Grande, Paraiba State, Brazil, from July to December 2007. The substrate for the pot plants was a 6 mm-sieved surface soil (Neossolo Quartzarenico). The experimental design was a completely randomized with three replications. The treatments were composed of five levels of Cu (0; 1; 2; 3 and 4 mg dm{sup -3}), which were applied at the time of planting. One plant of castor bean, cultivar BRS 188 - Paraguacu, was grown per pot after thinning and was irrigated whenever necessary. Data on plant height, number and length of leaves and stem diameter were measured at 21, 34, 77 and 103 days after planting. Copper levels used, in general, did not affect the plant height, stem diameter and leaf area, however they influenced the leaves and shoot biomass dry mass and the quadratic trend was the best to show the behavior of these. (author)

  5. Effect of powdered castor oil seed ( Ricinus communis L.) on some ...

    African Journals Online (AJOL)

    Effect of powdered castor oil seed ( Ricinus communis L.) on some internal organs of albino rat. ... Four feed formulations were used; powdered castor oil seed and commercial rat feed mixed in ratio 1:1, 1:2, 1:5, 1:10 and ordinary commercial rat feed, which serves as the control.These formulations were given to four ...

  6. Isotope labeling-based quantitative proteomics of developing seeds of castor oil seed (Ricinus communis L.)

    DEFF Research Database (Denmark)

    Nogueira, Fábio C S; Palmisano, Giuseppe; Schwämmle, Veit

    2013-01-01

    In this study, we used a mass spectrometry-based quantification approach employing isotopic (ICPL) and isobaric (iTRAQ) labeling to investigate the pattern of protein deposition during castor oil seed (Ricinus communis L.) development, including that of proteins involved in fatty acid metabolism...... give important insights into certain aspects of the biology of castor oil seed development such as carbon flow, anabolism, and catabolism of fatty acid and the pattern of deposition of SSPs, toxins, and allergens such as ricin and 2S albumins. We also found, for the first time, some genes of SSP...... could be mapped to extant castor gene models, considerably expanding the number of proteins so far identified from developing castor seeds. Cluster validation and statistical analysis resulted in 975 protein trend patterns and the relative abundance of 618 proteins. The results presented in this work...

  7. VARIATIONS IN SEED TRAITS OF CASTOR (Ricinus communis ...

    African Journals Online (AJOL)

    The sizes of castor seed have been reported to vary from a few millimeters long to about 20 mm in the giant species (Weiss, 2000). The seed weight varies. For instance, seeds found in Nigeria and Kenya has been reported to weigh. 69.3 and 59.2 g, respectively (Li et al., 2008). The typical fatty acid composition of castor oil.

  8. Apis mellifera pollination improves agronomic productivity of anemophilous castor bean (Ricinus communis).

    Science.gov (United States)

    Rizzardo, Rômulo A G; Milfont, Marcelo O; Silva, Eva M S da; Freitas, Breno M

    2012-12-01

    Castor bean (Ricinus communis L.) is cultivated mainly for biodiesel production because of its oil-rich seeds; it is assumed to be an anemophylous species. But pollination deficit can lead to low productivity often attributed to other reasons. In this paper, we investigated pollination requirements, pollination mechanism, occurrence of pollination deficit, and the role of biotic pollinators in a large commercial plantation of castor bean. Our results show that R. communis bears a mixed breeding system favoring selfing by geitonogamy, although the wind promotes mostly outcrossing. We also found that the honey bee (Apis mellifera L.) foraging on castor bean can both transfer pollen from male to female flowers within the same raceme and boost the release of airborne pollen by male flowers. Both situations increase geitonogamy rates, raising significantly fruit set and seed yield. This is the first report of an animal foraging activity increasing seed yield in an anemophilous and geitonogamous crop and elucidates the role of biotic pollinators in castor bean reproduction.

  9. Diversity of castor ( Ricinus communis L.) in Ethiopia | Alemaw ...

    African Journals Online (AJOL)

    An experiment was carried out to assess the diversity of castor germplasm in Ethiopia. A total of 102 accessions, one elite genotype and two standard varieties were characterized at Melkassa and Arsi Negelle, in the Central Rift Valley of Ethiopia using 12 traits for one during 2013 main season. Analysis of variance ...

  10. Variations in seed traits of castor ( Ricinus communis ) accessions ...

    African Journals Online (AJOL)

    The physicochemical analysis showed that castor seed and oil had saponification value of 182.9 mg/g, moisture content of 4.4%, acid value of 3.085 mg/g, viscosity of 110.41 cP, pH of 6.11, iodine value of 8.46 mg/g, specific gravity of 0.962 and refractive index of 1.477˚C. The proximate analysis showed that moisture ...

  11. Chemical Investigations of the Castor Bean Plant Ricinus communis

    Science.gov (United States)

    2012-12-01

    Storage Proteins TSP 3-(trimethylsilyl)-2,2,3,3-d4- propionic acid UV Unit Variance VIP Variable Importance in the Projection UNCLASSIFIED...probe head. Each sample was freeze dried and resuspended in D2O [with 0.01% (trimethylsilyl)-2,2,3,3-d4- propionic acid (TSP) and 2% d4-acetic acid ] at...analysing the 2% acidic R. communis extracts was not readily applicable to IRMS and ICPMS techniques due to interference from residual acetic acid

  12. Radiographic analysis in castor bean seeds (Ricinus communis L.)

    OpenAIRE

    Carvalho, Maria Laene Moreira de; Alves, Renato Augusto; Oliveira, Luciana Magda De.

    2010-01-01

    Castor bean cropping has great social and economic value, but its production has been affected by factors such as low quality seeds used for sowing. The quick and precise evaluation of seed quality by x-ray test is known as an effective method to evaluate seed lots, but little is known about the interpretation between of the type of radiographic image and the seed quality correlation. The potential of x-ray analysis as a marker of seed physiological quality and as an initial process for the i...

  13. ARTICLE - Inbreeding depression in castor bean (Ricinus communis L. progenies

    Directory of Open Access Journals (Sweden)

    Milton Krieger

    2012-12-01

    Full Text Available The purpose of this study was to investigate inbreeding depression (DE in castor bean. From a population derived from the Guarani cultivar, 60 mother plants were sampled. Three types of progenies were obtained from each one: from self-pollination (AU, from crosses (CR and from open pollination (PL. Grain yield of the progenies was evaluated in two locations. There was a strong interaction of progenies x locations, which led to obtaining estimates within each location. Broad variation was observed in inbreeding depression, with mean values of 6.7% and 13.4%, comparing AU progenies with PL progenies. It was observed that the population has high potential for selecting promising inbred lines. The frequency of mother plants generating progenies with simultaneous high general combination capacity and low inbreeding depression was low. Recurrent selection will increase the occurrence of parent plants associating these two properties, which is necessary for obtaining superior synthetic varieties.

  14. Apis mellifera pollination improves agronomic productivity of anemophilous castor bean (Ricinus communis

    Directory of Open Access Journals (Sweden)

    Rômulo A.G. Rizzardo

    2012-12-01

    Full Text Available Castor bean (Ricinus communis L. is cultivated mainly for biodiesel production because of its oil-rich seeds; it is assumed to be an anemophylous species. But pollination deficit can lead to low productivity often attributed to other reasons. In this paper, we investigated pollination requirements, pollination mechanism, occurrence of pollination deficit, and the role of biotic pollinators in a large commercial plantation of castor bean. Our results show that R. communis bears a mixed breeding system favoring selfing by geitonogamy, although the wind promotes mostly outcrossing. We also found that the honey bee (Apis mellifera L. foraging on castor bean can both transfer pollen from male to female flowers within the same raceme and boost the release of airborne pollen by male flowers. Both situations increase geitonogamy rates, raising significantly fruit set and seed yield. This is the first report of an animal foraging activity increasing seed yield in an anemophilous and geitonogamous crop and elucidates the role of biotic pollinators in castor bean reproduction.A mamoneira (Ricinus communis L. é cultivada principalmente para produção de biodiesel devido ao alto teor de óleo de suas sementes e considerada como sendo de polinização anemófila. Mas déficits de polinização podem levar a baixos índices de produtividade geralmente atribuídos a outros fatores. Neste trabalho foram investigados os requerimentos, mecanismos e déficit de polinização e o papel dos polinizadores bióticos em um monocultivo comercial de mamona. Os resultados mostram que R. communis possui um sistema de polinização misto, favorecendo a autopolinização por geitonogamia, embora o vento normalmente promova polinização cruzada. Observou-se também que a abelha melífera (Apis mellifera L. forrageando na mamoneira pode tanto transferir pólen das flores estaminadas para as pistiladas do mesmo racemo, quanto aumentar consideravelmente a liberação de p

  15. Physicochemical characteristics of seeds from wild and cultivated castor bean plants (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Jose Daniel Mosquera

    2018-01-01

    Full Text Available The castor (Ricinus communis L. is an oilseed plant whose main features are its drought resistance, and its adaptation to eroded, polluted, and low fertility soils. Its oil has a great demand in the industrial sector and it has recently attracted considerable interest for its use in the production of biodiesel and jet fuel. In this study, morphological, physical and chemical characterizations were performed to ascertain the quality of wild (VQ-1 and under cultivation (VQ-7 oil castor seeds. The results showed that there are differences in the morphological and physicochemical characteristics regarding oil content (44,95 vs 33,84%, ash (3,20 vs 2,42%, and 100-seed-weight (45,87 vs 54,23g; similar behavior was recorded when characterizing the oil: kinematic viscosity (269,67 vs 266,44mm2 /s, density (0,9389 vs 0,9465g/cm3 , and acidity index (0,9918 vs 0,5440mg KOH/g for VQ-1 and VQ-7, respectively. Growing conditions to which castor plants were subjected may influence both the final quality of seeds and chemical properties of the oil.

  16. Potential of castor bean (Ricinus communis L.) for phytoremediation of mine tailings and oil production.

    Science.gov (United States)

    Ruiz Olivares, Alejandro; Carrillo-González, Rogelio; González-Chávez, Ma del Carmen A; Soto Hernández, Ramón Marcos

    2013-01-15

    Bioenergy production combined with phytoremediation has been suggested to help in solving two critical world problems: the gradual reduction of fossil fuels and soil contamination. The aim of this research was to investigate the potential for the use of Ricinus communis L. (castor oil plant) as an energy crop and plant species to remediate metal-polluted sites. This study was performed in mine tailings containing high concentrations of Cu, Zn, Mn, Pb and Cd. Physico-chemical characterization, total, DTPA-extractable and water-soluble metals in rhizospheric tailings heap samples were carried. Metal concentrations in plant tissues and translocation factors (TFs) were also determined. The Ricinus seed-oil content was high between 41 and 64%, seeds from San Francisco site 6 had the highest oil content, while these from site 7 had the lowest. No trend between oil yield vs seed origin site was observed. Seed-oil content was negatively correlated with root concentration of Cu, Zn, Pb and Cd, but no correlation was observed with the extractable-metals. According to its shoot metal concentrations and TFs, castor bean is not a metal accumulator plant. This primary colonizing plant is well suited to cope with the local toxic conditions and can be useful for the stabilization of these residues, and for then decreasing metal bioavailability, dispersion and human health risks on these barren tailings heaps and in the surrounding area. Our work is the first report regarding combined oil production and a phytostabilization role for Ricinus plants in metal mine tailings and may give a new value to suitable metal-polluted areas. Copyright © 2012 Elsevier Ltd. All rights reserved.

  17. Single nucleotide polymorphisms for assessing genetic diversity in castor bean (Ricinus communis

    Directory of Open Access Journals (Sweden)

    Rabinowicz Pablo D

    2010-01-01

    Full Text Available Abstract Background Castor bean (Ricinus communis is an agricultural crop and garden ornamental that is widely cultivated and has been introduced worldwide. Understanding population structure and the distribution of castor bean cultivars has been challenging because of limited genetic variability. We analyzed the population genetics of R. communis in a worldwide collection of plants from germplasm and from naturalized populations in Florida, U.S. To assess genetic diversity we conducted survey sequencing of the genomes of seven diverse cultivars and compared the data to a reference genome assembly of a widespread cultivar (Hale. We determined the population genetic structure of 676 samples using single nucleotide polymorphisms (SNPs at 48 loci. Results Bayesian clustering indicated five main groups worldwide and a repeated pattern of mixed genotypes in most countries. High levels of population differentiation occurred between most populations but this structure was not geographically based. Most molecular variance occurred within populations (74% followed by 22% among populations, and 4% among continents. Samples from naturalized populations in Florida indicated significant population structuring consistent with local demes. There was significant population differentiation for 56 of 78 comparisons in Florida (pairwise population ϕPT values, p Conclusion Low levels of genetic diversity and mixing of genotypes have led to minimal geographic structuring of castor bean populations worldwide. Relatively few lineages occur and these are widely distributed. Our approach of determining population genetic structure using SNPs from genome-wide comparisons constitutes a framework for high-throughput analyses of genetic diversity in plants, particularly in species with limited genetic diversity.

  18. Evaluation of the cadmium and lead phytoextraction by castor bean (Ricinus communis L.) in hydroponics

    Science.gov (United States)

    Niu, Z. X.; Sun, L. N.

    2017-06-01

    Phytoextraction has been considered as an innovative method to remove toxic metals from soil; higher biomass plants such as castor bean (Ricinus communis L.) have already been considered as a hyperaccumulating candidate. In the present study, castor bean was used to accumulate the cadmium and lead in hydroponic culture, and the root exudates and biomass changes were analyzed. Results demonstrated that ratios of aerial biomass/ root biomass (AW/RW) in treatments declined with concentrations of Cd or Pb. Optical density (OD) at 190 nm and 280 nm of root exudates observed in Cd and Pb treatments were lower than the control. In single Cd or Pb treatments, bioconcentration factors (BCF) of Cd or Pb increased with time and decreased with concentrations, the highest BCFs appeared in Cd5 (14.36) and Pb50 (6.48), respectively. Cd-BCF or Pb-BCF showed positive correlations with AW/RW ratios and OD values, and they were negative correlated with Cd and Pb concentration. Results in this study may supply useful information for phytoremediation of soil contaminated with cadmium and lead in situ.

  19. In-vitro regeneration of castor bean (ricinus communis, L) and physic nut (jatropha curcas, L.)

    International Nuclear Information System (INIS)

    Afful, N. T.

    2008-06-01

    Investigations were conducted on in vitro regeneration of physic nut (Jatropha curcas, 1.) and castor bean (Ricinus communis, 1.) using zygotic embryo culture, shoot tip and meristem culture as well as somatic embryogenesis. Zygotic embryos from different stages of fruit maturity cultured on Murashige and Skoog (MS) medium supplemented with benzylaminopurine (BAP), kinetin and 2-isopentyl (2iP) produced vigorous seedlings with roots. However the optimal concentration of cytokinin for seedling development depended on the type cytokinin as well as the maturity stage of the fruit. Embryos from yellow fruits of Jatropha had the highest germination (100%) on an MS medium supplemented with 0.5 mg/L kinetin or 1 mg/L BAP while in Ricinus embryos from black fruits had the highest percentage germination (97%) on an MS medium modified with I mg/L 2iP or 0.5 or I mg/L BAP. Decrease in embryo viability especially in Jatropha as the seed matured may be due to high oil content in matured (black) fruit. Oil content in both Jatropha and Ricinus increased as the fruit matured from green to black and this may have effect on germination of zygotic embryos. In vitro culture response of shoot tip or meristem was significantly influenced by the concentration of growth regulators in the culture medium as well as the plant species. In both plant species, 2iP resulted in highest percentage shoot regeneration. The optimal concentration of 2iP was 0.5 mg/L for Ricinus shoot tip and 1.5 or 2.0 mg/L for Jatropha, indicating genotypic difference between the species. However excessive callus formation and browning in Ricinus led to the loss of all the regenerants. Shoot regeneration from meristem explants was also influenced by growth regulators with 2iP again being the best. Cultures of cotyledon and leaf lobe explants on MS medium supplemented with 2, 4-D and picloram resulted in callus induction with the exception of cotyledons obtained from black fruits. However transfer of calli onto fresh

  20. Collection of castor-oil plant germoplasm (Ricinus communis L. in two municipalities of Arauca, Colombia

    Directory of Open Access Journals (Sweden)

    Carlos Iván Cardozo Conde

    2013-05-01

    Full Text Available Ricinus communis L., commonly known as the castor-oil plant, is important for its use in biofuels production. With the objective of learning about its current status, in 40 villages influential to the oil complex of Caricare (municipality of Arauquita and Caño Limón (municipality of Arauca in Arauca, Colombia (where five years earlier the crop had been established, a collection of sexual seed was carried out between December 2011 and January 2012. The variables studied include passport data as a collection resource, local name, relief, and soil type among others. A Garmin map76CSx was used in order to identify the transects and record data such as geographic location and elevation. Simple descriptive statistics were used to identify the variables of greatest variation. Using the qualitative variables of greatest importance, a contingency table analysis with a significance level of 5%, a multiple correspondence analysis (MCA and principal component analysis (PCA were performed for quantitative and qualitative variables, in addition to a classification analysis through a similarity matrix. The castor-oil plant was found in 25% of the villages visited. 12 introductions were collected, four from Caricare and eight from Caño Limón. Although the environmental conditions were favo­rable for its cultivation, there are no castor-oil plant crops in the locations visited. The absence of grain commercialization and oil extraction equipment is the main limiting factor. A garden was established using collected materials for the purpose of research, breeding and propagation.

  1. Castor (Ricinus communis L. and Pigweed (Amaranthus retroflexus L. Growth Indices in Terms of Interference

    Directory of Open Access Journals (Sweden)

    naser jafarzadeh

    2016-11-01

    Full Text Available Introduction Growth analysis has been widely used in breeding programs to identify the important plant developmental phases and components related to higher yield under a particular set of environmental conditions. Castor bean (Ricinus communis L. is an important commercial crop. Castor oil based by products is used in manufacturing of several commercially important commodities like surfactants, coatings, greases, pharmaceuticals, cosmetics, polyesters, polymers, etc. Interference (Interactive effects among species on inter-species populations is one of the main issues on the eco-physiology of plant populations where weeds impose negative effects by approaching the plant to compete in light, water and nutrient elements availability and results in reduced growth and yield (Shinggu et al., 2011. Growth indices are useful for interpreting plant reactions to the crop and weed density. Various reasons have been attributed for the low productivity among the most important is weed competition (Radosevich, 1987. The aim of the present experiment was evaluating the interference effects of redroot pigweed on growth indices of castor bean in northwest of Iran. Materials and methods This experiment was conducted in Urmia, Iran (Agricultural Research of West Azarbayjan, Saatlo Station (37°44´18״ N Latitude and 45° 10´ 53״ E Longitude, at 1338 m above sea level in 2012. The soil of the experimental field was sandy - loam, with pH of 7.2. Competitive pattern of experiment was in two-factor based on a randomized complete block design (RCBD with three replications arranged in four castor plant densities (3, 4, 5 and 6 plants.m-2 and four redroot pigweed densities (0, 5, 10 and 15 plants.m-2. Redroot pigweed and castor seeds were simultaneously directly planted on the 22th May in 2012. Redroot pigweed plants were weeded at the times related to the treatments level. Irrigation and intercultural operations were performed whenever necessary. Plots were 3m×5m

  2. Effects of Oganic and Biofertilizers on Growth Indices of Castor Bean (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    A Amin Ghafori

    2016-07-01

    Full Text Available Introduction Castor plant, Ricinus communis L. is a species of flowering plant in the spurge family; Euphorbiaceae, which contains a vast number of plants mostly native to the tropics. It belongs to a monotypic genus Ricinus. The name Ricinus is a latin word for tick. The plant is probably named because its seed has markings and a dump at the end that resemble certain ticks (NCRI, 2014. Castorbean is an industrial oil seed crop containing about 45-58 percent oil, which has tremendous application in petrochemicals, pharmaceuticals, cosmetics, textiles, chemicals, soap, leather, paints, varnishes, ink, nylon and plastic. Castor oil is traditionally associated with medicine and veterinary use in the fields of obstetrics, dermatology. It is also used as laxative. Presently, its utilization as bio-diesel has magnified its importance. Its oil does not freeze even at high altitudes and it is one the best lubricants for jet engines. This 100% castor-based product, has numerous applications in industry such as rotating glass car-wipers, ski boots fixatives, and for use in air-brake systems on trucks. Many new uses, based on the biodegradability of castor oil derived products, are expected in the future (Labalette et al., 1996. The shell of the castor bean is used as an organic termite control agent and its seed cake as manure in the soil. Medicinal plants are valuable resources in a wide range of natural resources that scientific identification, cultivation, development and proper utilization of them can have an important role in community health, employment and non-petrol exports. Quality of medicinal plants is more important than other crops. One of the most important factors determining the yield of castor bean is fertility. Integrated supply of nutrient to plants through combinations of organic and inorganic sources is becoming an increasingly important aspect of environmentally sound agriculture. Reports showed that the application of manure on bean

  3. Effects of Oganic and Biofertilizers on Growth Indices of Castor Bean (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    A Amin Ghafori

    2016-07-01

    Full Text Available Introduction Castor plant, Ricinus communis L. is a species of flowering plant in the spurge family; Euphorbiaceae, which contains a vast number of plants mostly native to the tropics. It belongs to a monotypic genus Ricinus. The name Ricinus is a latin word for tick. The plant is probably named because its seed has markings and a dump at the end that resemble certain ticks (NCRI, 2014. Castorbean is an industrial oil seed crop containing about 45-58 percent oil, which has tremendous application in petrochemicals, pharmaceuticals, cosmetics, textiles, chemicals, soap, leather, paints, varnishes, ink, nylon and plastic. Castor oil is traditionally associated with medicine and veterinary use in the fields of obstetrics, dermatology. It is also used as laxative. Presently, its utilization as bio-diesel has magnified its importance. Its oil does not freeze even at high altitudes and it is one the best lubricants for jet engines. This 100% castor-based product, has numerous applications in industry such as rotating glass car-wipers, ski boots fixatives, and for use in air-brake systems on trucks. Many new uses, based on the biodegradability of castor oil derived products, are expected in the future (Labalette et al., 1996. The shell of the castor bean is used as an organic termite control agent and its seed cake as manure in the soil. Medicinal plants are valuable resources in a wide range of natural resources that scientific identification, cultivation, development and proper utilization of them can have an important role in community health, employment and non-petrol exports. Quality of medicinal plants is more important than other crops. One of the most important factors determining the yield of castor bean is fertility. Integrated supply of nutrient to plants through combinations of organic and inorganic sources is becoming an increasingly important aspect of environmentally sound agriculture. Reports showed that the application of manure on bean

  4. Discovery and Characterization of Novel Signatures from the Ricinus communis L. (Castor Bean) Genome

    Science.gov (United States)

    2006-11-01

    2006 2. REPORT TYPE N/A 3. DATES COVERED - 4. TITLE AND SUBTITLE Discovery And Characterization Of Novel Signatures From The Ricinus Communis...pressed herbarium specimens prepared from sequenced plants.) Lane 2, PI167112; lane 3, 167287; lane 4, 167342; lane 5, 170684; lane 6, 170686; lane

  5. Energy flow in castor bean (Ricinus communis L. production systems Fluxos de energia em sistemas de produção de mamona (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Adilson Nunes da Silva

    2010-12-01

    Full Text Available Although energy analysis is a way to evaluate the sustainability of production systems, this practice is not often used in the agribusiness. In this context, the castor bean (Ricinus communis L is an agricultural crop not yet well studied despite its great potential in the Brazilian energetic scenario. This article aimed to evaluate the productive potential of the castor bean oil, using an energetic view applied to two management systems: low (System 1 and medium (System 2 technologies. The quantification of the used material fluxes was made converting these factors in energy units. The input energy fluxes were 3,170.6 MJ ha¹ and 10,366.0 MJ ha¹ for Systems 1 and 2, respectively. The energy balance of System 1 was 11,938.2 MJ ha¹ and that of System 2 16,296.5 MJ ha¹. The net energetic gain or the energy gain over the invested energy (EROI of System 1 was 3.8 and of System 2, 2.6. Although presenting a greater energy demand and a lower EROI, System 2 had a greater energy balance, demonstrating a better viability of this cultivation system for the production of castor bean oil.A análise energética é uma forma de se avaliar a sustentabilidade de um sistema produtivo, apesar de ainda pouco utilizada no setor agropecuário. Inserida neste setor encontra-se a produção da mamoneira (Ricinus communis L., cultura ainda pouco estudada e que apresenta grande importância para o agronegócio brasileiro. Avaliou-se sob a ótica energética a produção potencial de óleo de mamona em dois sistemas de cultivo: com baixa (Sistema 1 e média (Sistema 2 tecnologias. Foi realizada a quantificação dos fluxos de materiais empregados nos dois sistemas de produção e conversão destes fatores em unidades de energia. Os fluxos de energia de entrada foram de 3.170,6 MJ ha¹ e 10.366 MJ ha¹ para os sistemas 1 e 2, respectivamente. O balanço de energia foi de 11.938,2 MJ ha¹ no sistema 1 e 16.296,5 MJ ha¹ no sistema 2. A lucratividade energética, retorno

  6. Activity of Ricinus communis (Euphorbiaceae) against Spodoptera ...

    African Journals Online (AJOL)

    One of the most studied plant species with insecticidal properties is the castor bean Ricinus communis. However, its activity against Spodoptera frugiperda is unclear. Therefore, to determinate the insecticidal and insectistatic activities of methanol, hexane and ethyl acetate extracts of the seeds and leaves of R. communis, ...

  7. Local Perceptions about the Effects of Jatropha (Jatropha curcas and Castor (Ricinus communis Plantations on Households in Ghana and Ethiopia

    Directory of Open Access Journals (Sweden)

    Joleen A. Timko

    2014-10-01

    Full Text Available Biofuel plantations have been hyped as a means to reinvigorate Africa’s rural areas. Yet there is still apprehension about the negative environmental and social impacts of large-scale commercial biofuel production around rising food prices, land grabbing, ecological damage, and disruption of rural livelihoods. Given the extent of Jatropha curcas production in Ghana and Ethiopia and Castor bean (Ricinus communis in Ethiopia, this paper presents the results of a study that assessed the socio-economic implications of industrial Jatropha plantations on local livelihoods in Ghana, and of industrial Jatropha and Castor plantations on local livelihoods in Ethiopia. This study used primary data collected from 234 households in Ghana and 165 in Ethiopia. The cultivation of Jatropha and Castor has had several important effects on local livelihoods in the study sites, most notably decreases in household landholdings due to the arrival of industrial Jatropha or Castor plantations; and the resulting changes these plantations have caused in household socio-economic status, food security, fallow periods, and fodder availability. We consider how a lack of meaningful consultation between local people, their traditional authorities and the biofuel company managers, along with shortcomings in each country’s broader land acquisition process and poor land use information, may have contributed to these overall negative effects on local livelihoods. We conclude by suggesting several ways that emerging biofuel industries could be improved from the perspective of local people and their livelihoods.

  8. Alternatif Pembuatan Biodiesel Melalui Transesterifikasi Minyak Castor (Ricinus communis Menggunakan Katalis Campuran Cangkang Telur Ayam dan Kaolin

    Directory of Open Access Journals (Sweden)

    Soni - Setiadji

    2017-05-01

    Full Text Available Biodiesel was produced by transesterification of castor oil (Ricinus communis using a catalyst of CaO and kaolin (CaO / kaolin had been performed. CaO was obtained from the calcination of eggshell. Castor oil is selected as biodiesel feedstock because it belongs to non-food oil and easy to cultivate. In general, the research method aims to comprise the CaO / Kaolin catalysts with a ratio of 15 mmol CaO per 1 gram of kaolin activated using impregnation method and biodiesel produced through transesterification of castor oil using the catalyst at 65 ºC for 8 hours with ratio of castor oil: methanol: catalyst (1: 15: 5% w / w. The reaction is carried out on the reflux system. The XRD analysis show the presence of silica and potassium aluminum silicate hydroxide in the catalyst. The EDS results show the catalyst-forming components CaO and silica. The FTIR analysis results show the absorption peak in the functional group forming the methyl ester compound. Based on the characterization of GC-MS, the largest methyl ester components contained in biodiesel are methyl risinoleate, methyl elaidat, methyl stearate, methyl linoleate, and methyl palmitate. The overall conversion of castor oil to methyl ester using CaO / kaolin catalyst is 97.36%. The largest component in castor oil is risinoleic acid, has been successfully converted to methyl risinoleate by 74.75%.DOI: http://dx.doi.org/10.15408/jkv.v0i0.4778

  9. Exploiting EST databases for the development and characterization of EST-SSR markers in castor bean (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Yang Jun-Bo

    2010-12-01

    Full Text Available Abstract Background The castor bean (Ricinus communis L., a monotypic species in the spurge family (Euphorbiaceae, 2n = 20, is an important non-edible oilseed crop widely cultivated in tropical, sub-tropical and temperate countries for its high economic value. Because of the high level of ricinoleic acid (over 85% in its seed oil, the castor bean seed derivatives are often used in aviation oil, lubricants, nylon, dyes, inks, soaps, adhesive and biodiesel. Due to lack of efficient molecular markers, little is known about the population genetic diversity and the genetic relationships among castor bean germplasm. Efficient and robust molecular markers are increasingly needed for breeding and improving varieties in castor bean. The advent of modern genomics has produced large amounts of publicly available DNA sequence data. In particular, expressed sequence tags (ESTs provide valuable resources to develop gene-associated SSR markers. Results In total, 18,928 publicly available non-redundant castor bean EST sequences, representing approximately 17.03 Mb, were evaluated and 7732 SSR sites in 5,122 ESTs were identified by data mining. Castor bean exhibited considerably high frequency of EST-SSRs. We developed and characterized 118 polymorphic EST-SSR markers from 379 primer pairs flanking repeats by screening 24 castor bean samples collected from different countries. A total of 350 alleles were identified from 118 polymorphic SSR loci, ranging from 2-6 per locus (A with an average of 2.97. The EST-SSR markers developed displayed moderate gene diversity (He with an average of 0.41. Genetic relationships among 24 germplasms were investigated using the genotypes of 350 alleles, showing geographic pattern of genotypes across genetic diversity centers of castor bean. Conclusion Castor bean EST sequences exhibited considerably high frequency of SSR sites, and were rich resources for developing EST-SSR markers. These EST-SSR markers would be particularly

  10. Synthesis and characterization of dialkanolamides from castor oil (Ricinus communis) as nonionic surfactant

    Science.gov (United States)

    Anwar, M.; Wahyuningsih, T. D.

    2017-12-01

    Nonionic surfactant of dialkanolamide derivates was synthesized and characterized from castor oil (Ricinus comunnis). Ricinoleic acid was isolated from castor oil by hydrolysis in alkaline (KOH) condition at 65 °C. Oxidation of ricinoleic acid by dilute potassium permanganate (KMnO4) in alkaline condition at 75-90 °C gave dicarboxylic acid which was then reacted with ethanolamine at 140-160 °C for 6 hours. The product was recrystallized with isopropanol, and the structure elucidation was performed by FTIR, 1HNMR spectrometer, and GC-MS with silylation method. Characterization of surfactants was carried out by surface tension measurement (capillary rise method), Critical Micelle Concentration (CMC) based on turbidity method and calculation of Hydrophilic-Lipophilic Balance (HLB) value with Griffin method and Bancroft rule. The result showed that ricinoleic acid in castor oil is 86.19 % and it is oxidation give an azelaic acid and octanedioic acid in 53.25 %. Amidation of a dicarboxylic acid and ethanolamine at 140-160 °C for 6 hours yielded of N1,N9-bis(2-hydroxyethyl)nona diamide in 49.35 %. Surfactant characterization indicates that dialkanolamide derivates can be used as a surfactant due to its ability to reduce the surface tension of ethanol with CMC at 1.2 g/L, HLB value is 5.58 and can be used as emulsifier water in oil (W/O).

  11. Proteomic profile of the nucellus of castor bean (Ricinus communis L.) seeds during development.

    Science.gov (United States)

    Nogueira, Fábio C S; Palmisano, Giuseppe; Soares, Emanoella L; Shah, Mohibullah; Soares, Arlete A; Roepstorff, Peter; Campos, Francisco A P; Domont, Gilberto B

    2012-03-16

    In this study, we performed a proteomic analysis of nucellus from two developmental stages of Ricinus communis seeds by a GeLC-MS/MS approach, using of a high resolution orbitrap mass spectrometer, which resulted in the identification of a total of 766 proteins that were grouped into 553 protein groups. The distribution of the identified proteins in stages III and IV into different Gene Ontology categories was similar, with a remarkable abundance of proteins associated with the protein synthesis machinery of cells, as well as several classes of proteins involved in protein degradation, particularly of peptidases associated with programmed cell death. Consistent with the role of the nucellus in mediating nutrient transfer from maternal tissues to the endosperm and embryo, a significant proportion of the identified proteins are related to amino acid metabolism, but none of the identified proteins are known to have a role as storage proteins. Moreover for the first time, ricin isoforms were identified in tissues other than seed endosperm. Results are discussed in the context of the spatial and temporal distribution of the identified proteins within the nucellar cell layers. Copyright © 2012 Elsevier B.V. All rights reserved.

  12. Diversity of Castor (Ricinus communis L.) in Ethiopia አህፅርኦት ...

    African Journals Online (AJOL)

    In Ethiopia, Castor grows as annual in the low lands to small tree perennial in the high lands. India, china, Brazil and USA are the major castor producers globally. Castor bears seeds that containing highly valuable industrial oil. Castor oil is unique among vegetable oil because it is the only commercial source of a ...

  13. Genotyping and Bioforensics of Ricinus communis

    Energy Technology Data Exchange (ETDEWEB)

    Hinckley, Aubree Christine [Univ. of California, Davis, CA (United States)

    2006-01-01

    The castor bean plant (Ricinus communis) is a member of the family Euphorbiaceae. In spite of its common name, the castor plant is not a true bean (i.e., leguminous plants belonging to the family, Fabaceae). Ricinus communis is native to tropical Africa, but because the plant was recognized for its production of oil with many desirable properties, it has been introduced and cultivated in warm temperate regions throughout the world (Armstrong 1999 and Brown 2005). Castor bean plants have also been valued by gardeners as an ornamental plant and, historically, as a natural rodenticide. Today, escaped plants grow like weeds throughout much of the southwestern United States, and castor seeds are even widely available to the public for order through the Internet. In this study, multiple loci of chloroplast noncoding sequence data and a few nuclear noncoding regions were examined to identify DNA polymorphisms present among representatives from a geographically diverse panel of Ricinus communis cultivated varieties. The primary objectives for this research were (1) to successfully cultivate castor plants and extract sufficient yields of high quality DNA from an assortment of castor cultivated varieties, (2) to use PCR and sequencing to screen available universal oligos against a small panel of castor cultivars, (3) to identify DNA polymorphisms within the amplified regions, and (4) to evaluate these DNA polymorphisms as appropriate candidates for assay development (see Figure 1). Additional goals were to design, test and optimize assays targeting any DNA polymorphisms that were discovered and to rapidly screen many castor cultivars to determine the amount of diversity present at that particular locus. Ultimately, the goal of this study was to construct a phylogeographic tree representing the genetic relationships present among Ricinus communis cultivars from diverse geographic regions. These research objectives were designed to test the hypothesis that cultivated varieties

  14. Effects The N-Hexane Extract Of Castor ( Ricinus Communis ) Seeds ...

    African Journals Online (AJOL)

    Materials and methods: The seeds of Castor plant were obtained, dried, pulverized, and exhaustively soxhlex extracted in N-hexane at 750C for 72 hours. This was dissolved in appropriate volumes of corn oil to make a concentration of 20mg/ml. The extract was administered to twenty –five (25) adult wistar rats at a dose of ...

  15. Antibacterial profile of fermented seed extracts of ricinus communis ...

    African Journals Online (AJOL)

    The study was carried out to ascertain the antibacterial properties inherent in fermented seed extracts of Ricinus communis. Dry seeds of R. communis (Castor oil plant) were deshelled, grounded to powder, fermented, and then extracted both with alcohol and water using Soxhlet machine. Different concentrations of the ...

  16. Rhipicephalus sanguineus (Acari: Ixodidae) female ticks exposed to castor oil (Ricinus communis): an ultrastructural overview.

    Science.gov (United States)

    Sampieri, B R; Furquim, K C S; Nunes, P H; Camargo-Mathias, M I

    2013-02-01

    Tick control has been accomplished through the use of synthetic acaricides, which has created resistant individuals, as well as contaminating the environment and nontarget organisms. Substances of plant origin, such as oils and extracts of eucalyptus and neem leaves, have been researched as an alternative to replace the synthetic acaricides. Ricinoleic acid esters from castor oil have recently been shown as a promising alternative in eliminating bacterial contamination during ethanol fermentation, by acting as an effective biocide. The same positive results have been observed when these esters are added to the food given to tick-infested rabbits. This study tested the effect of these substance on the reproductive system of Rhipicephalus sanguineus females, added to rabbit food, more specifically on oogenesis. For this, four groups were established: four control groups (CG1, CG2, CG3, and CG4) and four treatment groups (TG1, TG2, TG3, and TG4) with one rabbit in each (New Zealand White), used as hosts. After full 4 days feeding (semi-engorgement), the females were collected and had their ovaries extracted. In this study, it was observed that R. sanguineus females exposed to esters had their ovaries modified, which was demonstrated through transmission electron microscopy techniques. The addition of ricinoleic esters to the diet of tick-infested rabbits revealed how toxic such substances are for the cytoplasmic organelles of oocytes and pedicel cells. These compounds can change the morphophysiology of germ and somatic cells, consequently influencing their viability and, therefore, confirming that the ricinoleic acid esters from castor oil are a promising substance in the control of R. sanguineus.

  17. Polyurethane resins derived from castor oil (Ricinus communis) for tibial crest deviation in dogs

    International Nuclear Information System (INIS)

    Maria, P.P.; Padilha Filho, J.G.; Canola, J.C.; Castro, M.B.

    2004-01-01

    Medial patellar luxation is one of the most common orthopedic problems in small breeds of dogs and tibial crest deviation is a frequent accompaining anatomical abnormality. For that reason, the purpose of this study was to evaluate the behavior of castor oil derived polyurethane implants when apllied to experimental defects created on the medial side of the proximal tibia of normal puppies. Twelve dogs were randomly divided in 3 groups of 4 animals and were submitted to the same treatment. Histopathological study was performed respectively at 30 (GI), 60 (GII) and 90 (GIII) days post-surgery. Evaluations methods included clinical assessment, radiology, gross and macroscopic study, tomography and statistical analysis. Clinically, there were no signs of implant rejection. Radiology revealed intense periosteal reaction and new bone formation. On gross examination, there was thickening and lateral deviation of the tibial crest and new bone neoformation. On microscopic examination, there was fibrous tissue around the polyurethane, periosteal proliferation on the medial side of the tibia and no bone proliferation towards the implant. Cat scans reveled lateral deviation of the tibial crest in eleven animals, which was statistically significant (p [pt

  18. Balanço energético para a produção de biodiesel pela cultura da mamona (Ricinus communis L. Energy balance for biodiesel production by the castor bean crop (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Rodolfo Glauber Chechetto

    2010-12-01

    Full Text Available A cultura da mamona (Ricinus communis L. adquiriu prestígio ao interesse da indústria pela qualidade de seu óleo e, recentemente, pela busca de novas fontes de energias. O experimento que serviu como base para os dados utilizados nesse trabalho foi realizado na Fazenda Experimental Lageado, FCA - UNESP, no município de Botucatu - SP, no ano de 2008. O objetivo deste trabalho foi avaliar a viabilidade energética da cultura através do balanço e da eficiência energética, desde a implantação até a produção de biodiesel, utilizando parâmetros de consumo operacional no manejo para instalação e manutenção da cultura, colheita e processamento de óleo. As operações de manejo de solo, semeadura e colheita consumiramo total de 266,20 MJ ha-1, que juntamente com fertilizantes, agrotóxicos, combustíveis e lubrificantes, mão-de-obra, sementes e processamento industrial totalizaram uma entrada de energia de 56.808,10 MJ ha-1. A produção de energia foi de 72.814,00 MJ ha-1. O setor ainda carece de estudos que contribuiriam para o levantamento de dados e coeficientes energéticos mais específicos. A cultura da mamona foi considerada eficiente, permitindo ganho de 15.983,44 MJ ha-1, equivalente a aproximadamente 415 L de óleo diesel.The castor bean crop (Ricinus communis L. has acquired prestige due to industries interest in the oil quality and recently for new sources of energy demand. The experiment that served as basis for the data used in this study was conducted at the Lageado Experimental Farm, in Botucatu - SP, 2008. This study aimed to avaluate the crop viability through energy balance and energy efficiency since the implantation until biodiesel production using parameters of consumption in operational management for installation and maintenance of culture harvest and oil production. The soil management operations, sow and harvest consumed the total of 266.20 MJ ha-1, gathering with the fertilizers, pesticides, fuels

  19. Semeadura do híbrido Lyra de mamona (Ricinus communis L. sob plantio direto Seeding of castor bean (Ricinus communis L. hybrid Lyra in no-tillage system

    Directory of Open Access Journals (Sweden)

    Nilza Patrícia Ramos

    2008-04-01

    Full Text Available A semeadura mecanizada da mamona (Ricinus communis L. pode reduzir o tempo de operação e os custos associados à mão-de-obra, porém a escassez de informações nesta área tem prejudicado a adoção correta desta tecnologia. Assim, objetivou-se com esse trabalho verificar a regularidade da distribuição longitudinal de sementes do híbrido Lyra de mamona, em área de plantio direto e sua relação com rendimento de grãos; bem como a viabilidade da aplicação de cartas de controle para a avaliação do processo de semeadura, nesta cultura. O ensaio foi conduzido em área comercial de produção de grãos de mamona sob plantio direto, sendo avaliadas: distribuição longitudinal, porcentagens de espaçamentos normais, falhos e duplos na linha, número de planta por metro linear, altura de plantas, altura e comprimento do racemo primário e rendimento de grãos. Utilizou-se a estatística descritiva, a análise de correlações e as cartas de controle para a avaliação dos parâmetros propostos. Há necessidade de refinamento nas regulagens de semeadoras-adubadoras de precisão para a semeadura do híbrido Lyra de mamona, em áreas de plantio direto; a distribuição longitudinal de sementes de mamona influencia vários parâmetros fitotécnicos, incluindo o rendimento de grãos; a aplicação da carta de controle é uma ferramenta eficiente para a avaliação do processo de semeadura da mamona.The mechanized sowing of castor bean (Ricinus communis L. can reduce the operation time and the costs associated to labor, however the privation of information in this area have damaged the correct adoption of this technology. Thus, the research had as an aim to verify the regularity of longitudinal distribution of hybrid Lyra castor bean seeds, in a no-tillage system area, and its relationship with yield; and the viability of control charts for evaluation of sowing in this crop. The essay was carded out in a commercial area of grain production in no

  20. Ricinus communis L. (castor bean) as a potential candidate for revegetating industrial waste contaminated sites in peri-urban Greater Hyderabad: remarks on seed oil.

    Science.gov (United States)

    Boda, Ravi Kiran; Majeti, Narasimha Vara Prasad; Suthari, Sateesh

    2017-08-01

    Ricinus communis L. (castor bean or castor oil plant) was found growing on metal-contaminated sites (4) of peri-urban Greater Hyderabad comprises of erstwhile industrial areas viz Bollaram, Patancheru, Bharatnagar, and Kattedan industrial areas. During 2013-2017, about 60 research papers have appeared focusing the role of castor bean in phytoremediation of co-contaminated soils, co-generation of biomaterials, and environmental cleanup, as bioenergy crop and sustainable development. The present study is focused on its use as a multipurpose phytoremediation crop for phytostabilization and revegetation of waste disposed peri-urban contaminated soils. To determine the plant tolerance level, metal accumulation, chlorophyll, protein, proline, lipid peroxidation, oil content, and soil properties were characterized. It was noticed that the castor plant and soils have high concentration of metals such as cadmium (Cd), lead (Pb), iron (Fe), manganese (Mn), and zinc (Zn). The soils have high phosphorous (P), adequate nitrogen (N), and low concentration of potassium (K). Iron (Fe) concentrations ranged from1672±50.91 to 2166±155.78 mg kg -1 in the soil. The trend of metal accumulation Fe>Zn>Mn>Pb>Cd was found in different plant parts at polluted sites. The translocation of Cd and Pb showed values more than one in industrial areas viz Bollaram, Kattedan, and Bharatnagar indicating the plants resistance to metal toxicity. Chlorophyll and protein content reduced while proline and malondialdehyde increased due to its tolerance level under metal exposure. The content of ricinoleic acid was higher, and the fatty acids composition of polluted areas was almost similar to that of the control area. Thus, R. communis L. can be employed for reclamation of heavy metal contaminated soils.

  1. Mining whole genomes and transcriptomes of Jatropha (Jatropha curcas) and Castor bean (Ricinus communis) for NBS-LRR genes and defense response associated transcription factors.

    Science.gov (United States)

    Sood, Archit; Jaiswal, Varun; Chanumolu, Sree Krishna; Malhotra, Nikhil; Pal, Tarun; Chauhan, Rajinder Singh

    2014-11-01

    Jatropha (Jatropha curcas L.) and Castor bean (Ricinus communis) are oilseed crops of family Euphorbiaceae with the potential of producing high quality biodiesel and having industrial value. Both the bioenergy plants are becoming susceptible to various biotic stresses directly affecting the oil quality and content. No report exists as of today on analysis of Nucleotide Binding Site-Leucine Rich Repeat (NBS-LRR) gene repertoire and defense response transcription factors in both the plant species. In silico analysis of whole genomes and transcriptomes identified 47 new NBS-LRR genes in both the species and 122 and 318 defense response related transcription factors in Jatropha and Castor bean, respectively. The identified NBS-LRR genes and defense response transcription factors were mapped onto the respective genomes. Common and unique NBS-LRR genes and defense related transcription factors were identified in both the plant species. All NBS-LRR genes in both the species were characterized into Toll/interleukin-1 receptor NBS-LRRs (TNLs) and coiled-coil NBS-LRRs (CNLs), position on contigs, gene clusters and motifs and domains distribution. Transcript abundance or expression values were measured for all NBS-LRR genes and defense response transcription factors, suggesting their functional role. The current study provides a repertoire of NBS-LRR genes and transcription factors which can be used in not only dissecting the molecular basis of disease resistance phenotype but also in developing disease resistant genotypes in Jatropha and Castor bean through transgenic or molecular breeding approaches.

  2. Acyl-ACP thioesterases from castor (Ricinus communis L.): an enzymatic system appropriate for high rates of oil synthesis and accumulation.

    Science.gov (United States)

    Sánchez-García, Alicia; Moreno-Pérez, Antonio J; Muro-Pastor, Alicia M; Salas, Joaquín J; Garcés, Rafael; Martínez-Force, Enrique

    2010-06-01

    Acyl-acyl carrier protein (ACP) thioesterases are enzymes that terminate the intraplastidial fatty acid synthesis in plants by hydrolyzing the acyl-ACP intermediates and releasing free fatty acids to be incorporated into glycerolipids. These enzymes are classified in two families, FatA and FatB, which differ in amino acid sequence and substrate specificity. In the present work, both FatA and FatB thioesterases were cloned, sequenced and characterized from castor (Ricinus communis) seeds, a crop of high interest in oleochemistry. Single copies of FatA and FatB were found in castor resulting to be closely related with those of Jatropha curcas. The corresponding mature proteins were heterologously expressed in Escherichia coli for biochemical characterization after purification, resulting in high catalytic efficiency of RcFatA on oleoyl-ACP and palmitoleoyl-ACP and high efficiencies of RcFatB for oleoyl-ACP and palmitoyl-ACP. The expression profile of these genes displayed the highest levels in expanding tissues that typically are very active in lipid biosynthesis such as developing seed endosperm and young expanding leaves. The contribution of these two enzymes to the synthesis of castor oil is discussed. Copyright 2010 Elsevier Ltd. All rights reserved.

  3. Escala diagramática para avaliação de mofo cinzento (Amphobotrys ricini da mamoneira (Ricinus communis L. Diagramatic scale to assess gray mold (Amphobotyrs ricini in castor bean (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Haroldo Antunes Chagas

    2010-06-01

    Full Text Available O objetivo do trabalho foi a elaboração de uma escala diagramática para avaliação de mofo cinzento causado por Amphobotrys ricini (Buchw. em mamoneira (Ricinus communis L.. Utilizaram 59 cachos, que foram desinfestados em solução de hipoclorito de sódio a 2% por 30 segundos e em água destilada e esterilizada. Depois foram acondicionados em bandejas com espuma umedecida, onde receberam discos de micélio de 5mm do patógeno, permanecendo em câmara climática a 25ºC e UR de 80%. Observou-se a evolução da doença e foram obtidos fotos dos cachos doentes diariamente. Para a determinação da porcentagem de severidade dos cachos, os frutos infectados e sadios foram contados, estimando-se dessa forma a porcentagem da área lesionada e elaborando uma escala diagramática com seis níveis de severidade. A adoção da escala proposta, melhorou a acurácia (R²=0,94, com valores de "a" não significativamente diferentes de zero (0 e os valores de "b" não diferentes de um (1.The aim of the present study was to develop a diagrammatic scale to assess gray mold caused by Amphobotrys ricini in castor bean (Ricinus communis L.. The experiment included 59 clusters, which were disinfected in solution of sodium hypochlorite to 2% for 30 seconds and distilled water and sterilized. Then, they were packed in moistened foam trays which received 5mm mycelial discs, and were kept in a climatic chamber at 25º C and 80%. RH. The disease evolution was observed daily pictures of the clusters diseased. To determine the severity percentage of the bunches, infected and healthy fruits were counted, estimating thus the percentage of the injured area, and developing a diagrammatic scale with six severity levels. The adoption of the proposed scale, improved the accuracy (R² = 0,94 "a" values were not significantly different from zero (0 and "b" values were not significantly different from one (1.

  4. Eficiência da seleção recorrente para redução da estatura de plantas em mamoneira (Ricinus communis L. Recurrent selection efficiency for stature reduction of castor bean (Ricinus communis L. plants

    Directory of Open Access Journals (Sweden)

    Inocencio Junior de Oliveira

    2008-08-01

    Full Text Available Realizou-se, o presente trabalho, com o objetivo de avaliar a eficiência da seleção recorrente para a redução da estatura de plantas de mamona da cultivar Guarani (Ricinus communis L., tornando-a com porte adequado para facilitar a colheita manual e/ou mecânica. Foram realizados quatro ciclos de seleção recorrente com a utilização de progênies autofecundadas na cultivar Guarani para redução da estatura das plantas, nas condições edafoclimáticas dos municípios de São Manuel - SP, Botucatu - SP e Penápolis - SP. As avaliações de estatura das plantas e de produtividade de grãos (kg.ha-1, dos quatro ciclos de seleção e do ciclo original foram realizadas nos municípios de São Manuel - SP, Botucatu - SP e Penápolis - SP na safra 2005/2006, sob um delineamento de blocos casualizados com cinco repetições e parcela útil de 30 m². A análise de variância para as características avaliadas foi feita separadamente para cada local e conjuntamente para os três locais e, posteriormente, realizada a comparação das médias pelo teste de Tukey, a 5%. Foram estimados, para as três localidades, por análise de regressão, os ganhos genéticos dos quatros ciclos de seleção para estatura de plantas. A partir dos resultados obtidos pôde-se concluir que a seleção recorrente foi eficiente para a redução da estatura de plantas e que a cultivar de mamona Guarani apresenta variabilidade genética para essa característica e que a produtividade não foi influenciada pela redução da estatura de plantas.The aim of this work was to evaluate the recurrent selection efficiency for reduction of stature of the castor bean plants of the Guarani cultivar (Ricinus communis L., turning it with appropriate strucuture to facilitate the manual and/or mechanic harvest. Four cycles of recurrent selection were accomplished through the utilization of self-pollinated progenies in the Guarani cultivar for reduction of plants stature, in

  5. Tissue-specific expression and post-translational modifications of plant- and bacterial-type phosphoenolpyruvate carboxylase isozymes of the castor oil plant, Ricinus communis L.

    Science.gov (United States)

    O’Leary, Brendan; Fedosejevs, Eric T.; Hill, Allyson T.; Bettridge, James; Park, Joonho; Rao, Srinath K.; Leach, Craig A.; Plaxton, William C.

    2011-01-01

    This study employs transcript profiling together with immunoblotting and co-immunopurification to assess the tissue-specific expression, protein:protein interactions, and post-translational modifications (PTMs) of plant- and bacterial-type phosphoenolpyruvate carboxylase (PEPC) isozymes (PTPC and BTPC, respectively) in the castor plant, Ricinus communis. Previous studies established that the Class-1 PEPC (PTPC homotetramer) of castor oil seeds (COS) is activated by phosphorylation at Ser-11 and inhibited by monoubiquitination at Lys-628 during endosperm development and germination, respectively. Elimination of photosynthate supply to developing COS by depodding caused the PTPC of the endosperm and cotyledon to be dephosphorylated, and then subsequently monoubiquitinated in vivo. PTPC monoubiquitination rather than phosphorylation is widespread throughout the castor plant and appears to be the predominant PTM of Class-1 PEPC that occurs in planta. The distinctive developmental patterns of PTPC phosphorylation versus monoubiquitination indicates that these two PTMs are mutually exclusive. By contrast, the BTPC: (i) is abundant in the inner integument, cotyledon, and endosperm of developing COS, but occurs at low levels in roots and cotyledons of germinated COS, (ii) shows a unique developmental pattern in leaves such that it is present in leaf buds and young expanding leaves, but undetectable in fully expanded leaves, and (iii) tightly interacts with co-expressed PTPC to form the novel and allosterically-desensitized Class-2 PEPC heteromeric complex. BTPC and thus Class-2 PEPC up-regulation appears to be a distinctive feature of rapidly growing and/or biosynthetically active tissues that require a large anaplerotic flux from phosphoenolpyruvate to replenish tricarboxylic acid cycle C-skeletons being withdrawn for anabolism. PMID:21841182

  6. Irrigation of Castor Bean (Ricinus communis L. and Sunflower (Helianthus annus L. Plant Species with Municipal Wastewater Effluent: Impacts on Soil Properties and Seed Yield

    Directory of Open Access Journals (Sweden)

    Vasileios A. Tzanakakis

    2011-11-01

    Full Text Available The effects of plant species (castor bean (Ricinus communis L. versus sunflower (Helianthus annus L. and irrigation regime (freshwater versus secondary treated municipal wastewater on soil properties and on seed and biodiesel yield were studied in a three year pot trial. Plant species were irrigated at rates according to their water requirements with either freshwater or wastewater effluent. Pots irrigated with freshwater received commercial fertilizer, containing N, P, and K, applied at the beginning of each irrigation period. The results obtained in this study showed that irrigation with effluent did not result in significant changes in soil pH, soil organic matter (SOM, total kjeldahl nitrogen (TKN, and dehydrogenase activity, whereas soil available P was found to increase in the upper soil layer. Soil salinity varied slightly throughout the experiment in effluent irrigated pots but no change was detected at the end of the experiment compared to the initial value, suggesting sufficient salt leaching. Pots irrigated with effluent had higher soil salinity, P, and dehydrogenase activity but lower SOM and TKN than freshwater irrigated pots. Sunflower showed greater SOM and TKN values than castor bean suggesting differences between plant species in the microorganisms carrying out C and N mineralization in the soil. Plant species irrigated with freshwater achieved higher seed yield compared to those irrigated with effluent probably reflecting the lower level of soil salinity in freshwater irrigated pots. Castor bean achieved greater seed yield than sunflower. Biodiesel production followed the pattern of seed yield. The findings of this study suggest that wastewater effluent can constitute an important source of irrigation water and nutrients for bioenergy crop cultivations with minor adverse impacts on soil properties and seed yield. Plant species play an important role with regard to the changes in soil properties and to the related factors of

  7. Life history of Neoseiulus californicus (McGregor, 1954 (Acari: Phytoseiidae fed with castor bean (Ricinus communisL. pollen in laboratory conditions

    Directory of Open Access Journals (Sweden)

    PP Marafeli

    Full Text Available The predatory mite, Neoseiulus californicus(McGregor, 1954 (Acari: Phytoseiidae is one of the principal natural enemies of tetranychid mites in several countries, promoting efficient control of those mites in several food and ornamental crops. Pest attacks such as that of the spider mite, Tetranychus urticaeKoch, 1836 (Acari: Tetranychidae, is one of the problems faced by farmers, especially in the greenhouse, due to the difficulty of its control with the use of chemicals because of the development of fast resistance making it hard to control it. The objective of this work was to study the life history of the predatory mite N. californicus as a contribution to its mass laboratory rearing, having castor bean plant [Ricinus communis L. (Euphorbiaceae] pollen as food, for its subsequent use as a natural enemy of T. urticae on a cultivation of greenhouse rosebushes. The studies were carried out in the laboratory, at 25 ± 2°C of temperature, 70 ± 10% RH and a 14 hour photophase. The biological aspects and the fertility life table were appraised. Longevity of 32.9 days was verified for adult females and 40.4 days for males. The intrinsic rate of increase (rm was 0.2 and the mean generation time (T was 17.2 days. The population doubled every 4.1 days. The results obtained were similar to those in which the predatory mite N. californicus fed on T. urticae.

  8. Poliuretana de mamona (Ricinus communis para desvio da crista tibial no cão Polyurethane resins derived from castor oil (Ricinus communis for tibial crest deviation in dogs

    Directory of Open Access Journals (Sweden)

    Patricia Popak Maria

    2004-06-01

    Full Text Available A luxação medial de patela é uma das principais afecções ortopédicas que afetam cães de raças de pequeno porte. Tendo como princípio que o desvio da crista tibial é uma das alterações anatômicas encontradas, este estudo objetivou avaliar o efeito da poliuretana de mamona (Ricinus communis aplicada em defeitos produzidos experimentalmente na porção proximal medial da tíbia de cães normais em fase de crescimento. Para isto, foram utilizados 12 cães subdivididos aleatoriamente em 3 grupos de igual número, com mesmo tratamento, mas com análise histopatológica aos 30 (GI, 60 (GII e 90 (GIII dias. O estudo constou de avaliações clínica, radiográfica, macroscópica, histopatológica, tomográfica e análise estatística. Avaliação clínica demonstrou não haver rejeição do implante. A análise radiográfica revelou intensa reação periosteal e neoformações ósseas no local da implantação. Macroscopicamente observou-se espessamento da crista tibial, neoformações ósseas e desvio lateral da crista. Os achados à microscopia óptica revelaram presença de tecido conjuntivo fibroso ao redor da poliuretana, ausência de proliferação óssea em direção ao implante e proliferação de periósteo na face medial das tíbias. A tomografia computadorizada revelou desvio lateral da crista em 11 animais e estes desvios foram estatisticamente significantes em nível de 5% por meio do teste t pareado.Medial patellar luxation is one of the most common orthopedic problems in small breeds of dogs and tibial crest deviation is a frequent accompaining anatomical abnormality. For that reason, the purpose of this study was to evaluate the behavior of castor oil derived polyurethane implants when apllied to experimental defects created on the medial side of the proximal tibia of normal puppies. Twelve dogs were randomly divided in 3 groups of 4 animals and were submitted to the same treatment. Histopathological study was performed

  9. Exogenous glutamine increases lipid accumulation in developing seeds of castor bean (Ricinus communis L. cultured in vitro

    Directory of Open Access Journals (Sweden)

    Zhang Yang

    2015-01-01

    Full Text Available This report describes biomass production and compositional changes of developing castor seeds in response to change in the nitrogen resource (glutamine of the medium. During the early developmental period (24-36 days after pollination, oil was found to initially accumulate in the developing seeds. Carbohydrates and oil were inversely related after glutamine provision (35 mM, in the culture medium. [U-14C] sucrose labeling was used to investigate the effect of metabolic fluxes among different storage materials. Addition of glutamine led to a 7% increase of labeling in lipids and an inverse decrease of labeling in carbohydrates. It was postulated that changes in the glutamine concentration in the medium are likely to influence the partitioning of resources between the various storage products, especially carbohydrates and oil. These observations will contribute to a better understanding of assimilate partitioning in developing castor seeds and the development of molecular strategies to improve castor bean seed quality and plant breeding studies.

  10. A review of nutritional and toxicological implications of castor bean (Ricinus communis L.) meal in animal feeding systems.

    Science.gov (United States)

    Akande, T O; Odunsi, A A; Akinfala, E O

    2016-04-01

    The nutrient-rich defatted castor meal has been tested as a potential source of protein in diets of many livestock species but has limitation due to challenges of toxins. This review was conducted to compile the relevant research information on advances in the use of raw and differently processed castor seed meal in animal feed. In this article, distribution and uses of castor and its products were identified. Research findings on the nutrients profile, principal toxins, various detoxification strategies, nutritional value and toxicity on common livestock species were compiled and reviewed. The defatted seed meal had crude protein range of 32-48%, gross energy of about 3200 kcal/kg. Ricin content was 9.3 mg/g seed, and the average RCA content was 9.9 mg/g. The meal had high activity of lectin, which produced agglutination at about 4.70 mg/ml minimum assays. Reports of detoxification strategies showed varying degrees of success but high pH, moist heating and microbial techniques appeared to exert greater effect on deactivating ricin. Detoxification strategy for the allergen component is inconclusive. Tannins and the phenolic contents were present at trace level and did not constitute notable threat. It was concluded that castor seed holds great potential as feedstuff when upgraded but such upgrading must be safe, cost-effective and labour efficient for commercial acceptability. Journal of Animal Physiology and Animal Nutrition © 2015 Blackwell Verlag GmbH.

  11. High-yield production of biodiesel by non-catalytic supercritical methanol transesterification of crude castor oil (Ricinus communis)

    International Nuclear Information System (INIS)

    Román-Figueroa, Celián; Olivares-Carrillo, Pilar; Paneque, Manuel; Palacios-Nereo, Francisco Javier; Quesada-Medina, Joaquín

    2016-01-01

    The synthesis of biodiesel from crude castor oil in a catalyst-free process using supercritical methanol in a batch reactor was investigated, studying the evolution of intermediate products as well as the conversion of triglycerides and the yield of FAMEs (fatty acid methyl esters) (biodiesel). Experiments were carried out in a temperature range of 250–350 °C (10–43 MPa) at reaction times of 15–90 min for a methanol-to-oil molar ratio of 43:1. Maintaining thermal stability of biodiesel is one of the most important concerns in high-yield supercritical biodiesel production. Hence, thermal decomposition degree of FAMEs was also investigated in different reaction conditions. The maximum yield of FAMEs (96.5%) was obtained at 300 °C (21 MPa) and 90 min. Under these conditions, the conversion of triglycerides was complete, the yield of intermediate products was low (3.29 and 1.41% for monoglycerides and diglycerides, respectively), and thermal decomposition of FAMEs did not occur. The maximum degree of thermal decomposition (80.9%) was produced at 350 °C (43 MPa) and 90 min. Methyl ricinoleate, whose fatty acid chain was the most abundant (88.09 mol%) in castor oil, was very unstable above 300 °C and 60 min, leading to low yields of FAMEs under these conditions. - Highlights: • Supercritical synthesis of biodiesel from crude castor oil was investigated. • Supercritical methanolysis of crude castor oil reached a high yield of FAMEs. • Ricinoleic acid methyl ester was very unstable above 300 °C and 60 min reaction.

  12. Effects of sowing dates and different fertilizers on yield, yield components, and oil percentage of castor bean (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    parviz rezvani moghadam

    2009-06-01

    Full Text Available In order to study the effects of sowing dates and different fertilizers on yield, yield components, and oil percentage of castor bean, an experiment was conducted at Experimental station, College of Agriculture, Ferdowsi University of Mashhad, Iran in years 2004-2005. The experimental treatments comprised all combinations of four sowing dates (11 April, 25 April, 8 May and 22 May and three different fertilizers (cow manure (30 tons/ha, compost (30 tons/ha, chemical fertilizers (100 kg/ha N and 250 kg/ha of super phosphate and no fertilizer as control. Different characteristics such as plant height, main inflorescence height, number of inflorescence per plant, number of secondary stems per plant, number of capsules per plant, number of grain per plant, grain weight per plant, 100 seed weight, grain yield, oil percentage and oil yield were recorded. A factorial arrangement based on a randomized complete block design with three replications was used. The results showed by delaying sowing date grain yield, seed oil percentage and oil yield were decreased, but there was no significant differences between 25 April, 8 May and 22 May sowing dates. Harvest index and 100 seed weight did not affect by neither sowing dates nor fertilizer treatments. The highest number of branches per plant, number of fertile inflorescences per plant, number of fertile capsules per plant, number of grain per plant, grain weight per plant and biological yield were obtained at 8 May sowing date on chemical fertilizer. Percentage of seed oil, grain yield and oil yield was higher at the first sowing date (11 April in compost and chemical fertilizer treatments. Keywords: Castor bean, sowing date, fertilizer, grain yield, oil percentage.

  13. Phytochemical and Pharmacological Investigations of Ricinus communis Linn.

    Directory of Open Access Journals (Sweden)

    Ram Singh

    2015-01-01

    Full Text Available Medicinal plants have always played a vital role for the healthy human life. The family Euphorbiaceous is a family of flowering plants and contains nearly about 300 genera and 7,500 species. Amongst all, the species Ricinus communis or castor plant has high traditional and modern medicinal values. The individual parts of the plant like the seed, seed oil, leaves and the roots showed their importance in pharmacology. Traditionally, the plant has been used for the treatment of various diseases in traditional or folk remedies throughout the world. In modern pharmacology, this plant is reported to possess antioxidant, anti-inflammatory, anti-diabetic, central analgesic, antitumor, anti-nociceptive, antiasthmatic activity and other medicinal properties. These activities of the plant are due to the presence of important phytochemical constituents like flavonoids, glycosides, alkaloids, steroids, terpenoids etc. The aim of present article is to explore the chemical constituents, their structures and medicinal importance of Ricinus communis.

  14. In vitro antimicrobial and larvicidal properties of wild Ricinus communis L. in Mauritius

    Directory of Open Access Journals (Sweden)

    Sillma Rampadarath

    2016-02-01

    Conclusions: Ricinus communis (castor plant extracts possess larvicidal properties providing an effective eco-friendly control for fruit flies. The antimicrobial results justify the use of this plant in traditional medicine and the practice of supplementing decoctions/concoctions with conventional antibiotics.

  15. Spontaneous poisoning by Ricinus communis (Euphorbiaceae in cattle

    Directory of Open Access Journals (Sweden)

    Samuel S.C. Albuquerque

    2014-09-01

    Full Text Available The aim of this study is to report cases of spontaneous poisoning of cattle by Ricinus communis (castor beans in Paraíba, a semiarid region of northeastern Brazil. The cases were observed in 2 herds on neighboring properties in 2013. Clinical signs developed within 6-24 h and consisted of weakness, tachycardia, dyspnea, profuse watery diarrhea, dehydration, depression, instability, cramps, permanent lateral recumbency and death within 48-72 h. Of the 60 cattle at risk, 19 were affected and 14 died. Five fully recovered after the course of 12 days. Three animals were necropsied. The main gross lesions were hemopericardium, hemothorax, pulmonary edema, petechial hemorrhages in the epicardium and endocardium, ecchymoses at the papillary muscles and suffusions on the intercostal muscles. Hemorrhages were also observed in the abdominal cavity, spleen and mucosa of the abomasum and small intestine. The rumen content was liquid with a large amount of castor bean seeds. There were circular, whitish and focally diffuse areas in the liver parenchyma. The main microscopic lesions consisted of multifocal coagulative myocardial necrosis with the presence of mononuclear cell infiltration and varying degrees of bleeding between cardiac muscle fibers. The abomasum and small intestine mucosae and submucosa had mild edema and mononuclear and polymorphonuclear inflammatory cell infiltration. The diagnosis of R. communis was based on the history of plant consumption, clinical signs, pathology of the disease and the presence of large amounts of castor bean seeds in the forestomachs.

  16. Amelioration of Anti-Nutritive Effects of Castor Oil Seed ( Ricinus ...

    African Journals Online (AJOL)

    Three hundred and twenty (320) day old male broilers were used to investigate the amelioration of anti-nutritive effects of castor oil seed (Ricinus communis) meal in broilers' ration using natural fermentation and DL-Methionine supplementation. The experimental designed was a 4 × 2 factorial arrangement of dietary ...

  17. Immunogenic Properties of Ricinus Communis Var Minor Seed on ...

    African Journals Online (AJOL)

    Prof. Ogunji

    Abstract. The immunogenic properties of Ricinus communis var minor seed was determined after feeding 7 healthy virgin albino white rabbits with varying doses of 0.5g – 0.9g dried ground. Ricinus communis var minor seed included in their feed (5g/100g body weight). Booster doses of the same weight were further ...

  18. Immunogenic Properties of Ricinus Communis Var Minor Seed on ...

    African Journals Online (AJOL)

    The immunogenic properties of Ricinus communis var minor seed was determined after feeding 7 healthy virgin albino white rabbits with varying doses of 0.5g – 0.9g dried ground Ricinus communis var minor seed included in their feed (5g/100g body weight). Booster doses of the same weight were further administered ...

  19. Synthesis of Estolide 2-ethylhexyl Ester from Ricinus communis

    International Nuclear Information System (INIS)

    Nazrizawati Ahmad Tajuddin; Nor Habibah Rosli

    2013-01-01

    Estolide 2-ethylhexyl ester synthesized through condensation reaction between ricinoleic acid from castor oil (Ricinus communis) and lauric acid, and then capped with 2-ethylhexyl alcohol. The reaction was continuously conducted under vacuum for 24 hours. Product of 2-ethylhexyl ester was characterized by using Fourier Transform Infrared (FTIR) to determine functional group and Nuclear Magnetic Resonans (NMR) for structure's determination. The presence of ester group at 1738.23 cm -1 wavenumber indicates that the formation of estolide ester has occurred. The vibration peak of C-O at 1174.60 cm -1 and 1117.10 cm -1 support the formation of ester. The presence of CH 2 bending indicated the long-chain compound. The ester methine signal at 3.8669 ppm indicated the estolide linkage in the 1 H-NMR spectrum while the 13 C-NMR showed two carbonyl signals at 173.41 ppm for acid and 173.56 ppm for ester. (author)

  20. Testes de vigor para avaliação do potencial fisiológico de sementes de mamona (Ricinus communis L. Vigor test for the evaluation of the physiology potencial of castor bean (Ricinus communis L. seeds

    Directory of Open Access Journals (Sweden)

    Rita de Cássia Mendes

    2010-02-01

    Full Text Available A qualidade de sementes de mamona tem sido avaliada rotineiramente pelo teste de germinação, cujos resultados, muitas vezes, não são confirmados em campo. Nesse contexto, os testes de vigor são essenciais, pois retratam o comportamento das sementes sob maior amplitude de ambiente. Neste trabalho, objetivou-se avaliar a eficiência de métodos para determinar o potencial fisiológico de sementes de mamona. Para tanto, foram utilizados sete lotes de sementes de mamona, cultivar AL-Guarany, apresentando teor de água de aproximadamente 7% , que foram submetidos aos seguintes testes: germinação, primeira contagem de germinação, frio (a 10ºC/7 dias e a 25ºC/5 dias, porcentagem e velocidade de emergência de plântulas, envelhecimento acelerado a 41ºC e 45ºC e 100% UR, por 48, 72 e 96 horas e condutividade elétrica (25 sementes embebidas em 75 e 100mL de água destilada, a 25ºC, por 2, 4, 6, 8, 24, 48 e 72 horas. Os testes de frio e de envelhecimento acelerado (41ºC/72 horas e 100% UR foram eficientes para avaliação do potencial fisiológico de sementes de mamona, permitindo classificação de lotes quanto ao vigor semelhante à emergência de plântulas em solo. O teste de condutividade elétrica não se mostrou adequado para avaliação do potencial fisiológico das sementes de mamona.This work had the objective to determine the efficiency of different tests for the evaluation of physiological potential of castor bean seeds. Seven seed lots of AL-Guarany cultivar were submitted to the following tests: seed moisture content, standard germination, first count, cold test (10ºC/7 days followed by germination at 25ºC/5 days, seedling emergence, speed emergence index, accelerated aging (at 41ºC and 45ºC and 100% RH, for 48, 72, and 96h and electrical conductivity (25 seeds soaked into 75 and 100mL of distilled water, at 25ºC, for 2, 4, 6, 8, 24, 48, and 72 h. The trial was conducted in randomized completely design, with four

  1. Development of a bioassay to quantify the ricin toxin content of castor bean (Ricinus communis L. seeds=Desenvolvimento de um bioensaio para quantificar o teor da toxina ricina em sementes de mamona (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Dick Auld

    2012-10-01

    Full Text Available In this study, we developed a bioassay to quantify the ricin toxin content of castor bean seeds. Existing quantification methods do not always reflect actual toxicity of the seeds analyzed, which may present lower ricin content even though they are more toxic than seeds presenting a higher content of ricin. This is because these methods actually measure the addition of ricin RCA, which is a compound less toxic than pure ricin. We decided to use in this study, the nematode Caenorhabditis elegans, which has been widely used by the pharmaceutical industry. We tested two strains of C. elegans using different methods in 8 experiments. We examined 4 methods of extracting the ricin complex and 3 methods of exposing the nematodes. Among the nematode strains and ricin extraction methods tested, we concluded that the best strain for testing ricin toxicity was the strain called N2 and that the best method for ricin extraction was a rotating bath followed by centrifugation and exposing the nematodes in 24 well plates with a solution of nematodes extracted from the media with destilated waterexposing the nematodes in 24-well plates This method is inexpensive, quick and adequate for the selection of offspring with lower RIP content.Foi desenvolvido um bioensaio para quantificar o teor de ricina nas sementes de mamona. Os métodos de quantificação existentes não refletem a toxidez real das sementes analizadas, que pode mostrar um resultado de menor teor de ricina e ainda assim ser mais toxico do que as sementes que apresentaram teores maiores. Isto ocorre por que estes métodos medem alem da ricina a RCA, que é um composto menos tóxico que a ricina pura. Foi decidido utilizar neste estudo o nematoide Caenorhabditis elegans, que tem sido amplamente utilizado na industria farmacêutica. Foram testadas duas estirpes de C.elegans usadas em diferentes métodos contando com 8 experimentos distintos. nós examinamos 4 métodos de extração de ricina e 3 m

  2. Forensic Applications of Light-Element Stable Isotope Ratios of Ricinus communis Seeds and Ricin Preparations

    Energy Technology Data Exchange (ETDEWEB)

    Kreuzer, Helen W.; West, Jason B.; Ehleringer, James

    2013-01-01

    Seeds of the castor plant Ricinus communis, also known as castor beans, are of forensic interest because they are the source of the poison ricin. We have tested whether stable isotope ratios of castor seeds and ricin prepared by various methods can be used as a forensic signature. We collected over 300 castor seed samples from locations around the world and measured the C, N, O, and H stable isotope ratios of the whole seeds, oil, and three types of ricin preparations. Our results demonstrate that N isotope ratios can be used to correlate ricin prepared by any of these methods to source seeds. Further, stable isotope ratios distinguished >99% of crude and purified ricin protein samples in pair-wise comparison tests. Stable isotope ratios therefore constitute a valuable forensic signature for ricin preparations.

  3. Estudo experimental do poliuretano de óleo de mamona (Ricinus communis como substituto parcial do tendão calcâneo comum em coelhos (Oryctolagus cuniculus An experimental study of polyurethane of castor-oil plant (Ricinus communis as a partial substitute of the common calcaneous tendon in rabbits (Oryctogalus cuniculus

    Directory of Open Access Journals (Sweden)

    C.M.F. Rezende

    2001-12-01

    Full Text Available Com o objetivo de avaliar a eficiência da prótese de poliuretano de mamona como substituto parcial do tendão calcâneo comum, foram utilizadas 30 coelhas da raça Nova Zelândia, entre dois e três meses de idade e peso médio de 2kg. Após anestesia geral, o procedimento cirúrgico em ambos os membros constou de incisão caudo-lateral no sentido longitudinal do terço médio ao distal da tíbia e exposição do tendão calcâneo comum. Após a tenectomia do tendão do músculo gastrocnêmio, a prótese de poliuretano de cerca de 0,5cm de extensão por 0,5cm de diâmetro foi fixada aos cotos proximal e distal do tendão, empregando-se o fio de polipropileno monofilamentar 4-0, conforme técnica modificada de Kessler. A prótese de poliuretano na forma elastomérica revelou propriedades como textura e flexibilidade semelhantes à do tecido tendinoso, pode ser confeccionada na forma e no tamanho almejados e permite ser moldada, cortada e esterilizada por calor úmido. Todos os animais apoiaram os membros operados imediatamente após o retorno anestésico. Não se observaram sinais clínicos de infecção e não ocorreu deiscência de ferida. Percebeu-se aumento de volume local devido ao edema, evidente na primeira semana pós-cirúrgica, que gradualmente desapareceu . À palpação foi possível delimitar com facilidade a prótese que se conservou fixa no local e intacta. Clinicamente o poliuretano de mamona não induziu reação desfavorável que comprometesse a cicatrização tendínea, podendo ser indicado como substituto temporário de tendão.With the goal of evaluating the efficiency of a prosthesis of castor-oil plant (Ricinus communis polyurethane as a partial substitute for common calcaneous tendon, 30 New Zealand female rabbits, aging between two to three months, weighting about 2kg were used. After general anesthesia, the surgical procedure in both members consisted of rear lateral longitudinal incision, in the medium third of the

  4. Hasil Biji dan Kadar Minyak Jarak Kepyar Lokal Beaq Amor (Ricinus communis L. pada Berbagai Umur Pemangkasan Batang Utama

    Directory of Open Access Journals (Sweden)

    Bambang Budi Santoso

    2015-03-01

    Full Text Available ABSTRACTSuccessful castor (Ricinus communis L. cropping depends on the reliability of production technique. Branching is a useful agronomic trait because infloresence developed at each branch’s terminal. Pruning is considered as an important technique for branching stimulation. This study attempted to elucidate the effect of main stem pruning on the yield of Beaq Amor local variety of castor (Ricinus communis L. with short cultivation system. The experiment was conducted on dry land area of Amor-Amor, North Lombok, West Nusa Tenggara during February-July 2011 and was arranged in a single-factor randomized complete block design with three replications. The treatments were four types of pruning (i.e. no pruning, main stem pruning at 30 days after planting, 45 days after planting, and 60 days after planting. The results showed that the effect of pruning was significant on dry seed yield and was not significant on kernel oil content. Pruning at 30 days old and 45 days old plant yielded in the highest dry seed weight (374.9-387.8 g tree-1 or 943.0-974.3 kg ha-1 with oil content of 62.2%.Keywords: branching, canopy, dry seed, Ricinus communis L.

  5. Physicochemical characteristics of castor oil from local wild castor ...

    African Journals Online (AJOL)

    Physicochemical characteristics of castor oil from seeds of the local wild castor plant (Ricinus communis) found in Ghana were determined to evaluate its suitability for exploitation for industrial purposes. The castor seeds were found to be rich in oil, containing 57 per cent castor oil of which 37 per cent was easily expressed ...

  6. Influência da concentração de NaCl e pH na extração de ricina em torta de mamona (Ricinus communis L. e sua caracterização por eletroforese Influence of NaCl and pH concentration on the extraction of ricin in castor bean (Ricinus communis L. and its characterization by electrophoresis

    Directory of Open Access Journals (Sweden)

    Bárbara Amorim Silva

    2012-07-01

    Full Text Available A mamoneira (Ricinus communis L. é uma oleaginosa de alto valor econômico pelo fato de apresentar um mercado bem definido para o óleo extraído de suas sementes. A torta, que é um resíduo desta extração, se destaca pelo alto teor em proteínas. Dentre as proteínas encontradas na torta destaca-se a ricina, uma citotoxina, que inviabiliza sua utilização como fonte protéica alternativa para alimentação animal. O presente trabalho tem como objetivo identificar um melhor tratamento experimental para a extração de ricina da torta de mamona, visando futuros estudos de perda de integridade da ricina, o que garantiria a inocuidade do produto. Para tanto, buscou-se identificar a solução de maior capacidade de extração de proteínas, empregando a metodologia de superfície de resposta. Um delineamento composto central rotacional foi elaborado a fim de verificar o melhor pH e concentração de NaCl para a extração. Dos cinco diferentes valores de pH (4,0; 4,6; 6,0; 7,4; 8,0 e concentração de NaCl (0,0M; 0,3M; 1,0M; 1,7M; 2,0M utilizados, o tratamento associando fosfato de potássio 0,2M/NaCl 1,7M pH 7,4 foi escolhido como o melhor. A concentração de proteína extraída neste tratamento chegou a valores quatro vezes maiores que o encontrado no de mínima extração de proteína. Pela evidenciação do gel de eletroforese não houve extração preferencial de ricina nos tratamentos testados, entretanto etapas de purificação usando diálise e precipitação com sulfato de amônio, permitiram uma evidenciação melhor das duas cadeias polipeptídicas de ricina.Castor bean (Ricinus communis L. is an oilseed crop of high economic value due to the fact of presenting a clearly defined market for the oil extracted from its seeds. Castor cake, which is a residue of oil extraction, is at the moment receiving special attention because of its high protein content. However, among the proteins found in this cake it is observed the presence of

  7. IMUNIDADE CRUZADA PELAS SEMENTES DE Abrus precatorius E Ricinus communis EM BOVINOS Crossimmunity by the seeds of Abrus precatorius and Ricinus communis in cattle

    Directory of Open Access Journals (Sweden)

    Carlos Hubinger Tokarnia

    1997-01-01

    ão imunizados, demonstrando que a imunidade conferida pela ricina não inibe a ação da ricinina, o principio tóxico das folhas e do pericarpo.Five bovines immunized against the toxicity of the seeds of Abrus precatorius L. (jequiriti bean did not get poisoned or only slightly so when the seeds of Ricinus communis L. (castor bean were given in amounts that in bovines, which never before ingested the seeds of A. precatorius or R. communis, caused moderate to severe poisoning or even death. A sixth bovine, which was not well immunized against the toxic action of the seeds of A. precatorius, was severely poisoned when given a high dose of the seeds of R. communis. On the other side, from five bovines immunized against the toxic action of the seeds of R. communis four were severely poisoned and the fifth one moderately when the seeds of A. precatorius were given in doses that in bovines, which never before ingested seeds of R. communis or A. precatorius, caused slight to severe poisoning. It is concluded that bovines immunized against the toxic action of the seeds of A. precatorius are resistant to the toxic action of the seeds of R. communis, but that the contrary is not the case; this is, bovines immunized against the toxic action of the seeds of R. communis were not protected against the poisoning by A. precatorius. Earlier studies by other authors had shown that the toxalbumins of the seeds of A. precatorius and R. communis, respectively abrin and ricin, are different as to their antigenic properties. A possible explanation for the difference in results can be.that in the present study polygastric animals were used which received the seeds orally, but in the earlier studies monogastric animals received the seeds or toxins by parenteral route. The administration of the fresh leaves or the pericarp of the fruits R. communis to bovines, which had been immunized against the action of the seeds of the plant, had the same toxic effect as to not immunized animals, showing that the

  8. Selective response of Ricinus communis seedlings to soil borne rhizoctonia infection

    Directory of Open Access Journals (Sweden)

    Andras Bittsanszky

    2015-09-01

    Full Text Available Seedlings of Ricinus communis tolerated soil-borne Rhizoctonia infection in strain dependent manner. There was no connection revealed between pathogenicity of strains and their origin or taxonomic position, however, the castor plant proved to be susceptible to most strains highly pathogenic to other host plants as well. Rhizoctonia zeae (teleomorph: Waitea circinata, a species new for European flora, was less aggressive to R. communis as the most potent R. solani strains. The effect of Rhizoctonia infection on mass accumulation of hypocotyls was more prominent than that on cotyledons. The protein content and glutathione S-transferase (GST activity increased in parallel with evolution of disease syndrome. Metalaxyl, an acetanilide type systemic anti-omycete fungicide induced locally the GST activity in R. communis cotyledons with 24 hours lag phase, and this induction was altered in the seedlings grown in Rhizoctonia infested soil by strain dependent manner. It might be concluded, that the stress response related detoxication mechanisms of plants in tolerant host/parasite pairs take effect at higher level than in highly susceptible relationships.

  9. Ricinus communis L. A Value Added Crop for Remediation of Cadmium Contaminated Soil.

    Science.gov (United States)

    Bauddh, Kuldeep; Singh, Kripal; Singh, Rana P

    2016-02-01

    Heavy metal pollution of soil is a global environmental problem and therefore its remediation is of paramount importance. Cadmium (Cd) is a potential toxicant to living organisms and even at very low concentrations. This study was aimed to assess the effectiveness of Ricinus communis for remediation of Cd contaminated soils. For this, growth and biomass of R. communis and Cd accumulation, translocation and partitioning in different plant parts were investigated after 8 months of plant growth in Cd contaminated soil (17.50 mg Cd kg−1 soil). Eight months old plants stabilized 51 % Cd in its roots and rest of the metal was transferred to the stem and leaves. There were no significant differences in growth, biomass and yield between control and Cd treated plants, except fresh weight of shoots. The seed yield per plant was reduced only by 5 % of Cd contaminated plants than control. The amount of Cd translocated to the castor seeds was nominal i.e. 0.007 µg Cd g−1 seeds. The bioconcentration factor reduced significantly in shoots and seeds in comparison to roots. The data indicates that R. communis is highly tolerant to Cd contamination and can be used for remediation of heavy metal polluted sites.

  10. Physicochemical characterization of seven Mexican Ricinus communis L. seeds and oil contents

    International Nuclear Information System (INIS)

    Perdomo, Felipe A.; Acosta-Osorio, Andrés A.; Herrera, G.; Vasco-Leal, José F.; Mosquera-Artamonov, José D.; Millan-Malo, Beatriz; Rodriguez-Garcia, Mario E.

    2013-01-01

    This paper presents a rigorous study and characterization of seven Mexican Ricinus communis L. seeds and its respective extracted oil. Several physical–chemical properties were measured in order to know moisture, total lipid content, fiber content, starch presence, morphology, acidity, free fatty acid profile, ricinoleic acid content, viscosity and crude oil density. Three different methodologies were implemented for the oil extraction in each variety (extraction with chemical solvents and mechanical compression heated and non-heated). The yield percentage of the oil extraction was evaluated as well as the extraction method influence over the oil's nature. -- Highlights: ► We characterized seven different Castor seeds and oils from semi deserted region. ► We evaluate the performance of three different methods to obtain Castor Oils. ► It was found that the density and fatty acid profile depend on the method of extraction. ► According to x-ray diffraction experiments no crystalline compounds were found in the defatted mass. ► The viscosity of the Castor Oils was strongly influence by the extractive method

  11. Production, optimization and quality assessment of biodiesel from Ricinus communis L. oil

    Directory of Open Access Journals (Sweden)

    Maryam Ijaz

    2016-04-01

    Full Text Available At present, biodiesel is gaining tremendous attention due to its eco-friendly nature and is possible substitute for diesel fuel. Biodiesel as renewable energy source can be produced from edible and non-edible feedstock. Non-edible resources are preferred to circumvent for food competition. In the present study FAME was produced from Ricinus communis L. oil by transesterification with methanol and ethanol in the presence of potassium hydroxide. The practical optimal condition for the production of biodiesel from castor bean was found to be: methanol/oil molar ratio, 6:1; temperature, 60 °C; time, 45 min; catalyst concentration 0.32 g. Quality assessment of biodiesel showed comparable results with ASTM standards. The values of specific gravity (SG were 0.5, kinematic viscosity 2.45 cSt, acid values 0.13 mg KOH/g, carbon residue 0.03%, flash point 119 °C, fire point 125 °C, cloud point −10 °C and pour point −20 °C of Ricinus FAME, respectively. Based on our data, it is suggested that to overcome prevailing energy crisis this non-edible plant is useful for production of biodiesel, which is an alternate to fossil fuel and may be used alone or in blend with HSD in engine combustion.

  12. Análise macroscópica e histológica do emprego da poliuretana derivada do óleo de mamona (Ricinus communis aplicada na tíbia de cães em fase de crescimento Macroscopic and histopathologic evaluations of the use of polyurethane resins derived from castor oil (Ricinus communis applied in the tibia of the puppies

    Directory of Open Access Journals (Sweden)

    Patricia Popak Maria

    2003-08-01

    Full Text Available OBJETIVO: Estudar o efeito da poliuretana de mamona aplicada ao osso de cães em crescimento. MÉTODOS: Foram utilizados 12 cães subdivididos aleatoriamente em 3 grupos, os quais receberam o implante de mamona na face medial proximal da tíbia, com análise macroscópica e histopatológica aos 30 (GIII, 60 (GII e 90 (GI dias. RESULTADOS: A poliuretana foi recoberta por uma cápsula conjuntiva fibrosa, não ocorrendo proliferação óssea ao seu redor. CONCLUSÃO: A poliuretana é biocompatível, comportando-se como espaçador biológico em cães. Nesta espécie não ocorre a osteointegração.PURPOSE: To analyze the effects of castor oil derived poliurethane, when applied to bones of puppies. METHODS: Twelve dogs, randomly divided in 3 groups, received a castor oil derived poliurethane at the medial side of the proximal tibia. Gross and histopathologic evaluations were performed at 30 (GIII, 60 (GII and 90 (GI days. RESULTS: The poliurethane was enclosed in a connective fibrous tissue capsule and there was no new bone formation around it. CONCLUSION: The castor oil derived poliurethane is biocompatible and behaves as a biological "stand off" in dogs. Osteointegration does not occur in this species.

  13. Effet comparé des poudres de Nicotiana tabacum L, Cymbopogon citratus (D.C. Stapf et de l'huile de Ricinus communis L sur la conservation des graines de Vigna unguiculata (L Walp

    Directory of Open Access Journals (Sweden)

    Gakuru, S.

    1995-01-01

    Full Text Available Compared Effect of Nicotiana tabacum L, Cymbopogon citratus (D.C. Stapf Powders and Castor Oil Ricinus communis L. on Conservation of Cowpea Vigna Unguiculata (L. Walp Grains. The effect of powder of tobacco Nicotiana tabacum L. and citronella grass Cymbopogon citratus (D.C. Stapf and castor oil Ricinus communis L. on conservation of cowpea Vigna unguiculata (L. Walp. grains was investigated in Kisangani, Zaire. After 5 months of conservation, infestation rates by bean weevil Acanthoscelides obtectus Say were 72.5 %, 74.5 %, 49.5 % and 5 % respectively for the check, the samples treated by 1 % of citronella grass and tobacco powder and 1 % of castor oil. The powder dose of 7.5 % did not give more interesting results.

  14. Survey of the castor bean production (Ricinus communis L. in a collection of producers from five counties of Bahia State. = Levantamento da produção de mamona (Ricinus communis L. em uma amostra de produtores em cinco municípios do Estado da Bahia.

    Directory of Open Access Journals (Sweden)

    Vicente de Paula Queiroga

    2011-08-01

    Full Text Available The objective of this study was to verify the situation of the culture of castor bean from a collection of producers located in five counties of Bahia state, highlighting the technical conditions of production and commercialization of the product, beyond its social aspects. Twenty-five castor bean producers were interviewed during the 2005 agricultural year by a team of researchers from the Embrapa Cotton. A present questionnaire with 15 variable questions pertaining to agro-economic and social-economic was applied to producers with the objective to diagnose the agricultural social-economic profiles of theproducers of castor bean that are used for the production of berries to be used within the energy market of the Program of Biodiesel and Ricin chemistry. Data analysis concluded that the family farmers of Bahia have the culture of castor oil as, a major source of income, but the cultivation techniques, promising cultivars, and oil content are underutilized. It was shown that a technology gap can be solved by a adopting a differential pricing policy that is based on a feasibility comprehensive recovery program that increases the ricin culture productivity throughout the production chain, reduce costs, and increase the oil content of cultivars.ResumoObjetivou-se com este estudo verificar a situação da cultura da mamona em uma amostra de produtores levantados em cinco municípios localizados no noroeste do estado da Bahia (São Gabriel, Irecê, Lapão, Ibititá e Cafarnaum, destacando-se as condições técnicas de produção e de comercialização do produto, além dos seus aspectos sociais. Um total de 25 produtores de mamona foi entrevistado no ano agrícola de 2005, por uma equipe de pesquisadores da Embrapa Algodão. Um questionário preestabelecido com 15 variáveis agronômicas e socioecononômicas foi aplicado junto aos produtores, visando o diagnóstico do perfil agrossocioeconômico dos produtores de mamona que estão destinando sua

  15. Growth, tolerance efficiency and phytoremediation potential of Ricinus communis (L.) and Brassica juncea (L.) in salinity and drought affected cadmium contaminated soil.

    Science.gov (United States)

    Bauddh, Kuldeep; Singh, Rana P

    2012-11-01

    We have previously reported that Ricinus communis (castor) is more tolerant to soil cadmium (Cd) and more efficient for Cd phytoremediation than Brassica juncea (Indian mustard) (Bauddh and Singh, 2012). In the present study, R. communis was found more tolerant to salinity and drought in presence of Cd and removed more Cd in a given time than Indian mustard. R. communis produced 23 and twelve folds higher biomass in terms of fresh weight and dry weight, respectively than that in B. juncea during three months when grown in Cd contaminated soil in presence of 100mM NaCl salinity and ten day water withdrawal based drought at 90 day after sowing (DAS). Castor plants showed stronger self-protection ability in form of proline bioaccumulation (r(2)=0.949) than Indian mustard (r(2)=0.932), whereas a lower r(2) for malondialdehyde (MDA) and total soluble protein in R. communis (r(2)=0.914 and r(2)=0.915, respectively) than that of B. juncea (r(2)=0.947 and r(2)=0.927, respectively) indicated a greater damage to cell membrane in Indian mustard during the multiple stress conditions. Though, the amount of Cd accumulated in the roots and shoots of Indian mustard was higher as per unit biomass than that in castor, total removal of the metal from soil was much higher in castor on per plant basis in the same period in presence of the stresses. R. communis accumulated about seventeen and 1.5 fold higher Cd in their roots and shoots, respectively than that of B. juncea in 90 DAS under the multiple stresses. Salinity alone enhanced Cd uptake, whereas drought stress reduced its uptake in both the plants. Copyright © 2012 Elsevier Inc. All rights reserved.

  16. Toxic effects of Ricinus communis non-protein trypsin inhibitor on ...

    African Journals Online (AJOL)

    In the study reported herein, we aimed to isolate a trypsin inhibitor from Ricinus communis leaves through chromatographic and spectrometric techniques and evaluate its toxic effects on the development of Spodoptera frugiperda larvae. Plant extracts were submitted to fractionation in adsorption column. The fraction 10 ...

  17. Recognition factors of Ricinus communis agglutinin 1 (RCA(1)).

    Science.gov (United States)

    Wu, Albert M; Wu, June H; Singh, Tanuja; Lai, Li-Ju; Yang, Zhangung; Herp, Anthony

    2006-04-01

    Ricinus communis agglutinin (RCA1) is one of the most important applied lectins that has been widely used as a tool to study cell surfaces and to purify glycans. Although the carbohydrate specificity of RCA1 has been described, the information obtained was mainly focused on inhibition of simple Galbeta1-related oligosaccharides and simple clusters. Here, all possible recognition factors of RCA1 of glycan binding were examined by enzyme-linked lectinosorbent (ELLSA) and inhibition assays, using known mammalian Gal/GalNAc carbohydrate structural units and natural polyvalent glycans. Among the glycoproteins (gps) tested and expressed as 50% nanogram inhibition, the high-density polyvalent Galbeta1-4GlcNAc (II) glycotopes occurring in natural gps, such as Pneumococcus type 14 capsular polysaccharide which is composed of repeating poly II residues, resulted in 9.0 x 10(4), 1.5 x 10(5), 2.3 x 10(4) and 2.1 x 10(4)-fold higher affinities to RCA1 than the monomeric Gal, linear I/II and Tri-antennary-II (Tri-II). Of the ligands tested and expressed as nanomoles of 50% inhibition, Tri-II was the best, being about 2, 4, 25.6 and 33.3 times better inhibitor than Di-II, II, I (Galbeta1-3GlcNAc) and Gal, respectively. From the results of this study, it is concluded that: (a) Galbeta1-4GlcNAc and other Galbeta1-related oligosaccharides are essential for lectin binding and their polyvalent form in macromolecules should be the most important recognition factor for RCA1; (b) the combining site of RCA1 may be a groove type, recognizing Galbeta1-4GlcNAc (II) as the major binding site; (c) its combining size may be large enough to accommodate a tetrasaccharide of beta-anomeric Gal at the non-reducing end and most complementary to human blood group I Ma active trisaccharide (Galbeta1-4GlcNAcbeta1-6Gal) and lacto-N-neotetraose (Galbeta1-4GlcNAcbeta1-3Galbeta1-4Glc); (d) RCA1 has a preference for the beta-anomer of Gal oligosaccharides with a Galbeta1-4 linkage > Galbeta1-6 > or = Galbeta

  18. Essential oil of the leaves of Ricinus communis L.: in vitro cytotoxicity and antimicrobial properties.

    Science.gov (United States)

    Zarai, Zied; Ben Chobba, Ines; Ben Mansour, Riadh; Békir, Ahmed; Gharsallah, Néji; Kadri, Adel

    2012-08-13

    The aim of the present study was to appraise the antimicrobial activity of Ricinus communis L. essential oil against different pathogenic microorganisms and the cytotoxic activity against HeLa cell lines. The agar disk diffusion method was used to study the antibacterial activity of Ricinus communis L. essential oil against 12 bacterial and 4 fungi strains. The disc diameters of zone of inhibition (DD), the minimum inhibitory concentrations (MIC) and the concentration inhibiting 50% (IC50) were investigated to characterize the antimicrobial activities of this essential oil. The in vitro cytotoxicity of Ricinus communis L. essential oil was examined using a modified MTT assay; the viability and the IC50 were used to evaluate this test. The essential oil from the leaves of Ricinus communis L. was analyzed by GC-MS and bioassays were carried out. Five constituents of the oil were identified by GC-MS. The antimicrobial activity of the oil was investigated in order to evaluate its efficacy against twelve bacteria and four fungi species, using disc diffusion and minimum inhibitory concentration methods. The essential oil showed strong antimicrobial activity against all microorganisms tested with higher sensitivity for Bacillus subtilis, Staphylococcus aureus and Enterobacter cloacae. The cytotoxic and apoptotic effects of the essential oil on HeLa cell lines were examined by MTT assay. The cytotoxicity of the oil was quite strong with IC50 values less than 2.63 mg/ml for both cell lines. The present study showed the potential antimicrobial and anticarcinogenic properties of the essential oil of Ricinus communis L., indicating the possibilities of its potential use in the formula of natural remedies for the topical treatment of infections.

  19. In vitro effect of Aloe vera, Coriandrum sativum and Ricinus communis fractions on Leishmania infantum and on murine monocytic cells.

    Science.gov (United States)

    Rondon, Fernanda C M; Bevilaqua, Claudia M L; Accioly, Marina P; Morais, Selene M; Andrade-Junior, Heitor F; Machado, Lyeghyna K A; Cardoso, Roselaine P A; Almeida, Camila A; Queiroz-Junior, Eudson M; Rodrigues, Ana Caroline M

    2011-06-10

    In South America, visceral leishmaniasis is a zoonosis caused by the protozoan species Leishmania infantum (syn. L. chagasi) and is primarily transmitted through the bite of the female Lutzomyia longipalpis. Its main reservoir in urban areas is the dog. The application of control measures recommended by health agencies have not achieved significant results in reducing the incidence of human cases, and the lack of effective drugs to treat dogs resulted in the prohibition of this course of action in Brazil. Therefore, it is necessary to search new alternatives for the treatment of canine and human visceral leishmaniasis. The objectives of this study were to evaluate the in vitro effect of fractions from Aloe vera (aloe), Coriandrum sativum (coriander), and Ricinus communis (castor) on promastigotes and amastigotes of L. infantum and to analyze the toxicity against the murine monocytic cells RAW 264.7. To determine the viability of these substances on 50% parasites (IC50), we used a tetrazolium dye (MTT) colorimetric assay (bromide 3-4.5-dimethylthiazol-2-yl-2,5-dephenyltetrazolium), and on amastigotes we performed an in situ ELISA. All fractions were effective against L. infantum promastigotes and did not differ from the positive control pentamidine (p>0.05). However, the R. communis ethyl acetate and chloroform fractions, as well as the C. sativum methanol fraction, were the most effective against amastigotes and did not differ from the positive control amphotericin B (p>0.05). The R. communis ethyl acetate fraction was the least toxic, presenting 83.5% viability of RAW 264.7 cells, which was similar to the results obtained with amphotericin B (p>0.05). Based on these results, we intend to undertake in vivo studies with R. communis ethyl acetate fractions due the high effectiveness against amastigotes and promastigotes of L. infantum and the low cytotoxicity towards murine monocytic cells. Copyright © 2011 Elsevier B.V. All rights reserved.

  20. Biochemical, physiological and molecular responses of Ricinus communis seeds and seedlings to different temperatures: a multi-omics approach

    OpenAIRE

    Ribeiro de Jesus, P.R.

    2015-01-01

    Biochemical, physiological and molecular responses of Ricinus communis seeds and seedlings to different temperatures: a multi-omics approach by Paulo Roberto Ribeiro de Jesus The main objective of this thesis was to provide a detailed analysis of physiological, biochemical and molecular-genetic responses of Ricinus communis to temperature during seed germination and seedling establishment. In Chapter 2, I describe the assessment of 17 candidate reference genes across a diverse set of samples,...

  1. Three flavonol glycosides from Ricinus communis | Aqil | Bulletin of ...

    African Journals Online (AJOL)

    Bulletin of the Chemical Society of Ethiopia. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 11, No 1 (1997) >. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register. Three flavonol glycosides from Ricinus ...

  2. Use of Energy Crop (Ricinus communis L.) for Phytoextraction of Heavy Metals Assisted with Citric Acid.

    Science.gov (United States)

    Zhang, Hui; Chen, Xueping; He, Chiquan; Liang, Xia; Oh, Kokyo; Liu, Xiaoyan; Lei, Yanru

    2015-01-01

    Ricinus communis L. is a bioenergetic crop with high-biomass production and tolerance to cadmium (Cd) and lead (Pb), thus, the plant is a candidate crop for phytoremediation. Pot experiments were performed to study the effects of citric acid in enhancing phytoextraction of Cd/Pb by Ricinus communis L. Citric acid increased Cd and Pb contents in plant shoots in all treatments by about 78% and 18-45%, respectively, at the dosage of 10 mM kg(-1) soil without affecting aboveground biomass production. Addition of citric acid reduced CEC, weakened soil adsorption of heavy metals and activated Cd and Pb in soil solutions. The acid-exchangeable fraction (BCR-1) of Pb remained lower than 7% and significantly increased with citric acid amendment. Respective increases in soil evaluation index induces by 14% and 19% under the Cd1Pb50 and Cd1Pb250 treatments upon addition of citric acid resulted in soil quality improvement. Ricinus communis L. has great potential in citric acid-assisted phytoextraction for Cd and Pb remediation.

  3. Toxic effects of Ricinus communis non proteic trypsin inhibitor for ...

    African Journals Online (AJOL)

    Marcelo Haro

    2015-10-21

    Oct 21, 2015 ... studies of alternative and sustainable control methods for lepidopteran pest species. Key words: Castor beans, enzymatic inhibition, integrated pest management, plant defense against herbivory. INTRODUCTION. The fall armyworm .... inhibition in vitro testing. Inhibitor activity was determined as described ...

  4. The effect of herbivory on temporal and spatial dynamics of foliar nectar production in cotton and castor

    NARCIS (Netherlands)

    Wäckers, F.L.; Zuber, D.; Wunderlin, R.; Keller, F.

    2001-01-01

    The effects of feeding Spodoptera a littoralis (Boisd.) (Lepidoptera: Noctuidae) larvae on the quantity and distribution of extrafloral nectar production by leaves of castor ((Ricinus communis) and cotton (Gossypium herbaceum) were investigated. Following larval feeding, the total volume of nectar

  5. The effect of herbivory on temporal and spatial dynamics of foliar nectar production in cotton and castor

    NARCIS (Netherlands)

    Wäckers, F.L.; Zuber, D.; Wunderlin, R.; Keller, F.

    2001-01-01

    The effects of feeding Spodoptera littoralis(Boisd.) (Lepidoptera: Noctuidae) larvae on the quantity and distribution of extrafloral nectar production by leaves of castor (Ricinus communis) and cotton (Gossypium herbaceum) were investigated. Following larval feeding, the total volume of nectar

  6. Effect of experimental Ricinus communis solution for denture cleaning on the properties of acrylic resin teeth.

    Science.gov (United States)

    Pisani, Marina Xavier; Macedo, Ana Paula; Paranhos, Helena de Freitas Oliveira; Silva, Cláudia Helena Lovato da

    2012-01-01

    This study evaluated Knoop hardness, surface roughness and color alteration of artificial teeth for dentures after immersion in water, 1% sodium hypochlorite and an experimental solution of 2% Ricinus communis (RC). Thirty specimens of Vipi, Biolux and Trilux were analyzed. Tests of Knoop hardness, surface roughness and color alteration were conducted immediately after specimen preparation (T0) and after two immersion protocols for 15 days (ΔT(15)) and 183 days (ΔT(183)). Data variation (ΔT) were subjected to ANOVA and Tukey's test (pproperties. Both immersion protocols caused alterations on the analyzed properties.

  7. Can adaptive modulation of traits to urban environments facilitate Ricinus communis L. invasiveness?

    Science.gov (United States)

    Goyal, Neha; Pardha-Saradhi, P; Sharma, Gyan P

    2014-11-01

    This paper addresses the phenotypic variation among Ricinus communis L. populations in four urban habitat types (road verges, garbage dumps, construction debris, and natural area) in Delhi, India, by evaluating important traits such as plant height, basal circumference, seeds per plant, seed size, seed weight, specific leaf area, and reproductive index. An important biochemical marker, proline, considered as a good plant performance indicator under stress was also quantified in leaves of R. communis to evaluate its response in different habitats. Interestingly, the species showed significant variation in plant height, specific leaf area, seed size, seed weight, and leaf proline content in different habitat types. Leaf proline content was positively related to plant height, specific leaf area, and seed size while negatively related to the total number of seeds/plant. Interestingly, reproductive index, calculated as a ratio of the total number of seeds to the plant height also showed a negative relation with leaf proline content. Results indicated that R. communis exhibits adaptive modulation of growth, reproductive traits, and leaf proline content in various urban habitats which contributes to invasiveness, range expansion, and establishment of the species. The study also gives evidence of how morphological and physiological traits could directly affect invasiveness of R. communis.

  8. Evaluation of Ricinus communis L. for the Phytoremediation of Polluted Soil with Organochlorine Pesticides

    Directory of Open Access Journals (Sweden)

    Sandra Regina Rissato

    2015-01-01

    Full Text Available Phytoremediation is an attractive alternative to conventional treatments of soil due to advantages such as low cost, large application areas, and the possibility of in situ treatment. This study presents the assessment of phytoremediation processes conducted under controlled experimental conditions to evaluate the ability of Ricinus communis L., tropical plant species, to promote the degradation of 15 persistent organic pollutants (POPs, in a 66-day period. The contaminants tested were hexachlorocyclohexane (HCH, DDT, heptachlor, aldrin, and others. Measurements made in rhizosphere soil indicate that the roots of the studied species reduce the concentration of pesticides. Results obtained during this study indicated that the higher the hydrophobicity of the organic compound and its molecular interaction with soil or root matrix the greater its tendency to concentrate in root tissues and the research showed the following trend: HCHs < diclofop-methyl < chlorpyrifos < methoxychlor < heptachlor epoxide < endrin < o,p′-DDE < heptachlor < dieldrin < aldrin < o,p′-DDT < p,p′-DDT by increasing order of log Kow values. The experimental results confirm the importance of vegetation in removing pollutants, obtaining remediation from 25% to 70%, and demonstrated that Ricinus communis L. can be used for the phytoremediation of such compounds.

  9. Allelopathic effect of aqueous extract of fresh leaf castor beans ...

    African Journals Online (AJOL)

    Allelopathy defines the production of specific biomolecules (allelochemical) by a plant that can induce positive or negative impacts on another culture. The crop of castor beans (Ricinus communis L.) is being economically valued and receiving attention, mainly by the biodiesel production, castor oil and animal feeding.

  10. Allelopathic effect of aqueous extract of fresh leaf castor beans ...

    African Journals Online (AJOL)

    Rukevwe S. Abraka

    2016-12-07

    Dec 7, 2016 ... Allelopathy defines the production of specific biomolecules (allelochemical) by a plant that can induce positive or negative impacts on another culture. The crop of castor beans (Ricinus communis L.) is being economically valued and receiving attention, mainly by the biodiesel production, castor oil and.

  11. Screening of spontaneous castor bean accesses for genetic ...

    African Journals Online (AJOL)

    ... discriminant power between the castor bean accesses, being the multivariate analysis efficient in this process. The castor bean accesses ACS-001 CRSP and ACS-001-MASP are promising for introduction in genetic improvement programs of this culture. Keywords: Ricinus communis L., genotype, multivariate statistics, ...

  12. Screening of spontaneous castor bean accesses for genetic ...

    African Journals Online (AJOL)

    Tuoyo Aghomotsegin

    2016-10-05

    Oct 5, 2016 ... castor bean accesses, being the multivariate analysis efficient in this process. The castor bean accesses ACS-001-CRSP and ACS-001-MASP are promising for introduction in genetic improvement programs of this culture. Key words: Ricinus communis L., genotype, multivariate statistics, bioenergy.

  13. Biochemical, physiological and molecular responses of Ricinus communis seeds and seedlings to different temperatures: a multi-omics approach

    NARCIS (Netherlands)

    Ribeiro de Jesus, P.R.

    2015-01-01

    Biochemical, physiological and molecular responses of Ricinus communis seeds and seedlings to different temperatures: a multi-omics approach by Paulo Roberto Ribeiro de Jesus The main objective of this thesis was to provide a detailed analysis of physiological,

  14. Biochemical, physiological and molecular responses of Ricinus communis seeds and seedlings to different temperatures: a multi-omics approach

    NARCIS (Netherlands)

    Ribeiro de Jesus, P.R.

    2015-01-01

    Biochemical, physiological and molecular responses of Ricinus communis seeds and seedlings to different temperatures: a multi-omics approach

    by Paulo Roberto Ribeiro de Jesus

    The main objective of this thesis was to provide a detailed

  15. Effect of temperature on biomass allocation in seedlings of two contrasting genotypes of the oilseed crop Ricinus communis

    NARCIS (Netherlands)

    Ribeiro de Jesus, P.R.; Zanotti, R.F.; Deflers, C.; Fernandez, L.G.; Castro, De R.D.; Ligterink, W.; Hilhorst, H.W.M.

    2015-01-01

    Ricinus communis is becoming an important crop for oil production, and studying the physiological and biochemical aspects of seedling development may aid in the improvement of crop quality and yield. The objective of this study was to assess the effect of temperature on biomass allocation in two R.

  16. Seed Borne fungi Castor Oil ( Ricinus cummunis ): Effect of Their ...

    African Journals Online (AJOL)

    An investigation of fungi associated with castor oil seeds collected from four different locations in Nigeria showed Aspergillus niger, A. flavus, Fusarium moniliforme and Penicillium spp. to be the most abundant. Metabolites from these fungi significantly (p=0.05) depressed seed germination and seedling establishment.

  17. Expression of Ricinus communis receptors on epithelial cells in oral carcinomas and oral wounds.

    Science.gov (United States)

    Dabelsteen, E; Mackenzie, I C

    1978-12-01

    The histological distribution of receptors for Ricinus communis Fraction 1 (RCA1) in oral carcinomas and in oral epithelial cells during wound healing has been studied by use of fluorescein-tagged RCA1. Biopsies from 15 human oral carcinomas and adjacent normal mucosa showed RCA1 receptors at the cell membranes in the basal and spinous layer of the normal epithelium, whereas receptors could not be demonstrated in invading islands of the tumors. In healing oral wounds from eight humans and three monkeys, RCA1 receptors were demonstrated both in normal epithelium adjacent to the wounds and in the epithelial outgrowth from the wound margin. Titrations, however, showed that the epithelial outgrowth reacted more weakly than did the normal adjacent epithelium. These results support previous in vitro studies showing changes in carbohydrate composition of moving normal cells and of malignant cells, a finding that may be of interest in relation to formation of metastases.

  18. A BATCH REACTOR CONSTRUCTION FOR OBTAINING BIODIESEL FROM OIL Ricinus communis

    Directory of Open Access Journals (Sweden)

    Yolimar Fernández

    2014-06-01

    Full Text Available A batch reactor was constructed to obtain biodiesel from 5 liters of extracted from the seed of Ricinus communis. The reactor is made of stainless steel, 29cm length, 15.24 cm of inner diameter and a conical base of 20cm long, wall thickness of 0.2 cm, 1000 W tubular resistance and 110 volt motor. It is extracted and compared with the respective norms the physical and chemical properties of crude oil. Preliminary tests catalyzed transesterification of the oil with NaOH to verify the feasibility of the reaction and define the performed operational conditions. Obtained biodiesel was characterized and compared with references. The results showed that it is possible to obtain the biofuel in the batch reactor with a conversion 88%, confirming its application in transesterification reactions in a basic medium.

  19. Green synthesis of silver nanoparticles by Ricinus communis var. carmencita leaf extract and its antibacterial study

    Science.gov (United States)

    Ojha, Sunita; Sett, Arghya; Bora, Utpal

    2017-09-01

    In this study, we report synthesis of silver nanoparticles (RcAgNPs) from silver nitrate solution using methanolic leaf extract of Ricinus communis var. carmencita. The polyphenols present in the leaves reduce Ag++ ions to Ag0 followed by a color change. Silver nanoparticle formation was ensured by surface plasmon resonance between 400 nm to 500 nm. Crystallinity of the synthesized nanoparticles was confirmed by UHRTEM, SAED and XRD analysis. The capping of phytochemicals and thermal stability of RcAgNPs were assessed by FTIR spectra and TGA analysis, respectively. It also showed antibacterial activity against both gram positive and gram negative strains. RcAgNPs were non-toxic against normal cell line (mouse fibroblast cell line L929) at lower concentrations (80 µg ml-1).

  20. The phytoremediation potential of bioenergy crop Ricinus communis for DDTs and cadmium co-contaminated soil.

    Science.gov (United States)

    Huang, Huagang; Yu, Ning; Wang, Lijun; Gupta, D K; He, Zhenli; Wang, Kai; Zhu, Zhiqiang; Yan, Xingchu; Li, Tingqiang; Yang, Xiao-e

    2011-12-01

    Cadmium (Cd) and dichlorodiphenyltrichloroethane (DDT) or its metabolite residues are frequently detected in agricultural soils and food, posing a threat to human health. The objective of this study was to compare the ability of 23 genotypes of Ricinus communis in mobilizing and uptake of Cd and DDTs (p,p'-DDT, o,p'-DDT, p,p'-DDD and p,p'-DDE) in the co-contaminated soil. The plant genotypes varied largely in the uptake and accumulation of DDTs and Cd, with mean concentrations of 0.37, 0.43 and 70.51 for DDTs, and 1.22, 2.27 and 37.63 mg kg(-1) dw for Cd in leaf, stem and root, respectively. The total uptake of DDTs and Cd varied from 83.1 to 267.8 and 66.0 to 155.1 μg per pot, respectively. These results indicate that R. communis has great potential for removing DDTs and Cd from contaminated soils attributed to its fast growth, high biomass, strong absorption and accumulation for both DDTs and Cd. Copyright © 2011 Elsevier Ltd. All rights reserved.

  1. Higroscopic properties of castor seeds (Ricinus Comunis L.

    Directory of Open Access Journals (Sweden)

    M. C. Gely

    2009-03-01

    Full Text Available Sorption isotherms of castor seeds were evaluated at 30, 40, 50 and 60ºC using the static gravimetric method. Sigmoid trends were observed for isotherms obtained showing a clear effect of temperature. Experimental values were adjusted using the modified isotherms of Henderson, Halsey, Oswin and Guggenheim-Anderson-de Boer (GAB. Models were compared using four statistics parameters. The results showed that Modified Henderson model adjusted adequately the experimental values in the range of temperature evaluated. The experimental values of the safe storage moisture content for castor seeds varied between 6.1 to 8.4 % (d.b. between 20 and 40ºC, showing lower values than those reported for other traditional oilseeds as sunflower or rapeseed. The sorption heats evaluated from the combination of Clapeyron equation and Modified Henderson equation varied between 3400 and 2373 kJ/kg for moisture contents between 1 and 28 % (d.b.. Through Othmer relationship the value of the ratio Lb/Lf varied between 1.01 and 1.34 (for 14.5 and 1% d.b. moisture content respectively. The values obtained showed an exponential relationship with moisture content, of the form Lb/Lf=1+0.44exp(-0.17M with a determination coefficient R² of 0.97.

  2. Effect of plant and row spacing on the yield and oil contents of castor ...

    African Journals Online (AJOL)

    Castor (Ricinus communis L.) is an industrial non edible oilseed adapted to drier areas. An experiment was conducted in the Central Rift Valley of Ethiopia to determine optimum plant population of castor variety Hiruy. Four plant (50, 60, 70 and 80 cm) and four row spacing (60,80,100 and 120 cm) were arranged in factorial ...

  3. Acute Toxicity of Castor Oil Bean Extract and Tolerance Level of ...

    African Journals Online (AJOL)

    The experiment was carried out to determine the acute toxicity of raw castor oil bean (Ricinus communis) extract and the tolerance level of raw castor oil bean by broilers. The seeds were ground, defatted with petroleum ether and the residue was subjected to extraction with phosphate-buffered saline. The extract volume ...

  4. [Inhibition by cysteine of the carbohydrate-binding activity of lectins from Ricinus communis, Canavalia ensiformis and Euonymus europaeus].

    Science.gov (United States)

    Dvorkin, V M

    1985-10-01

    Precipitation induced by different lectins has been studied in the presence of some aminoacids. It was shown that precipitates formed by lectins from Ricinus communis (RCA1), Canavalia ensiformis (Con A), Euonymus europaeus (Eel) in the presence of appropriate carbohydrate-containing molecules disappeared after cysteine addition, like after addition of specific carbohydrate precipitation inhibitors. It is assumed that cysteine residues of RCA1, Con A and Eel lectins are essential for their carbohydrate binding activity.

  5. (11) EFFECT OF POWDERED CASTOR BEAN

    African Journals Online (AJOL)

    Adeyinka Odunsi

    A study was carried out at the Toxicology laboratory of the Department of Crop and Environmental protection,. Ladoke Akintola University of Technology Ogbomoso, to determine the effects of powdered castor oil seed. (Ricinus communis L.Euphorbiaceae) on kidney, liver, spleen of albino rats. The rats were in five groups, ...

  6. (11) EFFECT OF POWDERED CASTOR BEAN

    African Journals Online (AJOL)

    Adeyinka Odunsi

    Ricinus communis, are poisonous to people, animals and insects. One of the main toxic proteins is "ricin", named by ... whereas RCA is a weak cytotoxin and a powerful hemagglutinin. Poisoning by exposure to castor oil seed .... Both red and the white pulps are distinguishable and numerous small vascular channels are ...

  7. Carboxypeptidase of Castor Bean Endosperm during Germination

    OpenAIRE

    山本, 知子; 下田, 忠久; 船津, 軍喜; Yamamoto, Tomoko; Shimoda, Tadahisa; Funatsu, Gunki

    1982-01-01

    Carboxypeptidase (CPase) in the endosperm of castor bean (Ricinus communis L.) showed high activity at day 4 and 7 on germination. From the behavior of CPases on CM-cellulose column chromatography, the early stage CPases, which appeared before 4 day germination, were different from the later stage CPases which appeared after 6 day. Probably the former arised from ungerminated seeds and the latter was synthesized during the germination. The early stage endosperm of small grain castor bean cont...

  8. Eficiencia del extracto de Ricinus communis para el control del mosquito Culex

    Directory of Open Access Journals (Sweden)

    Diego Tomás Corradine Mora

    2014-05-01

    Full Text Available Este artículo evaluó el efecto insecticida del extracto de Ricinus communis sobre larvas de mosquitos Culex. A las 24 h la mortalidad es de 8.33 % con dosis de 1 mL del extracto en una concentración de 500 ppm; 35 % en dosis de 1 mL de una concentración de 1000 ppm; 65 % en dosis de 5 mL de una concentración de 1000 ppm; 98.33 % con 10 mL en concentración de 1000 ppm; testigos 3.3 %. Cuando se evaluó el efecto insecticida del extracto aplicado por aspersión en concentraciones de 500, 750 y 1000 ppm, se consiguieron mortalidades de 18.33, 36.66 y 48.32 %, respectivamente. Ninguna de las concentraciones evaluadas alcanzó el cien por ciento de letalidad. En la prueba de semicampo, solo se logró una mortalidad de 9 %. Se evidenció que el extracto tiene un mejor efecto insecticida para el control de ejemplares inmaduros en estado larvario que sobre los adultos.

  9. Evaluation of experimental cleanser solution of Ricinus communis: effect on soft denture liner properties.

    Science.gov (United States)

    Pisani, Marina Xavier; da Silva, Cláudia Helena Lovato; Paranhos, Helena Freitas Oliveira; Souza, Raphael Freitas; Macedo, Ana Paula

    2012-06-01

    This study evaluated colour stability, hardness and roughness of soft denture liners after immersion in various cleansers. Thirty specimens (14 mm × 4 mm) of Elite Soft Relining (ES) and Mucopren Soft (MS) were randomly immersed in distilled water at 37°C, sodium hypochlorite 1%, and an experimental Ricinus communis solution (RC) for 7, 15 and 183 continuous days. anova (p < 0.05) and Tukey's test indicated that after T7 (μ =8.79 ± 7.36); T15 (μ = 4.23 ± 2.62) and T183 (μ = 8.78 ± 3.16), MS presented a higher increase in hardness than ES. After T7, MS underwent an increase in roughness (μ = 0.09 ± 0.80); ES underwent a decrease (μ = -0.08 ± 0.16). RC caused the smallest variation in roughness. After T15, both materials presented an increase in roughness. After T183, ES (μ = -0.30 ± 0.48) presented a higher roughness variation than MS (μ = -0.07 ± 0.32). Hypochlorite caused an increase in roughness (μ = 0.02 ± 0.19). After all periods ES presented higher colour alteration than MS; highest colour alteration was caused by hypochlorite. Both materials were more stable after immersion in RC. © 2010 The Gerodontology Society and John Wiley & Sons A/S.

  10. IDENTIFICACIÓN DE MICROORGANISMOS ASOCIADOS A RESIDUOS DE HIGUERILLA (Ricinus communis

    Directory of Open Access Journals (Sweden)

    Teresa Cabra Cendales

    2015-05-01

    Full Text Available El objetivo de este artículo fue aislar e identificar los microorganismos presentes en los residuos de fruto y  torta de higuerilla (Ricinus communis. Se utilizaron medios de cultivo selectivos para la caracterización morfológica y bioquímica y para la identificación molecular se usó la técnica de PCR con oligonucleótidos universales RM y RB del gen 16S para bacterias y secuencias intergénicas ITS1 e ITS4 para hongos y levaduras. Las secuencias fueron analizadas identificándose nueve especies de hongos, siendo Penicillium brevicompactum predominante; 12 especies de bacterias, donde el género más recurrente fue Bacillus sp. y dos especies de levaduras, Rhodosporidium paludigenum y Pichia burtonni. La identificación de la microbiota nativa presente en los residuos de higuerilla es muy promisoria, aportando un amplio conocimiento sobre la versatilidad metabólica de cada una de las cepas aisladas. El mayor número de aislamientos se obtuvieron de la torta probablemente debido al alto contenido de nutrientes presentes en este residuo.

  11. CAPILLARY ELECTROPHORETIC ANALYSIS OF LOW-MOLECULAR-MASS OF CA SPECIES IN PHLOEM SAP OF Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Noor Fitri

    2010-06-01

    Full Text Available A capillary electrophoretic (CE analysis with ultra-violet (UV detection was performed for further separation of low-molecular-mass (LMM calcium species in phloem sap of Ricinus communis L. Two different background electrolytes (BGE were used for the separation; these are (1 hydrogen phosphate/dihydrogen phosphate buffer containing cetyltrimethylammonium bromide (CTAB as an electro-osmotic flow (EOF modifier, and (2 boric acid buffer containing CTAB. Various parameters affecting the analysis, including the composition and pH of the BGE were systematically studied. The sensitivity, resolution, baseline noise, migration time of the species peaks, and reproducibility of the method were evaluated under optimised condition. At least 13 UV-active species were optimally separated within about ten minutes. The optimised measurement condition was also achieved using 10 mM hydrogen phosphate/10 mM dihydrogen phosphate containing 0.5 mM CTAB at pH 8.0 as BGE, and by applying voltage of ‑20 kV and temperature of 14°C. Evidently, the analytical method was successfully used for the separation of LMM calcium species in phloem sap of R. communis L.   Keywords: capillary electrophoresis, calcium species, phloem sap, Ricinus communis

  12. Family of Ricinus communis Monosaccharide Transporters and RcSTP1 in Promoting the Uptake of a Glucose-Fipronil Conjugate.

    Science.gov (United States)

    Mao, Gen-Lin; Yan, Yin; Chen, Yan; Wang, Bing-Feng; Xu, Fei-Fei; Zhang, Zhi-Xiang; Lin, Fei; Xu, Han-Hong

    2017-08-02

    Enhancing the systemic distribution of a bioactive compound by exploiting the vascular transport system of a plant presents a means of reducing both the volume and frequency of pesticide/fungicide application. The foliar uptake of the glucose-fipronil conjugate N-[3-cyano-1-[2,6-dichloro-4-(trifluoromethyl)phenyl]-4-[(trifluoromethyl)sulfinyl]-1H-pyrazol-5-yl]-1-(β-d-glucopyranosyl)-1H-1,2,3-triazole-4-methanamine (GTF) achieved in castor bean (Ricinus communis) and its transport via the phloem are known to be mediated by monosaccharide transporter(s) [MST(s)], although neither the identity of the key MST(s) involved nor the mechanistic basis of its movement have yet to be described. On the basis of homology with Arabidopsis thaliana sugar transporters, the castor bean genome was concluded to harbor 53 genes encoding a sugar transporter, falling into the eight previously defined subfamilies INT, PMT, VGT, STP, ERD6, pGlucT, TMT, and SUT. Transcriptional profiling identified the product of RcSTP1 as a candidate for mediating GTF uptake, because this gene was induced by exposure of the plant to GTF. When RcSTP1 was transiently expressed in onion epidermis cells, the site of RcSTP1 deposition was shown to be the plasma membrane. A functional analysis based on RcSTP1 expression in Xenopus laevis oocytes demonstrated that its product has a high affinity for GTF. The long-distance root-to-shoot transport of GTF was enhanced in a transgenic soybean chimera constitutively expressing RcSTP1.

  13. Isolamento do alcalóide ricinina das folhas de Ricinus communis (Euphorbiaceae através de cromatografias em contracorrente Isolation of the alkaloid ricinine from the leaves of Ricinus communis (Euphorbiaceae through counter-current chromatography

    Directory of Open Access Journals (Sweden)

    Ana Cristina Leite

    2005-12-01

    Full Text Available Droplet counter-current chromatography, rotation locular counter-current chromatography and high-speed counter-current chromatography were applied to the preparative separation of the alkaloid ricinine from the dichloromethane extracts of Ricinus communis leaves. The solvent system used was composed of dichloromethane-methanol-water (93:35:72 v/v/v and all techniques led to the isolation of large amounts of the alkaloid. The best result was obtained through HSCCC, since the ricinine yield was respectively 50% and 30% higher than when using RLCCC or DCCC.

  14. In Vitro Assessment of Cytotoxicity, Antioxidant, and Anti-Inflammatory Activities of Ricinus communis (Euphorbiaceae Leaf Extracts

    Directory of Open Access Journals (Sweden)

    Vhutshilo Nemudzivhadi

    2014-01-01

    Full Text Available Ricinus communis has been utilized traditionally as medicine to treat inflammatory related diseases including wounds, sores, and boils. The leaves of R. communis were sequentially extracted with n-hexane, dichloromethane, acetone, and methanol using serial exhaustive extraction method. Antioxidant activity of all crude extracts was quantitatively measured against 2,2′-azino-bis (3-ethylbenzothiazoline-6-sulphonic acid free radical molecules using ABTS+ assay. Cytotoxic effect and anti-inflammatory activity of R. communis leaves extracts were evaluated on Human Caucasian skin fibroblast and Raw 264.7 macrophage cell lines, respectively. Methanol extract had the highest percentage free radical (ABTS+ scavenging activity of 95% at 2.50 mg/mL, acetone 91%, dichloromethane 62%, and hexane the least (50%. Percentage scavenging activity of ABTS+ free radical molecules increases with increase in concentrations of the plant extracts. Hexane and dichloromethane extracts had more than 90% cell viability at 100 µg/mL after 24 and 48 hours of exposure. Methanol extract had LC50 of 784 µg/mL after 24-hour exposure, hexane had 629.3 µg/mL and dichloromethane 573.6 µg/mL, and 544.6 µg/mL was the lowest with acetone extract. The study present the first report on the scavenging activity of R. communis leaf extracts against ABTS+ radicals and cytotoxic effects on human Caucasian skin fibroblast cell lines.

  15. Accumulation, selection and covariation of amino acids in sieve tube sap of tansy (Tanacetum vulgare) and castor bean (Ricinus communis): evidence for the function of a basic amino acid transporter and the absence of a γ-amino butyric acid transporter.

    Science.gov (United States)

    Bauer, Susanne N; Nowak, Heike; Keller, Frank; Kallarackal, Jose; Hajirezaei, Mohamad-Reza; Komor, Ewald

    2014-09-01

    Sieve tube sap was obtained from Tanacetum by aphid stylectomy and from Ricinus after apical bud decapitation. The amino acids in sieve tube sap were analyzed and compared with those from leaves. Arginine and lysine accumulated in the sieve tube sap of Tanacetum more than 10-fold compared to the leaf extracts and they were, together with asparagine and serine, preferably selected into the sieve tube sap, whereas glycine, methionine/tryptophan and γ-amino butyric acid were partially or completely excluded. The two basic amino acids also showed a close covariation in sieve tube sap. The acidic amino acids also grouped together, but antagonistic to the other amino acids. The accumulation ratios between sieve tube sap and leaf extracts were smaller in Ricinus than in Tanacetum. Arginine, histidine, lysine and glutamine were enriched and preferentially loaded into the phloem, together with isoleucine and valine. In contrast, glycine and methionine/tryptophan were partially and γ-amino butyric acid almost completely excluded from sieve tube sap. The covariation analysis grouped arginine together with several neutral amino acids. The acidic amino acids were loaded under competition with neutral amino acids. It is concluded from comparison with the substrate specificities of already characterized plant amino acid transporters, that an AtCAT1-like transporter functions in phloem loading of basic amino acids, whereas a transporter like AtGAT1 is absent in phloem. Although Tanacetum and Ricinus have different minor vein architecture, their phloem loading specificities for amino acids are relatively similar. © 2014 Scandinavian Plant Physiology Society.

  16. Repellent activity of Cnidoscolus phyllacanthus Mart. and Ricinus communis L. extracts against Aedes aegypti L. oviposition behavior

    Directory of Open Access Journals (Sweden)

    Lafayette Pereira Candido

    2015-12-01

    Full Text Available Female Aedes aegypti lay their eggs on nearly any moist substrate. Methods with potential to repel oviposition may reduce infestation, thereby contributing to control of epidemics. We evaluated the influence of Cnidoscolus phyllacanthus and Ricinus communis plant extracts on the oviposition behavior of A. aegypti. Lethal concentrations were first determined in experiments with larvae after 24 h of exposure, after which LC50 and LC90 were used to test oviposition repellency. The experiment consisted of an oviposition preference test based multiple-choice and no-choice assays. The Oviposition Activity Indices (OAIs from the multiple-choice test using both R. communis and C. phyllacanthus were negative, suggesting oviposition repellent and deterrent activity. The LC90 of both plant extracts deterred oviposition by this vector, as demonstrated by an OAI = value of -1. In the choice study, mean oviposition values were significantly different between R. communis and C. phyllacanthus. In the absence of choice, mosquitoes laid eggs independent of the substrate. In conclusion, our OAI values indicate that all substrates used repelled oviposition by A. aegypti.

  17. INTOXICAÇÃO EXPERIMENTAL PELAS SEMENTES TRITURADAS DE Ricinus communis (Euphorbiaceae EM COELHOS

    Directory of Open Access Journals (Sweden)

    Brito Marilene de Farias

    1997-01-01

    Full Text Available As sementes trituradas de Ricinus communis, administradas em doses únicas por sonda intragástrica a coelhos causou graves sintomas de intoxicação com êxito letal nos três coelhos que receberam a dose de 2 g/kg e em um dos quatro que receberam 1 g/kg. Os outros três coelhos que receberam 1g/kg desenvolveram sintomas discretos a moderados e se recuperaram, e os três que receberam 0,5g/kg só mostraram sintomas discretos. O período entre a administração das sementes e a morte ou recuperação variou de 12h47min a 68h08min, e de 3 a 6 dias, respectivamente. Os primeiros sintomas após a administração das sementes, foram observados dentro de cerca 8 horas nos casos letais e nos animais que adoeceram moderadamente, e dentro de cerca 24 horas nos casos com sintomatogia discreta. A evolução da intoxicação variou de 4 a 56 horas nos casos letais e de 2 a 5 meio dias nos casos de recuperação. A sintomatologia consistiu principalmente de perturbações digestivas. Os animais apresentaram inapetência até anorexia. As fezes geralmente eram escassas, com forma e tamanho das síbalas alteradas, eram escuras, às vezes pastosas, com muco. Havia nítidas manifestações de cólica. Os achados de necropsia mais evidentes foram constatados no intestino delgado e ceco. O conteúdo destes segmentos do intestino era líquido. A parede do intestino delgado apresentou congestão e edema e havia fibrina recobrindo a mucosa sob forma de pseudomembranas, ou na luz intestinal sob forma de flocos e/ou filamentos. No ceco havia edema da mucosa como também congestão da parede e fibrina aderida à mucosa ou encontrada em flocos e/ou filamentos no conteúdo. As alterações histológicas mais importantes foram verificadas no intestino delgado e ceco. No intestino delgado observou-se necrose de coagulação associada a congestão/hemorragias na mucosa. Havia ainda congestão/hemorragias e edema na submucosa. Lesões semelhantes foram vistas no ceco onde

  18. A case of massive infestation of a male green lizard Lacerta viridis/bilineata by castor bean tick Ixodes ricinus (Linnaeus, 1758):

    OpenAIRE

    Carretero, Miguel A.; Gomes, Veronika; Žagar, Anamarija

    2013-01-01

    Infestation by ticks affects several vertebrate groups, including reptiles. Castor bean tick Ixodes ricinus is the most widespread tick species. Here we report an impressive tick infestation of a male green lizard Lacerta viridis/bilineata found in 2012 in the vicinity of Bilpa cave in the Kolpa valley, Slovenia. Lizards as tick hosts can play an important role in the life cycle of I. ricinus and may also be potential vectors of Lyme disease. Zaprarazitiranost s klopi je pogost pojav pri v...

  19. Effect of temperature on biomass allocation in seedlings of two contrasting genotypes of the oilseed crop Ricinus communis.

    Science.gov (United States)

    Ribeiro, Paulo R; Zanotti, Rafael F; Deflers, Carole; Fernandez, Luzimar G; Castro, Renato D de; Ligterink, Wilco; Hilhorst, Henk W M

    2015-08-01

    Ricinus communis is becoming an important crop for oil production, and studying the physiological and biochemical aspects of seedling development may aid in the improvement of crop quality and yield. The objective of this study was to assess the effect of temperature on biomass allocation in two R. communis genotypes. Biomass allocation was assessed by measuring dry weight of roots, stems, and cotyledons of seedlings grown at three different temperatures. Root length of each seedling was measured. Biomass allocation was strongly affected by temperature. Seedlings grown at 25°C and 35°C showed greater biomass than seedlings grown at 20°C. Cotyledon and stem dry weight increased for both genotypes with increasing temperature, whereas root biomass allocation showed a genotype-dependent behavior. Genotype MPA11 showed a continuous increase in root dry weight with increasing temperature, while genotype IAC80 was not able to sustain further root growth at higher temperatures. Based on metabolite and gene expression profiles, genotype MPA11 increases its level of osmoprotectant molecules and transcripts of genes encoding for antioxidant enzymes and heat shock proteins to a higher extent than genotype IAC80. This might be causal for the ability to maintain homeostasis and support root growth at elevated temperatures in genotype MPA11. Copyright © 2015 Elsevier GmbH. All rights reserved.

  20. Control of papaya fruits anthracnose by essential oil of Ricinus communis

    Directory of Open Access Journals (Sweden)

    César Luis Siqueira Júnior

    2012-02-01

    Full Text Available The aim of this work was to investigate the potential of castor oil for the control of papaya diseases caused by the fungus Colletotrichum gloeosporioides and the bacterium Pseudomonas caricapapayae. The treatment with 1% castor oil did not significantly affect the fungal growth. The effectiveness of castor oil for the control of anthracnose was shown when 5% and 10% (v/v were used in the assays resulting in reduced mycelial growth. Fungal sporulation was strongly inhibited at 10% (v/v concentration of essential oil. The studies with the fresh fruits treated with 5% (v/v castor oil in aqueous emulsions resulted in effective reduction of pathogen spread in these fruits. No lesion was found in the fruits treated with oil, when compared to the control fruits. Castor oil showed no effect against the P. caricapapayae when tested in vitro. These results suggested the potential use of the castor bean essential oil and its fatty acids constituents for the control of anthracnose in papaya fruits.

  1. Estudio Químico, Micrográfico y Morfológico del Ricinus communis L., y su Aplicación en Pulpa Blanqueable

    OpenAIRE

    Teófilo Escoto García; José Guadalupe Rutiaga Quiñones; Rocío Orihuela Equihua; Antonio Rodríguez Rivas; José de Jesús Rivera Prado

    2014-01-01

    México posee una gran gama de especies vegetales no maderables o arbustivos, de los cuales se sabe muy poco, y para el caso del Ricinus communis L., existen trabajos sobre el uso de la semilla en biocombustibles y en la obtención de celulosa a partir del tallo. Con estos antecedentes se recolectó un espécimen de Ricinus communis , se descortezó y astilló para llevar a cabo los análisis de composición química, micrográfico y morfológico del tejido leñoso; aplicando además un proceso químico a ...

  2. Ricinus communis biocompatibility histological study in the nose of Cebus apella monkeys Avaliação histológica da biocompatibilidade do polímero da mamona no dorso nasal de macacos-pregos (Cebus apella

    Directory of Open Access Journals (Sweden)

    Paulo Cesar de Jesus Dias

    2009-06-01

    Full Text Available Bone tissue lesions can be caused by congenital and acquired factors, and result in nasal deformities with cosmetic and functional repercussion. Surgical treatment in these cases frequently requires complex reconstructions and the use of biomaterials. The polyurethane derived from castor beans (Ricinus communis has a favorable formulation in terms of ease of processing, flexibility, no emission of toxic vapors and low cost. Nonetheless, despite favorable results, studies about the use of castor beam polymer (Ricinus communis assessing tissue reaction on the nasal dorsum are still missing in the literature. AIM: the goal of the present investigation is to histologically assess the Ricinus communis polymer implant biocompatibility with the nasal dorsum. STUDY DESING: experimental. MATERIALS AND METHODS: we used four Cebus appela monkeys, in which we created a nasal dorsal defect in all the animals and there we placed the aforementioned implant. The animals were sacrificed 270 days after surgery and the samples were submitted to histological study. RESULTS: in the histology analysis we did not observe the presence of foreign body granulomas or phagocytic cells. We also observed a progressive bone formation and maturation. CONCLUSION: macroscopic and microscopic results showed that the castor oil polymer implant was biocompatible.Lesões do tecido ósseo podem ser causadas por fatores congênitos e adquiridos e resultar em deformidade nasal com repercussão estética e funcional. O tratamento cirúrgico desses casos requer reconstruções complexas e frequentemente o uso de biomateriais. O poliuretano derivado do óleo da mamona apresenta uma fórmula com aspectos favoráveis de processabilidade, flexibilidade de formulação, ausência de emissão de vapores tóxicos e baixo custo. Entretanto, a despeito dos resultados favoráveis, estudos referentes ao uso do polímero de mamona, avaliando a reação tecidual no dorso nasal, ainda não foram

  3. Toxic and repellent activity of selected monoterpenoids (thymol, carvacrol and linalool) against the castor bean tick, Ixodes ricinus (Acari: Ixodidae).

    Science.gov (United States)

    Tabari, Mohaddeseh Abouhosseini; Youssefi, Mohammad Reza; Maggi, Filippo; Benelli, Giovanni

    2017-10-15

    The castor bean tick, Ixodes ricinus, is a species of medical and veterinary importance. The use of synthetic acaricides for tick control has led to development of resistance, residues in the environment and animal products, and public health concerns. In this regard, plant essential oils and their main constituents represent an appealing alternative strategy to combat ticks. The phenols thymol and carvacrol and the alcohol linalool are monoterpenoids occurring in essential oils of several aromatic and medicinal plants, such as thyme, oregano, savory, lavender and coriander. Recent studies have shown toxicity of these monoterpenoids against selected mosquito vectors and other arthropod pests. However, information on their bioactivity on I. ricinus is not available. On this basis, here we evaluated the ovicidal, larvicidal and repellency effects of these compounds against I. ricinus. Concentrations of 0.25, 0.5, 1, 2 and 5% were sprayed on the egg masses, then hatching rates were noted. Larvicidal assays were conducted on unengorged larvae, following the larval packet technique. The repellency was determined by measuring the vertical migration behavior of ticks in laboratory conditions. Carvacrol and thymol at all concentrations tested led to a significant hatching decrease, showing an efficacy higher than permethrin, whereas linalool did not cause any significant effect. In the larvae treated with carvacrol and thymol (1, 2 and 5%), mortality rates reached 100% after 24h, showing a larvicidal efficacy higher than permethrin, whereas no effect was seen in the larval groups treated with linalool. Carvacrol and thymol at all concentrations tested showed >90% repellency on I. ricinus. Linalool was scarcely effective (50.24% repellency) only at the concentration of 5%. Overall, based on these results, the phenols carvacrol and thymol can be considered as candidate ingredients for the development of novel acaricidal formulations to control the populations of I. ricinus

  4. Metal concentration in plant tissues of Ricinus communis L. (Castor oil)

    African Journals Online (AJOL)

    SLO) contaminated soil at concentrations of 1-6% (w/w, oil/soil). Plant height and stem girth were depressed by spent lubricating oil at concentrations of 2% (w/w) and above. One percent (1%) spent lubricating oil in soil promoted growth of ...

  5. Proteomic profile of the nucellus of castor bean (Ricinus communis L.) seeds during development

    DEFF Research Database (Denmark)

    Nogueira, Fábio C S; Palmisano, Giuseppe; Soares, Emanoella L

    2012-01-01

    groups. The distribution of the identified proteins in stages III and IV into different Gene Ontology categories was similar, with a remarkable abundance of proteins associated with the protein synthesis machinery of cells, as well as several classes of proteins involved in protein degradation......, particularly of peptidases associated with programmed cell death. Consistent with the role of the nucellus in mediating nutrient transfer from maternal tissues to the endosperm and embryo, a significant proportion of the identified proteins are related to amino acid metabolism, but none of the identified...... proteins are known to have a role as storage proteins. Moreover for the first time, ricin isoforms were identified in tissues other than seed endosperm. Results are discussed in the context of the spatial and temporal distribution of the identified proteins within the nucellar cell layers....

  6. Light and electron microscopic observations in connection with the developing pistil and seed-appendix (caruncle of Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Katherine Liszt

    2014-01-01

    Full Text Available The development of the particularly organized stigma and obturator, their fine structure, their function as well as the histological differentiation and the role of the seed-appendix i.e. the caruncle of Ricinus communis L. have been investigated in several developmental phases from the so called "gynoecial primordium" state to the ripe state, 'using the terminology introduced by S a t t 1 e r (1974. The stigma cells are characterized by dens cytoplasm, numerous vesicles mostly of ER origin, ribosomes and negatively stained mitochondria. Dilatation of ER, the appearance of electron opaque substances in it and between the plasmamembran and cell wall are frequent. The degenerating process of some stigma cells will start before the pollination because of autolysis. In the cells of the obturator and young caruncle however dictyosomes can be found more frequently than in stigma cells and the starch content of the ;plastids is remarkable. The thickening of the cell wall is connected with the function of these tissues.

  7. Growth and carbon assimilation limitations in Ricinus communis (Euphorbiaceae under soil water stress conditions Crescimento e limitações à assimilação de carbono em Ricinus communis (Euphorbiaceae sob condições de estresse hídrico do solo

    Directory of Open Access Journals (Sweden)

    Tanise Luisa Sausen

    2010-09-01

    Full Text Available Water availability may influence plant carbon gain and growth, with large impacts on plant yield. Ricinus communis (L., a drought resistant species, is a crop with increasing economic importance in Brazil, due to its use in chemical industry and for the production of biofuels. Some of the mechanisms involved in this drought resistance were analyzed in this study by imposing progressive water stress to pot-grown plants under glasshouse conditions. Water withholding for 53 days decreased soil water gravimetric content and the leaf water potential. Plant growth was negatively and significantly reduced by increasing soil water deficits. With irrigation suspension, carbon assimilation and transpiration were reduced and remained mostly constant throughout the day. Analysis of A/Ci curves showed increased stomatal limitation, indicating that limitation imposed by stomatal closure is the main factor responsible for photosynthesis reduction. Carboxylation efficiency and electron transport rate were not affected by water stress up to 15 days after withholding water. Drought resistance of castor bean seems to be related to a pronounced, early growth response, an efficient stomatal control and the capacity to keep high net CO2 fixation rates under water stress conditions.A disponibilidade hídrica pode influenciar o ganho de carbono e o crescimento, com grande impacto na produtividade das plantas. Ricinus communis (L., uma espécie resistente à seca, é uma cultura de grande importância econômica no Brasil, devido ao seu uso na indústria química e para a produção de biocombustíveis. Alguns dos mecanismos envolvidos na resistência à seca desta espécie foram analisados através de um progressivo estresse hídrico em plantas cultivadas em vasos sob condições de casa de vegetação. A suspensão da irrigação por 53 dias decresceu o conteúdo gravimétrico de água no solo e o potencial hídrico das folhas. O crescimento das plantas foi

  8. Caracterización morfológica y agroproductiva de procedencias de Ricinus communis L. para la producción de aceite Morphological and agroproductive characterization of Ricinus communis L. provenances for oil production

    Directory of Open Access Journals (Sweden)

    R Machado

    2012-12-01

    Full Text Available El objetivo de este trabajo fue caracterizar dos procedencias introducidas desde Suramérica (Planta-2 y Planta-3 y tres colectadas en Cuba (SSCS-5, Colón-1 y Las Tunas, de Ricinus communis L. Para ello se consideraron indicadores morfológicos y agroproductivos. Se utilizaron parcelas de 40 m² (área vital, con diez plantas. El diseño fue totalmente aleatorizado y los datos se analizaron a partir de estadígrafos descriptivos. Planta-2 alcanzó la mayor velocidad de crecimiento (2,98 cm/día y, a los 17 meses, fue superior en cuanto a: el grosor del tallo (17,5 cm; el número de ramas primarias (45, secundarias (41 y terciarias (20; y el grosor de las ramas primarias (5,9 cm. SSCS-5, Colón-1 y Las Tunas mostraron racimos más largos, con un mayor número de frutos; pero fueron superadas por Planta-3 y Planta-2 en el peso de los frutos por racimo (134,9 y 139,0 g, respectivamente, con frutos y semillas más grandes. Las lesiones producidas por insectos y el grado de infestación por microorganismos patógenos no fueron representativos. El mayor rendimiento de semilla (95,1 kg, el de frutos por planta (5,28 kg y por área (4 398 kg/ha y el estimado de aceite por unidad de área (1 130,2 kg/ha se detectaron en Planta-2. Se concluye que estas procedencias poseen características morfoproductivas que las diferencian, y mostraron particularidades relevantes para la producción de aceite, el cual se destina no solo a la producción de biodiesel, sino a múltiples usos a partir de sus derivados. Se recomienda profundizar en estudios sobre la fitotecnia de R. communis, de forma particular en Planta-2; así como introducir tipos medianos que faciliten su cosecha.The objective of this work was to characterize two provenances introduced from South America (Planta-2 and Planta-3 and three provenances collected in Cuba (SSCS-5, Colón-1 and Las Tunas, of Ricinus communis L. For such purpose, morphological and agroproductive indicators were considered

  9. Immunochemical studies on the N-acetyllactosamine beta-(1----6)-linked trisaccharide specificity of Ricinus communis agglutinin.

    Science.gov (United States)

    Wu, A M; Sugii, S; Gruezo, F G; Kabat, E A

    1988-07-15

    The combining site of Ricinus communis agglutinin (RCA1) was studied by quantitative precipitin and precipitin inhibition assays. Of 31 complex carbohydrates tested, all except active and inactive antifreeze glycoproteins, Streptococcus group C polysaccharide, and native rat salivary glycoprotein, reacted strongly, and 22 completely precipitated the lectin, indicating that RCA1 has both a broad range of affinity and a low solubility of its carbohydrate-bound complex. Of the monosaccharides and glycosides tested for inhibition of precipitation, p-nitrophenyl beta-D-galactopyranoside was the best. It was about 6.4 times better than methyl beta-D-galactopyranoside. The beta anomer of glycosides of D-galactose was much more potent than the corresponding alpha anomer. Among the oligosaccharides tested, beta-D-Galp-(1----4)-beta-D-GlcpNAc-(1----6)-D-Gal was the best inhibitor, which was approximately 2/3 as active as p-nitrophenyl beta-D-galactopyranoside. It was approximately 1.4 times as active as beta-D-Gal-(1----4)-D-GlcNAc (N-acetyllactosamine), twice as active as beta-D-Gal-(1----3)-D-GlcNAc, and 4.5 times more active than lacto-N-tetraose. From the results, it can be concluded that; (a) hydrophobic interaction is important for binding; (b) the combining site of this lectin is at least as large as a trisaccharide; and (c) of the compounds studied, the trisaccharide beta-D-Galp-(1----4)-beta-D-GlcpNAc-(1----6)-D-Gal was the most complementary to the human blood group I Ma determinant beta-D-Galp-(1----4)-beta-D-GlcpNAc-(1----6)-D-Gal.

  10. Phloem sap proteins from Cucurbita maxima and Ricinus communis have the capacity to traffic cell to cell through plasmodesmata

    Science.gov (United States)

    Balachandran, Suchandra; Xiang, Yu; Schobert, Christian; Thompson, Gary A.; Lucas, William J.

    1997-01-01

    In angiosperms, the functional enucleate sieve tube system of the phloem appears to be maintained by the surrounding companion cells. In this study, we tested the hypothesis that polypeptides present within the phloem sap traffic cell to cell from the companion cells, where they are synthesized, into the sieve tube via plasmodesmata. Coinjection of fluorescently labeled dextrans along with size-fractionated Cucurbita maxima phloem proteins, ranging in size from 10 to 200 kDa, as well as injection of individual fluorescently labeled phloem proteins, provided unambiguous evidence that these proteins have the capacity to interact with mesophyll plasmodesmata in cucurbit cotyledons to induce an increase in size exclusion limit and traffic cell to cell. Plasmodesmal size exclusion limit increased to greater than 20 kDa, but less than 40 kDa, irrespective of the size of the injected protein, indicating that partial protein unfolding may be a requirement for transport. A threshold concentration in the 20–100 nM range was required for cell-to-cell transport indicating that phloem proteins have a high affinity for the mesophyll plasmodesmal binding site(s). Parallel experiments with glutaredoxin and cystatin, phloem sap proteins from Ricinus communis, established that these proteins can also traffic through cucurbit mesophyll plasmodesmata. These results are discussed in terms of the requirements for regulated protein trafficking between companion cells and the sieve tube system. As the threshold value for plasmodesmal transport of phloem sap proteins falls within the same range as many plant hormones, the possibility is discussed that some of these proteins may act as long-distance signaling molecules. PMID:9391168

  11. Phloem sap proteins from Cucurbita maxima and Ricinus communis have the capacity to traffic cell to cell through plasmodesmata.

    Science.gov (United States)

    Balachandran, S; Xiang, Y; Schobert, C; Thompson, G A; Lucas, W J

    1997-12-09

    In angiosperms, the functional enucleate sieve tube system of the phloem appears to be maintained by the surrounding companion cells. In this study, we tested the hypothesis that polypeptides present within the phloem sap traffic cell to cell from the companion cells, where they are synthesized, into the sieve tube via plasmodesmata. Coinjection of fluorescently labeled dextrans along with size-fractionated Cucurbita maxima phloem proteins, ranging in size from 10 to 200 kDa, as well as injection of individual fluorescently labeled phloem proteins, provided unambiguous evidence that these proteins have the capacity to interact with mesophyll plasmodesmata in cucurbit cotyledons to induce an increase in size exclusion limit and traffic cell to cell. Plasmodesmal size exclusion limit increased to greater than 20 kDa, but less than 40 kDa, irrespective of the size of the injected protein, indicating that partial protein unfolding may be a requirement for transport. A threshold concentration in the 20-100 nM range was required for cell-to-cell transport indicating that phloem proteins have a high affinity for the mesophyll plasmodesmal binding site(s). Parallel experiments with glutaredoxin and cystatin, phloem sap proteins from Ricinus communis, established that these proteins can also traffic through cucurbit mesophyll plasmodesmata. These results are discussed in terms of the requirements for regulated protein trafficking between companion cells and the sieve tube system. As the threshold value for plasmodesmal transport of phloem sap proteins falls within the same range as many plant hormones, the possibility is discussed that some of these proteins may act as long-distance signaling molecules.

  12. CAPACIDAD ANTAGÓNICA Y QUITINOLÍTICA DE MICROORGANISMOS AISLADOS DE RESIDUOS DE HIGUERILLA (Ricinus communis

    Directory of Open Access Journals (Sweden)

    TERESA CABRA C

    2014-06-01

    Full Text Available Se ha comprobado que los fertilizantes y controladores biológicos a base de microorganismos benéficos productores de metabolitos de interés, inducen el crecimiento vegetal y actúan contra microorganismos patógenos y plagas que afectan los agroecosistemas. Por lo tanto, su uso constituye una práctica eficiente de producción limpia que ayuda a reducir el impacto ambiental causado por el uso de agroquímicos. En este trabajo se evaluó la capacidad antagónica y quitinolítica de 15 cepas bacterianas y una levaduriforme, aisladas de residuos lignocelulósicos de higuerilla (Ricinus communis. La actividad antagónica de cada cepa se determinó por la capacidad de inhibir el crecimiento del hongo fitopatógeno Fusarium equiseti, en medio de cultivo PDA. Solamente la bacteria Bacillus subtilis, presentó una inhibición significativa del crecimiento del hongo equivalente al 76,08%. Por lo tanto se demuestra que la cepa de Bacillus subtilis puede ser empleada en la formulación de inoculantes microbianos. La capacidad quitinolítica de las cepas se definió por el crecimiento del microorganismo y por la formación de halos de hidrólisis alrededor de las colonias sobre el medio de cultivo suplementado con quitina coloidal. Ninguna de las cepas evaluadas mostró capacidad para degradar quitina.

  13. Cadmium tolerance and its phytoremediation by two oil yielding plants Ricinus communis (L.) and Brassica juncea (L.) from the contaminated soil.

    Science.gov (United States)

    Bauddh, Kuldeep; Singh, Rana P

    2012-09-01

    The effect of increasing level of cadmium in soil was investigated on biomass production, antioxidants, Cd bioaccumulation and translocation in Ricinus communis vis-à-vis a commonly studied oil crop Brassica juncea. The plants were exposed to 25, 50, 75, 100, and 150 mg Cd/Kg soil for up to 60 days. It was found that R. communis produced higher biomass at all the contamination levels than that of B. juncea. Proline and malondialdehyde in the leaves increased with increase in Cd level in both the species, whereas soluble protein decreased. The bioaccumulation of Cd was higher in B. juncea on the basis of the per unit biomass, total metal accumulation per plant was higher in R. communis. The translocation of Cdfrom roots to shoot was also higher in B. juncea at all Cd concentrations. R. communis appeared more tolerant and capable to clean Cd contaminated soil for longer period in one sowing than B. juncea and the former can grow in wasteland soil also in which later cannot be cultivated.

  14. EFICIÊNCIA DOS ÓLEOS DE NIM (Azadirachta indica A. Juss. E MAMONA (Ricinus communis L. NA RESISTÊNCIA DA MADEIRA DE SUMAÚMA (Ceiba pentandra (L. Gaerth. A FUNGOS XILÓFAGOS EM SIMULADORES DE CAMPO

    Directory of Open Access Journals (Sweden)

    Juarez Benigno Paes

    2012-01-01

    Full Text Available The research aimed to evaluate the efficiency of neem (Azadirachta indica and castor oil plant (Ricinus communis oils for the improvement of Ceiba pentandra wood resistance to xilophagous fungi in soil bed condition (field simulator. The neem and castor oil plant oils were extracted with absolute ethyl alcohol and employed in the preparation of oil solutions. Wood samples with dimensions of 1.5 x 0.5 x 15 cm (radial x tangential x longitudinal were treated to reach a nominal retention of 10 to 16 kg of solution/m³ of wood. The samples were submitted to the action of natural micro-flora of three soils; forest, agricultural use and natural pasture soils, for 180 days. Among the tested soils, the agricultural presented greater biological activity, which damaged the samples even more. Among the tested solutions, the pure neem oil provided increased protection to samples. The prepared solutions using neem and castor oil plant oils did not protect the wood from the attack of xylophagous fungi existing in the ground.

  15. Insight into the sialome of the castor bean tick, Ixodes ricinus

    Czech Academy of Sciences Publication Activity Database

    Chmelař, Jindřich; Anderson, J. M.; Mu, J.; Jochim, R. C.; Valenzuela, J. G.; Kopecký, Jan

    2008-01-01

    Roč. 9, č. 233 (2008), s. 1-21 ISSN 1471-2164 R&D Projects: GA MŠk(CZ) LC06009; GA ČR GA524/05/0811 Institutional research plan: CEZ:AV0Z60220518 Keywords : Ixodes ricinus * cDNA libraries * bioinformatics * tick feeding Subject RIV: EC - Immunology Impact factor: 3.926, year: 2008

  16. A sheep hydatid cyst glycoprotein as receptors for three toxic lectins, as well as Abrus precatorius and Ricinus communis agglutinins.

    Science.gov (United States)

    Wu, A M; Song, S C; Wu, J H; Pfüller, U; Chow, L P; Lin, J Y

    1995-01-18

    The binding properties of a glycoprotein with blood group P1 specificity isolated from sheep hydatid cyst fluid with Gal and GalNAc specific lectins was investigated by quantitative precipitin and precipitin inhibition assays. The glycoprotein completely precipitated Ricinus communis agglutinin (RCA1), Abrus precatorius agglutinin (APA) and Mistletoe toxic lectin-I (ML-I). Only 1.0 microgram of P1 glycoprotein was required to precipitate 50% of 5.1 micrograms ML-I nitrogen. It also reacted well with abrin-a and ricin, precipitating over 73% of the lectin nitrogen added, but poorly or weakly with Dolichos biflorus (DBL), Vicia villosa (VVL, a mixture of A4, A2B2 and B4), VVL-B4, Arachis hypogaea (PNA), Maclura pomifera (MPL), Bauchinia purpurea alba (BPL) and Wistaria floribunda (WFL) lectins. When an inhibition assay in the range of 5.1 micrograms N to 5.9 micrograms N of lectins (ML-I, abrin-a; ricin, RCA1, and APA, and 10 micrograms P1 active glycoprotein interaction was performed; from 76 to 100% of the precipitations were inhibited by 0.44 and 0.52 mumol of Gal alpha 1-->4Gal and Gal beta 1-->4GlcNAc, respectively, but not or insignificantly with 1.72 mumol of GlcNAc. The Gal alpha 1-->4Gal disaccharide found in this P1 active glycoprotein is a frequently occurring sequence of many glycosphingolipids located at the surface of mammalian cell membranes, especially human erythrocytes and intestinal cells for ligand binding and microbial toxin attachment. The present finding suggests that the Gal alpha 1-->4Gal beta 1-->4GlcNAc sequence in this P1 active glycoprotein is one of the best glycoprotein receptors for three toxic lectins (ricin, abrin-a, and ML-I) as well as for APA, and RCA1, and the result of inhibition assay implies that these lectins are recognizing part or all of the Gal alpha 1-->4Gal beta 1-->4GlcNAc sequence in the P1 active glycoprotein.

  17. Antimicrobial activity of complete denture cleanser solutions based on sodium hypochlorite and Ricinus communis – a randomized clinical study

    Directory of Open Access Journals (Sweden)

    Marcela Moreira SALLES

    2015-12-01

    Full Text Available ABSTRACT To preserve oral health and to maintain the prosthetic devices, it is important not only to improve the properties of commonly known hygiene products, but also to investigate new materials with antimicrobial action. Objectives This study evaluated the antimicrobial activity of sodium hypochlorite (0.25% and 0.50% and 10% Ricinus communis’ solutions against specific microorganisms. Material and Methods Sixty four maxillary complete denture wearers were instructed to brush their dentures three times a day and to soak them (20 min/day in the solutions: SH1: 0.25% sodium hypochlorite; SH2: 0.5% sodium hypochlorite; RC: 10% R. communis oil; and C: 0.85% saline (control. The solutions were used for 7 days in a randomized sequence. Following each period of use, there was a 1-week washout period. Antimicrobial activity was determined by Colony Forming Units (CFU counts of Streptococcus mutans, Candida spp., and gram-negative microorganisms. For collecting biofilm, the internal surface of maxillary dentures was brushed with saline solution, and biofilm suspension obtained. After dilutions (100 - 10-3, aliquots were seeded in Mitis salivarius, CHROMagar Candida®, and MacConkey agar for detecting S. mutans, Candida spp., or gram-negative microorganisms, respectively. After incubation, colonies were counted, and CFU/mL values were calculated. Then, transformation - log10 (CFU+1 - data were analyzed using the Friedman test (α=0.05. Results showed significant differences between the solutions (p<0.001. Results All three solutions showed antimicrobial activity against S. mutans. Against Candida spp., RC and SH1 solutions showed similar effect while SH2 showed superior activity. SH1 and SH2 solutions showed antimicrobial action against gram-negative microorganisms. The Candida species most frequently isolated was C. albicans, followed by C. tropicalis and C. glabrata. Conclusions The 0.5% sodium hypochlorite solution was the most effective and

  18. AVALIAÇÃO DO POTENCIAL FITORREMEDIADOR DA MAMONA (Ricinus communis L UTILIZANDO EFLUENTE SINTÉTICO CONTENDO CHUMBO.

    Directory of Open Access Journals (Sweden)

    Anita Lima

    2010-04-01

    Full Text Available Os estudos de novas formas para o tratamento de efluentes domésticos e industriais vêm aumentando gradativamente no Brasil, neste contexto destacam-se as correntes que defendem a atenuação natural e a biorremediação. Por essas razões, em anos recentes, passou-se a dar preferência a métodos in situ, os quais são mais econômicos e perturbam menos o ambiente. Uma técnica de remediação natural é a fitorremediação que, aplica-se à utilização de vegetação (árvores, arbustos, plantas rasteiras e aquáticas e de sua microbiota com o fim de remover, degradar ou isolar substâncias tóxicas ao ambiente. O presente trabalho teve como objetivo testar o capacidade de fitorremediação da mamona (Ricinus Communis L. na redução das concentrações de chumbo presente em efluente sintético, cujas características simulam aquelas encontradas em um dos principais efluentes da indústria de exploração do petróleo, a água de produção tratada. O delineamento experimental utilizado no estudo foi o de blocos inteiramente casualizado com a variação das concentrações de chumbo distribuídas em quatro tratamentos: 0 µg/L (T1, 250 µg/L (T2, 500 µg/L (T3, 1000 µg/L (T4. Na análise dos dados foi aplicado o teste estatístico ANOVA para a comparação das médias nos tratamentos. A avaliação realizada nas concentrações de chumbo no lixiviado indicou que ocorreram remoções máximas de 67,42%, 87,34% e 94,74% para os tratamentos T2, T3 e T4, respectivamente. A retenção do chumbo nos tecidos (sistema radicular, caule e folhas da mamona indicou que a planta apresentou boa capacidade de bioacumular o chumbo. PALAVRAS-CHAVE: Fitorremediação, Chumbo, Mamona.

  19. Jatropha curcas and Ricinus communis differentially affect arbuscular mycorrhizal fungi diversity in soil when cultivated for biofuel production in a Guantanamo (Cuba) tropical system.

    Science.gov (United States)

    Alguacil, M. M.; Torrecillas, E.; Hernández, G.; Torres, P.; Roldán, A.

    2012-04-01

    The arbuscular mycorrhizal fungi (AMF) are a key, integral component of the stability, sustainability and functioning of ecosystems. In this study, we characterised the AMF biodiversity in a control soil and in a soil cultivated with Jatropha curcas or Ricinus communis, in a tropical system in Guantanamo (Cuba), in order to verify if a change of land use to biofuel plant production had any effect on the AMF communities. We also asses whether some soil properties related with the soil fertility (total N, Organic C, microbial biomass C, aggregate stability percentage, pH and electrical conductivity) were changed with the cultivation of both crop species. The AM fungal small sub-unit (SSU) rRNA genes were subjected to PCR, cloning, sequencing and phylogenetic analyses. Twenty AM fungal sequence types were identified: 19 belong to the Glomeraceae and one to the Paraglomeraceae. Two AMF sequence types related to cultured AMF species (Glo G3 for Glomus sinuosum and Glo G6 for Glomus intraradices-G. fasciculatum-G. irregulare) disappeared in the soil cultivated with J. curcas and R. communis. The soil properties (total N, Organic C and microbial biomass C) were improved by the cultivation of the two plant species. The diversity of the AMF community decreased in the soil of both crops, with respect to the control soil, and varied significantly depending on the crop species planted. Thus, R. communis soil showed higher AMF diversity than J. curcas soil. In conclusion, R. communis could be more suitable in long-term conservation and sustainable management of these tropical ecosystems.

  20. Synthesis of amides and sulfonamides of {beta}-D- galactopyranosylamine and {beta}-lactosylamine and evaluation of their interactions with the lectins from Erythrina cristagalli and Ricinus communis; Sintese de amidas e sulfonamidas de {beta}-D-galactopiranosilamina e {beta}-lactosilamina e avaliacao de suas interacoes com lectinas de Erythrina cristagalli e de Ricinus communis

    Energy Technology Data Exchange (ETDEWEB)

    Butera, Anna Paola; Souza Filho, Jose Dias de [Universidade Federal de Minas Gerais, Belo Horizonte, MG (Brazil). Dept. de Quimica; Carvalho, Diogo Teixeira; Figueiredo, Rute Cunha; Faria, Luiz Carlos Alves de; Nunes, Maria Angelica; Prado, Maria Auxiliadora Fontes; Alves, Ricardo Jose [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Faculdade de Farmacia. Dept. de Produtos Farmaceuticos]. E-mail: ricardodylan@farmacia.ufmg.br; Andrade, Milton Hercules Guerra de; Silva, Karina Taciana Santos [Universidade Federal de Ouro Preto (UFOP), MG (Brazil). Inst. de Ciencias Exatas e Biologicas. Dept. de Ciencias Biologicas

    2007-09-15

    We report herein the synthesis of some {beta}-D-galactopyranosylamine and {beta}-lactosylamine amides and sulfonamides. The interactions of these compounds with lectins from the seeds of Erythrina cristagalli (LEC) and Ricinus communis (RCA120) were evaluated in a hemagglutination inhibitory activity assay. D-Galactose and lactose were used as reference compounds. The {beta}-lactosylamine amides and sulfonamides were nearly as active as lactose in inhibiting LEC mediated hemagglutination and were less active against RCA120 agglutinin. The {beta}-D-galactopyranosylamine amides and sulfonamides were, with one exception, considerably less active than D-galactose in the assay with both lectins. (author)

  1. Evaluation of Castor Bark Powder as a Corrosion Inhibitor for Carbon Steel in Acidic Media

    OpenAIRE

    Santos, André de Mendonça; Almeida, Thassia Felix de; Cotting, Fernando; Aoki, Idalina Vieira; Melo, Hercílio Gomes de; Capelossi, Vera Rosa

    2017-01-01

    The inhibition effect of castor bark powder obtained from Ricinus communis on AISI 1020 carbon steel in acidic media (HCl 0.5 mol.L-1) has been studied by electrochemical impedance spectroscopy (EIS), polarization curves, scanning vibrating electrode technique (SVET) and weight loss measurements. Fourier transform infrared spectroscopy (FTIR) and scanning electron microscopy (SEM) were employed as characterization techniques. The EIS and gravimetric results showed that the inhibitory efficien...

  2. Optimization of Preparation of Activated Carbon from Ricinus communis Leaves by Microwave-Assisted Zinc Chloride Chemical Activation: Competitive Adsorption of Ni2+ Ions from Aqueous Solution

    Directory of Open Access Journals (Sweden)

    M. Makeswari

    2013-01-01

    Full Text Available The preparation of activated carbon (AC from Ricinus communis leaves was investigated in this paper. Orthogonal array experimental design method was used to optimize the preparation of AC using microwave assisted zinc chloride. Optimized parameters were radiation power of 100 W, radiation time of 8 min, concentration of zinc chloride of 30% by volume, and impregnation time of 24 h, respectively. The surface characteristics of the AC prepared under optimized conditions were examined by pHZPC, SEM-EDAX, XRD, and FTIR. Competitive adsorption of Ni2+ ions on Ricinus communis leaves by microwave assisted zinc chloride chemical activation (ZLRC present in binary and ternary mixture was compared with the single metal solution. The effects of the presence of one metal ion on the adsorption of the other metal ion were investigated. The experimental results indicated that the uptake capacity of one metal ion was reduced by the presence of the other metal ion. The extent of adsorption capacity of the binary and ternary metal ions tested on ZLRC was low (48–69% as compared to single metal ions. Comparisons with the biosorption of Ni2+ ions by the biomass of ZLRC in the binary (48.98–68.41%-~Ni-Cu and 69.76–66.29%-~Ni-Cr and ternary solution (67.32–57.07%-~Ni–Cu and Cr could lead to the conclusion that biosorption of Ni2+ ions was reduced by the influence of Cu2+ and Cr3+ ions. The equilibrium data of the adsorption was well fitted to the Langmuir isotherm. The adsorption process follows the pseudo-second-order kinetic model.

  3. Allelopatic effect of different caster bean organs (Ricinus communis L. on reducing germination and growth of dodder (Cuscuta campestris Yuncker

    Directory of Open Access Journals (Sweden)

    S.M Seyyedi

    2016-05-01

    Full Text Available Introduction Dodder (Cascuta campestris Yuncker is an annual parasitic plant from the Convolvulaceae family (Mishra et al., 2007. It wraps around many adjacent dicot and a few monocot plants, penetrates in their vascular tissue and exploits photosynthates, nutrients and water (Lanini & Kogan, 2005. Consequently, the growth, vigor and production of the host plant will be severely reduced (Nadler-Hasasr & Rubin, 2003. Dodder is not able to complete its cycle, if it is not attached to a host. Therefore, it is entirely dependent on its host for supplying water, assimilates and minerals (Mishra et al., 2007. Considering the nature of dodder habit, it is rarely possible to completely control dodder by using different chemical herbicides (Lanini & Kogan, 2005. In addition, because of increasing the environmental concerns caused by applying synthetic herbicides, there is considerable attention to alternative strategies for weeds management (Batish et al., 2002; Bowmik & Inderjit, 2003. In recent years, allelopathic plants, an alternative strategy for weed management, have received massive attention (Narwal, 2010; Jamil et al., 2009. Due to the importance of dodder as a parasitic weed, this research was conducted with the purpose of studying the allelopathic effects of aqueous extracts and decay durations of caster bean (Ricinus communis L. organs on germination and emergence of dodder. Materials and methods The current study was conducted based on three separate experiments using a completely randomized design (CRD with factorial arrangement with three replications. The first experiment was conducted in petri dishes and consisted of caster bean organs at four levels (root, stem, leaf and total plant without inflorescence and their aqueous extract concentrations at 11 levels (0, 1, 2, 3, 4, 5, 6, 7, 8, 9 and 10%. The second experiment was conducted in pots and factors were caster bean organs at 4 levels (root, stem, leaf and total plant without

  4. Use of castor oil in pregnancies at term.

    Science.gov (United States)

    Garry, D; Figueroa, R; Guillaume, J; Cucco, V

    2000-01-01

    Despite wide use of castor oil to initiate labor, the obstetric literature contains few references to this botanical laxative. Derived from the castor plant Ricinus communis, castor oil may possess properties that are useful in post-term pregnancies. To evaluate the relationship between the use of castor oil and the onset of labor. Prospective evaluation. A community hospital in Brooklyn, NY. A total of 103 singleton pregnancies with intact membranes at 40 to 42 weeks referred for antepartum testing. Inclusion criteria included cervical examination, Bishop score of 4 or less, and no evidence of regular uterine contractions. Patients were alternately assigned to 1 of 2 study groups: a single oral dose of castor oil (60 mL) or no treatment. Castor oil was considered successful if labor began within 24 hours after dosing. Groups were compared for onset of labor in 24 hours, method of delivery, presence of meconium-stained amniotic fluid, Apgar score, and birth weight. Fifty-two women received castor oil and 48 were assigned no treatment. Following administration of castor oil, 30 of 52 women (57.7%) began active labor compared to 2 of 48 (4.2%) receiving no treatment. When castor oil was successful, 83.3% (25/30) of the women delivered vaginally. Women who receive castor oil have an increased likelihood of initiation of labor within 24 hours compared to women who receive no treatment. Castor oil use in pregnancy is underreported worldwide. This small series represents the first attempt to evaluate the medication.

  5. Effect of the extract of Ricinus communis L. on the osmotic fragility, labeling of red blood cells with Technetium-99m and morphology of the cells

    Directory of Open Access Journals (Sweden)

    Kristiana Cerqueira Mousinho

    2008-12-01

    Full Text Available The aim of this study was to evaluate the influence of the proteic extract of R. communis on the cell physiology by the osmotic fragility, labeling of the blood elements with the 99mTc and cell morphology. To evaluate the osmotic fragility, the blood samples of the Wistar rats were incubated with the concentrations of R. communis and with the solutions of NaCl (0.4; 0.7; 0.9%. In the labeling of the blood elements procedure, the rat blood was treated with a solution of Tc-99m and TCA at 5%, determining the rate of radioactivity (%ATI in the plasma (P and in the red blood cells (RBC. The soluble and insoluble fractions of the plasma were also evaluated. The cells morphology submitted to the extract was evaluated by the optical microscopy (x40. The results indicated that the rate of the hemolysis increased in the presence of 0.125 mg/mL of the extract. There was a decay of 49.69% in the rate of ATI in the insoluble fraction of the cells, with the morphological alterations in the red blood cells. These results suggested that the extract changed the capability of binding of the red blood cells due to the stannous ion oxidation, modifying the cells structure.Produtos naturais são usados freqüentemente por muitas pessoas no tratamento do câncer. O Ricinus communis L é uma Euforbiaceae que apresenta propriedades laxativas, purgativas e antitumorais. O objetivo deste trabalho é estudar a influência da fração protéica do extrato hidroalcoólico de R. communis L. na fisiologia celular através da fragilidade osmótica, da marcação de elementos sanguíneo com 99mTc e da morfologia celular. Para avaliar a fragilidade osmótica, amostras de sangue de ratos Wistar foram incubadas com concentrações de R. communis e com soluções de NaCl (0,4; 0,7; 0,9%. No procedimento de marcação de elementos sanguíneos, as amostras de sangue foram tratadas com solução de Tc-99m e TCA à 5%, determinando o percentual de radioatividade (%ATI no plasma (P e

  6. Induced mutations in castor

    International Nuclear Information System (INIS)

    Ganesan, K.; Javad Hussain, H.S.; Vindhiyavarman, P.

    2001-01-01

    Castor (Ricinus communis L.) is an important oilseed crop in India. To create variability mutations were induced in two cultivars 'TMV5' (maturing in 130-140 days) and 'CO1' (perennial type). Gamma rays and diethyl sulphate and ethidium bromide were used for seed treatment. Ten doses, from 100 to 1000 Gy were employed. For chemical mutagenesis five concentrations of mutagenes from 10 to 50 mM were tried. No economic mutants could be isolated after treatment with the chemical mutagens. The following economic mutants were identified in the dose 300 Gy of gamma rays. Annual types from perennial CO 1 castor CO 1 is a perennial variety (8-10 years) with bold seeds (100 seed weight 90 g) and high oil content (57%). Twenty-one lines were isolated with annual types (160-180 days) with high yield potential as well as bold seeds and high oil content. These mutants, identified in M 3 generation were bred true in subsequent generations up to M 8 generation. Critical evaluation of the mutants in yield evaluation trials is in progress

  7. CONSTRUCCIÓN DE UN REACTOR DISCONTINUO PARA LA OBTENCIÓN DE BIODIESEL A PARTIR DEL ACEITE DE Ricinus communis

    Directory of Open Access Journals (Sweden)

    Yolimar Fernández

    2014-01-01

    Full Text Available Se construyó un reactor discontinuo para obtener biodiesel a partir de 5 litros de extracto obtenido de la semilla de Ricinus communis. El reactor es de acero inoxidable, con longitud de 29 cm; diámetro interno de 15,24 cm y fondo cónico de 20cm de largo, espesor de la pared de 0,2cm, resistencia tubular de 1000 W y motor de 110 volt. Se extrajo y se comparó con las normas respectivas las propiedades físicas y químicas del aceite crudo. Se realizaron pruebas preliminares de transesterificación del aceite catalizadas con NaOH para constatar la viabilidad de la reacción y definir las condiciones operacionales. El biodiesel obtenido fue caracterizado y comparado con referencias presentes en la literatura. Los resultaron mostraron que es posible obtener el biocombustible en el reactor discontinuo con un grado de conversión 88%; confirmando su aplicación en reacciones de transesterificación en medio básico.

  8. Rendimento e Características Físicas dos Óleos de Nim (Azadirachta indica e Mamona (Ricinus communis

    Directory of Open Access Journals (Sweden)

    Juarez Benigno Paes

    Full Text Available A pesquisa objetivou avaliar o rendimento e a viscosidade de óleos de nim (Azadirachta indica e mamona (Ricinus communis. Os frutos de nim foram coletados no Núcleo de Pesquisa do Semiárido, em Patos, Paraíba, e os de mamona, às margens do Rio Espinharas, Patos e em Igaracy, Paraíba. Os frutos foram beneficiados no Laboratório de Tecnologia de Produtos Florestais, em Patos. Foram retiradas amostras de sementes para a determinação do teor de umidade e do rendimento em óleos. Os óleos foram extraídos com álcool etílico absoluto e empregados no preparo de soluções com os óleos de nim e mamona. Determinaram-se a densidade e a viscosidade das soluções. A mamona teve menor teor de umidade e rendimento em óleo que o nim. A densidade e a viscosidade do óleo de nim foram menores que o da mamona. Uma maior quantidade de óleos de mamona proporcionou aumento na densidade e na viscosidade das soluções preparadas.

  9. Molybdenum (Mo) increases endogenous phenolics, proline and photosynthetic pigments and the phytoremediation potential of the industrially important plant Ricinus communis L. for removal of cadmium from contaminated soil.

    Science.gov (United States)

    Hadi, Fazal; Ali, Nasir; Fuller, Michael Paul

    2016-10-01

    Cadmium (Cd) in agricultural soil negatively affects crops yield and compromises food safety. Remediation of polluted soil is necessary for the re-establishment of sustainable agriculture and to prevent hazards to human health and environmental pollution. Phytoremediation is a promising technology for decontamination of polluted soil. The present study investigated the effect of molybdenum (Mo) (0.5, 1.0 and 2.0 ppm) on endogenous production of total phenolics and free proline, plant biomass and photosynthetic pigments in Ricinus communis plants grown in Cd (25, 50 and 100 ppm) contaminated soils and the potential for Cd phytoextraction. Mo was applied via seed soaking, soil addition and foliar spray. Foliar sprays significantly increased plant biomass, Cd accumulation and bioconcentration. Phenolic concentrations showed significantly positive correlations with Cd accumulation in roots (R 2  = 0.793, 0.807 and 0.739) and leaves (R 2  = 0.707, 721 and 0.866). Similarly, proline was significantly positively correlated with Cd accumulation in roots (R 2  = 0.668, 0.694 and 0.673) and leaves (R 2  = 0.831, 0.964 and 0.930). Foliar application was found to be the most effective way to deliver Mo in terms of increase in plant growth, Cd accumulation and production of phenolics and proline.

  10. Outbreaks of Chrysodeixis includens (Walker (Lepidoptera: Noctuidae in common bean and castor bean in São Paulo State, Brazil

    Directory of Open Access Journals (Sweden)

    Edson Luiz Lopes Baldin

    2014-12-01

    Full Text Available Since 2009, increasing populations of Chrysodeixis includens (Walker (Lepidoptera: Noctuidae have been observed in cultivated common bean (Phaseolus vulgaris L. and castor bean (Ricinus communis L. at the Lageado Experimental Farm, belonging to the FCA/UNESP, Botucatu, São Paulo State, Brazil. Defoliations around 80% and 50% were observed in the common bean cv. Pérola and castor bean cv. IAC-2028, respectively. Samples of individuals (caterpillars and pupae were collected in the field, and kept in laboratory until adult emergence aiming to confirm the species. These are new observations for common bean in São Paulo State and, in the case of castor bean, unpublished in Brazil. It suggests that C. includens has adapted to attack other agricultural crops, demanding attention of common bean and castor bean producers.

  11. Tableros de partículas de bambú (Bambusa vulgaris Schrad y resina poliuretana a base de aceite de rícino (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Flávio Januário José

    Full Text Available Esta investigación tiene como objetivo la elaboración y la evaluación de tableros de partículas homogéneas aglomeradas, utilizándose dos materiales alternativos en la búsqueda de la sustentabilidad del proceso productivo. Fueron utilizadas partículas de Bambusa vulgaris Schrad por la rapidez del ciclo de producción de esta especie de bambú. Como pegante fue utilizada la resina poliuretana a base de aceite de ricino (Ricinus communis L., por su origen parcialmente renovable, y por ser considerada no tóxica. Para la caracterización del material, fueron fabricadas, en escala de laboratorio, tableros de partículas de bambú con dimensiones inferiores al 2.4 mm, combinadas con 5%, 10% y 15% de resina en relación a la masa de partículas de bambú. Probetas fueron evaluadas de acuerdo con las especificaciones de la norma NBR 14810 - Tableros de madera aglomerada. Antes de los ensayos de compresión las probetas fueron evaluadas por medio del ensayo no destructivo por ultra-sonido. Los resultados obtenidos indicaron que los tableros con el contenido de 10% de resina no fue estadísticamente diferente al contenido de 15%, siendo ambos superiores al contenido de 5%. La mayoría de las propiedades de los tableros fueron inferiores a aquellas de los tableros comerciales. No fue posible correlacionar la velocidad del pulso de ultra-sonido con la resistencia a la compresión longitudinal.

  12. RELACIÓN ENTRE VARIABLES CLIMÁTICAS CON LA MORFOLOGÍA Y CONTENIDO DE ACEITE DE SEMILLAS DE HIGUERILLA (Ricinus communis L. DE CHIAPAS

    Directory of Open Access Journals (Sweden)

    María Antonieta Goytia-Jiménez

    2011-01-01

    Full Text Available Ciento cincuenta y un accesiones de higuerilla (Ricinus communis L., colectadas en el estado de Chiapas, México, fueron caracterizadas por contenido de aceite, forma, tamaño y peso de la semilla, con el objetivo de generar información que pueda servir de base en un programa de mejoramiento para esta especie, que podría ser una opción rentable para la producción de biodiesel y bioturbosina. De acuerdo con su distribución, se establecieron las cuatro siguientes zonas climáticas: Región 1 clima Lluvioso tropical sin estación seca; Región 2 Sabana tropical con inviernos secos; Región 3 Sabana tropical con inviernos menos secos que la Región 2, y Región 4 Lluvioso Tropical. Se encontró una amplia variación en tamaño (de 0.05 a 2.49 cm2, color, peso (desde 7 hasta 123.9 g por cada 100 semillas y contenido de aceite (desde 12.20 a 64.84 %. Las asociaciones que se establecieron entre el tamaño y peso de 100 semillas con temperatura y precipitación fueron negativas, y significativas sólo en las regiones 3 y 4. No hubo significancia para las asociaciones del contenido de aceite con temperatura y precipitación, pero la tendencia fue a ser positivas en las regiones 1 y 4, las de mayor humedad de las cuatro regiones, y negativas en las regiones 2 y 3. Se concluye que los individuos de esta especie presentan una gran adaptación a diferentes entornos y crean fenotipos especiales para cada lugar en donde se desarrollan.

  13. Castor bean response to zinc fertilization

    Energy Technology Data Exchange (ETDEWEB)

    Chaves, Lucia Helena Garofalo; Cunha, Tassio Henrique Cavalcanti da Silva; Lima, Vinicius Mota; Cabral, Paulo Cesar Pinto; Barros Junior, Genival; Lacerda, Rogerio Dantas de [Universidade Federal de Campina Grande (UAEAg/UFCG), PB (Brazil). Unidade Academica de Engenharia Agricola

    2008-07-01

    Zinc is a trace element and it is absolutely essential for the normal healthy growth of plants. This element plays a part of several enzyme systems and other metabolic functions in the plants. Castor beans (Ricinus communis L.) crop is raising attention as an alternative crop for oil and biodiesel production. Despite the mineral fertilization is an important factor for increasing castor beans yield, few researches has been made on this issue, mainly on the use of zinc. In order to evaluate the effects of zinc on growth of this plant an experiment was carried out in a greenhouse, in Campina Grande, Paraiba State, Brazil, from July to December 2007. The substrate for the pot plants was a 6 mm-sieved surface soil (Neossolo Quartzarenico). The experimental design was a completely randomized with three replications. The treatments were composed of five levels of Zn (0; 2; 4; 6 and 8 mg dm{sup -3}), which were applied at the time of planting. One plant of castor bean, cultivar BRS 188 - Paraguacu, was grown per pot after thinning and was irrigated whenever necessary. Data on plant height, number and length of leaves and stem diameter were measured at 21, 34, 77 and 103 days after planting. Under conditions that the experiment was carried out the results showed that the Zn levels used, did not affect the castor bean plants growth. (author)

  14. Síntese de amidas e sulfonamidas de beta-D-galactopiranosilamina e beta-lactosilamina e avaliação de suas interações com lectinas de Erythrina cristagalli e de Ricinus communis Synthesis of amides and sulfonamides of beta-D- galactopyranosylamine and beta-lactosylamine and evaluation of their interactions with the lectins from Erythrina cristagalli and Ricinus communis

    Directory of Open Access Journals (Sweden)

    Anna Paola Butera

    2007-10-01

    Full Text Available We report herein the synthesis of some beta-D-galactopyranosylamine and beta-lactosylamine amides and sulfonamides. The interactions of these compounds with lectins from the seeds of Erythrina cristagalli (LEC and Ricinus communis (RCA120 were evaluated in a hemagglutination inhibitory activity assay. D-Galactose and lactose were used as reference compounds. The beta-lactosylamine amides and sulfonamides were nearly as active as lactose in inhibiting LEC mediated hemagglutination and were less active against RCA120 agglutinin. The beta-D-galactopyranosylamine amides and sulfonamides were, with one exception, considerably less active than D-galactose in the assay with both lectins.

  15. Secondary seed dispersal of Ricinus communis Linnaeus (Euphorbiaceae by ants in secondary growth vegetation in Minas Gerais Dispersão secundária de sementes de Ricinus communis Linnaeus (Euphorbiaceae por formigas em vegetação secundária em Minas Gerais

    Directory of Open Access Journals (Sweden)

    Mário Marcos do Espírito Santo

    2007-12-01

    Full Text Available In this study, I tested the efficacy of ants as secondary seed dispersers of Ricinus communis in southeastern Brazil. In a natural population of 143 individuals, I determined the ballistic dispersal distance for 62 seeds and 100 additional seeds were experimentally offered to ants in groups of ten seeds along a transect of 50 m. Fifty-three seeds were removed by ants, mainly by the leafcutter Atta sexdens (90.4%. The dispersal distance by ants was high, compared to the global average (4.38 m ± 0.74 m vs. 0.96 m, but was lower than the ballistic distance (7.27 m ± 0.13 m. Ants increased the total dispersal distance (8.66 m ± 0.60 m, but the main benefit for the plant was the directed dispersal, with seed deposition on the enriched soil of ant nests.Este estudo testou a eficiência de formigas como dispersores secundários de Ricinus communis no Brasil. Em uma população natural de 143 indivíduos, a distância de dispersão balística foi determinada para 62 sementes. Além disso, 100 sementes adicionais foram oferecidas a formigas em grupos de 10, ao longo de um transecto de 50 m. Cinqüenta e três sementes foram removidas por formigas, principalmente pela formiga-cortadeira Atta sexdens (90,4%. A distância de dispersão por formigas foi alta se comparada à média global (4,38m ± 0,74 m vs. 0,96 m, porém menor que a distância de dispersão balística (7,27 m ± 0,13 m. As formigas aumentaram a distância de dispersão total (8,66 m ± 0,60 m, mas o principal benefício para a planta foi a dispersão direcionada, com a deposição das sementes no solo enriquecido encontrado nos ninhos das formigas.

  16. Biodiesel production from castor oil in Brazil: A difficult reality

    International Nuclear Information System (INIS)

    Silva Cesar, Aldara da; Otavio Batalha, Mario

    2010-01-01

    The Brazilian National Program for Production and Use of Biodiesel (PNPB in Portuguese) has created a huge demand for biodiesel in Brazil. The PNPB is strongly based on social development through the inclusion of family farmers in projects integrated with biodiesel power plants. Among the various oilseeds, castor bean (Ricinus communis L.) was identified as the ideal one to promote social development in the semi-arid region. However, although promising, the mechanisms of the federal program are still insufficient to promote the effective participation of family farmers. This research shows that companies are facing huge problems in implementing contracts with family farmers. It describes and analyzes the functioning dynamics of this agro-production chain. This paper addresses the identification and the discussion of these obstacles, in order to increase the competitiveness of the biodiesel agribusiness chain, based on castor oil social projects in Brazil.

  17. Biodiesel production from castor oil in Brazil. A difficult reality

    Energy Technology Data Exchange (ETDEWEB)

    Silva Cesar, Aldara da; Otavio Batalha, Mario [Federal University of Sao Carlos, Gepai - Grupo de Estudos e Pesquisas Agroindustriais, Departamento de Engenharia de Producao - UFSCar, Rodovia Washington Luis, km 235 - CEP 13565-905 - Sao Carlos (Brazil)

    2010-08-15

    The Brazilian National Program for Production and Use of Biodiesel (PNPB in Portuguese) has created a huge demand for biodiesel in Brazil. The PNPB is strongly based on social development through the inclusion of family farmers in projects integrated with biodiesel power plants. Among the various oilseeds, castor bean (Ricinus communis L.) was identified as the ideal one to promote social development in the semi-arid region. However, although promising, the mechanisms of the federal program are still insufficient to promote the effective participation of family farmers. This research shows that companies are facing huge problems in implementing contracts with family farmers. It describes and analyzes the functioning dynamics of this agro-production chain. This paper addresses the identification and the discussion of these obstacles, in order to increase the competitiveness of the biodiesel agribusiness chain, based on castor oil social projects in Brazil. (author)

  18. Biodiesel production from castor oil in Brazil: A difficult reality

    Energy Technology Data Exchange (ETDEWEB)

    Silva Cesar, Aldara da, E-mail: aldara@dep.ufscar.b [Federal University of Sao Carlos, Gepai - Grupo de Estudos e Pesquisas Agroindustriais, Departamento de Engenharia de Producao - UFSCar, Rodovia Washington Luis, km 235 - CEP 13565-905 - Sao Carlos - SP (Brazil); Otavio Batalha, Mario [Federal University of Sao Carlos, Gepai - Grupo de Estudos e Pesquisas Agroindustriais, Departamento de Engenharia de Producao - UFSCar, Rodovia Washington Luis, km 235 - CEP 13565-905 - Sao Carlos - SP (Brazil)

    2010-08-15

    The Brazilian National Program for Production and Use of Biodiesel (PNPB in Portuguese) has created a huge demand for biodiesel in Brazil. The PNPB is strongly based on social development through the inclusion of family farmers in projects integrated with biodiesel power plants. Among the various oilseeds, castor bean (Ricinus communis L.) was identified as the ideal one to promote social development in the semi-arid region. However, although promising, the mechanisms of the federal program are still insufficient to promote the effective participation of family farmers. This research shows that companies are facing huge problems in implementing contracts with family farmers. It describes and analyzes the functioning dynamics of this agro-production chain. This paper addresses the identification and the discussion of these obstacles, in order to increase the competitiveness of the biodiesel agribusiness chain, based on castor oil social projects in Brazil.

  19. RESTORATIVE ASPECT OF CASTOR PLANT ON MAMMALIAN PHYSIOLOGY: A REVIEW

    Directory of Open Access Journals (Sweden)

    Attila Kádasi

    2011-10-01

    Full Text Available The castor plant (Ricinus communis L. is a robust perennial shrub of Euphorbiaceae family and different parts of the plant are widely used by various communities and forest dwellers in many regions of the world for treating a variety of ailments. About 80% of world population is still dependent on traditional herbal medicines. The plant is documented to possess beneficial effects as anti-oxidant, antifertility, anti inflammatory, antimicrobial, central nervous system stimulant, anti diabetic, insecticidal and larvicidal and many other medicinal properties. The extracts or the isolated compounds of this plant have been found to have potent activity against various ailments. The aim of this paper is to scrutinize the available literature related to the restorative activity of the castor plant as a herbal medicine on mammalian physiology and to accumulate those scientifically valid data in a nut shell in the form of a mini review.

  20. Ricinus communis agglutinin-mediated agglutination and fusion of glycolipid-containing phospholipid vesicles: effect of carbohydrate head group size, calcium ions, and spermine.

    Science.gov (United States)

    Hoekstra, D; Düzgüneş, N

    1986-03-25

    The glycolipids galactosylcerebroside (GalCer), lactosylceramide (LacCer), and trihexosylceramide (Gb3) were inserted into phospholipid vesicles, consisting of phosphatidylethanolamine and phosphatidic acid. The extent to which their carbohydrate head groups protruded beyond the vesicle surface and their interference with membrane approach were examined by determining vesicle susceptibility toward type I Ricinus communis agglutinin (RCA1) induced agglutination and Ca2+- and spermine-induced aggregation and fusion either in the presence or in the absence of the lectin. The initial agglutination rates increased in the order GalCer much less than LacCer less than Gb3, while a reversed order was obtained for Ca2+- and spermine-induced aggregation and fusion, indicating an enhanced steric interference on close approach of bilayers with increasing head group size. The lectin-mediated agglutination rates for LacCer- and Gb3-containing vesicles increased by an order of magnitude when Ca2+ was also included in the medium, at a concentration that did not induce aggregation per se. Charge neutralization could not account for this observation as the polyvalent cation spermine did not display this synergistic effect with RCA1. Addition of Ca2+ to preagglutinated vesicles substantially reduced the threshold cation concentration for fusion (micromolar vs. millimolar). Quantitatively, this concentration decreased with decreasing carbohydrate head group size, indicating that the head group protrusion determined the interbilayer distance within the vesicle aggregate. The distinct behavior of Ca2+ vs. spermine on RCA1-induced agglutination on the one hand and fusion on the other indicated that Ca2+ regulates the steric orientation of the carbohydrate head group, which appears to be related to its ability to dehydrate the bilayer. As a result, lectin agglutinability becomes enhanced while fusion will be interrupted as the interbilayer distance increases, the threshold head group size

  1. Caracterização de Amphobotrys ricini, agente causal do mofo-cinzento da mamoneira (Ricinus communis L.), avaliação de genótipos, controle químico e alternativo

    OpenAIRE

    Chagas, Haroldo Antunes [UNESP

    2012-01-01

    A mamoneira (Ricinus communis L.) é uma espécie oleaginosa tropical, cujo principal produto é o óleo extraído de suas sementes, sendo um dos mais versáteis da natureza e com muitas aplicações na indústria. Mesmo considerada uma planta rústica, a mamoneira está sujeita a doenças, dentre elas destacamos o mofo-cinzento, causada pelo fungo Amphobotrys ricini. Apesar de não ter relato no Brasil, o mofo-cinzento causado, também, pelo fungo Botrytis cinerea em mamoneira já foi descrito na Coréia do...

  2. PurificaÃÃo, caracterizaÃÃo bioquÃmica e atividade biolÃgica de um inibidor de tripsina da torta da mamona (Ricinus communis L.)

    OpenAIRE

    Rodolpho Glauber Guedes Silva

    2012-01-01

    A cultura da mamoneira (Ricinus communis L.) à de grande importÃncia socioeconÃmica devido Ãs suas sementes, que sÃo utilizadas, principalmente, na produÃÃo do Ãleo que pode ser empregado para diversos fins industriais. A extraÃÃo do Ãleo gera um subproduto de alto valor nutricional, conhecido como torta da mamona. PorÃm, a presenÃa de compostos tÃxicos e alergÃnicos dificulta utilizaÃÃo desse resÃduo como fonte de alimentaÃÃo animal. Outra forma de agregar valor à torta da mamona seria busca...

  3. Avaliação de fungicidas, óleos essenciais e agentes biológicos no controle de Amphobotrys ricini em mamoneira (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Haroldo Antunes Chagas

    2014-03-01

    Full Text Available A mamoneira (Ricinus communis L. é uma espécie oleaginosa tropical, sendo o óleo extraído de suas sementes um dos mais versáteis da natureza e com inúmeras aplicações industriais. Embora ainda seja uma espécie rústica, ela está sujeita a diversas doenças, dentre elas o mofo-cinzento, causada pelo fungo Amphobotrys ricini. O melhoramento genético seria a melhor alternativa para o controle da doença, mas demanda tempo para se obter cultivares resistentes. Dessa maneira, o uso de métodos de controle baseado em métodos químicos, alternativos ou biológicos mostra-se viável no curto prazo. O objetivo do trabalho foi estudar a eficiência do controle do mofo-cinzento, na cultura da mamoneira, utilizando-se de métodos químico, alternativo e biológico. Assim, procurou-se avaliar, tanto in vitro, quanto in vivo a eficiência de controle do patógenos utilizando-se de fungicidas, óleos essenciais e agentes de controle biológico. Quanto a inibição do crescimento micelial do patógeno in vitro os melhores tratamentos com os óleos essenciais foram os com a base de Cymbopogon martini e Cynnamomum zeylanicum, nas cinco concentrações testadas. Em ambos os óleos, o diâmetro médio das colônias ficou em 0,7 cm contra a média de 4,79 cm da testemunha. Com os fungicidas, nas quatro concentrações testadas, os mais eficientes foram os ingredientes ativos tiofanato metílico, carbendazim, tebuconazole e iprodione. O ED50 destes fungicidas ficou < 1uL/L, atestando 100% de inibição do crescimento micelial em todas as concentrações. Quanto à inibição da germinação dos conídios de A. ricini, os fungicidas tebuconazole e clorotalonil foram os melhores em todas as concentrações testadas, sendo a média dos conídios germinados destes fungicidas de 0,0 e 0,15%, respectivamente, contra 100% da testemunha. No campo, o tratamento com o fungicida iprodione foi o melhor quanto ao controle da doença quando comparados com os

  4. Castor and jatropha oils: production strategies – A review

    Directory of Open Access Journals (Sweden)

    Lago Regina C.A.

    2009-07-01

    Full Text Available The Brazilian bioenergy matrix is based on four platforms: ethanol, energy forests, residues and co-products and biodiesel. The food-energy dichotomy in the use of edible oils is one factor which has stimulated the search for non-edible oleaginous energy crops, such as many native palms. By the year 2000 Brazil had an annual deficit of 80 thousand tons of castor oil, making necessary to import oil from China and India. After a strong debate the National Program on Biodiesel Production (NPBP was launched by December 2004. After an initial excessive enthusiasm, small producers being focused in the program, a more mature and realistic planning is undertaken. Production in semi arid lands is being stimulated, mainly castor (Ricinus communis and Jatropha (Jatropha curcas. Apart from belonging to the same botanical family (Euphorbiaceae, both plants are well resistant to poor soils. Castor plant is well adapted to practically the whole country, except for some extreme areas (too low water availability or too much rain. Castor keeps being an alternative for the semi arid region but much more technology is requested to make it largely exploited. Following the petroleum crisis of 1980’s an ambitious research program on Jatropha curcas was initiated, later on discontinued and presently retaken by Embrapa and some Universities. Progress is slower than in the case of Ricinus communis. The first agronomical observations confirmed low productivity, problems with pests and diseases, high harvesting costs etc. Some strategic factors should be considered for the production of castor and Jatropha oils: 1. Production of raw materials; 2. Production of oils; 3. Detoxification and value aggregation to the extraction cakes and residues. Regarding raw material production, it is necessary a strong, long term research program on genetic breeding (short cycle varieties, with high productivity and allowing a sole harvesting, soil fertility, pest control, domestication

  5. Evaluation préliminaire de l'activité larvicide des extraits aqueux des feuilles du ricin (Ricinus communis L. et du bois de thuya (Tetraclinis articulata (Vahl Mast. sur les larves de quatre moustiques culicidés : Culex pipiens (Linné, Aedes caspius (Pallas, Culiseta longiareolata (Aitken et Anopheles maculipennis (Meigen

    Directory of Open Access Journals (Sweden)

    Mahari S.

    2006-01-01

    Full Text Available Preliminary evaluation of larvicidal activity of aqueous extracts from leaves of Ricinus communis L. and from wood of Tetraclinis articulata (Vahl Mast. on the larvae of four mosquito species: Culex pipiens (Linné, Aedes caspius (Pallas, Culiseta longiareolata (Aitken and Anopheles maculipennis (Meigen. Aqueous extracts of Ricinus communis leaves and Tetraclinis articulata wood showed strong toxic activity against larvae of several mosquitoes. In this study, insecticide effects of these plant extracts have been investigated on 2nd and 4th instars larvae of Culicidae insects, Culex pipiens (Linné, Aedes caspius (Pallas, Culiseta longiareolata (Aitken and Anopheles maculipennis (Meigen. After 24 hours of exposition, bioassays revealed low lethal concentrations LC50. To control mosquitoes, these plant extracts might be used as natural biocides.

  6. Environmental effects of nanosilver: impact on castor seed germination, seedling growth, and plant physiology.

    Science.gov (United States)

    Yasur, Jyothsna; Rani, Pathipati Usha

    2013-12-01

    Increasing use of nanoparticles in daily products is of great concern today, especially when their positive and negative impact on environment is not known. Hence, in current research, we have studied the impact of silver nanoparticle (AgNPs) and silver nitrate (AgNO3) application on seed germination, root, and shoot length of castor bean, Ricinus communis L. plant. Silver nanoparticles had no significant effects on seedling growth even at higher concentration of 4,000 mg L(-1), while the silver in bulk form as AgNO3 applied on the castor bean seeds inhibited the seed germination. Silver uptake in seedlings of the castor seeds on treatment with both the forms of silver was confirmed through atomic absorption spectroscopy studies. The silver nanoparticle and silver nitrate application to castor seeds also caused an enhanced enzymatic activity of ROS enzymes and phenolic content in castor seedlings. High-performance liquid chromatography analysis of individual phenols indicated enhanced content of parahydroxy benzoic acid. These kinds of studies are of great interest in order to unveil the movement and accumulation of nanoparticles in plant tissues for assessing future applications in the field or laboratory.

  7. CASTOR BEAN AND SUNFLOWER INTERCROPPING SYSTEMS IN ROW ARRANGEMENT: BIOLOGICAL EFFICIENCY

    Directory of Open Access Journals (Sweden)

    Ciro de Miranda Pinto

    2012-07-01

    Full Text Available An experiment field was carried in the agricultural seasons 2008, 2009 and 2010, with aim of studying the response of castorbean (Ricinus communis L. intercropping with sunflower (Helianthus annus L. in row arrangement in the dryland farming conditions. In addition, it was evaluated the biological efficiency of plants in intercropping systems.The design used in the experiment was randomized block with seven treatement and four replications. The treatments were represented by rows of castor oil (Ma and sunflower (Gi listed below: 1Ma:1Gi; 1Ma:2Gi; 1Ma:3Gi; 2Ma:2Gi; 2Ma:3Gi; castor and sunflower in the monoculture. The efficiency of intercropping was measured by LER, ATER, LEC, average between LER and ATER, SPI and CoR. The grain yield of castor bean and sunflower were reduced in intercropped row arrangements. The row arrangement 1Ma:2Gi showed the smallest reduction of average productivity of castor beans and sunflower in the evaluation period of the experiment. The castor bean was the dominant crop in relation to sunflower.

  8. Jatropha curcasand Ricinus communisdisplay contrasting photosynthetic mechanisms in response to environmental conditions

    Directory of Open Access Journals (Sweden)

    Milton Costa Lima Neto

    2015-06-01

    Full Text Available Higher plants display different adaptive strategies in photosynthesis to cope with abiotic stress. In this study, photosynthetic mechanisms and water relationships displayed byJatropha curcasL. (physic nuts andRicinus communisL. (castor bean, in response to variations in environmental conditions, were assessed.R. communis showed higher CO2 assimilation, stomatal and mesophyll conductance thanJ. curcas as light intensity and intercellular CO2 pressure increased. On the other hand,R. communis was less effective in stomatal control in response to adverse environmental factors such as high temperature, water deficit and vapor pressure deficit, indicating lower water use efficiency. Conversely,J. curcas exhibited higher photosynthetic efficiency (gas exchange and photochemistry and water use efficiency under these adverse environmental conditions.R. communisdisplayed higher potential photosynthesis, but exhibited a lowerin vivo Rubisco carboxylation rate (Vcmax and maximum electron transport rate (Jmax. During the course of a typical day, in a semiarid environment, with high irradiation, high temperature and high vapor pressure deficit, but exposed to well-watered conditions, the two studied species presented similar photosynthesis. Losing potential photosynthesis, but maintaining favorable water status and increasing non-photochemical quenching to avoid photoinhibition, are important acclimation mechanisms developed byJ. curcas to cope with dry and hot conditions. We suggest thatJ. curcas is more tolerant to hot and dry environments thanR. communis but the latter species displays higher photosynthetic efficiency under well-watered and non-stressful conditions.

  9. Trial of an experimental castor oil solution for cleaning dentures.

    Science.gov (United States)

    Andrade, Ingrid Machado de; Andrade, Kelly Machado de; Pisani, Marina Xavier; Silva-Lovato, Cláudia Helena; de Souza, Raphael Freitas; Paranhos, Helena de Freitas Oliveira

    2014-01-01

    Denture hygiene is essential because denture biofilm is involved in oral infections and systemic diseases. Although there are chemical agents available on the market, none of them have ideal properties and research on such products is still necessary. The aim of this study was to evaluate the efficacy of a castor bean (Ricinus communis)-based solution for removing denture biofilm, compared to two traditional products (sodium hypochlorite and alkaline peroxide). Fifty maxillary complete denture wearers were instructed to brush their dentures after meals and to immerse their dentures once a day in the following solutions: Saline (20 min; control), Polident alkaline peroxide (3 min), NaOCl (20 min) and 2% castor oil solution (20 min). Participants used each solution for a period of 7 consecutive days, according to a random sequence. After each period, the internal surfaces of maxillary complete dentures were stained with a disclosing solution (1% neutral red), photographed and the disclosed biofilm was quantified with the aid of specific software. The influence of treatments on results was verified by the Friedman test (α=0.05). Tested solutions presented significant difference (Fr=51.67; pcastor oil presented intermediate results (median: 1.0% and 1.5%, respectively). It can be concluded that the castor oil solution tested in this study was comparable to alkaline peroxide in terms of efficiency in denture biofilm removal.

  10. Análise clínica, radiológica, macroscópica e histológica do úmero de codornas domésticas (Coturnix japonica, submetido ao implante da poliuretana derivada do polímero de mamona (Ricinnus communis Clinical, radiological, macroscopical and histological analysis of domestic quail (Coturnix japonica humerus submitted to implant of polyurethane from castor oil polymer (Ricinnus communis

    Directory of Open Access Journals (Sweden)

    Juliano Bolson

    2005-10-01

    ça de trabéculas e medula óssea no interior do implante. Concluiu-se que a poliuretana derivada do polímero de mamona é biocompatível em aves, podendo ser utilizada na cirurgia ortopédica, ocorrendo osteointegração.In orthopedic surgery there are frequently situations in which the surgeon faces severe bone losses caused by high-energy trauma, tumors or infections. Repairing these losses require knowledge about filling materials. Those materials can be biological, synthetic or metallic, with emphasis in bony grafts and biomaterial implants. The increase of the use of birds as pets is leading to an increasing number of clinical and surgical cases related to this taxon, where fractures are the most commonly observed surgical problems. The objective of this study was to evaluate clinical, radiological, macroscopic and microscopic effects of the polyurethane derived from castor oil (Ricinus communis polymer, when implanted in the humerus of domestic quails (Coturnix japonica. Twenty male and female quails, were used randomly distributed in four groups of five individuals. The birds received the implants in the left humerus, being submitted to daily physical examination during the postoperative period, immediate and biweekly radiological examination, and macroscopic and microscopic evaluation at the 15th, 30th, 60th and 90th days. Clinically, there were not observed local, regional or systemic changes. Radiologically, increase in local density was observed with no signs of changes in bone or adjacent tissue, as well as in the air sacs. Macroscopic analysis revealed that the polyurethane derived from castor oil polymer was not absorbed in none of the four groups, remaining implanted within the pneumatic bone. Its resistance, however, has changed. Microscopic examination evidenced minimum inflammatory reaction, slight fibrosis around the implants, and osteo-integration with presence of trabeculi and bone marrow inside the implants. Concluding, implants of polyurethane

  11. Seeds' physicochemical traits and mucilage protection against aluminum effect during germination and root elongation as important factors in a biofuel seed crop (Ricinus communis).

    Science.gov (United States)

    Silva, Giovanni Eustáquio Alves; Ramos, Flávia Toledo; de Faria, Ana Paula; França, Marcel Giovanni Costa

    2014-10-01

    We determined the length, volume, dry biomass, and density in seeds of five castor bean cultivars and verified notable physicochemical trait differences. Seeds were then subjected to different toxic aluminum (Al) concentrations to evaluate germination, relative root elongation, and the role of root apices' rhizosphere mucilage layer. Seeds' physicochemical traits were associated with Al toxicity responses, and the absence of Al in cotyledons near to the embryo was revealed by Al-hematoxylin staining, indicating that Al did not induce significant germination reduction rates between cultivars. However, in the more sensitive cultivar, Al was found around the embryo, contributing to subsequent growth inhibition. After this, to investigate the role of mucilage in Al tolerance, an assay was conducted using NH4Cl to remove root mucilage before or after exposure to different Al concentrations. Sequentially, the roots were stained with hematoxylin and a quantitative analysis of staining intensity was obtained. These results revealed the significant contribution of the mucilage layer to Al toxicity responses in castor bean seedlings. Root growth elongation under Al toxicity confirmed the role of the mucilage layer, which jointly indicated the differential Al tolerance between cultivars and an efficient Al-exclusion mechanism in the tolerant cultivar.

  12. Energetic balance of castor oil methyl and ethyl esters; Balanco energetico de esteres metilicos e etilicos de oleo de mamona

    Energy Technology Data Exchange (ETDEWEB)

    Almeida Neto, Jose Adolfo de; Cruz, Rosenira Serpa da; Alves, Jaenes Miranda; Pires, Monica de Moura; Robra, Sabine [Universidade Estadual de Santa Cruz, Ilheus BA (Brazil). Grupo Bioenergia e Meio Ambiente]. E-mails: jalmeida@uesc.br; Parente Junior, Expedito [Tecnologias Bioenergeticas Ltda. (TECBIO), Fortaleza, CE (Brazil); Fundacao Nucleo de Tecnologia Industrial (NUTEC), Fortaleza, CE (Brazil)]. E-mail: expeditojr@tecbio.com.br

    2004-07-01

    Castor oil (Ricinus communis L.) is one of the cultures chosen by the biodiesel federal and state programs to supply raw material for biodiesel production - a biofuel indicated as renewable and less pollutant than its fossil competitor. An energetic balance was performed based on LCA - Life Cycle Analysis principles and Input-Output Analysis, comparing the castor oil energy performance with others traditional cultures: colza (Brassica napus) in Europe and soybean (Glycine max) in the United States. Energy balance (O-I) was positive in both production ways (methyl and ethyl) independent of coproduct use allocation alternative. The relation Output-Input (O-I) calculated for castor oil biodiesel [1.3-2.9] was higher than the colza (1.2-1.9) and lower than the soybean (3.2--3.4), independent of the way and allocation of the used byproduct. Both indicators suggest the energy and environmental viability of the castor oil biodiesel, provided that high agricultural productivity (higher than 1.500 kg/ha year) can be guaranteed. The potentialization of the positive energetic and environmental effects depends on the adequate utilization of the coproducts and process residues, the improvement of the energy efficiency in the the castor oil and biodiesel processing and the implementation of efficient management in the use of the chemical inputs (specially the N), responsible for up 5% of the total energy input.

  13. Genome-Wide Identification, Evolutionary Analysis, and Stress Responses of the GRAS Gene Family in Castor Beans

    Directory of Open Access Journals (Sweden)

    Wei Xu

    2016-06-01

    Full Text Available Plant-specific GRAS transcription factors play important roles in regulating growth, development, and stress responses. Castor beans (Ricinus communis are important non-edible oilseed plants, cultivated worldwide for its seed oils and its adaptability to growth conditions. In this study, we identified and characterized a total of 48 GRAS genes based on the castor bean genome. Combined with phylogenetic analysis, the castor bean GRAS members were divided into 13 distinct groups. Functional divergence analysis revealed the presence of mostly Type-I functional divergence. The gene structures and conserved motifs, both within and outside the GRAS domain, were characterized. Gene expression analysis, performed in various tissues and under a range of abiotic stress conditions, uncovered the potential functions of GRAS members in regulating plant growth development and stress responses. The results obtained from this study provide valuable information toward understanding the potential molecular mechanisms of GRAS proteins in castor beans. These findings also serve as a resource for identifying the genes that allow castor beans to grow in stressful conditions and to enable further breeding and genetic improvements in agriculture.

  14. NTP technical report on the toxicity studies of Castor Oil (CAS No. 8001-79-4) in F344/N Rats and B6C3F1 Mice (Dosed Feed Studies).

    Science.gov (United States)

    Irwin, R

    1992-03-01

    Castor oil is a natural oil derived from the seeds of the castor bean, Ricinus communis. It is comprised largely of triglycerides with a high ricinolin content. Toxicity studies with castor oil were performed by incorporating the material at concentrations as high as 10% in diets given to F344/N rats and B6C3F1 mice of both sexes for 13 weeks. Genetic toxicity studies also were performed and were negative for mutation induction in Salmonella typhimurium, for induction of sister chromatid exchanges or chromosomal aberrations in Chinese hamster ovary cells, and for induction of micronuclei in the peripheral blood erythrocytes of mice evaluated at the end of the 13-week studies. Exposure to castor oil at dietary concentrations as high as 10% in 13-week studies did not affect survival or body weight gains of rats or mice (10 per sex and dose). There were no biologically significant effects noted in hematologic analyses in rats. Mild increases in total bile acids and in serum alkaline phosphatase were noted at various times during the studies in rats receiving the higher dietary concentrations of castor oil. Liver weights were increased in male rats receiving the 10% dietary concentration and in male and female mice receiving diets containing 5% or 10% castor oil. However, there were no histopathologic lesions associated with these liver changes, nor were there any compound-related morphologic changes in any organ in rats or mice. No significant changes were noted in a screening for male reproductive endpoints, including sperm count and motility, and no changes were observed in the length of estrous cycles of rats or mice given diets containing castor oil. Thus, no significant adverse effects of castor oil administration were noted in these studies. Synonyms: Ricinus Oil, oil of Palma Christi, tangantangan oil, phorboyl, Neoloid.

  15. Undecylenic acid: a valuable and physiologically active renewable building block from castor oil.

    Science.gov (United States)

    Van der Steen, Marijke; Stevens, Christian V

    2009-01-01

    A lot of attention is currently being paid to the transition to a biobased economy. In this movement, most efforts concentrate on the development of bioenergy applications including bioethanol, biodiesel, thermochemical conversion of biomass, and others. However, in the energy sector other nonbiomass alternatives are known, whereas no valuable alternatives are available when thinking about chemical building blocks. Therefore, it is also essential to develop new routes for the synthesis of bio-based chemicals and materials derived thereof. Such intermediates can originate either from plants or from animals. Castor oil is a non-edible oil extracted from the seeds of the castor bean plant Ricinus communis (Euphorbiaceae), which grows in tropical and subtropical areas. Globally, around one million tons of castor seeds are produced every year, the leading producing areas being India, PR China, and Brazil.2 10-Undecenoic acid or undecylenic acid is a fatty acid derived from castor oil that, owing to its bifunctional nature, has many possibilities to develop sustainable applications.

  16. Impact of castor meal on root-knot and free-living nematodes

    Directory of Open Access Journals (Sweden)

    Cecilia Helena Silvino Prata Ritzinger

    2014-08-01

    Full Text Available Soil amendment may enhance soil quality as well as reduce plant-parasitic nematode. Despite the many applications already undertaken using castor meal, its efficiency in controlling root-knot nematodes (RKN, Meloidogyne incognita when applied to melon (Cucumis melo is still not clear. Three different amounts of castor meal (Ricinus communis applied were evaluated in microplots planted with melon either with or without RKN. The impact of castor meal on soil free-living nematode communities was also determined. Total nematode genera richness was estimated as 37 for the entire set of microplots sampled across both sampling dates. Rarefaction analysis resulted in 12 collector's curves out of the total of 30 that reached the horizontal asymptote. Univariate ANOVA with two factors yielded differences (p < 0.05 only with regard to the time factor. Simpson, Shannon, Evenness and Equitability indices showed a trend toward moderate increases by the end of the experiment, while the other indices were higher for tomato in pre-transplant sampling compared to harvest. Nematode community and diversity changed during the course of the experiment, although there was substantial confounding heterogeneity within and between the factorial combinations from the beginning. Root knot population was not reduced by the castor meal but increased throughout the period, regardless of treatment. RKN reduced melon yield, number and weight of melon.

  17. Simultaneous allergen inactivation and detoxification of castor bean cake by treatment with calcium compounds

    International Nuclear Information System (INIS)

    Fernandes, K.V.; Deus-de-Oliveira, N.; Godoy, M.G.; Guimarães, Z.A.S.; Nascimento, V.V.; Melo, E.J.T. de; Freire, D.M.G.; Dansa-Petretski, M.; Machado, O.L.T.

    2012-01-01

    Ricinus communis L. is of great economic importance due to the oil extracted from its seeds. Castor oil has been used for pharmaceutical and industrial applications, as a lubricant or coating agent, as a component of plastic products, as a fungicide or in the synthesis of biodiesel fuels. After oil extraction, a castor cake with a large amount of protein is obtained. However, this by-product cannot be used as animal feed due to the presence of toxic (ricin) and allergenic (2S albumin) proteins. Here, we propose two processes for detoxification and allergen inactivation of the castor cake. In addition, we establish a biological test to detect ricin and validate these detoxification processes. In this test, Vero cells were treated with ricin, and cell death was assessed by cell counting and measurement of lactate dehydrogenase activity. The limit of detection of the Vero cell assay was 10 ng/mL using a concentration of 1.6 × 10 5 cells/well. Solid-state fermentation (SSF) and treatment with calcium compounds were used as cake detoxification processes. For SSF, Aspergillus niger was grown using a castor cake as a substrate, and this cake was analyzed after 24, 48, 72, and 96 h of SSF. Ricin was eliminated after 24 h of SSF treatment. The cake was treated with 4 or 8% Ca(OH) 2 or CaO, and both the toxicity and the allergenic properties were entirely abolished. A by-product free of toxicity and allergens was obtained

  18. Cálculo del balance de energía para higuerilla (Ricinus communis L. desde las etapas de producción en campo hasta el valor energético de cada componente de la planta

    Directory of Open Access Journals (Sweden)

    Hipólito Ortíz-Laurel

    2017-01-01

    Full Text Available Introducción : Pruebas de balance de energía permiten redirigir los insumos desde las etapas de producción de un cultivo, e igualmente, precesar la cantidad de energía utilizada para cada proceso y así, verificar la eficiencia al transformar la energía contenida en el cultivo cuando debe cumplir con una función deseada. Método : la planta de higuerilla (Ricinus communis L. con propósitos de cultivo energético fue sembrada en campo y sometida a procesos de mantenimiento de l cultivo y en la cosecha, la planta completa fue colectada para análisis energético, donde cada una de sus partes inclu i das las semillas fueron evaluadas en función de su contenido de energía. Así, para determinar el balance de energía; los valores de la energía biológica de la planta fueron comparados con la energía aplicada en cada uno de los procesos técnicos y físicos para la producción del cult i vo y en su procesamiento . Resultados : La energía aplicada para producir el cultivo r esulta un 28% superior a la energía a obtener de la planta. Asimismo, la biomasa de la planta completa de higuerilla, sin contar las semillas genera el doble de energía comparado con el aceite de las semillas, por lo que, conviene utilizar toda la planta e n términos de energía . Conclusión : Es recomendable utilizar el aceite de las seillas como biomaterial, ya que el b a lance es positivo en un 15%.

  19. Effect of glycerine and essential oils (Anacardium occidentale and Ricinus communis on animal performance, feed efficiency and carcass characteristics of crossbred bulls finished in a feedlot system

    Directory of Open Access Journals (Sweden)

    Olga Teresa Barreto Cruz

    2014-11-01

    Full Text Available The effect of corn substitution by glycerine and essential oils on animal performance, apparent digestibility and red and white blood cells of crossbred bulls finished in feedlot was evaluated. Thirty bulls with average weight of 311±28.8 kg and 22±2 month-old were allocated in three diets: CON (without glycerine or essential oils, GLY (with glycerine and GEO (with glycerine and essential oils. The bulls were fed a diet of sorghum silage, cracked corn, soybean meal, urea, limestone and mineral salt. Three grams of cashew and castor oil/animal/day were included in GEO diet. Animals were kept in feedlot for 115 days and slaughtered at average weight of 467±40.6 kg. No differences (P<0.05 among diets regarding final body weight, average daily gain and feed conversion were reported. Ether extract intake was higher (P<0.05 in CON diet compared to the others. Dry matter, organic matter and crude protein digestibility was higher (P<0.05 in GLY diet compared to CON. Acid detergent fibre digestibility was higher (P<0.05 in CON compared to GLY diet. Nonfibrous carbohydrate, fibrous carbohydrate and ether extract digestibility were similar (P>0.05 among diets. No effect of glycerine and essential oil addition on total blood cholesterol, triglycerides, haemogram, leukogram and plasmatic proteins was observed. Corn replacement by glycerine and essential oils addition did not affect (P>0.05 carcass weight, dressing and conformation, carcass length and cushion thickness.

  20. Effects of Foliar Applications of Sulfur, Nitrogen and Phosphorus on Castor Bean (Ricinus cmmunis L. Seed Yield and its Components under Water Deficit Conditions

    Directory of Open Access Journals (Sweden)

    M. Mosavi

    2015-08-01

    Full Text Available To determine the effects of foliar applications of some macroelements on castor seed yield and its components under drought stress conditions, an experiment was conducted at the Agricultural Research Center of East Azerbaijan province. A factorial experiment, based on randomized complete block design with three replications, was carried out during 2013 growing season. Treatment factors consisted of irrigations with two levels (no water deficit and water deficit during grain filling stage and of foliar applications of macroelements with four levels [control, wettable sulfur (0.2 percent, nitrogen (urea: 0.6 percent and phosphor (super phosphate triple: 0.4 percent. Traits studied were: plant height, number of inflorescence, number of lateral branches, number of leaves, leaf temperature, relative water content, number of seeds per plant, 1000-kernal weight and seed yield. All traits, except number of inflorescence, were affected significantly by drought stress. Water deficit reduced plant height, number of leaves, number of seeds per plant, 1000-kernal weight, seed yield, relative water content, while it increased leaf temperature. Number of lateral branches was affected significantly by interaction between factors. Maximum latral branches (1.86 were obtained under non-stress treatment with nitrogen foliar application. Moderate drought stress had significant effect on leaf temperature and relative water content. It seems that, these traits can be used in determination of water deficit effects on castor bean.

  1. Intraspecific DNA methylation polymorphism in the non-edible oilseed plant castor bean

    Directory of Open Access Journals (Sweden)

    Shan He

    2017-10-01

    Full Text Available Investigation of the relationships of phenotypic and epigenetic variations might be a good way to dissect the genetic or molecular basis of phenotypic variation and plasticity in plants. Castor bean (Ricinus communis L., an important non-edible oilseed crop, is a mono-species genus plant in the family Euphorbiaceae. Since it displays rich phenotypic variations with low genetic diversity, castor bean is a good model to investigate the molecular basis of phenotypic and epigenetic variations. Cytosine DNA methylation represents a major molecular mechanism of epigenetic occurrence. In this study, epigenetic diversity of sixty landrace accessions collected worldwide was investigated using the methylation-sensitive amplification polymorphism (MSAP technique. Results showed that the epigenetic diversity (based on the polymorphism of DNA methylated loci exhibited a medium variation (Ne = 1.395, He = 0.242, I = 0.366 at the population level though the variation was great, ranging from 3.80% to 34.31% among accessions. Both population structure analysis and the phylogenetic construction (using the neighbor-joining criteria revealed that the two main clades were identified, but they did not display a distinct geographic structure. After inspecting the location of polymorphic methylated loci on genome we identified that the polymorphic methylated loci occur widely in nuclear and organelle genomes. This study provides new data to understand phenotypic and epigenetic variations in castor bean.

  2. Castor oil biodiesel and its blends as alternative fuel

    International Nuclear Information System (INIS)

    Berman, Paula; Nizri, Shahar; Wiesman, Zeev

    2011-01-01

    Intensive production and commercialization of biodiesel from edible-grade sources have raised some critical environmental concerns. In order to mitigate these environmental consequences, alternative oilseeds are being investigated as biodiesel feedstocks. Castor (Ricinus communis L.) is one of the most promising non-edible oil crops, due to its high annual seed production and yield, and since it can be grown on marginal land and in semi-arid climate. Still, few studies are available regarding its fuel-related properties in its pure form or as a blend with petrodiesel, many of which are due to its extremely high content of ricinoleic acid. In this study, the specifications in ASTM D6751 and D7467 which are related to the fatty acid composition of pure castor methyl esters (B100) and its blend with petrodiesel in a 10% vol ratio (B10) were investigated. Kinematic viscosity and distillation temperature of B100 (15.17 mm 2 s -1 and 398.7 o C respectively) were the only two properties which did not meet the appropriate standard limits. In contrast, B10 met all the specifications. Still, ASTM D7467 requires that the pure biodiesel meets the requirements of ASTM D6751. This can limit the use of a wide range of feedstocks, including castor, as alternative fuel, especially due to the fact that in practice vehicles normally use low level blends of biodiesel and petrodiesel. These issues are discussed in depth in the present study. -- Highlights: → CaME can be used as a biodiesel alternative feedstock when blended in petrodiesel. → Due to the high levels of ricinoleic acid maximum blending level is limited to 10%. → Today, CaME blends are not a viable alternative feedstock. → ASTM D7467 requires that pure biodiesel must meet all the appropriate limits.

  3. Distribution and chemical forms of copper in the root cells of castor seedlings and their tolerance to copper phytotoxicity in hydroponic culture.

    Science.gov (United States)

    Kang, Wei; Bao, Jianguo; Zheng, Jin; Hu, Hongqin; Du, Jiangkun

    2015-05-01

    The subcellular localization and chemical forms of copper in castor (Ricinus communis L.) seedlings grown in hydroponic nutrient solution were identified by chemical extraction, transmission electron microscopy, and Fourier transform infrared spectroscopy. The wild castor seeds were harvested from an abandoned copper mine in Tonglu Mountain, Daye City of Hubei Province, China. The results revealed that (1) the seedlings grew naturally in MS liquid medium with 40.00 mg kg(-1) CuSO4, in which the seedling growth rate and biomass index were 0.14 and 1.23, respectively, which were the highest values among all the treatments. The copper content in castor seedlings increased along with elevated CuSO4 concentration in the medium, reaching a maximum value of 16 570.12 mg kg(-1)(DW) when exposed to 60.00 mg L(-1) CuSO4, where 91.31% of the copper was accumulated in roots. (2) The copper existed in various chemical forms in the roots of the castor seedlings. Copper of 67.66% was extracted from the components of cell walls, such as exchangeable acidic polar compounds, cellulose and lignin, protein and pectin, and less concentrated in cell cytoplasm and nuclei. (3) Furthermore, the root cell walls were thickened when the castor seedlings exposed to CuSO4, with a large amount of high-density electron bodies, attached to the thickened cell walls. In the cell walls, most copper was bound to the carboxyl (-COOH) and hydroxyl (-OH) groups of acidic polar compounds, cellulose, hemicellulose, and polysaccharides. The conclusion showed that castor exhibited a strong tolerance to copper, the copper were accumulated mainly in the root cell, the root cell walls of castor were the major location of patience and detoxification in copper stress.

  4. Energetic potential of the vegetable oil of Canton Tosagua ricinus comunnis

    International Nuclear Information System (INIS)

    Brito Sauvanell, Angel Luis; Saltos Giler, Manuel; Lopez Vera, Mario Rene; Rodriguez Moreira, Marat

    2011-01-01

    The plantation of Higuerilla (Ricinus communis L.) can be considered as an alternative of high energy, economic and social importance for the climatic conditions of the Ecuador's coastal area, due to its easy cultivation, the resistance to the drought is being considered as a plant generator for rent and work for small farmers in the geography of Tosagua, Rocafuerte and other towns in the vicinity to Manabi province. The castor oil is a xerofila and heliofila plantation in other words , adapted to arid atmospheres and sun loving. The paper shows a characterization carried out to higuerilla seeds in the biotechnology laboratory of to the Polytechnic High School of Calceta (ESPAM). The seeds collected in different villages near Tosagua, let us estimate the energy potential of the Higuerilla plantation like energy source for the Manabi province. The industrialization of the product obtained from Higuerilla plantation would have as advantage the pure vegetable oil (PVO) as main by-product, besides it can obtain a cake rich in protein. The castor oil cake can be used to restore out lands; also, it contains products that can be used for the control of nematodes of the ground, due to the high toxicity that confers it toxic protein denominated ricine. (author)

  5. Histologic and immunohistochemical evaluation of biocompatibility of castor oil polyurethane polymer with calcium carbonate in equine bone tissue.

    Science.gov (United States)

    Nóbrega, Fernanda S; Selim, Mariana B; Arana-Chavez, Victor E; Correa, Luciana; Ferreira, Márcio P; Zoppa, André L V

    2017-10-01

    OBJECTIVE To evaluate the efficacy of castor oil polyurethane polymer with calcium carbonate for use in a unicortical ostectomy on the dorsal surface of the third metacarpal bone of horses. ANIMALS 6 adult horses. PROCEDURES A unicortical ostectomy was created on the dorsal surface of both third metacarpal bones of each horse. Castor bean (Ricinus communis) oil polyurethane polymer with calcium carbonate was implanted into the ostectomy on 1 limb, and the ostectomy of the contralateral limb was left unfilled and served as a control sample. Ostectomy sites were evaluated histologically 120 days later. Biopsy specimens were obtained from the interface of bone and polymer or the interface of bone and newly formed tissue; specimens were processed for histomorphometric evaluation by use of light microscopy, immunohistochemical analysis, histochemical analysis, and transmission electron microscopy. RESULTS Osteoconductive activity of the biomaterial was confirmed by the presence of osteoblasts in the biopsy specimens. Absence of a chronic inflammatory response or foreign body reaction indicated biocompatibility. Expression of osteoblast markers was detected in the newly formed tissue. CONCLUSIONS AND CLINICAL RELEVANCE Results indicated that castor oil polyurethane polymer with calcium carbonate could be an acceptable compound for use as a bone substitute in horses with fractures in which bone filling is necessary.

  6. Simultaneous allergen inactivation and detoxification of castor bean cake by treatment with calcium compounds.

    Science.gov (United States)

    Fernandes, K V; Deus-de-Oliveira, N; Godoy, M G; Guimarães, Z A S; Nascimento, V V; Melo, E J T de; Freire, D M G; Dansa-Petretski, M; Machado, O L T

    2012-11-01

    Ricinus communis L. is of great economic importance due to the oil extracted from its seeds. Castor oil has been used for pharmaceutical and industrial applications, as a lubricant or coating agent, as a component of plastic products, as a fungicide or in the synthesis of biodiesel fuels. After oil extraction, a castor cake with a large amount of protein is obtained. However, this by-product cannot be used as animal feed due to the presence of toxic (ricin) and allergenic (2S albumin) proteins. Here, we propose two processes for detoxification and allergen inactivation of the castor cake. In addition, we establish a biological test to detect ricin and validate these detoxification processes. In this test, Vero cells were treated with ricin, and cell death was assessed by cell counting and measurement of lactate dehydrogenase activity. The limit of detection of the Vero cell assay was 10 ng/mL using a concentration of 1.6 x 10(5) cells/well. Solid-state fermentation (SSF) and treatment with calcium compounds were used as cake detoxification processes. For SSF, Aspergillus niger was grown using a castor cake as a substrate, and this cake was analyzed after 24, 48, 72, and 96 h of SSF. Ricin was eliminated after 24 h of SSF treatment. The cake was treated with 4 or 8% Ca(OH)2 or CaO, and both the toxicity and the allergenic properties were entirely abolished. A by-product free of toxicity and allergens was obtained.

  7. Simultaneous allergen inactivation and detoxification of castor bean cake by treatment with calcium compounds

    Directory of Open Access Journals (Sweden)

    K.V. Fernandes

    2012-11-01

    Full Text Available Ricinus communis L. is of great economic importance due to the oil extracted from its seeds. Castor oil has been used for pharmaceutical and industrial applications, as a lubricant or coating agent, as a component of plastic products, as a fungicide or in the synthesis of biodiesel fuels. After oil extraction, a castor cake with a large amount of protein is obtained. However, this by-product cannot be used as animal feed due to the presence of toxic (ricin and allergenic (2S albumin proteins. Here, we propose two processes for detoxification and allergen inactivation of the castor cake. In addition, we establish a biological test to detect ricin and validate these detoxification processes. In this test, Vero cells were treated with ricin, and cell death was assessed by cell counting and measurement of lactate dehydrogenase activity. The limit of detection of the Vero cell assay was 10 ng/mL using a concentration of 1.6 x 10(5 cells/well. Solid-state fermentation (SSF and treatment with calcium compounds were used as cake detoxification processes. For SSF, Aspergillus niger was grown using a castor cake as a substrate, and this cake was analyzed after 24, 48, 72, and 96 h of SSF. Ricin was eliminated after 24 h of SSF treatment. The cake was treated with 4 or 8% Ca(OH2 or CaO, and both the toxicity and the allergenic properties were entirely abolished. A by-product free of toxicity and allergens was obtained.

  8. Simultaneous allergen inactivation and detoxification of castor bean cake by treatment with calcium compounds

    Energy Technology Data Exchange (ETDEWEB)

    Fernandes, K.V.; Deus-de-Oliveira, N. [Laboratório de Química e Função de Proteínas e Peptídeos, Centro de Biociências e Biotecnologia, Universidade Estadual do Norte Fluminense Darcy Ribeiro, Rio de Janeiro, RJ (Brazil); Godoy, M.G. [Laboratório de Biotecnologia Microbiana, Instituto de Química, Universidade Federal do Rio de Janeiro, Rio de Janeiro, RJ (Brazil); Guimarães, Z.A.S. [Laboratório de Biologia Celular e Tecidual, Centro de Biociências e Biotecnologia, Universidade Estadual do Norte Fluminense Darcy Ribeiro, Rio de Janeiro, RJ (Brazil); Nascimento, V.V. [Laboratório de Química e Função de Proteínas e Peptídeos, Centro de Biociências e Biotecnologia, Universidade Estadual do Norte Fluminense Darcy Ribeiro, Rio de Janeiro, RJ (Brazil); Melo, E.J.T. de [Laboratório de Biologia Celular e Tecidual, Centro de Biociências e Biotecnologia, Universidade Estadual do Norte Fluminense Darcy Ribeiro, Rio de Janeiro, RJ (Brazil); Freire, D.M.G. [Laboratório de Biotecnologia Microbiana, Instituto de Química, Universidade Federal do Rio de Janeiro, Rio de Janeiro, RJ (Brazil); Dansa-Petretski, M.; Machado, O.L.T. [Laboratório de Química e Função de Proteínas e Peptídeos, Centro de Biociências e Biotecnologia, Universidade Estadual do Norte Fluminense Darcy Ribeiro, Rio de Janeiro, RJ (Brazil)

    2012-08-24

    Ricinus communis L. is of great economic importance due to the oil extracted from its seeds. Castor oil has been used for pharmaceutical and industrial applications, as a lubricant or coating agent, as a component of plastic products, as a fungicide or in the synthesis of biodiesel fuels. After oil extraction, a castor cake with a large amount of protein is obtained. However, this by-product cannot be used as animal feed due to the presence of toxic (ricin) and allergenic (2S albumin) proteins. Here, we propose two processes for detoxification and allergen inactivation of the castor cake. In addition, we establish a biological test to detect ricin and validate these detoxification processes. In this test, Vero cells were treated with ricin, and cell death was assessed by cell counting and measurement of lactate dehydrogenase activity. The limit of detection of the Vero cell assay was 10 ng/mL using a concentration of 1.6 × 10{sup 5} cells/well. Solid-state fermentation (SSF) and treatment with calcium compounds were used as cake detoxification processes. For SSF, Aspergillus niger was grown using a castor cake as a substrate, and this cake was analyzed after 24, 48, 72, and 96 h of SSF. Ricin was eliminated after 24 h of SSF treatment. The cake was treated with 4 or 8% Ca(OH){sub 2} or CaO, and both the toxicity and the allergenic properties were entirely abolished. A by-product free of toxicity and allergens was obtained.

  9. Analysis of active ricin and castor bean proteins in a ricin preparation, castor bean extract, and surface swabs from a public health investigation.

    Science.gov (United States)

    Schieltz, David M; McGrath, Sara C; McWilliams, Lisa G; Rees, Jon; Bowen, Michael D; Kools, John J; Dauphin, Leslie A; Gomez-Saladin, Eduardo; Newton, Bruce N; Stang, Heather L; Vick, Michael J; Thomas, Jerry; Pirkle, James L; Barr, John R

    2011-06-15

    In late February 2008, law enforcement officials in Las Vegas, Nevada, discovered in a hotel room, a copy of The Anarchist Cookbook, suspected castor beans and a "white powder" thought to be a preparation of ricin. Ricin is a deadly toxin from the seed of the castor bean plant (Ricinus communis). The United States regulates the possession, use, and transfer of ricin and it is the only substance considered a warfare agent in both the Chemical and the Biological Weapons Conventions. Six samples obtained from the hotel room were analyzed by laboratories at the Centers for Disease Control and Prevention using a panel of biological and mass spectrometric assays. The biological assays (real time-PCR, time resolved fluorescence and cytotoxicity) provided presumptive evidence of active ricin in each of the samples. This initial screen was followed by an in-depth analysis using a novel, state-of-the-art mass spectrometry-based ricin functional assay and high sensitivity tandem mass spectrometry for protein identification. Mass spectrometric analysis positively identified ricin and confirmed that in each of the samples it was enzymatically active. The tandem mass spectrometry analysis used here is the most selective method available to detect ricin toxin. In each sample, ricin was unequivocally identified along with other R. communis plant proteins, including the highly homologous protein RCA120. Although database searches using tandem mass spectra acquired from the samples indicated that additional controlled substances were not present in these samples, the mass spectrometric results did provide extensive detail about the sample contents. To the best of our knowledge following a review of the available literature, this report describes the most detailed analysis of a white powder for a public health or forensic investigation involving ricin. Published by Elsevier Ireland Ltd.

  10. A novel xyloglucan film-based biosensor for toxicity assessment of ricin in castor seed meal.

    Science.gov (United States)

    Furtado, R F; Alves, C R; Moreira, A C O; Azevedo, R M; Dutra, R F

    2012-06-20

    Oil from the seed of the castor plant (Ricinus communis L.) is an important commodity for a number of industries, ranging from pharmaceuticals to renewable energy resources. However, the seed and subsequent seed meal contain ricin (RCA60), a potent cytotoxin, making it an unusable product for animal feed. In order to investigate the efficiency of reducing the toxicity of the seed meal, a biosensor is proposed by exploring the lectin-carbohydrate binding. A gold electrode was assembled with a film of Xyloglucan (XG) extracted from Hymenaea courbaril L. The analytical response to RCA60 was obtained using a polyclonal antibody against RCA60 conjugated to peroxidase. The current responses were generated by reaction with H2O2 and amplified with hydroquinone as chemical mediator. Voltammetric studies showed that the XG film was tightly bound to the gold electrode. This biosensor allows discriminate lectins in native and denatured forms. The limit of detection of native RCA60 was 2.1 μg mL(-1). This proposed biosensor showed to be a potential and accurate method for toxicity assessment of the ricin in castor seed meal by simple polysaccharide film-electrode strategy. Copyright © 2012. Published by Elsevier Ltd.

  11. Analysis of castor bean ribosome-inactivating proteins and their gene expression during seed development

    Directory of Open Access Journals (Sweden)

    Guilherme Loss-Morais

    2013-01-01

    Full Text Available Ribosome-inactivating proteins (RIPs are enzymes that inhibit protein synthesis after depurination of a specific adenine in rRNA. The RIP family members are classified as type I RIPs that contain an RNA-N-glycosidase domain and type II RIPs that contain a lectin domain (B chain in addition to the glycosidase domain (A chain. In this work, we identified 30 new plant RIPs and characterized 18 Ricinus communis RIPs. Phylogenetic and functional divergence analyses indicated that the emergence of type I and II RIPs probably occurred before the monocot/eudicot split. We also report the expression profiles of 18 castor bean genes, including those for ricin and agglutinin, in five seed stages as assessed by quantitative PCR. Ricin and agglutinin were the most expressed RIPs in developing seeds although eight other RIPs were also expressed. All of the RIP genes were most highly expressed in the stages in which the endosperm was fully expanded. Although the reason for the large expansion of RIP genes in castor beans remains to be established, the differential expression patterns of the type I and type II members reinforce the existence of biological functions other than defense against predators and herbivory.

  12. SOIL EXCHANGEABLE ALUMINUM INFLUENCING THE GROWTH AND LEAF TISSUE MACRONUTRIENTS CONTENT OF CASTOR PLANTS

    Directory of Open Access Journals (Sweden)

    ROSIANE DE LOURDES SILVA DE LIMA

    2014-01-01

    Full Text Available Three castor ( Ricinus communis genotypes were studied regarding tolerance to high exchange factorial distribution of five doses of exchangeable aluminum added to the soil (0, 0.15, 0.30, 0.60, and 1.20 cmol c dm - 3 and three castor genotypes (BRS Nordestina, BRS Paraguaçu, and Lyra. The plants were raised in pots in a greenhouse. At 53 days after emergence, data were taken on plant height, leaf area, dry mass of shoot and root, and leaf tissue content of macronutrients. The most sensitive genotype was the cv. BRS Nordestina, in which the shoot and root dry weight in the highest aluminum content were reduced to 12.9% and 16.2% of the control treatment, respectively. The most tolerant genotype was the hybrid Lyra, in which the shoot and root dry weight in the maximum content of aluminum were reduced to 43.5% and 42.7% of the control treatment, respectively.The increased exchangeable aluminum affected the leaf nutrient content, and the intensity of the response was different among cultivars. The aluminum toxicity increased N, Ca, and Mg contents and reduced on P, K, and S contents. The cv. BRS Nordestina had a drastic shoot dry weight reduction associated with an intense increment in the N leaf content. Thus, the N increment was caused by a concentration effect caused by the limited growth.

  13. Morphology and viability of castor bean genotypes pollen grains

    Directory of Open Access Journals (Sweden)

    Maria Selma Alves Silva Diamantino

    2016-01-01

    Full Text Available The objective of this work was to characterize the morphology and viability of the pollen of 15 genotypes of castor bean (Ricinus communis L. and to generate information that can assist in the selection of highly promising male parents for future use in genetic improvement programs aimed at producing seeds for oil extraction. Acetolysis and scanning electron microscopy was used to characterize the morphology of the pollen. The viability of the pollen grains was estimated by in vitro germination and colorimetric analysis (acetocarmine 2% and 2, 3, 5-triphenyltetrazolium chloride 1%. For the in vitro germination, pollen grains were grown in 10 types of solidified culture medium consisting of different concentrations of sucrose, boric acid, calcium nitrate, magnesium sulfate and potassium nitrate. The pollen grains had the following characteristics: medium size, isopolar and subspheroidal shape, radial symmetry, circular ambit, 3-colporate, elongated endoapertures, tectate exine and granulated sexine. The acetocarmine dye overestimated pollen viability. The media M5 and M8 were the most efficient at promoting the germination of pollen grains. The studied genotypes had high levels of viability and can therefore be used as male parents in genetic improvement programs.

  14. Identification and functional expression of a type 2 acyl-CoA:diacylglycerol acyltransferase (DGAT2) in developing castor bean seeds which has high homology to the major triglyceride biosynthetic enzyme of fungi and animals.

    Science.gov (United States)

    Kroon, Johan T M; Wei, Wenxue; Simon, William J; Slabas, Antoni R

    2006-12-01

    Seed oil from castor bean (Ricinus communis) contains high amounts of hydroxy fatty acid rich triacylglycerols (TAGs) that can serve as raw material for production of bio-based products such as nylon, cosmetics, lubricants, foams, and surfactants. Diacylglycerol acyltransferase (DGAT) catalyses the terminal reaction in the acyl-CoA dependent Kennedy pathway of triglyceride biosynthesis. There is still some debate whether there are three or four enzymes in yeast that have DGAT activity and catalyse the synthesis of TAG but of these the DGAT2 homologue Dga1 contributes in a major way to TAG biosynthesis. Here we report on the cloning of a cDNA for DGAT2 from castor bean and prove its biological activity following expression in yeast and enzymatic assays using diricinolein as the acceptor and ricinoleoyl-CoA as the donor. Previous reports of DGAT in castor have focussed on DGAT1 which has little amino acid sequence homology to DGAT2. Expressional studies demonstrate that DGAT2 is 18-fold more highly expressed in seeds than in leaves and shows temporal specific expression during seed development. In contrast, DGAT1 shows little difference in expression in seeds versus leaves. We conclude that in castor bean DGAT2 is more likely to play a major role in seed TAG biosynthesis than DGAT1.

  15. Crioconservação de sementes de mamona das variedades nordestina e pernambucana Cryoconservation of nordestina and pernambucana varieties of castor bean seeds

    Directory of Open Access Journals (Sweden)

    Francisco de A. C. Almeida

    2002-01-01

    Full Text Available É grande a importância da mamoneira (Ricinus communis L. para a economia do semi-árido nordestino, que é responsável por 80% da produção nacional, no entanto durante 1970 e 2000, a produção líquida dessa oleaginosa foi reduzida na mesma percentagem. Registrou-se também a existência de aproximadamente 90 tipos diferentes de sementes empregadas no cultivo desta Euforbiaceae. Devido a este problema, o trabalho desenvolvido no Laboratório de Processamento e Armazenamento de Produtos Agrícolas do DEAg/UFPB, objetivou desenvolver técnicas de crioconservação para duas variedades de Ricinus communis, com vistas a uma armazenagem segura e por tempo indefinido. O delineamento experimental utilizado foi o inteiramente casualizado, com os dados obtidos nos 7º e 14º dias depois da semeadura, dispostos em um arranjo fatorial 2 x 3 x 2 x 2 (duas variedades, três períodos de crioconservação, duas temperaturas de crioconservação e dois tipos de acondicionamento com oito repetições de vinte e cinco sementes cada uma. Os dados obtidos foram submetidos à análise de variância e as médias dos fatores qualitativos comparadas pelo teste de Tukey, a 5% de probabilidade. Com os resultados obtidos concluiu-se que: o nível máximo de umidade para a crioconservação das sementes das duas variedades de Ricinus communis (nordestina e pernambucana encontra-se entre 4 e 10% base úmida; os melhores resultados de qualidade fisiológica foram obtidos aos 30 dias da crioconservação, podendo essas sementes serem crioconservadas tanto no vapor (-176 ºC como na imersão (-196 ºC em nitrogênio líquido; o canister de alumínio utilizado para acondicionar as sementes mostrou-se superior ao de PVC.The castor bean (Ricinus communis L. has great importance for the economy of the semi-arid region of the northeast of Brazil, responsible for 80% of the national production, but during 1970 and 2000, the net production of this oil crop was reduced

  16. Computational identification and phylogenetic analysis of the oil-body structural proteins, oleosin and caleosin, in castor bean and flax.

    Science.gov (United States)

    Hyun, Tae Kyung; Kumar, Dhinesh; Cho, Young-Yeol; Hyun, Hae-Nam; Kim, Ju-Sung

    2013-02-25

    Oil bodies (OBs) are the intracellular particles derived from oilseeds. These OBs store lipids as a carbon resource, and have been exploited for a variety of industrial applications including biofuels. Oleosin and caleosin are the common OB structural proteins which are enabling biotechnological enhancement of oil content and OB-based pharmaceutical formations via stabilizing OBs. Although the draft whole genome sequence information for Ricinus communis L. (castor bean) and Linum usitatissimum L. (flax), important oil seed plants, is available in public database, OB-structural proteins in these plants are poorly indentified. Therefore, in this study, we performed a comprehensive bioinformatic analysis including analysis of the genome sequence, conserved domains and phylogenetic relationships to identify OB structural proteins in castor bean and flax genomes. Using comprehensive analysis, we have identified 6 and 15 OB-structural proteins from castor bean and flax, respectively. A complete overview of this gene family in castor bean and flax is presented, including the gene structures, phylogeny and conserved motifs, resulting in the presence of central hydrophobic regions with proline knot motif, providing an evolutionary proof that this central hydrophobic region had evolved from duplications in the primitive eukaryotes. In addition, expression analysis of L-oleosin and caleosin genes using quantitative real-time PCR demonstrated that seed contained their maximum expression, except that RcCLO-1 expressed maximum in cotyledon. Thus, our comparative genomics analysis of oleosin and caleosin genes and their putatively encoded proteins in two non-model plant species provides insights into the prospective usage of gene resources for improving OB-stability. Copyright © 2012 Elsevier B.V. All rights reserved.

  17. Fractional characterisation of jatropha, neem, moringa, trisperma, castor and candlenut seeds as potential feedstocks for biodiesel production in Cuba

    Energy Technology Data Exchange (ETDEWEB)

    Martin, Carlos [Bioresource Technology group, Department of Chemistry and Chemical Engineering, University of Matanzas, Autopista a Varadero, km 3, Matanzas 44740 (Cuba); Department of Chemical Engineering, University of Vigo (Campus Ourense), Polytechnical Building, As Lagoas, 32004 Ourense (Spain); Moure, Andres; Dominguez, Herminia; Parajo, Juan C. [Department of Chemical Engineering, University of Vigo (Campus Ourense), Polytechnical Building, As Lagoas, 32004 Ourense (Spain); Martin, Giraldo [Experimental Station of Pastures and Forages ' ' Indio Hatuey' ' , Central Espana Republicana, CP 44280, Matanzas (Cuba); Carrillo, Eugenio [Biomass Energy Department, National Renewable Energy Centre (CENER), Ciudad de la Innovacion 4, Sarriguren, 31621 Pamplona (Spain)

    2010-04-15

    A preliminary investigation on the suitability of various non-edible oil seeds for the integral utilisation of their fractions for production of biodiesel and other products was carried out. The oil seeds considered were jatropha (Jatropha curcas), neem (Azadirachta indica), moringa (Moringa oleifera), trisperma (Aleurites trisperma), castor beans (Ricinus communis) and candlenut (Aleurites moluccana). The highest oil content (62.0% (w/w)) was found in trisperma seeds, but the use of that oil for biodiesel production is restricted by its high content of polyunsaturated fatty acids. The oils of castor beans and moringa contained 86.0% of ricinoleic acid and 70.6% of oleic acid, respectively, while in the oils from the other seeds no predominance of any acid was observed. According to the oil yield and to the fatty acid composition of the oil, jatropha was identified as the most promising oil seed for biodiesel production in Cuba. All the press cakes were rich in protein, the highest content (68.6%) being detected in moringa cake. The investigation revealed that the husks of neem and moringa can be considered potential substrates for ethanol production due to their high cellulose content (approximately 30%). A high concentration (4.3%) of acetyl groups was found in neem husks, what is favourable for the hydrolytic conversion of polysaccharides to simple sugars. A high protein content (15.2%) was detected in moringa husks, which is a positive feature for lowering the cost of nutrient supplementation in ethanolic fermentation. (author)

  18. Genome-wide comparative analysis of papain-like cysteine protease family genes in castor bean and physic nut.

    Science.gov (United States)

    Zou, Zhi; Huang, Qixing; Xie, Guishui; Yang, Lifu

    2018-01-10

    Papain-like cysteine proteases (PLCPs) are a class of proteolytic enzymes involved in many plant processes. Compared with the extensive research in Arabidopsis thaliana, little is known in castor bean (Ricinus communis) and physic nut (Jatropha curcas), two Euphorbiaceous plants without any recent whole-genome duplication. In this study, a total of 26 or 23 PLCP genes were identified from the genomes of castor bean and physic nut respectively, which can be divided into nine subfamilies based on the phylogenetic analysis: RD21, CEP, XCP, XBCP3, THI, SAG12, RD19, ALP and CTB. Although most of them harbor orthologs in Arabidopsis, several members in subfamilies RD21, CEP, XBCP3 and SAG12 form new groups or subgroups as observed in other species, suggesting specific gene loss occurred in Arabidopsis. Recent gene duplicates were also identified in these two species, but they are limited to the SAG12 subfamily and were all derived from local duplication. Expression profiling revealed diverse patterns of different family members over various tissues. Furthermore, the evolution characteristics of PLCP genes were also compared and discussed. Our findings provide a useful reference to characterize PLCP genes and investigate the family evolution in Euphorbiaceae and species beyond.

  19. Building Supply Systems from Scratch: The Case of the Castor Bean for Biodiesel Chain in Minas Gerais, Brazil

    Directory of Open Access Journals (Sweden)

    Kassia Watanabe

    2012-12-01

    Full Text Available The present study contributes to identifying obstacles to the development of a local biodiesel agro-industrial system (AGS in the state of Minas Gerais, Brazil. The research questions are: “How do local social characteristics influence the organizational effectiveness of agents involved in the joint production effort?”; and “How can the institutional arrangement of biodiesel production be described?” The method adopted is the case study, focused on family farmers served by the Family Farmers Rural Extension and Technical Assistance Company (EMATER. This state organization introduced castor beans (Ricinus communis L. to family farmers as an alternative crop to supply a processing plant (Darcy Ribeiro Biodiesel Plant—DRBP in northern Minas Gerais state, Brazil. These family farmers are not horizontally organized, and sign individual contracts with DRBP. The paper concludes that the primary obstacle to developing the biodiesel AGS with castor beans in Minas Gerais is the lack of horizontal organization among family farmers.

  20. Ectopic overexpression of castor bean LEAFY COTYLEDON2 (LEC2) in Arabidopsis triggers the expression of genes that encode regulators of seed maturation and oil body proteins in vegetative tissues.

    Science.gov (United States)

    Kim, Hyun Uk; Jung, Su-Jin; Lee, Kyeong-Ryeol; Kim, Eun Ha; Lee, Sang-Min; Roh, Kyung Hee; Kim, Jong-Bum

    2013-01-01

    The LEAFY COTYLEDON2 (LEC2) gene plays critically important regulatory roles during both early and late embryonic development. Here, we report the identification of the LEC2 gene from the castor bean plant (Ricinus communis), and characterize the effects of its overexpression on gene regulation and lipid metabolism in transgenic Arabidopsis plants. LEC2 exists as a single-copy gene in castor bean, is expressed predominantly in embryos, and encodes a protein with a conserved B3 domain, but different N- and C-terminal domains to those found in LEC2 from Arabidopsis. Ectopic overexpression of LEC2 from castor bean under the control of the cauliflower mosaic virus (CaMV) 35S promoter in Arabidopsis plants induces the accumulation of transcripts that encodes five major transcription factors (the LEAFY COTYLEDON1 (LEC1), LEAFY COTYLEDON1-LIKE (L1L), FUSCA3 (FUS3), and ABSCISIC ACID INSENSITIVE 3 (ABI3) transcripts for seed maturation, and WRINKELED1 (WRI1) transcripts for fatty acid biosynthesis), as well as OLEOSIN transcripts for the formation of oil bodies in vegetative tissues. Transgenic Arabidopsis plants that express the LEC2 gene from castor bean show a range of dose-dependent morphological phenotypes and effects on the expression of LEC2-regulated genes during seedling establishment and vegetative growth. Expression of castor bean LEC2 in Arabidopsis increased the expression of fatty acid elongase 1 (FAE1) and induced the accumulation of triacylglycerols, especially those containing the seed-specific fatty acid, eicosenoic acid (20:1(Δ11)), in vegetative tissues.

  1. Ectopic overexpression of castor bean LEAFY COTYLEDON2 (LEC2) in Arabidopsis triggers the expression of genes that encode regulators of seed maturation and oil body proteins in vegetative tissues☆

    Science.gov (United States)

    Kim, Hyun Uk; Jung, Su-Jin; Lee, Kyeong-Ryeol; Kim, Eun Ha; Lee, Sang-Min; Roh, Kyung Hee; Kim, Jong-Bum

    2013-01-01

    The LEAFY COTYLEDON2 (LEC2) gene plays critically important regulatory roles during both early and late embryonic development. Here, we report the identification of the LEC2 gene from the castor bean plant (Ricinus communis), and characterize the effects of its overexpression on gene regulation and lipid metabolism in transgenic Arabidopsis plants. LEC2 exists as a single-copy gene in castor bean, is expressed predominantly in embryos, and encodes a protein with a conserved B3 domain, but different N- and C-terminal domains to those found in LEC2 from Arabidopsis. Ectopic overexpression of LEC2 from castor bean under the control of the cauliflower mosaic virus (CaMV) 35S promoter in Arabidopsis plants induces the accumulation of transcripts that encodes five major transcription factors (the LEAFY COTYLEDON1 (LEC1), LEAFY COTYLEDON1-LIKE (L1L), FUSCA3 (FUS3), and ABSCISIC ACID INSENSITIVE 3 (ABI3) transcripts for seed maturation, and WRINKELED1 (WRI1) transcripts for fatty acid biosynthesis), as well as OLEOSIN transcripts for the formation of oil bodies in vegetative tissues. Transgenic Arabidopsis plants that express the LEC2 gene from castor bean show a range of dose-dependent morphological phenotypes and effects on the expression of LEC2-regulated genes during seedling establishment and vegetative growth. Expression of castor bean LEC2 in Arabidopsis increased the expression of fatty acid elongase 1 (FAE1) and induced the accumulation of triacylglycerols, especially those containing the seed-specific fatty acid, eicosenoic acid (20:1Δ11), in vegetative tissues. PMID:24363987

  2. Inheritance of Plant Height in two Ethiopian Castor Varieties

    African Journals Online (AJOL)

    The green revolution in Asia was led by the semi dwarf varieties of wheat and rice during the 1960s. Nowadays ... Castor (Racinnus communis L.) is an industrial non edible oil seed that originated in East. Africa probably Ethiopia ... At the fourth generation single plants from each inbred line were reciprocally crossed to ...

  3. Bayesian integration of isotope ratio for geographic sourcing of castor beans.

    Science.gov (United States)

    Webb-Robertson, Bobbie-Jo; Kreuzer, Helen; Hart, Garret; Ehleringer, James; West, Jason; Gill, Gary; Duckworth, Douglas

    2012-01-01

    Recent years have seen an increase in the forensic interest associated with the poison ricin, which is extracted from the seeds of the Ricinus communis plant. Both light element (C, N, O, and H) and strontium (Sr) isotope ratios have previously been used to associate organic material with geographic regions of origin. We present a Bayesian integration methodology that can more accurately predict the region of origin for a castor bean than individual models developed independently for light element stable isotopes or Sr isotope ratios. Our results demonstrate a clear improvement in the ability to correctly classify regions based on the integrated model with a class accuracy of 60.9 ± 2.1% versus 55.9 ± 2.1% and 40.2 ± 1.8% for the light element and strontium (Sr) isotope ratios, respectively. In addition, we show graphically the strengths and weaknesses of each dataset in respect to class prediction and how the integration of these datasets strengthens the overall model.

  4. Castor oil polymer induces bone formation with high matrix metalloproteinase-2 expression.

    Science.gov (United States)

    Saran, Wallace Rocha; Chierice, Gilberto Orivaldo; da Silva, Raquel Assed Bezerra; de Queiroz, Alexandra Mussolino; Paula-Silva, Francisco Wanderley Garcia; da Silva, Léa Assed Bezerra

    2014-02-01

    The aim of this study was to evaluate the modulation of matrix metalloproteinase-2 (MMP-2) and -9 (MMP-9) expression in newly formed bone tissue at the interface between implants derived from castor oil (Ricinus communis) polymer and the tibia medullary canal. Forty-four rabbits were assigned to either Group 1 (n = 12; control) or Group 2 (n = 30), which had the tibial medullary canals reamed bilaterally and filled with polymer. CT scans showed no space between the material surface and the bone at the implant/bone marrow interface, and the density of the tissues at this interface was similar to the density measured of other regions of the bone. At 90 days postimplantation, the interface with the polymer presented a thick layer of newly formed bone tissue rich in osteocytes. This tissue exhibited ongoing maturation at 120 and 150 days postimplantation. Overall, bone remodeling process was accompanied by positive modulation of MMP-2 and low MMP-9 expression. Differently, in control group, the internal surface close to the medullary canal was lined by osteoblasts, followed by a bone tissue zone with few lacunae filled with osteocytes. Maturation of the tissue of the medullary internal surface occurred in the inner region, with the bone being nonlamellar. © 2013 Wiley Periodicals, Inc.

  5. Bayesian Integration of Isotope Ratio for Geographic Sourcing of Castor Beans

    Directory of Open Access Journals (Sweden)

    Bobbie-Jo Webb-Robertson

    2012-01-01

    Full Text Available Recent years have seen an increase in the forensic interest associated with the poison ricin, which is extracted from the seeds of the Ricinus communis plant. Both light element (C, N, O, and H and strontium (Sr isotope ratios have previously been used to associate organic material with geographic regions of origin. We present a Bayesian integration methodology that can more accurately predict the region of origin for a castor bean than individual models developed independently for light element stable isotopes or Sr isotope ratios. Our results demonstrate a clear improvement in the ability to correctly classify regions based on the integrated model with a class accuracy of 60.9±2.1% versus 55.9±2.1% and 40.2±1.8% for the light element and strontium (Sr isotope ratios, respectively. In addition, we show graphically the strengths and weaknesses of each dataset in respect to class prediction and how the integration of these datasets strengthens the overall model.

  6. Defining carbohydrate specificity of Ricinus communis agglutinin as Gal beta 1-->4GlcNAc (II) > Gal beta 1-->3GlcNAc (I) > Gal alpha 1-->3Gal (B) > Gal beta 1-->3GalNAc (T).

    Science.gov (United States)

    Wu, J H; Herp, A; Wu, A M

    1993-03-01

    To define carbohydrate specificity of Ricinus communis agglutinin (RCA1), the combining site of RCA1 was further characterized by quantitative precipitin (QPA) and precipitin-inhibition assays (QPIA). Among the oligosaccharides tested for QPIA, Gal beta 1-->4GlcNAc (II, human blood group type II precursor sequence) was found to be 7.1 times more active than Gal beta 1-->3GalNAc (T, Thomsen-Friedenreich sequence) and about 1.7 times more active than the other three disaccharides tested--Gal beta 1-->4Man, Gal beta 1-->3DAra and Gal beta 1-->6GalNAc. Gal alpha 1-->4Gal, the receptor of the uropathogenic E. coli ligand was 3.6 times less active than the II sequence. These results indicate that the beta 1-->4 linkage of the terminal Gal to subterminal GlcNAc is important as this beta 1-->4GlcNAc sequence is at least 1.6 times more active than other types of disaccharides. Among the glycoproteins examined for QPA, native and desialized bovine submandibular glycoproteins, native and desialized human plasma alpha 1-acid glycoproteins, as well as crude hog stomach mucin and its three mild acid hydrolyzed products reacted well with the lectin. These glycoproteins precipitated over 75% of the lectin nitrogen added indicating that RCA1 has the ability to recognize Gal beta 1-->4/3GlcNAc and/or the related residues at the non-reducing ends and at positions in the interior of the chains. However, Tn (GalNAc alpha 1-->Ser/Thr sequence) rich glycoproteins such as desialized ovine submandibular glycoprotein and desialized armadillo salivary glycoprotein, in which over 90% of the carbohydrate side chains are Tn determinants with none or only a trace of I/II or T determinants, precipitated poorly with RCA1. From the present and previous results obtained, the carbohydrate specificity of RCA1 can be constructed and summarized in decreasing order by lectin determinants as follows: II (Gal beta 1-->4GlcNAc) > I (Gal beta 1-->3GlcNAc) > E (Gal alpha 1-->4Gal) and B (Gal alpha 1-->3Gal

  7. Criblage in vitro des graines d'accessions locales de ricin ( Ricinus ...

    African Journals Online (AJOL)

    Le ricin (Ricinus communis L.) est une plante peu exigeante dont la culture offre d'énormes potentialités économiques pour les exploitants agricoles sénégalais. L'identification de génotypes performants avec des rendements acceptables en conditions de stress salin constitue une des solutions pour promouvoir cette ...

  8. Performance and Emission Characteristics of a Compression Ignition Engine Operating on Blends of Castor Oil Biodiesel-Diesel

    Science.gov (United States)

    Kanwar, Roopesh; Sharma, Pushpendra Kumar; Singh, Aditya Narayan; Agrawal, Yadvendra Kumar

    2017-04-01

    Diesel vehicles are the nerves and veins of transportation, particularly in developing countries. With the rapid rate of modernization, increasing demand of fuel is inevitable. The exponential increase in fuel prices and the scarcity of its supply from the environment have promoted interest in the development of alternative sources of fuel. In this work, genus Ricinus communis L. was studied in order to delimit their potential as a raw material for biodiesel production. Further, castor oil, ethyl ester were prepared by transesterification using potassium hydroxide (KOH) as a catalyst and tested on a four-stroke, single-cylinder compression ignition engine. The test was carried out at a constant speed of 3000 rpm at different loads. The results represent a substantial decrease in carbon monoxide (CO) emission with an increasing biodiesel percentage. The reduction of CO in B05, B10, B15 and B20 averaged 11.75, 22.02, 24.23 and 28.79 %, respectively, compared to mineral diesel. The emission results of the comparative test indicated that CO, oxygen (O2) and smoke density emissions are found to be lower when the engine is filled with B05, B10, B15 and B20 as compared to mineral diesel, while carbon dioxide (CO2) and nitrogen oxide (NOx) with B05, B10, B15 and B20 are found to increase marginally. Brake thermal efficiency and brake specific fuel consumption decrease and increase respectively in biodiesel with different blends in comparison of mineral diesel.

  9. Propolis or cashew and castor oils effects on composition of Longissimus muscle of crossbred bulls finished in feedlot

    Directory of Open Access Journals (Sweden)

    Maribel Velandia Valero

    2014-12-01

    Full Text Available The natural additive products (propolis or essential oils, in replacing antibiotics, could be used as an alternative for feed strategies to improve animal production. This work was performed to evaluate the effect of natural additives as propolis or essential oils on meat quality of crossbred (Aberdeen Angus vs. Nellore bulls. Thirty bulls were kept in feedlot (individual pen for 55 d and randomly assigned to one of three diets (n = 10: control (CON, propolis (PRO, or essential oils (OIL. CON diet consists of corn silage (45% DM and concentrate (cracked corn, soybean meal, glycerin, limestone, and mineral salt, 55% DM. The PRO group received same CON diet plus 3 g animal-1 d-1 of propolis premix added to the concentrate. The OIL group received same CON diet and 3 g animal-1 d-1 of a premix (cashew Anacardium occidentale L. and castor Ricinus communis L. oils added to the concentrate. Fat thickness (5.0 mm, pH (5.9, Longissimus muscle area 58.0 cm², marbling, texture, color (L* = 36.6, a* = 17.3, and b* = 5.9, lipid oxidation (0.08 malonaldehyde kg-1 meat, and Warner-Bratzler shear force (3.3 kg were unaffected by the diet. PRO and OIL diets had no effect neither on moisture (73.7%, ashes (1.1%, protein (23.8%, and lipids (1.7%, fatty acid composition or polyunsaturated/saturated fatty acid (PUFA/ SFA, 0.13, and n-6/n-3 ratio (6.9 on Longissimus muscle. Addition of natural additives as propolis extract or cashew and castor oils in the diet of bulls when they are finished in a feedlot did not change meat qualities.

  10. Three flavonol glycosides from Ricinus communis | Aqil | Bulletin of ...

    African Journals Online (AJOL)

    The PDF file you selected should load here if your Web browser has a PDF reader plug-in installed (for example, a recent version of Adobe Acrobat Reader). If you would like more information about how to print, save, and work with PDFs, Highwire Press provides a helpful Frequently Asked Questions about PDFs.

  11. The Effect Of Ricinus Communis Variety Minor On Reproductive ...

    African Journals Online (AJOL)

    Thee estrous cycle of the rats were distorted. Furthermore, this seed extract induced changes in the ovarian and uterine histology, which may be due partly to alteration in the estrogen/ progesterone balance, as well as direct effect on these reproductive organs. Hematological indices were not affected in women volunteers ...

  12. Produtividade da mamona irrigada com esgoto doméstico tratado Productivity of castor bean irrigated with treated domestic sewage

    Directory of Open Access Journals (Sweden)

    Neyliane C. de Souza

    2010-05-01

    Full Text Available A mamoneira (Ricinus communis L., oleaginosa de relevante importância econômica e social no Nordeste, apresenta-se como alternativa para a produção do biodiesel. O experimento objetivou avaliar, em escala real, os aspectos produtivos da cultura da mamona irrigada com esgoto doméstico tratado. Empregou-se o sistema de microaspersão; a delimitação experimental foi de quatro repetições e quatro tratamentos: T1: água do poço e adubação recomendada; T2: esgoto doméstico tratado e adubação recomendada; T3: somente esgoto doméstico tratado e T4: esgoto doméstico tratado e metade da adubação recomendada. Verificou-se que as unidades irrigadas com esgoto tratado superaram as irrigadas com água, em quase todas as variáveis analisadas. A produtividade foi maior nos tratamentos irrigados com esgoto e adubação (T2 e (T4, alcançando produtividade de 1.986 e 1.412 kg ha-1, respectivamente. O teor de óleo contido nas sementes foi analisado e não apresentou nenhuma diferença significativa entre os tratamentos com adubação (T1, T2 e T4, sendo que o tratamento com esgoto tratado (T3 forneceu baixíssimos teores de óleo na semente.The castor bean (Ricinus communis L., an oil crop of economic and social importance for the Northeast region of Brazil, can be used for biodiesel production. The experiment aimed to evaluate, at a realistic scale, the productive aspects of the castor bean irrigated with treated sewage. Microsprinkler irrigation method was selected, and the experimental set-up consisted of four repetitions and four different treatments: well water and recommended fertilization (T1; treated wastewater and recommended fertilization (T2; treated wastewater without external recommended fertilization (T3; and treated wastewater and half of recommended fertilization (T4. It was found that units irrigated with treated sewage exceeded the ones irrigated with well water in almost all variables. The highest productivities were in the

  13. Genomic DNA Methylation Analyses Reveal the Distinct Profiles in Castor Bean Seeds with Persistent Endosperms1

    Science.gov (United States)

    Yang, Tianquan; Dong, Xue; Li, De-Zhu

    2016-01-01

    Investigations of genomic DNA methylation in seeds have been restricted to a few model plants. The endosperm genomic DNA hypomethylation has been identified in angiosperm, but it is difficult to dissect the mechanism of how this hypomethylation is established and maintained because endosperm is ephemeral and disappears with seed development in most dicots. Castor bean (Ricinus communis), unlike Arabidopsis (Arabidopsis thaliana), endosperm is persistent throughout seed development, providing an excellent model in which to dissect the mechanism of endosperm genomic hypomethylation in dicots. We characterized the DNA methylation-related genes encoding DNA methyltransferases and demethylases and analyzed their expression profiles in different tissues. We examined genomic methylation including CG, CHG, and CHH contexts in endosperm and embryo tissues using bisulfite sequencing and revealed that the CHH methylation extent in endosperm and embryo was, unexpectedly, substantially higher than in previously studied plants, irrespective of the CHH percentage in their genomes. In particular, we found that the endosperm exhibited a global reduction in CG and CHG methylation extents relative to the embryo, markedly switching global gene expression. However, CHH methylation occurring in endosperm did not exhibit a significant reduction. Combining with the expression of 24-nucleotide small interfering RNAs (siRNAs) mapped within transposable element (TE) regions and genes involved in the RNA-directed DNA methylation pathway, we demonstrate that the 24-nucleotide siRNAs played a critical role in maintaining CHH methylation and repressing the activation of TEs in persistent endosperm development. This study discovered a novel genomic DNA methylation pattern and proposes the potential mechanism occurring in dicot seeds with persistent endosperm. PMID:27208275

  14. Pyrolysis of Waste Castor Seed Cake: A Thermo-Kinetics Study

    Directory of Open Access Journals (Sweden)

    Abdullahi Muhammad Sokoto

    2018-03-01

    Full Text Available Biomass pyrolysis is a thermo-chemical conversion process that is of both industrial and ecological importance. The efficient chemical transformation of waste biomass to numerous products via pyrolysis reactions depends on process kinetic rates; hence the need for kinetic models to best design and operate the pyrolysis. Also, for an efficient design of an environmentally sustainable pyrolysis process of a specific lignocellulosic waste, a proper understanding of its thermo-kinetic behavior is imperative. Thus, pyrolysis kinetics of castor seed de-oiled cake (Ricinus communis using thermogravimetric technique was studied. The decomposition of the cake was carried out in a nitrogen atmosphere with a flow rate of 100mL min-1 from ambient temperature to 900 °C. The results of the thermal profile showed moisture removal and devolatilization stages, and maximum decomposition of the cake occurred at a temperature of 200-400 °C. The kinetic parameters such as apparent activation energy, pre-exponential factor, and order of reaction were determined using Friedman (FD, Kissinger-Akahira-Sunose (KAS, and Flynn-Wall-Ozawa (FWO kinetic models. The average apparent activation energy values of 124.61, 126.95 and 129.80 kJmol-1 were calculated from the slopes of the respective models. The apparent activation energy values obtained depends on conversion, which is an evidence of multi-step kinetic process during the pyrolytic decomposition of the cake. The kinetic data would be of immense benefit to model, design and develop a suitable thermo-chemical system for the conversion of waste de-oil cake to energy carrier.

  15. Regulatory Phosphorylation of Bacterial-Type PEP Carboxylase by the Ca2+-Dependent Protein Kinase RcCDPK1 in Developing Castor Oil Seeds.

    Science.gov (United States)

    Ying, Sheng; Hill, Allyson T; Pyc, Michal; Anderson, Erin M; Snedden, Wayne A; Mullen, Robert T; She, Yi-Min; Plaxton, William C

    2017-06-01

    Phosphoenolpyruvate carboxylase (PEPC) is a tightly controlled cytosolic enzyme situated at a crucial branch point of central plant metabolism. In developing castor oil seeds ( Ricinus communis ) a novel, allosterically desensitized 910-kD Class-2 PEPC hetero-octameric complex, arises from a tight interaction between 107-kD plant-type PEPC and 118-kD bacterial-type (BTPC) subunits. The native Ca 2+ -dependent protein kinase (CDPK) responsible for in vivo inhibitory phosphorylation of Class-2 PEPC's BTPC subunit's at Ser-451 was highly purified from COS and identified as RcCDPK1 (XP_002526815) by mass spectrometry. Heterologously expressed RcCDPK1 catalyzed Ca 2+ -dependent, inhibitory phosphorylation of BTPC at Ser-451 while exhibiting: ( i ) a pair of Ca 2+ binding sites with identical dissociation constants of 5.03 μM, ( ii ) a Ca 2+ -dependent electrophoretic mobility shift, and ( iii ) a marked Ca 2+ -independent hydrophobicity. Pull-down experiments established the Ca 2+ -dependent interaction of N-terminal GST-tagged RcCDPK1 with BTPC. RcCDPK1-Cherry localized to the cytosol and nucleus of tobacco bright yellow-2 cells, but colocalized with mitochondrial-surface associated BTPC-enhanced yellow fluorescent protein when both fusion proteins were coexpressed. Deletion analyses demonstrated that although its N-terminal variable domain plays an essential role in optimizing Ca 2+ -dependent RcCDPK1 autophosphorylation and BTPC transphosphorylation activity, it is not critical for in vitro or in vivo target recognition. Arabidopsis ( Arabidopsis thaliana ) CPK4 and soybean ( Glycine max ) CDPKβ are RcCDPK1 orthologs that effectively phosphorylated castor BTPC at Ser-451. Overall, the results highlight a potential link between cytosolic Ca 2+ signaling and the posttranslational control of respiratory CO 2 refixation and anaplerotic photosynthate partitioning in support of storage oil and protein biosynthesis in developing COS. © 2017 American Society of Plant

  16. Regulatory Phosphorylation of Bacterial-Type PEP Carboxylase by the Ca2+-Dependent Protein Kinase RcCDPK1 in Developing Castor Oil Seeds1[OPEN

    Science.gov (United States)

    Hill, Allyson T.; Anderson, Erin M.; She, Yi-Min

    2017-01-01

    Phosphoenolpyruvate carboxylase (PEPC) is a tightly controlled cytosolic enzyme situated at a crucial branch point of central plant metabolism. In developing castor oil seeds (Ricinus communis) a novel, allosterically desensitized 910-kD Class-2 PEPC hetero-octameric complex, arises from a tight interaction between 107-kD plant-type PEPC and 118-kD bacterial-type (BTPC) subunits. The native Ca2+-dependent protein kinase (CDPK) responsible for in vivo inhibitory phosphorylation of Class-2 PEPC’s BTPC subunit’s at Ser-451 was highly purified from COS and identified as RcCDPK1 (XP_002526815) by mass spectrometry. Heterologously expressed RcCDPK1 catalyzed Ca2+-dependent, inhibitory phosphorylation of BTPC at Ser-451 while exhibiting: (i) a pair of Ca2+ binding sites with identical dissociation constants of 5.03 μM, (ii) a Ca2+-dependent electrophoretic mobility shift, and (iii) a marked Ca2+-independent hydrophobicity. Pull-down experiments established the Ca2+-dependent interaction of N-terminal GST-tagged RcCDPK1 with BTPC. RcCDPK1-Cherry localized to the cytosol and nucleus of tobacco bright yellow-2 cells, but colocalized with mitochondrial-surface associated BTPC-enhanced yellow fluorescent protein when both fusion proteins were coexpressed. Deletion analyses demonstrated that although its N-terminal variable domain plays an essential role in optimizing Ca2+-dependent RcCDPK1 autophosphorylation and BTPC transphosphorylation activity, it is not critical for in vitro or in vivo target recognition. Arabidopsis (Arabidopsis thaliana) CPK4 and soybean (Glycine max) CDPKβ are RcCDPK1 orthologs that effectively phosphorylated castor BTPC at Ser-451. Overall, the results highlight a potential link between cytosolic Ca2+ signaling and the posttranslational control of respiratory CO2 refixation and anaplerotic photosynthate partitioning in support of storage oil and protein biosynthesis in developing COS. PMID:28363991

  17. A castor oil-containing dental luting agent: effects of cyclic loading and storage time on flexural strength.

    Science.gov (United States)

    Derceli, Juliana Dos Reis; Fais, Laiza Maria Grassi; Pinelli, Lígia Antunes Pereira

    2014-01-01

    Favorable results in the use of castor oil polyurethane (COP) as pulp capping, membrane material, sealer, mouthwash and in bone repair, associated with the fact that Ricinus communis is not derived from petroleum and it is abundant in Brazil, encourage researches in the development of luting agents. Objectives This study compared the flexural strength (FS) of a castor oil-containing dental luting agent with a weight percentage of 10% (wt%) of calcium carbonate (COP10) with RelyX ARC (RX) after mechanical cycling (MC) and distilled water storage. Material and Methods Sixty-four specimens (25x2x2 mm) were fabricated and divided into two groups, COP10 and RX (control). Each group was divided into 4 subgroups (n=8) according to the storage time, 24 hours (24 h) or 60 days (60 d), and the performance (MC+FS) or not (only FS) of the mechanical cycling test. The FS (10 kN; 0.5 mm/min) and MC tests (10,000 cycles, 5 Hz, 0.5 mm/min) were carried out using an MTS-810 machine. The data were analyzed using ANOVA (α=0.05). Results The obtained FS (MPa) values were: COP10 24h- 19.04±2.41; COP10 60d- 17.92±3.54; RX 24h- 75.19±3.43; RX 60d- 88.77±6.89. All the RX specimens submitted to MC fractured, while the values for COP10 after MC were as follows: COP10 24h- 17.90±1.87 and COP10 60d- 18.60±1.60. Conclusions A castor oil-containing dental luting agent with a weight percentage of 10% (wt%) of calcium carbonate is resistant to mechanical cycling without decreases in flexural strength. However, mean COP10 showed only about 25% of the RelyX ARC mean flexural strength.

  18. Characterization of Ricin and R. communis Agglutinin Reference Materials

    Directory of Open Access Journals (Sweden)

    Sylvia Worbs

    2015-11-01

    Full Text Available Ricinus communis intoxications have been known for centuries and were attributed to the toxic protein ricin. Due to its toxicity, availability, ease of preparation, and the lack of medical countermeasures, ricin attracted interest as a potential biological warfare agent. While different technologies for ricin analysis have been established, hardly any universally agreed-upon “gold standards” are available. Expert laboratories currently use differently purified in-house materials, making any comparison of accuracy and sensitivity of different methods nearly impossible. Technically challenging is the discrimination of ricin from R. communis agglutinin (RCA120, a less toxic but highly homologous protein also contained in R. communis. Here, we established both highly pure ricin and RCA120 reference materials which were extensively characterized by gel electrophoresis, liquid chromatography-electrospray ionization-tandem mass spectrometry (LC-ESI MS/MS, and matrix-assisted laser desorption ionization–time of flight approaches as well as immunological and functional techniques. Purity reached >97% for ricin and >99% for RCA120. Different isoforms of ricin and RCA120 were identified unambiguously and distinguished by LC-ESI MS/MS. In terms of function, a real-time cytotoxicity assay showed that ricin is approximately 300-fold more toxic than RCA120. The highly pure ricin and RCA120 reference materials were used to conduct an international proficiency test.

  19. Characterization of Ricin and R. communis Agglutinin Reference Materials

    Science.gov (United States)

    Worbs, Sylvia; Skiba, Martin; Söderström, Martin; Rapinoja, Marja-Leena; Zeleny, Reinhard; Russmann, Heiko; Schimmel, Heinz; Vanninen, Paula; Fredriksson, Sten-Åke; Dorner, Brigitte G.

    2015-01-01

    Ricinus communis intoxications have been known for centuries and were attributed to the toxic protein ricin. Due to its toxicity, availability, ease of preparation, and the lack of medical countermeasures, ricin attracted interest as a potential biological warfare agent. While different technologies for ricin analysis have been established, hardly any universally agreed-upon “gold standards” are available. Expert laboratories currently use differently purified in-house materials, making any comparison of accuracy and sensitivity of different methods nearly impossible. Technically challenging is the discrimination of ricin from R. communis agglutinin (RCA120), a less toxic but highly homologous protein also contained in R. communis. Here, we established both highly pure ricin and RCA120 reference materials which were extensively characterized by gel electrophoresis, liquid chromatography-electrospray ionization-tandem mass spectrometry (LC-ESI MS/MS), and matrix-assisted laser desorption ionization–time of flight approaches as well as immunological and functional techniques. Purity reached >97% for ricin and >99% for RCA120. Different isoforms of ricin and RCA120 were identified unambiguously and distinguished by LC-ESI MS/MS. In terms of function, a real-time cytotoxicity assay showed that ricin is approximately 300-fold more toxic than RCA120. The highly pure ricin and RCA120 reference materials were used to conduct an international proficiency test. PMID:26703723

  20. Deficiências de macronutrientes no estado nutricional da mamoneira cultivar Iris Deficiencies of macronutrients on nutritional status of castor bean cultivar Iris

    Directory of Open Access Journals (Sweden)

    José Lavres Junior

    2005-02-01

    Full Text Available Os objetivos deste trabalho foram avaliar o efeito da deficiência dos macronutrientes no crescimento e estado nutricional da mamoneira (Ricinus communis L. e a obtenção do quadro sintomatológico das deficiências de N, P, K, Ca, Mg e S. Cultivou-se Ricinus communis L. cultivar Iris em solução nutritiva, tendo como tratamentos soluções completa e deficientes em N, P, K, Ca, Mg e S. Foram determinadas a concentração indireta de clorofila, a atividade da redutase do nitrato, os teores solúveis de N (NO3-, P (H2PO4- e K+ e realizados testes rápidos para N, P e K. As deficiências de N, Ca, S e Mg foram as que mais restringiram a produção de massa de matéria seca, na ordem decrescente: N>Ca>S>Mg>K>P. Os maiores acúmulos de macronutrientes, no tratamento completo, foram observados nas raízes e no limbo das folhas inferiores. As concentrações críticas para N e Ca, ambas no limbo das folhas superiores e, Mg, no pecíolo das inferiores foram, respectivamente, 46,7, 13,8 e 6,5 g kg-1. As deficiências influenciaram as leituras do clorofilômetro. A atividade da redutase do nitrato guardou relação direta com a determinação da clorofila. Os teores de N (NO3-, P (H2PO4- e K+ foram menores nas folhas deficientes em N, P e K, respectivamente, o mesmo acontecendo quando avaliadas pela análise de toque.The objectives of this work were to evaluate the effect of macronutrient deficiencies on growth and on nutritional status of castor beans (Ricinus communis L., and to obtain the symptoms of the lack of N, P, K, Ca, Mg and S. Nutrient solutions containing all macronutrients and those from which one of these elements was omitted were the treatments used. The following determinations were made: chlorophyll (indirectly, nitrate reductase activity, NO3--N, H2PO4--P and K+, both on soluble fractions, and by spot tests. Deficiencies of N, Ca, S and Mg were the most limiting for dry matter production, followed in decreasing order by those of K and

  1. Pré-condicionamento das sementes de mamoneira para o teste de tetrazólio = Preconditioning of castor bean seeds for the tetrazolium test

    Directory of Open Access Journals (Sweden)

    Carolina Maria Gaspar-Oliveira

    2011-04-01

    Full Text Available O objetivo do trabalho foi padronizar a metodologia de pré-condicionamento das sementes de mamoneira (Ricinus communis L. para a avaliação do potencial fisiológico pelo teste de tetrazólio. Testaram-se os seguintes métodos de pré-condicionamento: sementes com tegumento entre papel umedecido a 30, 35 e 40ºC por 6, 8, 10, 12, 14, 16 e 18h; sementes sem tegumento entre papel umedecido e sementes com tegumento imersas em água a 25, 30, 35 e 40º C por 1, 2, 3, 4, 5 e 6h. Após o pré-condicionamento, removeu-se o tegumento das sementes, que foram cortadas no sentido do comprimento e imersas na solução de tetrazólio a 0,2%, por 120 min., a 35ºC. Avaliaram-se a porcentagem de germinação das sementes, o teor de água, antes e após a embebição, e a uniformidade na coloração das sementes após o teste de tetrazólio. O delineamento experimental foi inteiramente casualizado, e a comparação de médias realizada pelo teste de Tukey a 5% de probabilidade. Concluiu-se que o pré-condicionamento para o teste detetrazólio deve ser realizado nas sementes de mamoneira com tegumento, entre papel toalha umedecido, a 35ºC por 12h para que os resultados desse teste assemelhem-se aos obtidos no teste de germinação.This research had the objective of standardizing the methodology for preconditioning of castor bean (Ricinus communis L. seeds for the evaluation of their physiological potential by the tetrazolium test. The evaluated seed preconditioning methods were: seeds with coatbetween moist paper towel at 30, 35 and 40ºC for 6, 8, 10, 12, 14, 16 and 18 hours; and seeds without coat between moist paper towel; and seeds with coat immersed in water, at 25, 30, 35 and 40ºC for 1, 2, 3, 4, 5 and 6 hours. After preconditioning, the seed coat was removed, the seeds were cut lengthwise, and immersed in tetrazolium solution at a concentration of 0.2% for 120 minutes at 35ºC. The seeds’ germination percentage, moisture content before and after

  2. Crescimento e produção de bagas da mamoneira irrigada com água residuária doméstica Growth and production of seeds of castor bean crop irrigated with domestic wastewater

    Directory of Open Access Journals (Sweden)

    Luis N. Rodrigues

    2009-12-01

    Full Text Available Objetivou-se avaliar os efeitos da irrigação com água de esgoto doméstico sobre o crescimento e a produção de bagas da mamoneira (Ricinus communis L, em ambiente protegido. A pesquisa foi desenvolvida entre novembro/2005 e maio/2006, no Centro de Tecnologia e Recursos Naturais (CTRN da UFCG-PB. Foram estudados 5 níveis de reposição da evapotranspiração da cultura - ETc, (0,60, 0,75, 0,90, 1,05 e 1,20 em duas cultivares de mamoneira (BRS Nordestina e BRS Paraguaçu, constituindo um fatorial 5 x 2, com três repetições, no delineamento estatístico de blocos ao acaso. Avaliaram-se altura de planta, diâmetro caulinar, número de folhas e área foliar aos 48, 90, 132 e 174 dias após a semeadura (DAS. A produção de sementes foi avaliada na última data. A mamoneira irrigada com 0,60 ETc, em relação a 1,05 da ETc, aos 174 DAS, teve a altura de planta, o diâmetro caulinar, o número de folhas, a área foliar e produção de sementes reduzidos em 23,45, 16,14, 26,23, 44,06 e 50,59%, respectivamente. O crescimento em altura da cultivar BRS Paraguaçu foi significativamente maior, ao longo do ensaio, enquanto a BRS Nordestina se destacou em área foliar, no início do ciclo. A produção de bagas foi semelhante nas duas cultivares Não houve interação significativa entre os fatores estudados.The objective of this study was to evaluate the impacts of irrigation with domestic wastewater on growth and production of seeds of castor bean (Ricinus communis L in greenhouse. The research was carried out between November, 2005 and May, 2006, at Centro de Tecnologia e Recursos Naturais (CTRN of UFCG - PB. A randomized block design was used, with 5 x 2 scheme of factorial analysis with three replications, testing 5 levels of replacement of crop evapotranspiration - ETc (0.60, 0.75, 0.90, 1.05 and 1.20 ETc and 2 cultivars of castor bean (BRS Nordestina and BRS Paraguaçu. Plant height, stem diameter, number of leaves and leaf area were evaluated

  3. Características agronômicas de cultivares de mamona em função do local de cultivo e da época de semeadura no Rio Grande do Sul Characteristics of castor bean cultivars according to the environmental crop and sowing season in Rio Grande do Sul State, Brazil

    Directory of Open Access Journals (Sweden)

    Jacson Zuchi

    2010-03-01

    Full Text Available A mamona (Ricinus communis L. é uma planta oleaginosa anual e, ocasionalmente, bienal em regiões tropicais, com ciclo médio de 150 dias para a maioria das cultivares anuais e de 120 a 130 dias para cultivares anuais precoces. O objetivo deste trabalho foi avaliar características agronômicas de cultivares das mamonas 'Al Guarany 2002', 'IAC 80', 'IAC 226' e 'BRS 188 Paraguaçu'em função do ambiente de cultivo e da época de semeadura. As cultivares foram semeadas entre o primeiro e o quinto dia dos meses de novembro e dezembro, na Embrapa Clima Temperado, em Pelotas, Rio Grande do Sul. Cada época teve 12 unidades experimentais em três blocos casualizados. A emergência, a altura de planta e de inserção do primeiro cacho, o período de florescimento e colheita e o ataque de pragas e doenças foram avaliados e analisados com o programa WinStat Versão 2.0. O comportamento entre as cultivares diferiu entre locais de cultivo e época de semeadura. A inserção do cacho foi mais alta, e as florações e colheitas foram mais tardias em plantas da segunda época de semeadura. Danos por pragas e doenças e os descritores morfológicos da planta de mamona apresentaram diferenças entre os locais de cultivo.Castor bean (Ricinus communis L. is an oleaginous plant with annual cycle and occasionally biennial cycle in tropical areas, with mean cycle of 150 days for the majority of annual cultivars and 120 to 130 days for annual early cultivars. The objective of this study was to evaluate the agronomic characteristics of castor cultivars according to environmental crop and sowing season. The experiment was conduced at Embrapa Clima Temperado - Pelotas/RS, in two places. The castor cultivars used in this research were 'Al Guarany 2002', 'IAC 80', 'IAC 226' and 'BRS 188 Paraguaçu', which were sown in two sowing times: the first was in early November (between 1st and 5st and the second was in early December (between 1st and 5st. Each sowing season was

  4. Efeito de deficiência de micronutrientes no estado nutricional da mamoneira cultivar Iris Micronutrient deficiency effect on the nutritional status of the castor bean cultivar Iris

    Directory of Open Access Journals (Sweden)

    Anderson Lange

    2005-01-01

    Full Text Available Os objetivos deste trabalho foram caracterizar os sintomas visuais de deficiência de micronutrientes e avaliar efeitos desses micronutrientes no estado nutricional da mamoeira. O experimento foi realizado em casa de vegetação utilizando-se solução nutritiva, de fevereiro a junho de 2003. Foram utilizadas plantas de mamoneira (Ricinus communis L. do híbrido comercial Íris. Os tratamentos foram: completo, omissão de B, omissão de Cu, omissão de Fe, omissão de Mn, omissão de Mo e omissão de Zn. A omissão de B, Fe e Mn resultou em sintomas característicos de deficiência. Os sintomas se desenvolveram primeiramente em plantas deficientes em Fe ou Mn, seguidas das deficientes em boro. A produção de matéria seca foi afetada na seguinte ordem: Fe>Mn>B. Tanto as folhas superiores como as inferiores refletem o estado nutricional da mamoneira em relação a B, Cu, Fe, Mn, Mo e Zn. O teor de clorofila nas folhas, medido em unidades SPAD, foi influenciado pela omissão dos micronutrientes.The objectives of this work were to characterize the visual symptoms of micronutrient deficiencies, and their effects on nutricional status of castor beans. A greenhouse experiment with nutrient solutions was carried out from February to June, 2003. The commercial hybrid "Iris" was used. Treatments were as follows: complete, minus B, minus Cu, minus Fe, minus Mn, minus Mo, and minus Zn. Symptoms of deficiency were observed in the treatments with omission of B, Fe, and Mn. The symptoms firstly developed when either Fe or Mn was deficient, and they were followed by those deficient in boron. Dry matter yield was affected in the decreasing order: Fe>Mn>B. Both upper and lower leaves reflect the nutritional status of the castor bean with respect to B, Cu, Fe, Mn, Mo and Zn. Leaf chlorophyll, as measured in units SPAD, was influenced by the treatments.

  5. Simulación de los cambios de carbono orgánico del suelo en sistema de cultivo con higuerilla por el modelo RothC Simulation of soil organic carbon changes in crop systems with castor bean using the RothC model

    Directory of Open Access Journals (Sweden)

    Lucila González Molina

    2012-11-01

    Full Text Available El objetivo del presente trabajo fue la simulación de los cambios del carbono orgánico del suelo (COS, por el modelo RothC, en razón del cambio de uso de suelo del sistema tradicional - asociación maíz-calabaza (TMC - a sistemas con higuerilla (Ricinus communis: multiestratos (MUL, callejones (CALL y monocultivo de higuerilla (HIG. Las simulaciones del COS se hicieron para las profundidades de suelo 0-20 y 0-40 cm, para el periodo de 1980-2040, considerándose como línea base al sistema TMC. Las tasas de cambio de COS estimadas con el RothC, en ambas profundidades de suelo, estuvieron en 0,5-1,2, 0,4-0,8, 0,3-0,5 y 0,04-0,1 Mg ha-1 de C por año en los sistemas HIG, MUL, CALL y TMC, respectivamente, y fueron consistentes con las reportadas en la literatura. El desempeño del RothC tuvo 89% de eficiencia (EF, con R²=0,9, lo que muestra que este modelo puede usarse con información temporal del COS escasa, información de la historia de uso de suelo y mediciones de la entrada de residuos vegetales aéreos y subterráneos en el suelo.The objective of this work was to simulate, by the RothC model, the changes in soil organic carbon (SOC caused by changes of land use - from the traditional maize-squash (TMC association to systems with castor bean (Ricinus communis: multilayer (MUL, alleys (CALL and monoculture (HIG. SOC simulations were performed for 0-20 and 0-40 cm soil depths, for the period 1980-2040, considering the TMC system as the base line. SOC change rates estimated with RothC, for both soil depths, were 0.5-1.2, 0.4-0.8, 0.3-0.5 and 0.04-0.1 Mg ha-1 C per year in the HIG, MUL, CALL and TMC systems, respectively, and were consistent with those reported in the literature. RothC perfomance had 89% efficiency (EF and R² = 0.9, which shows that this model can be used with scarce SOC temporal information, information on the history of land use, and with input measurements of aerial and underground plant residues in the soil.

  6. The CASTOR initiative

    Energy Technology Data Exchange (ETDEWEB)

    Le Thiez, Pierre [GEOGREEN (France)

    2008-07-15

    In this paper it is spoken over the CASTOR project, which has 31 partners of 12 European countries. Also it is spoken on the strategy for the CO{sub 2} reduction in Europe; what on the capture and post-combustion has been done, and what as far as geologic CO{sub 2} storage has been accomplished. [Spanish] En esta ponencia se habla sobre el proyecto Castor, el cual cuenta con 31 socios de 12 paises europeos. Tambien se habla sobre la estrategia para la reduccion de CO{sub 2} en Europa; lo que se ha hecho en cuanto a captura post-combustion y lo que se ha hecho para el almacenamiento geologico de CO{sub 2}.

  7. Antifungal Efficacy of Myrtus communis Linn

    OpenAIRE

    Sadeghi Nejad; Erfani Nejad; Yusef Naanaie; Zarrin

    2014-01-01

    Background The ethanolic extract of Myrtus communis Linn. leaves was assayed in vitro as a growth inhibitor against opportunistic fungi such as Candida and Aspergillus species. Myrtus communis Linn. (Family, Myrtaceae) is an aromatic evergreen shrub or small tree. It is native to the Mediterranean region. Objectives This study aimed to assess antifungal activity (in vitro) of the ethanolic extracts of Myrtus communis leaves as a g...

  8. ECRH on CASTOR

    Czech Academy of Sciences Publication Activity Database

    Preinhaelter, Josef; Žáček, František; Irzak, M. A.; Vahala, L.; Vahala, G.

    2000-01-01

    Roč. 50, S 3 (2000), s. 51-56 ISSN 0011-4626. [Symposium on Plasma Physics and Technology/19th./. Prague, 06.06.2000-09.06.2000] R&D Projects: GA ČR GA202/00/1215; GA ČR GA202/97/0778 Institutional research plan: CEZ:AV0Z2043910 Keywords : plasma * tokamak * CASTOR Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 0.298, year: 2000

  9. Volume de recipientes e composição de substratos para produção de mudas de mamoneira Recipients volume and substrate composition for castor seedlings production

    Directory of Open Access Journals (Sweden)

    Rosiane de Lourdes Silva de Lima

    2006-06-01

    Full Text Available A mamoneira (Ricinus communis L.é uma oleaginosa bem adaptada ao cultivo na região semi-árida por sua rusticidade e resistência ao estresse hídrico. Seu plantio é tradicionalmente feito por sementes, mas o uso de mudas pode se tornar atraente como estratégia para melhor aproveitamento da curta estação chuvosa. Para adoção desta tecnologia, a definição de aspectos técnicos como volume de recipientes, composição do substrato e período de permanência da muda no viveiro são fundamentais para o êxito da técnica. Conduziu-se experimento em casa-de-vegetação da Embrapa Algodão em Campina Grande, com sementes da cultivar de mamona de porte médio BRS Nordestina, em delineamento de blocos casualizados com 4 repetições e 25 tratamentos em distribuição fatorial 5², sendo os fatores cinco volumes de recipientes e cinco composições de substratos. Entre 15 e 43 dias após a emergência (DAE foram feitas cinco coletas destrutivas semanais para obtenção de dados de altura, diâmetro caulinar, área foliar, número de folhas e matéria seca da parte aérea e radicular. Com os dados obtidos calculou-se o tamanho da folha. Detectaram-se efeitos significativos dos tratamentos em todas as variáveis estudadas. O crescimento das mudas estabilizou-se aproximadamente aos 36 DAE, independente do volume do recipiente. Os substratos compostos por mistura de areia com esterco bovino ou casca de amendoim propiciaram o melhor crescimento das mudas, enquanto aqueles contendo bagaço de cana ou mucilagem de sisal foram os piores. Recipientes de 2 L de volume foram os mais adequados para a produção de mudas de mamoneira.Castor (Ricinus communis L. is an oilseed crop well adapted for growing at semi-arid region for its rusticity and resistance to water deficit. It is usually planted by seeds, but planting by seedling can become attractive as a strategy for better use of the short rainy season. Before the adoption of this technology some aspects

  10. Desenvolvimento e produção de duas cultivares de mamoneira sob estresse salino Growth and production of two cultivars of castor bean under saline stress

    Directory of Open Access Journals (Sweden)

    Sérvulo M. S. Silva

    2008-08-01

    Full Text Available Visando estudar o comportamento de duas cultivares BRS Paraguaçu e BRS Energia de mamoneira (Ricinus communis L., irrigadas com quatro níveis de condutividade elétrica da água de irrigação (CEa: 0,7; 2,7; 4,7 e 6,7 dS m-1, a 25 °C, conduziu-se um experimento no delineamento inteiramente casualizado, com 3 repetições, em esquema fatorial 4 x 2. As variáveis avaliadas foram altura de planta, diâmetro de caule, número de folhas, área foliar e consumo diário de água pela planta aos 80 e 100 dias após semeadura, número de dias para 1ª inflorescência, altura do 1º racemo aos 100 dias após semeadura, dias para colheita, número de frutos no 1º cacho, peso dos frutos, das sementes e de 10 sementes aos 150 DAS. A salinidade da água de irrigação interferiu na altura de planta, diâmetro do caule, número de folhas, área foliar e consumo de água, a partir de 4,7 dS m-1 aos 80 e 100 DAS, nas duas cultivares. Verificou-se, na cultivar BRS Energia maior precocidade na emissão da 1ª inflorescência e maior altura do racemo, enquanto na cultivar BRS Paraguaçu se obteve menor produção de frutos e de sementes e maior peso de 10 sementes.With the objective of studying the behavior of two cultivars BRS Paraguaçu and BRS Energy of castor bean (Ricinus communis L., irrigated with four levels of electrical conductivity of irrigation water (ECw: 0.7; 2.7; 4.7 and 6.7 dS m-1, at 25 °C, an experiment was conducted in a randomized design with 3 replications, in a factorial scheme of 4 x 2. The variables measured were: plant height, stem diameter, leaf area, number of leaves and water consumption by plant at 80 and 100 days after sowing (DAS, number of days for emission of first inflorence and height of first cluster at 100 DAS, days to harvest, number of fruits in the 1st cluster, weight of fruits, and 10 seeds at 150 DAS. The salinity of the irrigation water significantly affected the plant height, stem diameter, number of leaves, leaf

  11. The CASTOR shower library

    International Nuclear Information System (INIS)

    Mundim Filho, Luiz Martins; Carvalho, Wagner de Paula

    2012-01-01

    Full text: CASTOR (Centaur And Strange Object Research) is an electromagnetic (EM) and hadronic (HAD) calorimeter, based on tungsten and quartz plates, operating in the CMS Detector (Compact Muon Solenoid) at LHC. The calorimeter detects Cerenkov radiation and is positioned around the beam pipe in the very forward region of CMS (at 14.38 m from the interaction point), covering the pseudo-rapidity range between -6.6 ≤ η≤-5.1 . It is longitudinally segmented into 14 sections, 2 for the EM and 12 for the HAD parts and is 16-fold azimuthally symmetric around the beam pipe. A Shower Library is needed for CASTOR Monte Carlo simulation, as the full simulation of showers takes a long time and the high multiplicity of particles in the forward region makes this simulation very time consuming. The Shower Library is used as a look-up table in the form of a ROOT file, so that when a simulated particle enters the detector with a certain energy and direction, characterized by the azimuthal angle φ and the pseudo-rapidity η, instead of making the full simulation of the shower in CASTOR, it is substituted by one already stored in the Shower Library. Showers corresponding to two types of particles are included in the Shower Library: electrons (or photons) and charged pions. The software implemented to make the Shower Library is described, as well as the validation of this library and timing studies. This package has been developed in the context of the official software of the CMS Collaboration, CMSSW. (author)

  12. TRANSFORMATION OF RICINOLEIC OF CASTOR OIL INTO LINOLEIC (OMEGA-6 AND CONJUGATED LINOLEIC ACID BY DEHYDRATION

    Directory of Open Access Journals (Sweden)

    Marham Sitorus

    2010-06-01

    Full Text Available The ricinoleic of Castor Oil was dehydrated by various dehydrator agent (P2O5, K2CO3, H3PO4, NaHSO4, Al2O3, molecular sieve and activated bentonite at 450 °C - HCl on the same condition (150 °C, mol ratio 1:1 and 2 hours . The compositions of Refined Ricinus Castor Oil as starting material were : 0.92% palmitic , 5.56% linoleic , 4.07% octadecanoic , 1.22% stearic and 85.06% ricinoleic. The spesific wave number of IR was bandwith 3411 cm-1 caused of hydroxyl (-OH group of ricinoleic at C-12 as main component. The product was Dehydrated Castor Oil (DCO mixed of linoleic (omega 6 [C18 : 2 (9,12] and Conjugated Linoleic Acid (CLA [C18: 2 (9,11]. The best dehydrator was P2O5 based on three parameters were : Free Fatty Acid (FFA nearly the same (1.855% of Castor oil and 2.139% of DCO, the most increased of Iodium value (49.860 mg/g of Castor oil in to 63.090 mg/g of DCO, and the most decresed of hydroxyl number (28.27 mg of Castor oil in to 17.75 mg/g of DCO. To optimized the dehydration was done by various number of P2O5 (3g, 5g and 7g, tempereture (room, 100 °C and 150 °C and time (2h, 2.5h, 3h, and 3.5h. The optimal conditon of dehydration was not found yet. Some of sugestted or idea for dehydration were: dehydration must be done by base or netral, non oxydator dehydrator, mol ratio 1:1, temperature (100-150 °C and 2-3.5 h. Based on GC-MS the best DCO (7g P2O5, 150 °C and 3.5 h were showed that the decrease of ricinoleic 14.13% (85.08% of Castor Oil in to 70.93% of DCO, increased linoleic 2.09% (5.56 of Castor oil in to 7.65% of DCO and conducted of 9.09% CLA. Some new peaks between linoleic and ricinoleic are maybe isomer's of linoleic and CLA. The wave number of cunjugated alkene (C=C (1666.3 cm-1 of IR spectra of DCO together with GC-MS chromatogram's to indicated that linoleic and CLA were conducted.   Keywords: castor oil, risinoleic, dehydration, omega 6 dan CLA

  13. Secondary metabolites and bioactivities of Myrtus communis

    OpenAIRE

    Mahmoud I Nassar; El-Sayed A Aboutabl; Rania F Ahmed; Ezzel-Din A El-Khrisy; Khaled M Ibrahim; Amany A Sleem

    2010-01-01

    Background: Myrtus species are characterized by the presence of phenolic acids, flavonoids, tannins, volatile oils and fatty acids. They are remedies for variety of ailments. This study therefore investigated medicinal effects of Myrtus communis L. Methods: Bioactivity studies of Myrtus communis L. leaves were carried out on volatile oil, 7% methanol and aqueous extracts and the isolated compounds myricetin 3-O-β-glucopyranoside, myricetin 3-O-∝-rhamnopyranoside and gallic acid. Results: Dete...

  14. Antifungal Efficacy of Myrtus communis Linn

    Directory of Open Access Journals (Sweden)

    Sadeghi Nejad

    2014-08-01

    Full Text Available Background The ethanolic extract of Myrtus communis Linn. leaves was assayed in vitro as a growth inhibitor against opportunistic fungi such as Candida and Aspergillus species. Myrtus communis Linn. (Family, Myrtaceae is an aromatic evergreen shrub or small tree. It is native to the Mediterranean region. Objectives This study aimed to assess antifungal activity (in vitro of the ethanolic extracts of Myrtus communis leaves as a growth inhibitor against 24 clinical isolates of Candida, including C. albicans, C. glabrata, and C. tropicalis also three species of Aspergillus, including A. niger, A. flavus, and A. terreus. Materials and Methods The ethanolic extract of myrtle leaves was prepared by maceration method and minimal inhibitory concentration (MIC of Myrtus communis leaves extract was determined by agar-well diffusion technique. Amphotericin B and clotrimazole were used as the positive control in this assay. Results The minimal inhibitory concentration (MICs values of Myrtus communis leaves extract ranged 0.625-5.0 µg/µL and 5-40 µg/µL against tested Candida spp. and Aspergillus spp., respectively. Conclusions Results revealed that the ethanolic extract of Myrtus communis leaves have antifungal potency against both pathogenic tested fungi, and it can be used as a natural antifungal agent.

  15. Produção de fitomassa e acúmulo de nutrientes por plantas de cobertura e cultivo da mamona em sucessão no sistema plantio direto Cover crops phytomass and nutrient accumulation and castor bean grown in succession under no-tillage system

    Directory of Open Access Journals (Sweden)

    André Godoy da Silva

    2010-10-01

    Full Text Available Objetivou-se avaliar a produção de matéria seca (MS e o acúmulo de nutrientes pela crotalária (Crotalaria juncea L. e pelo milheto (Pennisetum glaucum (L. R. Brown, em cultivos isolado e consorciado, e o efeito do manejo mecânico da palhada no desempenho da cultura da mamona (Ricinus communis L., em sucessão, na fase de implantação do sistema plantio direto. O experimento foi instalado em um Nitossolo Vermelho (Rhodic Kandiudox, em Botucatu, São Paulo (SP (22°58'S, 48°23'W e 765m de altitude. O delineamento utilizado foi o de blocos casualizados, em parcelas subdivididas, com quatro repetições. As parcelas foram constituídas por três coberturas vegetais: crotalária - cultivar 'IAC-KR1'; milheto - cultivar 'BN 2'; e consórcio crotalária + milheto. As subparcelas foram constituídas pela ausência e presença do manejo mecânico da palhada com triturador horizontal 20 dias após o manejo químico. O milheto produziu maior quantidade de MS e apresentou maiores teores de K, Mg e S na parte aérea, enquanto a crotalária apresentou maiores teores de N e Ca. O milheto acumulou mais N, P, K, Mg e S na parte aérea, enquanto a crotalária acumulou maior quantidade de Ca. A produtividade de grãos da mamoneira foi maior em sucessão ao consórcio crotálaria + milheto e na ausência do manejo mecânico da palhada.The objective of this study was to evaluate aboveground matter production and nutrients accumulation by sunnhemp (Crotalaria juncea L. and pearl millet (Pennisetum glaucum (L. R. Brown, in sole crop and intercropped, and the effect of straw mulch mechanical management on castor bean (Ricinus communis L. performance, in notillage system establishment. The experiment was carried out on a Rhodic Kandiudox, in Botucatu, SP, Brazil (22°58'S, 48°23'W and 765m above sea level. A randomized block design, in a splitplot scheme, with four replications, was used. The plots were composed by three cover crops: sunnhemp - cv. 'IAC-KR1

  16. Protein (Viridiplantae): 389551 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available nel, putative Ricinus communis MENDPLLPYHSPRKRTPPQLPPILCPLPEDDEVSLPLSISPSELKERLIFGPSPSPNDSTPVFEALTHSLNSPRP...SCSNQEFNFHDSPRHHQQPQSWLIDPNYSWTKTNLHRSKTAPAMAVINDSLNSSHIPKPQFGSQSIVRQAFVLLILYLSFGVV

  17. The calcium-dependent protein kinase RcCDPK2 phosphorylates sucrose synthase at Ser11 in developing castor oil seeds.

    Science.gov (United States)

    Fedosejevs, Eric T; Gerdis, Suzanne A; Ying, Sheng; Pyc, Michal; Anderson, Erin M; Snedden, Wayne A; Mullen, Robert T; She, Yi-Min; Plaxton, William C

    2016-10-15

    Imported sucrose is cleaved by sucrose synthase (SUS) as a critical initial reaction in the biosynthesis of storage end-products by developing seeds. Although SUS is phosphorylated at a conserved seryl residue by an apparent CDPK (Ca 2+ -dependent protein kinase) in diverse plant tissues, the functions and mechanistic details of this process remain obscure. Thus, the native CDPK that phosphorylates RcSUS1 (Ricinus communis SUS1) at Ser 11 in developing COS (castor oil seeds) was highly purified and identified as RcCDPK2 by MS/MS. Purified RcSUS1-K (-kinase) and heterologously expressed RcCDPK2 catalyzed Ca 2+ -dependent Ser 11 phosphorylation of RcSUS1 and its corresponding dephosphopeptide, while exhibiting a high affinity for free Ca 2+ ions [K 0.5 (Ca 2+ ) < 0.4 µM]. RcSUS1-K activity, RcCDPK2 expression, and RcSUS1 Ser 11 phosphorylation peaked during early COS development and then declined in parallel. The elimination of sucrose import via fruit excision triggered RcSUS1 dephosphorylation but did not alter RcSUS1-K activity, suggesting a link between sucrose signaling and posttranslational RcCDPK2 control. Both RcCDPK2-mCherry and RcSUS1-EYFP co-localized throughout the cytosol when transiently co-expressed in tobacco suspension cells, although RcCDPK2-mCherry was also partially localized to the nucleus. Subcellular fractionation revealed that ∼20% of RcSUS1-K activity associates with microsomal membranes in developing COS, as does RcSUS1. In contrast with RcCDPK1, which catalyzes inhibitory phosphorylation of COS bacterial-type phosphoenolpyruvate carboxylase at Ser 451 , RcCDPK2 exhibited broad substrate specificity, a wide pH-activity profile centered at pH 8.5, and insensitivity to metabolite effectors or thiol redox status. Our combined results indicate a possible link between cytosolic Ca 2+ -signaling and the control of photosynthate partitioning during COS development. © 2016 The Author(s); published by Portland Press Limited on behalf of the

  18. Biotechnology for improved hHydroxy fatty acid production in oilseed lesquerella

    Science.gov (United States)

    The conventional source of hydroxy fatty acid (HFA) is from castor (Ricinus communis), 90% of castor oil is ricinoleic acid (18:1OH). Ricinoleic acid and its derivatives are used as raw materials for numerous industrial products, such as lubricants, plasticizers and surfactants. The production of ca...

  19. Nutritive value and biochemical changes in broiler chickens fed ...

    African Journals Online (AJOL)

    Castor bean (Ricinus communis Linn.) is an important oilseed rich in protein but rarely used as livestock feed due to antinutritional factors. Castor seed was detoxified using combined processing techniques of moist heating and fermentation (5 and 7- day) or lye treatment and fed to150 day-old Anak 2000 broiler chicks at ...

  20. Untitled

    African Journals Online (AJOL)

    BCP) from three crosses of castor (Ricinus communis L.) were studied using randomised complete block design to determine the level of variabilities with a ties' to ascertaining the improvement potentials through selection. The results show that castor plants are largely heterozygous, an attribute that is highly desirable in ...

  1. 21 CFR 172.876 - Castor oil.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Castor oil. 172.876 Section 172.876 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... Multipurpose Additives § 172.876 Castor oil. The food additive castor oil may be safely used in accordance with...

  2. Neuroprotective effect of undecylenic acid extracted from Ricinus communis L. through inhibition of μ-calpain.

    Science.gov (United States)

    Lee, Eunyoung; Eom, Ji-Eun; Kim, Hye-Lin; Kang, Da-Hye; Jun, Kyu-Yeon; Jung, Duk Sang; Kwon, Youngjoo

    2012-05-12

    The key neuropathological features of Alzheimer's disease are abnormal deposition of Aβ plaques and insoluble Aβ peptides in extracellular brain and intracellular neurofibril tangles induced by abnormal tau hyperphosphorylation. μ-Calpain is one of the factors that bridge these Aβ- and hyperphosphorylated tau-mediated pathological pathways. Undecylenic acid (UDA), a naturally occurring unsaturated fatty acid, was discovered as a μ-calpain inhibitor by screening a chemical library using a substrate specific μ-calpain assay method. UDA inhibited Aβ oligomerization and Aβ fibrillation and reversed Aβ-induced neuronal cell death. In addition, UDA scavenged ROS and reversed the levels of proapoptotic proteins induced by ROS in SH-SY5Y cells. UDA inhibited μ-calpain activity with better potency than the known peptide-like μ-calpain inhibitor, MDL28170, in SH-SY5Y and HEK293T cells transfected with the catalytic subunit of μ-calpain. These results suggest that UDA is a novel non-peptide-like μ-calpain inhibitor with good cell permeability and potent neuroprotective effect. Copyright © 2012 Elsevier B.V. All rights reserved.

  3. Accumulation of Heavy Metals in Ricinus communis L. from Mn Contaminated Area

    Directory of Open Access Journals (Sweden)

    YI Xin-yu

    2014-02-01

    Full Text Available Xiangbi No. 1 and Zibi No. 7 were planted in the Mn contaminated soils to explore its potential of ecological remediation and ener-gy utilization in the areas of Mn contaminated site. The major nutrient elements and the concentrations of heavy metals(Mn, Pb, Zn, Cu and Cr in different parts(root, branch and leaf and topsoil samples were detected after entering into the period of reproductive growth.The results showed that the average content of Mn was as high as 7 884.96 mg·kg-1,which exceeded 6.5 times of national soil environmental quality standard(level 2.The mean level of Mn in tissues of Xiangbi No. 1 was found to be in the sequence of root>leaf>branch,whereas,the mean level of Mn in different parts of Zibi No. 7 was found to be in the order of leaf>fruit>branchroot respectively. The average concentration of Mn in the leaf reached the peak value(765.43 mg·kg-1,which was higher than Xiangbi No.1 about 79.53%.The leaf/root ratios of Pb, Cu, Cr contents in Zibi No. 7 were higher than those of Xiangbi No. 1 samples.The accumulation and translocation in plants was affect-ed by different heavy metal elements in soils.The results demonstrated that Zibi No. 7 had a better uptake and translocation capacity of Mn,Pb,Cu and Cr, meanwhile,plants of two species had differences in accumulation and translocation ability and were proved to possess good Mn-tolerance ability for remediation of heavy metal contaminated soils.

  4. Structural and Spectroscopic Properties of the Peroxodiferric Intermediate of Ricinus communis Soluble Delta(9) Desaturase

    Czech Academy of Sciences Publication Activity Database

    Srnec, Martin; Rokob, Tibor András; Schwartz, J. K.; Kwak, Y.; Rulíšek, Lubomír; Solomon, E. I.

    2012-01-01

    Roč. 51, č. 5 (2012), s. 2806-2820 ISSN 0020-1669 R&D Projects: GA MŠk LC512 Institutional research plan: CEZ:AV0Z40550506 Keywords : diferrous non-heme iron enzyme * QM/MM calculations * delta-9 * desaturase * reaction mechanism Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.593, year: 2012

  5. Entomopathogenic fungi associated with Ixodes ricinus ticks

    DEFF Research Database (Denmark)

    Kalsbeek, Vibeke; Frandsen, F.; Steenberg, Tove

    1995-01-01

    The objective of this study was to demonstrate the occurrence of entomopathogenic fungi on Ixodes ricinus ticks in relation to the tick stage, engorgement and season. Ticks were collected from the vegetation, from small rodents and from deer. All entomopathogenic fungi found belonged to the Hypho......The objective of this study was to demonstrate the occurrence of entomopathogenic fungi on Ixodes ricinus ticks in relation to the tick stage, engorgement and season. Ticks were collected from the vegetation, from small rodents and from deer. All entomopathogenic fungi found belonged....... ricinus population, since females were the most frequently infected stage....

  6. Divergência genética entre acessos e cultivares de mamoneira por meio de estatística multivariada Genetic divergence on castor bean accesses and cultivars through multivariate analysis

    Directory of Open Access Journals (Sweden)

    Mauro Nóbrega da Costa

    2006-11-01

    Full Text Available O objetivo deste trabalho foi avaliar a divergência genética entre acessos e cultivares de mamoneira (Ricinus communis L. e utilizá-la como critério na escolha de genitores que viabilizem, a partir de hibridações, a formação de populações segregantes. Os tratamentos foram representados pelos acessos BRA 4871, BRA 2968, BRA 5550 e BRA 7722 Papo-de-gia, e as cultivares BRS 188 Paraguaçu, BRS 149 Nordestina, IAC-80, Mirante-10 e Pernambucana Melhorada. As características analisadas foram: início do florescimento (FR, número de racemos por planta (NRP, comprimento efetivo do racemo primário (CR, altura de planta (AP, potencial produtivo (PP e teor de óleo nas sementes (TO. A divergência genética foi estimada por meio de estatística multivariada, com base em variáveis canônicas e análise de agrupamento, tendo-se empregado a distância euclidiana média. Houve a formação de dois grupos: o grupo I formado por oito genótipos e o grupo II por apenas um genótipo, a cultivar Mirante-10. Apesar de a cultivar Mirante-10 ter sido a mais divergente, não deve ser recomendada para hibridação, por sua baixa média de desempenho. As demais cultivares também apresentam restrições para hibridação, por serem bastante similares. As variáveis que mais contribuíram para a divergência genética foram FR, AP, TO e CR.This work aimed to evaluate genetic divergence among castor bean (Ricinus communis L. cultivars, in order to enable the choice of parents which make the formation of segregating populations possible. Accesses BRA 4871, BRA 2968, BRA 5550 and BRA 7722 Papo-de-gia, and cultivars BRS 188 Paraguaçu, BRS 149 Nordestina, IAC-80, Mirante-10 and Pernambucana Melhorada were evaluated. Characteristics analyzed were: days to flowering, number of racemes per plant, length of pistillate region of main raceme, plant height, potential yield, and seed oil content. The genetic divergence among accesses and cultivars was studied by

  7. Acquisition through common slave (servus communis

    Directory of Open Access Journals (Sweden)

    Bogunović Mirjana B.

    2016-01-01

    Full Text Available Common slave (servus communis is a slave who belongs to two masters. Both masters may entirely dispose with the slave because their joint ownership allows it. However, acquisitions through common slave (servus communis is not that clear. Does a slave evenly oblige co-masters or only the master on whose behalf he has acted? Is it possible for a slave to work in the interest of one master and oblige another? Who does the unconscientious slave correspond to, the third party or a betrayed master? This paper will analyze the opinions of two Roman iurists, which will partly solve doubts that this institute causes.

  8. Volatile Constituents of Ferula communis L. subsp. communis Growing Spontaneously in Greece

    Directory of Open Access Journals (Sweden)

    Stavroula Manolakou

    2013-01-01

    Full Text Available The essential oils of Greek Ferula communis subsp. communis from different plant parts were obtained by hydrodistillation and analyzed by means of GC and GC-MS. Ninety three compounds were identified in the total essential oils. Sesqui terpenes were the most dominant class of compounds in the leaves and inflorescences oils, while infructescences oils were rich in monoterpenes with α-pinene (35.2-40.6% being the dominant component.

  9. Labelling of castor oil for myocardial study

    International Nuclear Information System (INIS)

    Hallaba, E.; Al-Suhybani, A.; Zaki, F.S.; Abdullah, M.E.

    1985-01-01

    The labelling of castor oil, hydrolyzed castor oil and oleic acid by iodine monochloride and chloramine-T was investigated. The effect of iodinating agent and concentration of castor oil on labelling yield was studied. A comparative pharmacological study with analog aliphatic acids was carried out. Castor oil labelled with iodine monochloride concentrates in heart and liver in good proportion, better than other natural fatty acids and nearly equal to analog fatty acids. Infrared study revealed that the OH group in ricinoleic acid may protect the sup(125)I added across the double bond with minor changes in biochemical properties causing better extraction by muscle of the heart. (author)

  10. Castor Oil-Based Biodegradable Polyesters.

    Science.gov (United States)

    Kunduru, Konda Reddy; Basu, Arijit; Haim Zada, Moran; Domb, Abraham J

    2015-09-14

    This Review compiles the synthesis, physical properties, and biomedical applications for the polyesters based on castor oil and ricinoleic acid. Castor oil has been known for its medicinal value since ancient times. It contains ∼90% ricinoleic acid, which enables direct chemical transformation into polyesters without interference of other fatty acids. The presence of ricinoleic acid (hydroxyl containing fatty acid) enables synthesis of various polyester/anhydrides. In addition, castor oil contains a cis-double bond that can be hydrogenated, oxidized, halogenated, and polymerized. Castor oil is obtained pure in large quantities from natural sources; it is safe and biocompatible.

  11. A Density Map of the Tick-Borne Encephalitis and Lyme Borreliosis Vector Ixodes ricinus (Acari: Ixodidae) for Germany.

    Science.gov (United States)

    Brugger, Katharina; Boehnke, Denise; Petney, Trevor; Dobler, Gerhard; Pfeffer, Martin; Silaghi, Cornelia; Schaub, Günter A; Pinior, Beate; Dautel, Hans; Kahl, Olaf; Pfister, Kurt; Süss, Jochen; Rubel, Franz

    2016-11-01

    The castor bean tick Ixodes ricinus (L.) is the principal vector for a variety of viral, bacterial, and protozoan pathogens causing a growing public-health issue over the past decades. However, a national density map of I. ricinus is still missing. Here, I. ricinus nymphs in Germany were investigated by compiling a high-resolution map depicting the mean annually accumulated nymphal density, as observed by monthly flagging an area of 100 m 2 Input data comprise ticks collected at 69 sampling sites. The model domain covers an area of about 357,000 km 2 (regional scale). Two negative binomial regression models were fitted to the data to interpolate the tick densities to unsampled locations using bioclimatic variables and land cover, which were selected according to their significance by the Akaike information criterion (AIC). The default model was fitted to the complete dataset resulting in AIC = 842. An optimized model resulted in a significantly better value of AIC = 732. Tick densities are very low in urban (green) areas. Maximum annual densities up to 1,000 nymphs per 100 m 2 are observed in broad-leaved forests. The tick maps were verified by leave-one-out cross-validation. Root mean square errors of RMSE = 137 and RMSE = 126 nymphs per 100 m 2 were estimated for the two models, respectively. These errors are of the order of the interannual variation of the tick densities. The compilation of a high-resolution density map of unfed nymphal I. ricinus for Germany provides a novel, nationwide insight into the distribution of an important disease vector. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  12. Synthesis of novel castor oil phosphonates

    Science.gov (United States)

    Castor oil has served as a versatile hydroxy fatty acid (HFA); its principle component, ricinoleic acid, can be isolated from castor oil and has been modified extensively for a number of applications. Additionally, phosphonates and their corresponding phosphonic acids are a functional moiety that ha...

  13. Weed management strategies for castor bean crops

    Directory of Open Access Journals (Sweden)

    Augusto Guerreiro Fontoura Costa

    2014-04-01

    Full Text Available Castor bean crops are agriculturally relevant due to the quality and versatility of their oil, both for the chemical industry and for biodiesel production. Proper weed management is important for both the cultivation and the yield of castor bean crops; therefore, the intention of the present work is to review pertinent information regarding weed management, including the studies regarding weed interference periods, chemical controls for use in different crop production systems and herbicide selectivity, for castor bean crops. Weed science research for castor bean crops is scarce. One of the main weed management challenges for castor bean crops is the absence of herbicides registered with the Ministry of Agriculture, Livestock and Food Supply (MALFS. Research for viable herbicides for weed control in castor bean crops should be directed by research and/or rural extension institutions, associations and farmers cooperatives, as well as by manufactures, for the registration of these selective herbicides, which would be primarily used to control eudicotyledons in castor bean crops. New studies involving the integration of weed control methods in castor bean also may increase the efficiency of weed management, for both small farmers using traditional crop methods in the Brazilian Northeast region, as well as for areas with the potential for large scale production, using conservation tillage systems, such as the no-tillage crop production system.

  14. Growth and production of castor bean under different levels of irrigation water salinity and nitrogen dosesCrescimento e produção da mamoneira cultivada sob diferentes níveis de salinidade da água de irrigação e doses de nitrogênio

    Directory of Open Access Journals (Sweden)

    Reginaldo Gomes Nobre

    2013-06-01

    Full Text Available The castor bean (Ricinus communis L. is a plant belonging to the family Euphorbiaceae, and stands for the rusticity and adaptation to adverse conditions of climate and soil, for the fast growth, high production and considerable oil content in its seeds. In this context, this study we conducted to evaluate the effect of different levels of irrigation water of salinity and nitrogen on the growth and yield of castor bean cv. BRS Energia. The experiment was conducted in lysimeters under field conditions, at the Centro de Ciências e Tecnologia Agroalimentar, of Universidade Federal de Campina Grande. A complete randomized block design in a 5 x 5 factorial design with three replications. Treatments included a combination of five levels of electrical conductivity of irrigation water (0.4, 1.4, 2.4, 3.4 and 4.4 dS m-1 and five doses of nitrogen (50, 75; 100, 125 and 150% of the recommended dose. The number of leaves, stem diameter, plant height, dry mass of stems and leaves, and fruit number in primary raceme of castor bean cv. BRS Energia were linearly and negatively affected by irrigation water salinity from 0.4 dS m-1, the dry mass of leaves and production of primary cluster are variables more sensitive to salt stress, increasing doses of nitrogen fertilization promoted at harvest, increase in dry weight of stem and leaves and number of fruit in primary cluster; applying increasing doses of nitrogen reduced the effect of salinity on stem diameter of castor bean cv. BRS Energia.A mamoneira (Ricinus communis L. é uma planta pertencente à família Euphorbiaceae que se destaca pela rusticidade e boa adaptação a condições adversas de clima e solo, apresentando rápido crescimento, elevada produção e considerável teor de óleo em suas sementes. Neste contexto, conduziuse esta pesquisa objetivando avaliar a influência da irrigação com água de diferentes concentrações salinas e doses de nitrogênio sobre o crescimento e a produção de

  15. In vitro micropropagation of almond (Amygdalus communis L. cv ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-06-17

    Jun 17, 2008 ... This method here in described will be useful for the rapid multiplication of almond (A. communis L. cv. Nonpareil) in commercial exploitation. Key words: Amygdalus communis L.cv. Nonpareil, micropropagation, zygotic embryos, in vitro. INTRODUCTION. The almond (Prunus dulcis, syn. Prunus amygdalus ...

  16. Labelling of castor oil for myocardial studies

    International Nuclear Information System (INIS)

    Hallaba, E.; Al-Suhybani, A.; Zaki, F.S.; Abdullah, M.E.

    1985-01-01

    The labelling of castor oil, hydrolysed castor oil and oleic acid was investigated by the iodine monochloride and chloramine-T methods. The effect of the iodinating agent and the concentration of castor oil on the labelling yield was studied. A comparative pharmacological study with analog aliphatic fatty acids was carried out. Castor oil labelled with iodine monochloride concentrated in the heart and liver in good proportion, better than other natural fatty acids and nearly equal to analog aliphatic fatty acids. An infra-red study showed that the OH group of the ricinoleic acid apparently protects the 125 I added on the double bond, with minor changes in biochemical properties and better uptake by the heart muscle. (author)

  17. Exotic Rickettsiae in Ixodes ricinus: fact or artifact?

    NARCIS (Netherlands)

    Tijsse-Klasen, E.; Fonville, M.; Overbeek, van L.S.; Reimerink, J.H.J.; Sprong, H.

    2010-01-01

    Several pathogenic Rickettsia species can be transmitted via Ixodes ricinus ticks to humans and animals. Surveys of I. ricinus for the presence of Rickettsiae using part of its 16S rRNA gene yield a plethora of new and different Rickettsia sequences. Interpreting these data is sometimes difficult

  18. Response of clarias gariepinus to dietary castor seeds processed by ...

    African Journals Online (AJOL)

    Castor seed variously treated by boiling, roasting, boiling and roasting, decorticated lyle treated, boiling and fermenting was tested for improved nutrient content and elimination of toxins. 10% processed castor seed cake (CSC) was included in diets and fed to 180 catfishes for 4-weeks to assay the dietary castor seed based ...

  19. 21 CFR 178.3280 - Castor oil, hydrogenated.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Castor oil, hydrogenated. 178.3280 Section 178.3280 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD... Certain Adjuvants and Production Aids § 178.3280 Castor oil, hydrogenated. Hydrogenated castor oil may be...

  20. 75 FR 44917 - Castor Oil, Ethoxylated, Dioleate; Tolerance Exemption

    Science.gov (United States)

    2010-07-30

    ... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 180 [EPA-HQ-OPP-2010-0232; FRL-8835-3] Castor Oil... castor oil, ethoxylated, dioleate; when used as an inert ingredient in a pesticide chemical formulation.... This regulation eliminates the need to establish a maximum permissible level for residues of castor oil...

  1. 75 FR 40751 - Castor Oil, Ethoxylated, Oleate; Tolerance Exemption

    Science.gov (United States)

    2010-07-14

    ... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 180 [EPA-HQ-OPP-2010-0231; FRL-8834-4] Castor Oil... castor oil, ethoxylated, oleate (CAS Reg. No. 220037-02-5) with a minimum number average molecular weight... regulation eliminates the need to establish a maximum permissible level for residues of castor oil...

  2. Potentials for Use of Medicinal Plants in Female Reproductive ...

    African Journals Online (AJOL)

    USER

    canadensis L.), and Chaste tree fruits (Vitex agnus- castus L.) are listed in the U. S. Pharmacopoeia and are available as dietary supplements to be used for premenstrual stress syndrome, as emmenagogue agents, and for gynaecological problems. Castor oil (Ricinus communis L.)18 and cotton bark root (Gossypium.

  3. MRI in soils: determination of water concent changes due to root water uptake by means of a multi-slice-multi-echo sequence (MSME)

    NARCIS (Netherlands)

    Pohlmeier, A.; Vergeldt, F.; Gerkema, E.; As, van H.; Dusschoten, van D.; Vereecken, H.

    2010-01-01

    Root water uptake by ricinus communis (castor bean) in fine sand was investigated using MRI with multiecho sampling. Before starting the experiments the plants germinated and grew for 3 weeks in a cylindrical container with a diameter of 9 cm. Immediately before the MRI experiments started, the

  4. Evaluation of the safety and efficacy of Lesquerella fendleri seed and oils as poultry feed additives

    Science.gov (United States)

    Lesquerella (Lesquerella fendleri (Gray) Wats) is an oil seed plant capable of growth over a large geographic area of the southwestern U.S. The seed oil contains hydroxyfatty acids, useful in a variety of industrial products, and can replace imported castor bean oil (Ricinus communis L.). Lesquere...

  5. Evaluation of some bioagents and botanicals in in vitro control of ...

    African Journals Online (AJOL)

    SERVER

    2008-04-03

    Apr 3, 2008 ... culture with the pathogen to monitor antagonistic effect. In another experiment, botanicals of tobacco. (Nicotiana tabacum) and castor plant (Ricinus communis) were incorporated as poison in a growth media. Of all the four bio-agents used, only P. fluorescens was able to inhibit the growth of the pathogen.

  6. Effects of graded levels of dehulled and cooked caster oil bean ...

    African Journals Online (AJOL)

    Anak strain) were used in an experiment to investigate the effects of dehulled and cooked castor oil bean (Ricinus communis L) meal supplemented with L-lysine on growth performance and certain blood parameters of broiler finishers. The birds ...

  7. Untitled

    Indian Academy of Sciences (India)

    their lipase content with a view to get cheap and active lipase on a large scale. The lipases are prepared from the following oilseeds according to. Longnecker and Haly's method and the different factors which control the activity of these lipases are studied--(1) Castor (Ricinus communis);. (2) Groundnut (Arachis hypogea); ...

  8. Effect of thermal processing methods on the proximate composition ...

    African Journals Online (AJOL)

    The nutritive value of raw and thermal processed castor oil seed (Ricinus communis) was investigated using the following parameters; proximate composition, gross energy, mineral constituents and ricin content. Three thermal processing methods; toasting, boiling and soaking-and-boiling were used in the processing of the ...

  9. The Relationship between Social Factors and the Poverty ...

    African Journals Online (AJOL)

    Ada Global

    The nutritive value of raw and thermal processed castor oil seed (Ricinus communis) was investigated using the following parameters; proximate composition, gross energy, mineral constituents and ricin content. Three thermal processing methods; toasting, boiling and soaking-and-boiling were used in the processing of the ...

  10. Efficacy of vegetable oils against dry bean beetles Acanthoscelides ...

    African Journals Online (AJOL)

    Acanthoscelides obtectus (Say) is a major pest of stored dry beans (Phaseolus vulgaris L.) and other legumes world wide. The objective of this study was to assess the efficacy of castor (Ricinus communis L.) and cottonseed (Gossypium hirsutum) oils against A. obtectus on stored dry beans under laboratory conditions.

  11. Amplification of the active site of BnLIP3 gene of Brassica napus L ...

    African Journals Online (AJOL)

    Utilisateur

    Until now, few data are available concerning molecular level of plant lipases. However, some lipases have been purified from seeds of several plants such as maize (Zea maize) (Lin et al., 1984), castor (Ricinus communis) (Fuchs et al., 1996), Cyprinus carpio (Han- liang et al., 2010) and iron weed (Vernonia galamensis).

  12. O hodowli in vitro wycinków z łodygi rącznika (Ricinus communis L. i wilczomlecza tyrlicza (Euphorbia lathyris L. [In vitro culture of segment from shoots of Ricinus communis L. and Euphorbia lathyris L.

    Directory of Open Access Journals (Sweden)

    B. Wojciechowska

    2015-01-01

    Full Text Available The influence of certain factors on the growth and differentiation of the material investigated was analysed. Histo- and organogenesis are discussed together with the anatomy of the coalescence of the segments.

  13. Descriptores botánicos para caracterizar germoplasmas de Ricinus communis de diferentes zonas de Costa Rica

    Directory of Open Access Journals (Sweden)

    Paola Solera-Steller

    2015-03-01

    Los resultados mostraron valores significativos para la longitud del racimo y el número de frutos por racimo, la razón largo/ancho del fruto, peso del fruto, la razón del largo/ancho de la semilla y el peso de la semilla, con correlaciones superiores a un 45%. Sin embargo, el ACP mostró que existe una alta variabilidad entre los datos, algo muy común entre individuos silvestres, debido principalmente a su forma de dispersión y a la gran cantidad de zonas de vida muestreadas. Para la CJA, se pudieron observar tres grupos ordenados principalmente por las correlaciones entre el tamaño del racimo y el número de frutos, la razón largo/ancho y el peso del fruto y la razón largo/ancho y peso de la semilla, los cuales pueden usarse como indicadores para la caracterización morfológica de la higuerilla proveniente de todo el país.

  14. Phloem flow and sugar transport in Ricinus communis L. is inhibited under anoxic conditions of shoot or roots

    NARCIS (Netherlands)

    Peuke, A.D.; Gessler, A.; Trumbore, S.; Windt, C.W.; Homan, N.; Gerkema, E.; As, van H.

    2015-01-01

    Anoxic conditions should hamper the transport of sugar in the phloem, as this is an active process. The canopy is a carbohydrate source and the roots are carbohydrate sinks.By fumigating the shoot with N2 or flooding the rhizosphere, anoxic conditions in the source or sink, respectively, were

  15. Toxicity of six plant extracts and two pyridine alkaloids from Ricinus communis against the malaria vector Anopheles gambiae

    Science.gov (United States)

    The African malaria vector, Anopheles gambiae s.s., is known to feed selectively on certain plants for sugar sources. However, the adaptive significance of this behavior especially on how the extracts of such plants impact on the fitness of this vector has not been explored. This study determined th...

  16. Tough Blends of Polylactide and Castor Oil

    Energy Technology Data Exchange (ETDEWEB)

    Robertson, Megan L.; Paxton, Jessica M.; Hillmyer, Marc A. (UMM)

    2012-10-10

    Poly(l-lactide) (PLLA) is a renewable resource polymer derived from plant sugars with several commercial applications. Broader implementation of the material is limited due to its inherent brittleness. We show that the addition of 5 wt % castor oil to PLLA significantly enhances the overall tensile toughness with minimal reductions in the modulus and no plasticization of the PLLA matrix. In addition, we used poly(ricinoleic acid)-PLLA diblock copolymers, synthesized entirely from renewable resources, as compatibilizers for the PLLA/castor oil blends. Ricinoleic acid, the majority fatty acid comprising castor oil, was polymerized through a lipase-catalyzed condensation reaction. The resulting polymers contained a hydroxyl end-group that was subsequently used to initiate the ring-opening polymerization of L-lactide. The binary PLLA/castor oil blend exhibited a tensile toughness seven times greater than neat PLLA. The addition of block copolymer allowed for control over the morphology of the blends, and even further improvement in the tensile toughness was realized - an order of magnitude larger than that of neat PLLA.

  17. Phenylpropanoid esters of lesquerella and castor oil

    Science.gov (United States)

    Lesquerella (LO) and castor oil (CO) were esterified at the secondary hydroxyl groups of their 14-hydroxyeicos-cis-11-enoic fatty acids and 12-hydroxyoctadec-cis-9-enoic fatty acids, respectively, with 4-acetoxy-3-methoxycinnamic acid (acetoxyferulic acid). The unconventional esterifications were co...

  18. Tough blends of polylactide and castor oil.

    Science.gov (United States)

    Robertson, Megan L; Paxton, Jessica M; Hillmyer, Marc A

    2011-09-01

    Poly(l-lactide) (PLLA) is a renewable resource polymer derived from plant sugars with several commercial applications. Broader implementation of the material is limited due to its inherent brittleness. We show that the addition of 5 wt % castor oil to PLLA significantly enhances the overall tensile toughness with minimal reductions in the modulus and no plasticization of the PLLA matrix. In addition, we used poly(ricinoleic acid)-PLLA diblock copolymers, synthesized entirely from renewable resources, as compatibilizers for the PLLA/castor oil blends. Ricinoleic acid, the majority fatty acid comprising castor oil, was polymerized through a lipase-catalyzed condensation reaction. The resulting polymers contained a hydroxyl end-group that was subsequently used to initiate the ring-opening polymerization of l-lactide. The binary PLLA/castor oil blend exhibited a tensile toughness seven times greater than neat PLLA. The addition of block copolymer allowed for control over the morphology of the blends, and even further improvement in the tensile toughness was realized-an order of magnitude larger than that of neat PLLA.

  19. Babesia species in questing Ixodes ricinus, Sweden.

    Science.gov (United States)

    Karlsson, Maria E; Andersson, Martin O

    2016-02-01

    Babesiosis is an emerging tick-transmitted zoonosis in large parts of the world. In Sweden, the occurrence and diversity of Babesia species is largely unknown. In order to estimate the exposure to Babesia from infected ticks, we collected questing Ixodes ricinus from several sites across southern Sweden during two consecutive field seasons and investigated the occurrence of Babesia species. We report for the first time the occurrence of the zoonotic species Babesia venatorum in Swedish ticks, with a prevalence of 1%. We also detected B. microti (prevalence 3.2%) and B. divergens (prevalence 0.2%). The incidence of Babesia in questing ticks is substantially lower than that of several other tick-borne diseases in Sweden. Nevertheless, babesiosis should not be neglected as a possible diagnosis following tick bites in humans and animals in Sweden. Copyright © 2015 Elsevier GmbH. All rights reserved.

  20. PHYSIOLOGIC AND SANITARY QUALITY OF CASTOR BEAN SEEDS UNDER DIFFERENT CHEMICAL TREATMENTS QUALIDADE FISIOLÓGICA E SANITÁRIA DE SEMENTES DE MAMONA SUBMETIDAS A DIFERENTES TRATAMENTOS QUÍMICOS

    Directory of Open Access Journals (Sweden)

    Manoel Murilo Macedo Barbosa

    2009-12-01

    ="en-US" align="JUSTIFY">KEY-WORDS: Ricinus communis L.; seeds pathogens; carbendazim; carboxim; thiram.

    O tratamento de sementes com fungicidas tornou-se medida indispensável no controle de patógenos. Entretanto, a eficácia de muitos produtos ainda não é bem conhecida para algumas culturas. Este trabalho teve por objetivo avaliar o efeito de diferentes doses dos fungicidas carbendazim e carboxim + thiram no controle de patógenos e sua interferência sobre a qualidade fisiológica em sementes de mamona. O ensaio foi constituído dos seguintes tratamentos (gramas do ingrediente ativo por 100 kg de sementes: carbendazim (15, 30 e 60, carboxim + thiram (25 + 25, 50 + 50, 100 + 100, formoldeído 0,15% (v/v e testemunha (água destilada. A qualidade fisiológica das sementes foi determinada pela germinação, primeira contagem, emergência a campo, índice de velocidade de emergência (IVE, número de folhas, comprimento, massa verde e seca da parte aérea e condutividade elétrica. Não houve diferenças estatísticas entre os tratamentos, nas avaliações de germinação, IVE, número de folhas, comprimento, massa verde e seca da parte aérea. O tratamento com formoldeído, se comparado aos demais, proporcionou menores médias (p < 0,05 para a primeira contagem e emergência a campo. Sementes tratadas com fungicidas apresentaram maior condutividade elétrica. Os fungos identificados foram Cladosporium spp.; Bipolaris spp.;

  1. Evaluation of Anti-Acetylcholinesterase Activity and Antioxidant Potential of Ricinine (a Central Nervous System Stimulant) Isolated from Ricinius communis

    International Nuclear Information System (INIS)

    Khan, B.; Rasheed, A.; Yasin, K.A.; Ahmed, M.N.; Ghous, T.; Andleeb, S.

    2016-01-01

    In the current research, an attempt has been made to isolate ricinine (an alkaloid) from the leaves of Ricinus communis L. for its possible applications in the prevention and treatment of Alzheimer's disease. The anti-acetylcholinesterase (anti-AChE) and antioxidant activity of ricinine was determined. Antioxidant and metal chelating activity was evaluated by 2,2-azinobis-(3-ethylbenzothiazoline-6-sulfonic acid) radical cation (ABTS./sup +/) decolorisation and ferrozine metal chelating assays. Screening of the AChE inhibitory activity by flow injection method showed significant inhibitory action with IC/sub 50/ values of 54.5 μg/ml. The stronger ABTS.+ scavenging potential (IC/sub 50/ 63.80μg/ml) as well as metal chelating potential (IC/sub 50/ 31.27 μg/ml) of ricinine was observed. We conclude that because of high yield (4mg/200g of dried material), the compound may be considered as a promising cognition-enhancing drug for the treatment and prevention of human dementia. (author)

  2. Evaluation of the antidiarrheal activity of the leaf extracts of Myrtus communis Linn (Myrtaceae) in mice model.

    Science.gov (United States)

    Sisay, Mekonnen; Engidawork, Ephrem; Shibeshi, Workineh

    2017-02-10

    Myrtus communis L. has a folkloric repute for the management of diarrhea and dysentery in different parts of the world. However, the safety and efficacy of the leaf extract have not been scientifically validated in animal model. This study was, therefore, aimed to investigate the antidiarrheal effect of 80% methanol extract (80ME) and solvent fractions of the leaves of Myrtus communis L. in mice. The antidiarrheal activity of the 80ME and solvent fractions was evaluated against castor oil induced diarrheal model, charcoal meal and enteropooling tests. For the 80%ME, the test groups received 100, 200 and 400 mg/kg of the extract. In case of fractions, the test groups received various doses of fractions (200, 300, 400 mg/kg and an additional dose of 800 mg/kg for the aqueous fraction (AF)), where as negative controls received the vehicle (10 ml/kg) and positive controls received loperamide (3 mg/kg). The 80ME at 200 mg/kg (p < 0.05) & 400 mg/kg (p < 0.01) as well as the chloroform fraction (CF) and methanol fraction (MF) at 400 mg/kg (p < 0.05) significantly delayed the onset of diarrhea. Besides, the 80ME (at all tested doses) and both of these fractions (at 300 & 400 mg/kg) significantly decreased the frequency and weight of fecal outputs. Results from the charcoal meal test revealed that the 80ME, at all doses, (p < 0.001) as well as the CF and MF at 300 mg/kg (p < 0.05) & 400 mg/kg (p < 0.001) produced a significant anti-motility effect. Similarly, in the entero-pooling test, the 80ME (at all tested doses) (p < 0.01) as well as the CF and MF (at 300 & 400 mg/kg, p < 0.05) produced a significant decline in the weight and volume of intestinal contents, whereas the AF revealed significant effect (p < 0.05) at dose of 800 mg/kg only. The study demonstrated that the 80ME and solvent fractions contain bioactive constituents that have antidiarrheal activity. Therefore, this study provides a scientific support for the

  3. Optimization of biodiesel production from castor oil.

    Science.gov (United States)

    da Silva, Nivea de Lima; Maciel, Maria Regina Wolf; Batistella, César Benedito; Maciel Filho, Rubens

    2006-01-01

    The transesterification of castor oil with ethanol in the presence of sodium ethoxide as catalyst is an exceptional option for the Brazilian biodiesel production, because the castor nut is quite available in the country. Chemically, its oil contains about 90% of ricinoleic acid that gives to the oil some beneficial characteristics such as its alcohol solubility at 30 degrees C. The transesterification variables studied in this work were reaction temperature, catalyst concentration and alcohol oil molar ratio. Through a star configuration experimental design with central points, this study shows that it is possible to achieve the same conversion of esters carrying out the transesterification reaction with a smaller alcohol quantity, and a new methodology was developed to obtain high purity biodiesel.

  4. Agronomically valuable mutant lines of castor

    International Nuclear Information System (INIS)

    Bokhan, I.K.

    1990-01-01

    Dry seeds of four castor varieties (VNIIMK 165-improved, VNIIMK 18, Chervonnaya and Antika) were treated with six chemical mutagens, N-nitroso-N-methyl urea (NMU), N-nitroso-N-ethyl urea (NEU), dimethyl sulphate (DMS), diethyl sulphate (DES), ethylenimine (EI) and 1,4-bis-diazoacetyl-butane (DAB) in various doses during 18 hours. About 40,000 plants were studied in M 2 and 80 types of mutations were found, including a number of valuable mutants: short-stemmed, semi-dwarf, dwarf, early maturing, with female and interspersed types of racemes, highly productive etc. Based on trials in M 3 -M 4 , on small plots with two or three replications, the superior mutant lines were identified. The best mutants are presented in the table. Early maturation is very important for growing castor in the USSR, as it is the predecessor of winter wheat in crop rotation. The mutants M2-323 and Ml-83 are of great value as they show early maturation and high yield. Their productivity is mainly conditioned by a high percentage of interspersed plants. The reduction of plant height is of great importance for the successful combine harvesting of castor. Mutant lines M2-119 and Ml-284 characterised by low plant height and high yield are very interesting in this respect. The obtained initial material will be used in further breeding work

  5. Synthesis of branched naphthoquinones from castor oil

    Directory of Open Access Journals (Sweden)

    Adriano Olímpio da Silva

    2012-06-01

    Full Text Available The naphthoquinones are cyclic aromatic α,β-dienonas with a basic framework derived from naphthalene. They are also found in many higher plants, algae, fungi and as the product of the  metabolism  of some  bacteria  having large biologica activity described in the literature such as antibacterial, anti-inflammatory, antitumor, anticancer and trypanocidal [1-3]. Castor oil is an abundant raw material in Brazil of great versatility and, it is present in biodiesel production, surfactants, cosmetics and others. Considering the importance of naphthoquinones and, the availability of the ricinoleic acid from castor oil, the aim of this study was the preparation of new branched naphthoquinones in order to test their trypanocidal activity. Castor oil was submitted to saponification with sodium hydroxide, ethanol and water under reflux for 6 h. We then carried out an acid hydrolysis with hydrochloric acid and the formed ricinoleic acid was extracted with ethyl acetate. Following, through Kochi-Anderson addition reaction it was performed the alkylation of a naphthoquinone 1 and 2, using ammonium persulfate, silver nitrate, acetonitrile and water, under heating at 70-80 ° C during 3 h, to give the branched naphthoquinones 4 and 5 (scheme 1. The naphthoquinone 3 will be similarly submitted to this procedure. The naphthoquinones 4 and 5 were purified by column chromatography on sílica gel using hexane as the eluent. The compounds were characterized by mass spectrometry and 1H and 13CNMR spectroscopy.

  6. LHCb: CASTORFS - A Filesystem to Access CASTOR

    CERN Multimedia

    Mazurov, A

    2009-01-01

    CASTOR provides a powerful and rich interface for managing files and pools of files backed by tape-storage. The API is modelled very closely on that of a POSIX filesystem, where part of the actual I/O part is handled by the rfio library. While the API is very close to POSIX it is still separated, which unfortunately makes it impossible to use standard tools and scripts straight away. This is particularly inconvenient when applications are written in languages other than C/C++ such as is frequently the case in web-apps. Here up to now the only the recourse was to use command-line utilities and parse their output, which is clearly a kludge. We have implemented a complete POSIX filesystem to access CASTOR using FUSE (Filesystem in Userspace) and have successfully tested and used this on SLC4 and SLC5 (both in 32 and 64 bit). We call it CastorFS. In this paper we will present its architecture and implementation, with emphasis on performance and caching aspects.

  7. Antimicrobial activity of the essential oil of Myrtus Communis L ...

    African Journals Online (AJOL)

    The development of microbial resistance to antibiotics is a global concern. The present study was carried out to determine the composition and the antimicrobial potential of the essential oil of Myrtus communis L. against 13 pathogenic strains responsible of many infections. The results show that levels of MIC observed ...

  8. Spatiotemporal features of microsporogenesis in the cycad species Macrozamia communis.

    Science.gov (United States)

    Yan, Xiaodong; Bai, Mei; Ning, Xiping; Ouyang, Haibo; Zhang, Shouzhou; Yang, Ming; Wu, Hong

    2015-07-01

    • Spatiotemporal features of microsporogenesis may provide important clues about the evolution of microsporogenesis in seed plants. One cellular feature that attracts special attention is advance cell wall ingrowths (ACWIs) at future cytokinetic sites in microsporocytes since they have been found only in species of an ancient lineage of angiosperms, Magnolia, and in much less detail, of an ancient lineage of gymnosperms, cycads. Further investigation into microsporogenesis in a cycad species may yield knowledge critical to understanding the establishment of ACWIs as an important feature for comparative studies of microsporogenesis in seed plants.• Bright-field and epifluorescence microscopy, confocal laser scanning microscopy, and transmission electron microscopy were used to investigate the microsporogenic process in Macrozamia communis, a species in the Zamiaceae family of cycads.• In prophase-II microsporocytes in M. communis, ACWIs form as a callose ring between the newly formed nuclei and are not accompanied by cytokinetic apparatuses such as mini-phragmoplasts, wide tubules, or wide tubular networks. Shortly after the second nuclear division, new ACWIs, albeit thinner than the previous ACWIs, form between the newly formed nuclei. Subsequent cell plate formation in the planes of the ACWIs typically results in tetragonal tetrads.• Cytokinesis at the cell periphery is initiated earlier than cell plate formation in the cell interior in microsporogenesis in M. communis. The cellular features uncovered in M. communis may serve as useful reference features for comparative studies of microsporogenesis in plants. © 2015 Botanical Society of America, Inc.

  9. Synthesis and characterization of castor oil-based polyurethane for ...

    Indian Academy of Sciences (India)

    Polyurethane (PU) based on polyol, derived from castor oil has been synthesized and characterized for potential use as a base material for electrolytes. Transesterification process of castor oil formed a polyol with hydroxyl value of 190 mg KOH g–1 and molecular weight of 2786 g mol–1. The polyols together with 4 ...

  10. Synthesis and characterization of castor oil-based polyurethane for ...

    Indian Academy of Sciences (India)

    Administrator

    adhesives and thermal insulation.14–16 However, modifica- tion of PU for use as host in polymer electrolytes has not ... is no report related to the potential of castor oil-polyol- based PU as host in polymer electrolytes. ... The reactor was filled with castor oil and 15 wt% of gly- cerol was added to it. The percentage of the ...

  11. Novel alpha-hydroxy phosphonic acids via castor oil

    Science.gov (United States)

    Hydroxy fatty acids (HFAs) have found a number of uses in today’s market, with uses ranging from materials to pharmaceuticals. Castor oil has served as a versatile HFA; its principle component, ricinoleic acid, can be isolated from castor oil and has been modified extensively for a number of applica...

  12. Synthesis and characterization of castor oil-based polyurethane

    Indian Academy of Sciences (India)

    Polyurethane (PU) based on polyol, derived from castor oil has been synthesized and characterized for potential use as a base material for electrolytes. Transesterification process of castor oil formed a polyol with hydroxyl value of 190 mg KOH g–1 and molecular weight of 2786 g mol–1. The polyols together with 4 ...

  13. Synthesis and characterization of castor oil based polyurethane ...

    Indian Academy of Sciences (India)

    Unknown

    Abstract. A series of interpenetrating polymer networks (IPNs) of castor oil based polyurethane/polyacrylo- nitrile (PU/PAN: 80/20, 60/40, 50/50, 40/60 and 20/80) were synthesized by condensation reaction of castor oil with methylene diisocyanate and acrylonitrile, employing benzoyl peroxide (BPO) and ethylene glycol ...

  14. Registration of Crop Varieties A Unique Purple Castor (Racinnus ...

    African Journals Online (AJOL)

    Most of the castor produced in Russia,. USA, Israel, Brazil, China and India comes from hybrid varieties. In 1999 a unique purple castor population was noticed during a field trip at. Adullala near Melkassa. One killo gram of seed was abstained from the farmer, and mass selection for uniformity, top branching and short plant.

  15. Synthesis and characterization of castor oil-based polyurethane for ...

    Indian Academy of Sciences (India)

    Administrator

    Abstract. Polyurethane (PU) based on polyol, derived from castor oil has been synthesized and characterized for potential use as a base material for electrolytes. Transesterification process of castor oil formed a polyol with hydroxyl value of 190 mg KOH g–1 and molecular weight of 2786 g mol–1. The polyols together with.

  16. Interpenetrating polymer networks based on polyol modified castor ...

    Indian Academy of Sciences (India)

    Unknown

    glycerol modification of castor oil results in more crosslinked and stiffer IPNs possessing better mechanical properties over that of unmodified castor oil polyurethane/. PHEMA IPNs. 3.5 Chemical resistance. The percentage weight loss of IPNs were determined in. H2SO4, CH3COOH, HCl, HNO3, NaCl and NaOH etc and.

  17. Castor halls. A problem for the century; Castor-Hallen. Ein Jahrhundertproblem

    Energy Technology Data Exchange (ETDEWEB)

    Stay, Jochen

    2017-01-15

    The interim storage of high-level radioactive waste will last longer than asserted. The existing halls for the castor casks are not appropriate for this task with respect to safety. The casks themselves are not designed for long-term storage. Politics obviously do not consider the problems seriously.

  18. Essential oil composition and antioxidant activity of two Juniperus communis L. varieties growing wild in Serbia

    Directory of Open Access Journals (Sweden)

    Rajčević Nemanja F.

    2016-01-01

    Full Text Available The genus Juniperus L. (Cupressaceae consists of ca. 67 species and 34 varieties. Juniperus communis L. grows on dry hills or mountainous tracts and is widely distributed in the northern hemisphere. A typical variety J. communis L. var. communis was collected in Deliblatska peščara (Deliblato Sands and variety J. communis L. var. saxatilis Pall. in Kopaonik Mountain. Needle essential oils were obtained using Clevenger apparatus and analyzed using GC/MS and GC/FID. Antioxidant activity of essential oils was evaluated using DPPH assay. A total of 78 compounds were detected and identified. Both oils are characterized by high abundance of monoterpenes. The main constituents of J. communis var. communis essential oil were sabinene (39.4%, α-pinene (13.3%, myrcene (4.7% and terpinen-4-ol (3.7%, while J. communis var. saxatilis essential oil had α-pinene (34.9%, sabinene (20.3%, δ-3-carene (6.4% and germacrene B (6.3% as the most abundant components. DPPH test showed IC50 values 0.66 mg/ml for J. communis var. communis and 0.32 mg/ml for J. communis var. saxatilis. Although antioxidant activity was weaker than used standards (BHT and L-ascorbic acid it is still significant.

  19. Castor Oil Transesterification Catalysed by Liquid Enzymes

    DEFF Research Database (Denmark)

    Andrade, Thalles; Errico, Massimiliano; Christensen, Knud Villy

    2017-01-01

    In the present work, biodiesel production by reaction of non-edible castor oil with methanol under enzymatic catalysis is investigated. Two liquid enzymes were tested: Eversa Transform and Resinase HT. Reactions were performed at 35 °C and with a molar ratio of methanol to oil of 6:1. The reaction...... and fully reused; in the latter, a mixture of 50 % reused and 50 % fresh enzymes was tested. In the case of total reuse after three cycles, both enzymes achieved only low conversions. The biodiesel content in the oil-phase using Eversa Transform was 94.21 % for the first cycle, 68.39 % in the second, and 33...

  20. The extensible alloscutal cuticle of the tick, Ixodes ricinus

    DEFF Research Database (Denmark)

    Andersen, Svend Olav; Roepstorff, Peter

    2005-01-01

    The proteins in the distensible alloscutal cuticle of the blood-feeding tick, Ixodes ricinus, have been characterized by electrophoresis and chromatography, two of the proteins were purified and their total amino acid sequence determined. They show sequence similarity to cuticular proteins from...

  1. Rickettsiae in questing Ixodes ricinus ticks in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Venclíková, Kristýna; Rudolf, Ivo; Mendel, Jan; Betášová, Lenka; Hubálek, Zdeněk

    2014-01-01

    Roč. 5, č. 2 (2014), s. 135-138 ISSN 1877-959X Institutional support: RVO:68081766 Keywords : Ixodes ricinus * Anaplasma phagocytophilum * Rickettsia spp. * Rickettsia helvetica * Rickettsia monacensis * Candidatus Neoehrlichia mikurensis Subject RIV: EE - Microbiology, Virology Impact factor: 2.718, year: 2014

  2. Identification of Salp15 homologues in Ixodes ricinus ticks

    NARCIS (Netherlands)

    Hovius, J. W. R.; Ramamoorthi, N.; van't Veer, C.; de Groot, K. A.; Nijhof, A. M.; Jongejan, F.; van Dam, A. P.; Fikrig, E.

    2007-01-01

    The 15-kDa Ixodes scapularis salivary gland protein Salp15 protects Borrelia burgdorferi sensu stricto from antibody-mediated killing and facilitates infection of the mammalian host. In addition, Salp 15 has been shown to inhibit T-cell activation. We determined whether Ixodes ricinus, the major

  3. Truncus arteriosus communis in combination with cor triatriatum sinsitrum.

    Science.gov (United States)

    Klusmeier, Elmar; Haas, Nikolaus A; Sandica, Eugen

    2016-01-01

    Truncus arteriosus communis is a rare CHD, accounting for only 1% of all congenital cardiac abnormalities. It has been associated with other malformations of the heart, mainly truncal valve (bicuspid/quadricuspid) and aortic arch abnormalities such as right, interrupted, and hypoplastic aortic arch. Cor tratriatrum sinistrum is another rare CHD, and it has been associated with other cardiac defects such as anomalous pulmonary venous drainage, ventricular septal defect, coarctation of the aorta, and tetralogy of Fallot. The combination of truncus arteriosus communis and cor tratriatrum sinistrum has not been reported so far. This case study describes the diagnosis of a unique case, including these two very rare cardiac defects and the successful surgical treatment thereafter.

  4. Castor oil for induction of labour: a retrospective study.

    Science.gov (United States)

    Neri, Isabella; Dante, Giulia; Pignatti, Lucrezia; Salvioli, Chiara; Facchinetti, Fabio

    2018-08-01

    The aim of this study is to investigate the safety and efficacy of castor oil to induce labour. A retrospective observational case control study was conducted over five years. Castor oil was proposed to women referred to the Birth Centre (Castor Oil group (COG)). They were compared to women who chose to be followed by the traditional doctor-led unit (control group (CG)). Castor oil was administered in a 60 ml single dose in 200 ml of warm water. Inclusion criteria were gestational age between 40 and 41 weeks plus premature rupture of membranes between 12 and 18 hours or amniotic fluid index ≤4 or Bishop Score of ≤4 or absence of spontaneous labour over 41 + 4 weeks. Pharmacological induction of labour was required for 18 women in the COG (45%) and 36 in the CG (90%) (p castor oil showed a higher incidence of vaginal delivery, whereas the incidence of caesarean section was lower in the COG, but no statistical significance was reached. The use of castor oil is related to a higher probability of labour initiation within 24 hours. Castor oil can be considered a safe non-pharmacological method for labour induction.

  5. Diversity of Babesia in Ixodes ricinus ticks in Poland.

    Science.gov (United States)

    Welc-Falęciak, R; Bajer, A; Paziewska-Harris, A; Baumann-Popczyk, A; Siński, E

    2012-01-01

    The aims of this study were: (1) to estimate Babesia prevalence in the most common species of tick in Poland, Ixodes ricinus, in two recreational areas (Urwitałt in the Mazury Lake District and Bielański Forest in Warsaw), and (2) to evaluate the molecular diversity of Babesia isolates in questing I. ricinus in Poland. Questing ticks were collected from vegetation in forest areas in Urwitałt near Mikołajki and in Bielański Forest (Warsaw). Purified genomic DNA was used with specific primers to amplify a fragment of the Babesia spp. 18S rRNA gene. Tick-drag indices for I. ricinus were high in both study areas, reaching somewhat higher values in Urwitałt than in Bielański Forest. The overall prevalence of Babesia spp. in examined ticks was 1.6%. In Urwitałt, two strains of B. microti were identified using rRNA sequences: the enzootic Munich strain and an isolate close to the zoonotic Jena strain. The proportion of infections due to these two strains in questing ticks reversed over a six-year period. During 3 years of study in Bielański Forest, all Babesia isolates obtained from I. ricinus were identical to Babesia sp. EU1 (B. venatorum), previously recognized as an agent of human babesiosis. This study has confirmed the presence of enzoonotic and zoonotic Babesia species/strains in the abundant human-biting tick I. ricinus in recreational areas in Poland. It has also shown that the distribution of different genotypes has changed over time, however the reasons for these fluctuations still remain to be investigated.

  6. Castor Oil Based Polyurethanes: Synthesis and Characterization

    Science.gov (United States)

    Macalino, AD; Salen, VA; Reyes, LQ

    2017-09-01

    In this study, polyurethanes based on castor oil and 1,6-hexamethylene diisocyanate (HMDI) were synthesized with varying weight ratio of the castor oil and HMDI. The formation of urethane linkages was verified through the use of a fourier transform infrared spectroscopy (FTIR). The hydrophilicity of the films was evaluated through the use of a contact angle meter and it was found that the contact angle of all the films were below 90 degrees which confirms their hydrophilicity. The thermal stability of the PU films were studies through the use of a thermal gravimetric analyzer and found that all of the polyurethane films exhibited two weight loss events at elevated temperatures wherein the first weight loss event was observed to occur at 285°C to 384°C while the second weight loss event was observed at around 521°C to 551°C. The hardness, elastic modulus, and tensile elongation of the PU films were determined by using a universal testing machine (UTM) where it was found out that the hardness and the elastic modulus of the film is directly proportional with HMDI loading while the tensile elongation is inversely proportional to it. Lastly, it was known through the swelling studies of the PU films that it does not swell, this is due to the presence of unreacted triglycerides in the material, which prevents water from permeating to the films.

  7. Viability Prediction of Ricinus cummunis L. Seeds Using Multispectral Imaging

    DEFF Research Database (Denmark)

    Olesen, Merete Halkjær; Nikneshan, Pejman; Shrestha, Santosh

    2015-01-01

    The purpose of this study was to highlight the use of multispectral imaging in seed quality testing of castor seeds. Visually, 120 seeds were divided into three classes: yellow, grey and black seeds. Thereafter, images at 19 different wavelengths ranging from 375–970 nm were captured of all the s...

  8. Modified Castor Oil as an Epoxy Resin Curing Agent

    Directory of Open Access Journals (Sweden)

    B. P. Patel

    2004-01-01

    Full Text Available A castor oil, an agricultural product, is an unsaturated material. Hence the castor oil is brominated by bromine liquid. The brominated castor oil (BCO was then reacted with excess of aliphatic diamines viz; ethylene diamine, 1,3-propane diamine and 1,6-hexane diamine. The resultant amino functionalized castor oil (ACO samples were then characterized by elemental analysis, IR spectral study and number of amino groups. All the three ACO samples were then employed for the curing of commercial Brominated epoxy resin. The curing of epoxy resin by ACO was monitored on differential scanning calorimeter (DSC and based on the DSC study their glass fibre reinforced composites (GRC were fabricated. The cured samples (i.e. unreinforced were also subjected to thermo gravimetric analysis (TGA. The chemical, mechanical and electrical properties of the glass fibre reinforced composites (GRC were also evaluated.

  9. Production of Detergent from Castor Oil

    Directory of Open Access Journals (Sweden)

    Abubakar Garba ISAH

    2006-07-01

    Full Text Available This research work was carried out with the objective of extraction of oil from castor seeds and its utilization to produce a synthetic detergent. Solvent extraction method was employed in extracting the oil and the total percent oil yield was found to be 23.8%. The experimentally determined saponification value of the oil was 183.7275mgKOH/g of oil. The detergent efficiency, determined as a measure of the foamability of the detergent was found to be 2.6cm. The pH tests revealed mildly basic properties. The color, scent and efficiency of the detergent were improved with the addition of bleaching agent, perfume and foaming agents respectively.

  10. The Castor 120 (TM) motor: Development and qualification testing results

    Science.gov (United States)

    Hilden, Jack G.; Poirer, Beverly M.

    1993-01-01

    This paper discusses Thiokol Corporation's static test results for the development and qualification program of the Castor 120(TM) motor. The demonstration program began with a 25,000-pound motor to demonstrate the new technologies and processes that would be used on the larger Castor 120(TM) motor. The Castor 120(TM) motor was designed to be applicable as a first stage, second stage, or strap-on motor. Static test results from the Castor 25 and two Castor 120(TM) motors are discussed in this paper. The results verified the feasibility of tailoring the propellant grain configuration and nozzle throat diameter to meet various customer requirements. The first and second motors were conditioned successfully at ambient temperature and 28 F, respectively, to demonstrate that the design could handle a wide range of environmental launch conditions. Furthermore, the second Castor 120(TM) motor demonstrated a systems tunnel and forward skirt extension to verify flight-ready stage hardware. It is anticipated that the first flight motor will be ready by the fall of 1994.

  11. Borreliae in Ixodes ricinus ticks feeding on humans

    Czech Academy of Sciences Publication Activity Database

    Hubálek, Zdeněk; Halouzka, Jiří; Juřicová, Zina

    2004-01-01

    Roč. 18, č. 3 (2004), s. 228-231 ISSN 0269-283X R&D Projects: GA ČR GA206/03/0726; GA AV ČR IBS6093007 Institutional research plan: CEZ:AV0Z6093917 Keywords : Borrelia burgdorferi * Ixodes ricinus * Lyme disease Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology Impact factor: 1.405, year: 2004

  12. Longitudinal surveillance of the tick Ixodes ricinus for borreliae

    Czech Academy of Sciences Publication Activity Database

    Hubálek, Zdeněk; Halouzka, Jiří; Juřicová, Zina

    2003-01-01

    Roč. 17, č. 1 (2003), s. 46-51 ISSN 0269-283X R&D Projects: GA ČR GA206/00/1204; GA AV ČR IBS6093007 Institutional research plan: CEZ:AV0Z6093917 Keywords : Borrelia burgdorferi * Ixodes ricinus * Lyme disease Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology Impact factor: 1.040, year: 2003

  13. Ixodes ricinus defensins attack distantly-related pathogens

    Czech Academy of Sciences Publication Activity Database

    Tonk, M.; Cabezas-Cruz, A.; Valdés, James J.; Rego, Ryan O. M.; Grubhoffer, Libor; Estrada--Pena, A.; Vilcinskas, A.; Kotsyfakis, Michalis; Rahnamaeian, M.

    2015-01-01

    Roč. 53, č. 2 (2015), s. 358-365 ISSN 0145-305X R&D Projects: GA MŠk(CZ) EE2.3.30.0032; GA ČR GAP502/12/2409 EU Projects: European Commission(XE) 278976 Institutional support: RVO:60077344 Keywords : Antimicrobial peptide * Defensin * Ixodes ricinus * Listeria monocytogenes * Staphylococcus aureus * Staphylococcus epidermidis * Escherichia coli * Pseudomonas aeruginosa * Fusarium spp Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.620, year: 2015

  14. Castor Oil: Properties, Uses, and Optimization of Processing Parameters in Commercial Production.

    Science.gov (United States)

    Patel, Vinay R; Dumancas, Gerard G; Kasi Viswanath, Lakshmi C; Maples, Randall; Subong, Bryan John J

    2016-01-01

    Castor oil, produced from castor beans, has long been considered to be of important commercial value primarily for the manufacturing of soaps, lubricants, and coatings, among others. Global castor oil production is concentrated primarily in a small geographic region of Gujarat in Western India. This region is favorable due to its labor-intensive cultivation method and subtropical climate conditions. Entrepreneurs and castor processors in the United States and South America also cultivate castor beans but are faced with the challenge of achieving high castor oil production efficiency, as well as obtaining the desired oil quality. In this manuscript, we provide a detailed analysis of novel processing methods involved in castor oil production. We discuss novel processing methods by explaining specific processing parameters involved in castor oil production.

  15. Castor oil for induction of labour: not harmful, not helpful.

    Science.gov (United States)

    Boel, Machteld Elisabeth; Lee, Sue Jean; Rijken, Marcus Johannes; Paw, Moo Koo; Pimanpanarak, Mupawjay; Tan, Saw Oo; Singhasivanon, Pratap; Nosten, François; McGready, Rose

    2009-10-01

    Castor oil is one of the most popular drugs for induction of labour in a non-medical setting; however, published data on safety and effectiveness of this compound to induce labour remain sparse. To assess the safety and effectiveness of castor oil for induction of labour in pregnancies with an ultrasound estimated gestational at birth of more than 40 weeks. Data were extracted from hospital-based records of all pregnant women who attended antenatal clinics on the Thai-Burmese border and who were more than 40 weeks pregnant. The effectiveness of castor oil to induce labour was expressed as time to birth and analysed with a Cox proportional hazards regression model. Measures associated with safety were fetal distress, meconium-stained amniotic fluid, tachysystole of the uterus, uterine rupture, abnormal maternal blood pressure during labour, Apgar scores, neonatal resuscitation, stillbirth, post-partum haemorrhage, severe diarrhoea and maternal death. Proportions were compared using Fisher's exact test. Of 612 women with a gestation of more than 40 weeks, 205 received castor oil for induction and 407 did not. The time to birth was not significantly different between the two groups (hazard ratio 0.99 (95% confidence interval: 0.81 to 1.20; n = 509)). Castor oil use was not associated with any harmful effects on the mother or fetus. Castor oil for induction of labour had no effect on time to birth nor were there any harmful effects observed in this large series. Our findings leave no justification for recommending castor oil for this purpose.

  16. Surveillance of Ixodes ricinus ticks (Acari: Ixodidae) in Iceland.

    Science.gov (United States)

    Alfredsson, Matthias; Olafsson, Erling; Eydal, Matthias; Unnsteinsdottir, Ester Rut; Hansford, Kayleigh; Wint, William; Alexander, Neil; Medlock, Jolyon M

    2017-10-10

    Ixodes ricinus is a three-host tick, a principal vector of Borrelia burgdorferi (s.l.) and one of the main vectors of tick-borne encephalitis (TBE) virus. Iceland is located in the North Atlantic Ocean with subpolar oceanic climate. During the past 3-4 decades, average temperature has increased, supporting more favourable conditions for ticks. Reports of I. ricinus have increased in recent years. If these ticks were able to establish in a changing climate, Iceland may face new threats posed by tick-borne diseases. Active field surveillance by tick flagging was conducted at 111 sites around Iceland from August 2015 to September 2016. Longworth mammal traps were used to trap Apodemus sylvaticus in southwestern and southern Iceland. Surveillance on tick importation by migratory birds was conducted in southeastern Iceland, using bird nets and a Heligoland trap. Vulpes lagopus carcasses from all regions of the country were inspected for ticks. In addition, existing and new passive surveillance data from two institutes have been merged and are presented. Continental probability of presence models were produced. Boosted Regression Trees spatial modelling methods and its predictions were assessed against reported presence. By field sampling 26 questing I. ricinus ticks (7 males, 3 females and 16 nymphs) were collected from vegetation from three locations in southern and southeastern Iceland. Four ticks were found on migratory birds at their arrival in May 2016. A total of 52 A. sylvaticus were live-trapped but no ticks were found nor on 315 V. lagopus carcasses. Passive surveillance data collected since 1976, reports further 214 I. ricinus ticks from 202 records, with an increase of submissions in recent years. The continental probability of presence model correctly predicts approximately 75% of the recorded presences, but fails to predict a fairly specific category of recorded presence in areas where the records are probably opportunistic and not likely to lead to

  17. Castor Oil: Properties, Uses, and Optimization of Processing Parameters in Commercial Production

    OpenAIRE

    Patel, Vinay R.; Dumancas, Gerard G.; Kasi Viswanath, Lakshmi C.; Maples, Randall; Subong, Bryan John J.

    2016-01-01

    Castor oil, produced from castor beans, has long been considered to be of important commercial value primarily for the manufacturing of soaps, lubricants, and coatings, among others. Global castor oil production is concentrated primarily in a small geographic region of Gujarat in Western India. This region is favorable due to its labor-intensive cultivation method and subtropical climate conditions. Entrepreneurs and castor processors in the United States and South America also cultivate cast...

  18. Castor oil induces laxation and uterus contraction via ricinoleic acid activating prostaglandin EP3 receptors

    OpenAIRE

    Tunaru, Sorin; Althoff, Till F.; Nüsing, Rolf M.; Diener, Martin; Offermanns, Stefan

    2012-01-01

    Castor oil is one of the oldest drugs. When given orally, it has a laxative effect and induces labor in pregnant females. The effects of castor oil are mediated by ricinoleic acid, a hydroxylated fatty acid released from castor oil by intestinal lipases. Despite the wide-spread use of castor oil in conventional and folk medicine, the molecular mechanism by which ricinoleic acid acts remains unknown. Here we show that the EP3 prostanoid receptor is specifically activated by ricinoleic acid and...

  19. Vaccination against Bm86 Homologues in Rabbits Does Not Impair Ixodes ricinus Feeding or Oviposition

    NARCIS (Netherlands)

    Coumou, Jeroen; Wagemakers, Alex; Trentelman, Jos J.; Nijhof, Ard M.; Hovius, Joppe W.

    2014-01-01

    Human tick-borne diseases that are transmitted by Ixodes ricinus, such as Lyme borreliosis and tick borne encephalitis, are on the rise in Europe. Diminishing I. ricinus populations in nature can reduce tick exposure to humans, and one way to do so is by developing an anti-vector vaccine against

  20. 21 CFR 524.2620 - Liquid crystalline trypsin, Peru balsam, castor oil.

    Science.gov (United States)

    2010-04-01

    ... NEW ANIMAL DRUGS § 524.2620 Liquid crystalline trypsin, Peru balsam, castor oil. (a)(1) Specifications..., and 788.0 milligrams of castor oil. (2) Sponsor. See No. 051079 in § 510.600(c) of this chapter. (b)(1... balsam, and 800 milligrams of castor oil. (2) Sponsor. See No. 017135 in § 510.600(c) of this chapter. (c...

  1. Growth, development, reproductive competence and adult behaviour of Spodoptera litura (Lepidoptera: Noctuidae) reared on different diets

    International Nuclear Information System (INIS)

    Seth, R.K.; Sharma, V.P.

    2002-01-01

    Spodoptera litura was reared on natural food (castor leaves, Ricinus communis) and on a several semi-synthetic diets using quasi mass rearing techniques. The effect of the different diets and rearing regimes on S. litura growth, development, reproductive competence and adult behaviour was measured. Spodoptera litura reared from a modified chickpea-based diet provided the greatest growth index and index of adequacy. These studies were conducted as a prerequisite for the evaluation of F 1 sterility technique. (author)

  2. Castor oil biodiesel as an alternative fuel for diesel engines

    International Nuclear Information System (INIS)

    Benavides, Alirio; Benjumea, Pedro; Pashova, Veselina

    2007-01-01

    In this paper, a study related to the production and use of castor oil biodiesel is presented. The maximum methyl esters yield of the castor oil transesterification reaction is obtained under the following conditions: ambient temperature, a molar ratio of methanol to vegetable oil equal to 9 and a catalyst percentage equal to 0.8%. The castor oil biodiesel can be blended with petroleum diesel as far as 15% in such way that the resulting blend complies with national and international technical standards for diesel fuels. Its high viscosity becomes the main difficulty for using castor oil biodiesel in engines. However this biofuel exhibits excellent cold flow properties (low values of cloud and pour points). The motor tests using castor oil biodiesel petroleum diesel blends, for the biodiesel proportion tested; show that a biodiesel percentage increase leads to an increase in the specific fuel consumption, a decrease in the fuel air ratio, a slight decrease in smoke opacity, while the fuel conversion efficiency and the CO and CO 2 emissions practically remain constants

  3. Heterogeneous catalysis afford biodiesel of babassu, castor oil and blends

    Energy Technology Data Exchange (ETDEWEB)

    Carvalho, Lee M.G. de; Abreu, Wiury C. de; Silva, Maria das Gracas de O. e; Matos, Jose Milton E. de; Moura, Carla V.R. de; Moura, Edmilson M. de, E-mail: mmoura@ufpi.edu.br [Universidade Federal do Piaui (UFPI), Teresina, PI (Brazil). Departamento de Quimica; Lima, Jose Renato de O.; Oliveira, Jose Eduardo de [Universidade Estadual Paulista Julio de Mesquita Filho (UNESP/IQ/CEMPEQC), Araraquara, SP (Brazil). Instituto de Quimica. Centro de Monitoramento e Pesquisa da Qualidade de Combustiveis, Biocombustiveis, Petroleo e Derivados

    2013-04-15

    This work describes the preparation of babassu, castor oil biodiesel and mixtures in various proportions of these oils, using alkaline compounds of strontium (SrCO{sub 3} + SrO + Sr (OH){sub 2}) as heterogeneous catalysts. The mixture of oils of these oleaginous sources was used in the production of biodiesel with quality parameters that meet current legislation. The catalyst was characterized by X-ray diffractometry (XDR), physisorption of gas (BET method), scanning electron microscopy (SEM), energy dispersive spectroscopy (EDX) and Fourier transform infrared spectroscopy (FTIR). The viscometric technique was used to monitor the optimization.The transesterification reactions performed using strontium compounds reached conversion rates of 97.2% babassu biodiesel (BB), 96.4% castor oil biodiesel (COB) and 95.3% Babassu/Castor Oil Biodiesel 4:1 (BBCO41). (author)

  4. Heterogeneous catalysis afford biodiesel of babassu, castor oil and blends

    International Nuclear Information System (INIS)

    Carvalho, Lee M.G. de; Abreu, Wiury C. de; Silva, Maria das Gracas de O. e; Matos, Jose Milton E. de; Moura, Carla V.R. de; Moura, Edmilson M. de; Lima, Jose Renato de O.; Oliveira, Jose Eduardo de

    2013-01-01

    This work describes the preparation of babassu, castor oil biodiesel and mixtures in various proportions of these oils, using alkaline compounds of strontium (SrCO 3 + SrO + Sr (OH) 2 ) as heterogeneous catalysts. The mixture of oils of these oleaginous sources was used in the production of biodiesel with quality parameters that meet current legislation. The catalyst was characterized by X-ray diffractometry (XDR), physisorption of gas (BET method), scanning electron microscopy (SEM), energy dispersive spectroscopy (EDX) and Fourier transform infrared spectroscopy (FTIR). The viscometric technique was used to monitor the optimization.The transesterification reactions performed using strontium compounds reached conversion rates of 97.2% babassu biodiesel (BB), 96.4% castor oil biodiesel (COB) and 95.3% Babassu/Castor Oil Biodiesel 4:1 (BBCO41). (author)

  5. Deep Sequencing Analysis of the Ixodes ricinus Haemocytome.

    Directory of Open Access Journals (Sweden)

    Michalis Kotsyfakis

    2015-05-01

    Full Text Available Ixodes ricinus is the main tick vector of the microbes that cause Lyme disease and tick-borne encephalitis in Europe. Pathogens transmitted by ticks have to overcome innate immunity barriers present in tick tissues, including midgut, salivary glands epithelia and the hemocoel. Molecularly, invertebrate immunity is initiated when pathogen recognition molecules trigger serum or cellular signalling cascades leading to the production of antimicrobials, pathogen opsonization and phagocytosis. We presently aimed at identifying hemocyte transcripts from semi-engorged female I. ricinus ticks by mass sequencing a hemocyte cDNA library and annotating immune-related transcripts based on their hemocyte abundance as well as their ubiquitous distribution.De novo assembly of 926,596 pyrosequence reads plus 49,328,982 Illumina reads (148 nt length from a hemocyte library, together with over 189 million Illumina reads from salivary gland and midgut libraries, generated 15,716 extracted coding sequences (CDS; these are displayed in an annotated hyperlinked spreadsheet format. Read mapping allowed the identification and annotation of tissue-enriched transcripts. A total of 327 transcripts were found significantly over expressed in the hemocyte libraries, including those coding for scavenger receptors, antimicrobial peptides, pathogen recognition proteins, proteases and protease inhibitors. Vitellogenin and lipid metabolism transcription enrichment suggests fat body components. We additionally annotated ubiquitously distributed transcripts associated with immune function, including immune-associated signal transduction proteins and transcription factors, including the STAT transcription factor.This is the first systems biology approach to describe the genes expressed in the haemocytes of this neglected disease vector. A total of 2,860 coding sequences were deposited to GenBank, increasing to 27,547 the number so far deposited by our previous transcriptome studies

  6. CASTOR: Cathode/Anode Satellite Thruster for Orbital Repositioning

    Science.gov (United States)

    Mruphy, Gloria A.

    2010-01-01

    The purpose of CASTOR (Cathode/Anode Satellite Thruster for Orbital Repositioning) satellite is to demonstrate in Low Earth Orbit (LEO) a nanosatellite that uses a Divergent Cusped Field Thruster (DCFT) to perform orbital maneuvers representative of an orbital transfer vehicle. Powered by semi-deployable solar arrays generating 165W of power, CASTOR will achieve nearly 1 km/s of velocity increment over one year. As a technology demonstration mission, success of CASTOR in LEO will pave the way for a low cost, high delta-V orbital transfer capability for small military and civilian payloads in support of Air Force and NASA missions. The educational objective is to engage graduate and undergraduate students in critical roles in the design, development, test, carrier integration and on-orbit operations of CASTOR as a supplement to their curricular activities. This program is laying the foundation for a long-term satellite construction program at MIT. The satellite is being designed as a part of AFRL's University Nanosatellite Program, which provides the funding and a framework in which student satellite teams compete for a launch to orbit. To this end, the satellite must fit within an envelope of 50cmx50cmx60cm, have a mass of less than 50kg, and meet stringent structural and other requirements. In this framework, the CASTOR team successfully completed PDR in August 2009 and CDR in April 2010 and will compete at FCR (Flight Competition Review) in January 2011. The complexity of the project requires implementation of many systems engineering techniques which allow for development of CASTOR from conception through FCR and encompass the full design, fabrication, and testing process.

  7. Hard X-ray studies on the Castor tokamak

    International Nuclear Information System (INIS)

    Mlynar, J.

    1990-04-01

    The electron runaway processes in tokamaks are discussed with regard to hard X radiation measurements. The origin and confinement of runaway electrons, their bremsstrahlung spectra and the influence of lower hybrid current drive on the distribution of high-energy electrons are analyzed for the case of the Castor tokamak. The hard X-ray spectrometer designed for the Castor tokamak is also described and preliminary qualitative results of hard X-ray measurements are presented. The first series of integral measurements made it possible to map the azimuthal dependence of the hard X radiation

  8. Laser-fabricated castor oil-capped silver nanoparticles

    Science.gov (United States)

    Zamiri, Reza; Zakaria, Azmi; Abbastabar, Hossein; Darroudi, Majid; Husin, Mohd Shahril; Mahdi, Mohd Adzir

    2011-01-01

    Silver nanoparticles were fabricated by ablation of a pure silver plate immersed in castor oil. A Nd:YAG-pulsed Q-switch laser with 1064-nm wavelength and 10-Hz frequency was used to ablate the plate for 10 minutes. The sample was characterized by ultraviolet-visible, atomic absorption, Fourier transform-infrared spectroscopies, and transmission electron microscopy. The results of the fabricated sample showed that the nanoparticles in castor oil were about 5-nm in diameter, well dispersed, and showed stability for a long period of time. PMID:21698083

  9. Laser-fabricated castor oil-capped silver nanoparticles.

    Science.gov (United States)

    Zamiri, Reza; Zakaria, Azmi; Abbastabar, Hossein; Darroudi, Majid; Husin, Mohd Shahril; Mahdi, Mohd Adzir

    2011-01-01

    Silver nanoparticles were fabricated by ablation of a pure silver plate immersed in castor oil. A Nd:YAG-pulsed Q-switch laser with 1064-nm wavelength and 10-Hz frequency was used to ablate the plate for 10 minutes. The sample was characterized by ultraviolet-visible, atomic absorption, Fourier transform-infrared spectroscopies, and transmission electron microscopy. The results of the fabricated sample showed that the nanoparticles in castor oil were about 5-nm in diameter, well dispersed, and showed stability for a long period of time.

  10. Synthesis of carbon nanotubes using natural carbon precursor: Castor oil

    Science.gov (United States)

    Raziah, A. Z.; Junizah, A. R.; Saifuddin, N.

    2012-09-01

    Castor oil has long been an article of commerce due to its versatility as it is widely used as a starting material for many industrial chemical products because of its unique structure. In this study, carbon nanotubes has been synthesized by thermal decomposition of castor oil in nitrogen atmosphere at 300-400δC using custom-made microwave processing unit. The precursor material was catalyzed by iron clusters originating from the addition of ferrocene. The morphology and characterization of the CNTs were studied and discussed by transmission electron microscopy (TEM).

  11. Physicochemical and phytochemical standardization of berries of Myrtus communis Linn.

    Directory of Open Access Journals (Sweden)

    Sabiha Sumbul

    2012-01-01

    Full Text Available Purpose: Herbal medicines are gaining more and more attention all over the world due to their long historical clinical practice and less side effects. The major limitation with herbal medicines is that the lack of standardization technique. Initially, the crude drugs were identified by comparison only with the standard description available. Materials and Methods: Standardization of drugs means confirmation of its identity and determination of its quality and purity. The quality control standards of various medicinal plants, used in indigenous system of medicine, are significant nowadays in view of commercialization of formulations based on medicinal plants. The quality of herbal drugs is the sum of all factors, which contribute directly or indirectly to the safety, effectiveness, and acceptability of the product. Lack of quality control can affect the efficacy and safety of drugs that may lead to health problems in the consumers. Standardization of drugs is needed to overcome the problems of adulteration and is most developing field of research now. Therefore, there is an urgent need of standardized drugs having consistent quality. Results: The drug showed the presence of phyto-chemical constituents. Powdered drug was treated with different reagents and examined under UV light. Different reagents showed different colors of the drug at 2 wavelengths. The percentage of physiological active compounds viz. total phenolics, tannins, volatile oil, fixed oil, and alkaloids were also observed. Conclusion: Myrtus communis L. (Family: Myrtaceae is one of the important drug being used in Unani system of medicine for various therapeutic purposes. In this study, an attempt has been made to study berries of M. communis from physico-chemical and phytochemical standardization point of view.

  12. Beaver (Castor canadensis) in heavily browsed environments

    Science.gov (United States)

    Baker, Bruce W.

    2003-01-01

    Beaver (Castor canadensis) populations have declined or failed to recover in heavily browsed environments. I suggest that intense browsing by livestock or ungulates can disrupt beaver-willow (Salix spp.) mutualisms that likely evolved under relatively low herbivory in a more predator-rich environment, and that this interaction may explain beaver and willow declines. Field experiments in Rocky Mountain National Park, Colorado, USA, found the interaction of beaver and elk (Cervus elaphus) herbivory suppressed compensatory growth in willow. Intense elk browsing of simulated beaver-cut willow produced plants which were small and hedged with a high percentage of dead stems, whereas protected plants were large and highly branched with a low percentage of dead stems. Evaluation of a winter food cache showed beaver had selected woody stems with a lower percentage of leaders browsed by elk. A lack of willow stems suitable as winter beaver food may cause beaver populations to decline, creating a negative feedback mechanism for beaver and willow. In contrast, if browsing by livestock or ungulates can be controlled, and beaver can disperse from a nearby source population, then beaver may build dams in marginal habitat which will benefit willow and cause a positive riparian response that restores proper function to degraded habitat. In a shrub-steppe riparian ecosystem of northwestern Colorado, USA, rest from overgrazing of livestock released herbaceous vegetation initiating restoration of a beaver-willow community. Thus, competition from livestock or ungulates can cause beaver and willow to decline and can prevent their restoration in heavily browsed riparian environments, but beaver and willow populations can recover under proper grazing management.

  13. Infection of Ixodes ricinus (Acari: Ixodidae) by Borrelia burgdorferi sensu lato in North Africa

    Science.gov (United States)

    Zhioua, E.; Bouattour, A.; Hu, C.M.; Gharbi, M.; Aeschliman, A.; Ginsberg, H.S.; Gern, L.

    1999-01-01

    Free-living adult Ixodes ricinus L. were collected in Amdoun, situated in the Kroumiry mountains in northwestern Tunisia (North Africa). Using direct fluorescence antibody assay, the infection rate of field-collected I. ricinus by Borrelia burgdorferi sensu lato was 30.5% (n = 72). No difference in infection rate was observed between male and female ticks. Spirochetes that had been isolated from I. ricinus from Ain Drahim (Kroumiry Mountains) in 1988 were identified as Borrelia lusitaniae (formerly genospecies PotiB2). This is the first identification of a genospecies of Borrelia burgdorferi sensu lato from the continent of Africa.

  14. Genetic structure and diversity in Juniperus communis populations in Saxony, Germany

    Directory of Open Access Journals (Sweden)

    Reim Stefanie

    2016-06-01

    Full Text Available In recent years, land use changes led to a rapid decline and fragmentation of J. communis populations in Germany. Population isolation may lead to a restricted gene flow and, further, to negative effects on genetic variation. In this study, genetic diversity and population structure in seven fragmented J. communis populations in Saxony, Germany, were investigated using nuclear microsatellites (nSSR and chloroplast single nucleotide polymorphism (cpSNP. In all Saxony J. communis populations, a high genetic diversity was determined but no population differentiation could be detected whatever method was applied (Bayesian cluster analysis, F-statistics, AMOVA. The same was true for three J. communis out-group samples originating from Italy, Slovakia and Norway, which also showed high genetic diversity and low genetic differences regarding other J. communis populations. Low genetic differentiation among the J. communis populations ascertained with nuclear and chloroplast markers indicated high levels of gene flow by pollen and also by seeds between the sampled locations. Low genetic differentiation may also provide an indicator of Juniper survival during the last glacial maximum (LGM in Europe. The results of this study serve as a basis for the implementation of appropriate conservation measures in Saxony.

  15. Optimization of biodiesel production from castor oil by response ...

    African Journals Online (AJOL)

    This work investigated the possibility of using response surface methodology based on a four factor five level central composite design to optimize biodiesel production from castor oil. The reaction variables were oil: ethanol ratio, lipozyme concentration, time and temperature. The properties of the biodiesel produced were ...

  16. Interpenetrating polymer networks based on polyol modified castor ...

    Indian Academy of Sciences (India)

    Unknown

    Abstract. Interpenetrating polymer networks (IPNs) of glycerol modified castor oil polyurethane (GC–PU) and poly[2-hydroxyethylmethacrylate] (PHEMA) were synthesized using benzoyl peroxide as initiator and. N,N-methylene bis acrylamide as crosslinker. GC–PU/PHEMA interpenetrating polymer networks were obtained ...

  17. Synthesis and characterization of castor oil based polyurethane ...

    Indian Academy of Sciences (India)

    Unknown

    Castor oil; MDI; interpenetrating; mechanical; crystal size; strain. 1. Introduction. Interpenetrating polymer networks (IPNs) constitute a group of polymer composite materials possessing unique properties which are related to their method of synthe- sis (Sperling 1981). IPNs typically consist of a flexible elastomer and one or ...

  18. Evaluation of castor oil samples for potential toxin contamination

    Science.gov (United States)

    Castor oil and its derivatives are widely used as a chemical feedstock for production of lubricants and greases, and for engineering plastics, plasticizers and surfactants. They also have wide application in consumer goods such as lipstick, deodorants and medicinal products. Due to concerns about th...

  19. response of clarias gariepinus to dietary castor seeds processed

    African Journals Online (AJOL)

    Admin

    cake is obtained as a residue of oil extraction from castor seeds. The cake has high protein content of 39%, crude fibre 18%, 7.5% ash, 3% soluble carbohydrate and. 40% ether extract (Devendra, 1988). In spite of the high nutrient content of the cake, its use in feeding animals is limited due to the presence of some toxicants ...

  20. Comparative Analysis of Flame Characteristics of Castor Oil and ...

    African Journals Online (AJOL)

    The flame characteristics of castor oil based foam and that of polyether foam impregnated with inorganic flame retardants (FR) were investigated. The polyether foams were impregnated with measured concentration of Antimony trioxide and Sodium bromide, Ammonium dihydrogen orthophosphate, Diammonium hydrogen ...

  1. Early Stage Design of a Bio refinery from Castor Oil

    DEFF Research Database (Denmark)

    de Faria, Daniela; Quaglia, Alberto; Pessoa, Fernando

    2014-01-01

    and network scenarios. The tool integrates d ata collection, modelling and superstructure optimization to determine the optimal network for a biorefinery. The application of the synthesis - analysis method and its corresponding computer aided tool is highlighte d for a case study where castor oil...

  2. Interpenetrating polymer networks based on polyol modified castor ...

    Indian Academy of Sciences (India)

    Interpenetrating polymer networks (IPNs) of glycerol modified castor oil polyurethane (GC–PU) and poly[2-hydroxyethylmethacrylate] (PHEMA) were synthesized using benzoyl peroxide as initiator and N,N-methylene bis acrylamide as crosslinker. GC–PU/PHEMA interpenetrating polymer networks were obtained by ...

  3. Composition of acylglycerols in castor oil and their biosynthetic pathway

    Science.gov (United States)

    Castor oil has many industrial uses, such as the manufacture of aviation lubricant, plastics, paints, coatings, and cosmetics, because of its high content of ricinoleate (hydroxy fatty acid). We have identified many molecular species of acylglycerols using electrospray ionization mass spectrometry o...

  4. Comparative Analysis of Flame Characteristics of Castor Oil and ...

    African Journals Online (AJOL)

    ABSTRACT: The flame characteristics of castor oil based foam and that of polyether foam impregnated with inorganic flame retardants (FR) were investigated. The polyether foams were impregnated with measured concentration of Antimony trioxide and Sodium bromide, Ammonium dihydrogen orthophosphate ...

  5. Develop a New Lesquerella fendleri Crop for Castor Oil Production

    Science.gov (United States)

    Seed oil of Lesquerella fendleri contains a valuable hydroxy fatty acid (HFA), lesquerolic acid (20:1OH). The conventional source of HFA is ricinoleic acid (18:1OH) from castor seeds. Ricinoleic acid and its derivatives are used as raw materials for numerous industrial products, such as lubricants, ...

  6. GNS Castor V/21 Headspace Gas Sampling 2014

    Energy Technology Data Exchange (ETDEWEB)

    Winston, Philip Lon [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2016-01-01

    Prior to performing an internal visual inspection, samples of the headspace gas of the GNS Castor V/21 cask were taken on June 12, 2014. These samples were taken in support of the CREIPI/Japanese nuclear industry effort to validate fuel integrity without visual inspection by measuring the 85Kr content of the cask headspace

  7. Qualitative histologic evaluation of the tissue reaction to the polyurethane resin (ricinus communis - based biopolymer implantation assessed by light and scanning electron microscopy

    Directory of Open Access Journals (Sweden)

    Gustavo Campos Belmonte

    2013-01-01

    Full Text Available The tissue reaction of bone tissue accessed by light microscopy and scanning electron microscopy (SEM images after polyurethane resin implantation is presented in this study. Twenty four male rabbits were used, divided into two groups of 12 animals each (experimental group and control group in which full-thickness cranial defect was surgically created. At 30 and 90 days post operation 6 animals of each group were euthanized and bone samples were removed for analysis. The microscopic results indicated no inflammatory foreign body reaction, a perfect union between the polymer and surgical bone bed surface, lack of bone resorption and presence of a thin layer of osteogenic material covering the polymer surface in contact with the surgical bone bed. The SEM images demonstrate the porosity of the resin, with diameters from 120 to 500 µm. This important feature of this polymer is associated with its osteoconductivity, allowing the bone growth inside it, improving the integration between the material and bone tissue. These results confirm that polyurethane resin derived from Ricinuscommunis is an excellent bone substitute for use in repair surgery for great bone losses.

  8. Ixodes ticks belonging to the Ixodes ricinus complex encode a family of anticomplement proteins.

    Science.gov (United States)

    Daix, V; Schroeder, H; Praet, N; Georgin, J-P; Chiappino, I; Gillet, L; de Fays, K; Decrem, Y; Leboulle, G; Godfroid, E; Bollen, A; Pastoret, P-P; Gern, L; Sharp, P M; Vanderplasschen, A

    2007-04-01

    The alternative pathway of complement is an important innate defence against pathogens including ticks. This component of the immune system has selected for pathogens that have evolved countermeasures. Recently, a salivary protein able to inhibit the alternative pathway was cloned from the American tick Ixodes scapularis (Valenzuela et al., 2000; J. Biol. Chem. 275, 18717-18723). Here, we isolated two different sequences, similar to Isac, from the transcriptome of I. ricinus salivary glands. Expression of these sequences revealed that they both encode secreted proteins able to inhibit the complement alternative pathway. These proteins, called I. ricinus anticomplement (IRAC) protein I and II, are coexpressed constitutively in I. ricinus salivary glands and are upregulated during blood feeding. Also, we demonstrated that they are the products of different genes and not of alleles of the same locus. Finally, phylogenetic analyses demonstrate that ticks belonging to the Ixodes ricinus complex encode a family of relatively small anticomplement molecules undergoing diversification by positive Darwinian selection.

  9. Seasonal distribution of Borreliae in Ixodes ricinus ticks in the Belgrade region

    Directory of Open Access Journals (Sweden)

    Milutinović Marija

    2006-01-01

    Full Text Available Green areas at four localities in the Belgrade region (Ada Ciganlija, Košutnjak, Miljakovac forest, and Mt. Avala were investigated in 2004. The aim of the research was to clarify the faunistic composition, relative abundance, and population dynamics of ticks, as well as the seasonal distribution of Borrelia burgdorferi sensu lato (sl in Ixodes ricinus. Two species of ticks were detected: Ixodes ricinus and Dermacentor reticulates. Relative abundance analysis revealed that the species Ixodes ricinus was predominant (97.41 %. Out of 942 Ixodes ricinus ticks, 188 (19.96 % were infected with Borrelia burgdorferi sl. The infection rate of adults by localities ranged from 19.16% to 30.99% (Mt. Avala and Ada Ciganlija, respectively.

  10. Experimental in vitro transmission of Babesia sp. (EU1) by Ixodes ricinus.

    Science.gov (United States)

    Bonnet, Sarah; Brisseau, Nadine; Hermouet, Axelle; Jouglin, Maggy; Chauvin, Alain

    2009-01-01

    Babesia sp. (EU1), first characterized in 2003, has been implicated in human cases of babesiosis in Italy, Austria and Germany. It has been identified in roe deer and in its suspected tick vector, Ixodes ricinus, in several European countries. The aim of the present study was to validate the competence of I. ricinus as a vector of Babesia sp. (EU1) via experimental infections. For this purpose, a parasite strain isolated from roe deer was cloned in sheep erythrocytes. After experimental infections, parasite DNA was successfully amplified by PCR in both eggs and larvae originating from infected I. ricinus females and in the salivary glands of females exposed to Babesia sp. (EU1) as nymphs. We also demonstrate that infected females were able to transmit parasite DNA during a new blood meal. Together with previous epidemiological studies, these results validate I. ricinus as a competent vector for Babesia sp. (EU1).

  11. Identification of minor acylglycerols less polar than triricinolein in castor oil by mass spectrometry and the proposed biosynthetic pathway of castor oil

    Science.gov (United States)

    Ricinoleate (OH18:1), a monohydroxy fatty acid, has many industrial uses such as the manufacture of biodegradable plastics, nylon, plasticizers, lubricants, cosmetics and paints. Castor oil is the only commericial source of ricinoleate which occurs as triacylglycerols. Triacylglycerols in castor oil...

  12. Vaccination against Bm86 Homologues in Rabbits Does Not Impair Ixodes ricinus Feeding or Oviposition.

    Directory of Open Access Journals (Sweden)

    Jeroen Coumou

    Full Text Available Human tick-borne diseases that are transmitted by Ixodes ricinus, such as Lyme borreliosis and tick borne encephalitis, are on the rise in Europe. Diminishing I. ricinus populations in nature can reduce tick exposure to humans, and one way to do so is by developing an anti-vector vaccine against tick antigens. Currently, there is only one anti-vector vaccine available against ticks, which is a veterinary vaccine based on the tick antigen Bm86 in the gut of Rhipicephalus microplus. Bm86 vaccine formulations cause a reduction in the number of Rhipicephalus microplus ticks that successfully feed, i.e. lower engorgement weights and a decrease in the number of oviposited eggs. Furthermore, Bm86 vaccines reduce transmission of bovine Babesia spp. Previously two conserved Bm86 homologues in I. ricinus ticks, designated as Ir86-1 and Ir86-2, were described. Here we investigated the effect of a vaccine against recombinant Ir86-1, Ir86-2 or a combination of both on Ixodes ricinus feeding. Recombinant Ixodes ricinus Bm86 homologues were expressed in a Drosophila expression system and rabbits were immunized with rIr86-1, rIr86-2, a combination of both or ovalbumin as a control. Each animal was infested with 50 female adults and 50 male adults Ixodes ricinus and tick mortality, engorgement weights and egg mass were analyzed. Although serum IgG titers against rIr86 proteins were elicited, no effect was found on tick feeding between the rIr86 vaccinated animals and ovalbumin vaccinated animals. We conclude that vaccination against Bm86 homologues in Ixodes ricinus is not an effective approach to control Ixodes ricinus populations, despite the clear effects of Bm86 vaccination against Rhipicephalus microplus.

  13. Phenolic contents of myrtle (Myrtus communis L.) fruits

    OpenAIRE

    Arzu BAYIR YEĞİN; Halil İbrahim UZUN

    2015-01-01

    Mersin (Myrtus communis L.) Akdeniz Bölgesinin önemli bir doğal bitkisidir. Meyveleri siyah ve beyaz renklidir. Mersin bitkisi hakkında yapılan çalışmaların çoğu özellikle yapraklarında bulunan uçucu yağların tespiti ile ilgili iken, son yıllarda sağlık üzerine etkileri nedeniyle mersinin içerdiği fenolik bileşikler ve bunların etkileri üzerine çalışmalar yoğunlaşmıştır. Çalışmanın amacı, mersin meyvelerinin içerdiği fenolik bileşik miktarlarını ve bunların genotiplere göre değişimini saptama...

  14. Splice Variants of the Castor WRI1 Gene Upregulate Fatty Acid and Oil Biosynthesis When Expressed in Tobacco Leaves.

    Science.gov (United States)

    Ji, Xia-Jie; Mao, Xue; Hao, Qing-Ting; Liu, Bao-Ling; Xue, Jin-Ai; Li, Run-Zhi

    2018-01-05

    The plant-specific WRINKLED1 (WRI1) is a member of the AP2/EREBP class of transcription factors that positively regulate oil biosynthesis in plant tissues. Limited information is available for the role of WRI1 in oil biosynthesis in castor bean ( Ricinus connunis L.), an important industrial oil crop. Here, we report the identification of two alternatively spliced transcripts of RcWRI1 , designated as RcWRI1-A and RcWRI1-B . The open reading frames of RcWRI1-A (1341 bp) and RcWRI1-B (1332 bp) differ by a stretch of 9 bp, such that the predicted RcWRI1-B lacks the three amino acid residues "VYL" that are present in RcWRI1-A. The RcWRI1-A transcript is present in flowers, leaves, pericarps and developing seeds, while the RcWRI1-B mRNA is only detectable in developing seeds. When the two isoforms were individually introduced into an Arabidopsis wri1-1 loss-of-function mutant, total fatty acid content was almost restored to the wild-type level, and the percentage of the wrinkled seeds was largely reduced in the transgenic lines relative to the wri1-1 mutant line. Transient expression of each RcWRI1 splice isoform in N. benthamiana leaves upregulated the expression of the WRI1 target genes, and consequently increased the oil content by 4.3-4.9 fold when compared with the controls, and RcWRI1-B appeared to be more active than RcWRI1-A . Both RcWRI1-A and RcWRI1-B can be used as a key transcriptional regulator to enhance fatty acid and oil biosynthesis in leafy biomass.

  15. Effect of castor cake and elephant grass composting on edaphic fauna

    OpenAIRE

    Scoriza,Rafael Nogueira; Bianchi,Miriam de Oliveira; Correia,Maria Elizabeth Fernandes; Leal,Marco Antonio de Almeida

    2016-01-01

    ABSTRACT: Elephant grass and castor cake when combined can make a promising organic fertilizer. However, castor cake contains potentially toxic chemicals, such as ricin and ricinine. To test potential effects of these chemicals, compost piles of elephant grass ( Pennisetum purpureum Schum.) with castor cake were prepared with different C:N ratios (T1 = 40, T2 = 30, T3 = 20; T4 = 30 [control, elephant grass + crotalaria]) to evaluate colonization by edaphic fauna and any suppressive effects of...

  16. Preparation and research on properties of castor oil as a diesel fuel additive

    OpenAIRE

    Nurbakhit Imankulov

    2012-01-01

    The research shows an opportunity of preparing biodiesel fuel on the basis of local diesel fuel and the bioadditive - castor oil. Limiting optimum concentration of introduction of the bioadditive equal was established as 5% mass ratio. The castor oil released from seeds of Palma Christi grown on experimental field. All physical and chemical characteristics of the oil including IR-spectra were determined. Operating conditions of castor oil introduction (temperature, solubility, concentra-tion,...

  17. Antileishmanial and cytotoxic effects of essential oil and methanolic extract of Myrtus communis L.

    Science.gov (United States)

    Mahmoudvand, Hossein; Ezzatkhah, Fatemeh; Sharififar, Fariba; Sharifi, Iraj; Dezaki, Ebrahim Saedi

    2015-02-01

    Plants used for traditional medicine contain a wide range of substances that can be used to treat various diseases such as infectious diseases. The present study was designed to evaluate the antileishmanial effects of the essential oil and methanolic extract of Myrtus communis against Leishmania tropica on an in vitro model. Antileishmanial effects of essential oil and methanolic extract of M. communis on promastigote forms and their cytotoxic activities against J774 cells were evaluated using MTT assay for 72 hr. In addition, their leishmanicidal activity against amastigote forms was determined in a macrophage model, for 72 hr. Findings showed that the main components of essential oil were α-pinene (24.7%), 1,8-cineole (19.6%), and linalool (12.6%). Findings demonstrated that M. communis, particularly its essential oil, significantly (Pessential oil and methanolic extract was 8.4 and 28.9 μg/ml against promastigotes, respectively. These values were 11.6 and 40.8 μg/ml against amastigote forms, respectively. Glucantime as control drug also revealed IC50 values of 88.3 and 44.6 μg/ml for promastigotes and amastigotes of L. tropica, respectively. The in vitro assay demonstrated no significant cytotoxicity in J774 cells. However, essential oil indicated a more cytotoxic effect as compared with the methanolic extract of M. communis. The findings of the present study demonstrated that M. communis might be a natural source for production of a new leishmanicidal agent.

  18. Test of the quasi-optical grill for lower hybrid current drive on the CASTOR tokamak

    International Nuclear Information System (INIS)

    Klima, R.; Pavlo, P.; Preinhaelter, J.; Stoeckel, J.; Zacek, F.; Jakubka, K.; Kletecka, P.; Kryska, L.

    1994-03-01

    Feasibility studies of a new diffraction structure for launching lower hybrid waves into a tokamak plasma - of the microwave quasi-optical grill - are reported. The main parameters of the grill designed for the CASTOR tokamak are summarized, and results of preliminary radiation pattern measurements of a non-optimized model antenna are presented. The influence of a relatively great curvature of the plasma surface in the CASTOR tokamak is discussed and the ray tracing of the launched lower-hybrid wave in the actual CASTOR plasma is shown. Finally, the results of probe measurements of the CASTOR plasma core are given. (J.U.) 17 figs., 9 refs

  19. Production of quartz plates for CMS-CASTOR Experiment

    CERN Document Server

    Adiguzel, Aytul; Ayhan, Aydin; Bakirci, Mustafa Numan; Basegmez, Suzan; Beaumont, Willem; Borras, Kerstin; Campbell, Alan; De Paula Carvalho, W; Çerçi, Salim; De Jesus Damiao, Dilson; Dogangün, O; Dumanoglu, Isa; d'Enterria, David; Erchov, Y; Eskut, Eda; Figueiredo, D; Girgis, Semiray; Göttlicher, P; Gouskos, Loukas; Gurpinar, Emine; Hos, Ilknur; Katkov, Igor; Katsas, Panagiotis; Khein, Lev; Knutsson, Albert; Kuznetsov, Andrey; Lebeau, Michel; Van Mechelen, Pierre; Muhl, Carsten; Musienko, Yuri; Ochesanu, Silvia; Onengüt, G; Onengut, G Jr; Ozdemir, Kadri; Panagiotou, Apostolos; Polatoz, A; Ripert, Marion; Shileev, K; Sogut, Kenan; Tiflov, B TaliV; Kayis-Topaksu, A; Uzun, Dilber

    2008-01-01

    Light transmission rate performance of $102$ irradiated quartz samples was measured to select the best quartz plates for CMS-CASTOR calorimeter. All the produced quartz plates were originally used in a previous CERN experiment, DELPHI. Three different doses of $^{60}$Co source were used with the collaboration of PSI (Paul Scherrer Institute, Villigen PSI, Switzerland.) to study the transmission rate performance of the quartz samples after irradiation for different incident light, ranging from $250$ to $700$ nm in $5$ nm increasing steps. All samples show different decrease in the rate with wavelength for different doses. Three different steps were followed before irradiation to find out the best way of cleaning the original DELPHI Cu/Cr tracks on the samples. Results of these measurements presented here correspond to the quartz plates that will be used in one hadronic sector of CASTOR calorimeter until end of 2008. For the full calorimeter new quartz plates will be installed. We also present the light transmi...

  20. Fallot's tetralogy in a European beaver (Castor fiber).

    Science.gov (United States)

    Wenger, Sandra; Gull, Jessica; Glaus, Tony; Blumer, Serafin; Wimmershoff, Julia; Kranjc, Asja; Steinmetz, Hanspeter; Hatt, Jean-Michel

    2010-06-01

    A 20-mo-old, female, 9-kg European beaver (Castor fiber) presented with apathy, reduced appetite of 3-day duration and a grade 5/6 systolic heart murmur. Thoracic radiographs revealed a diffuse broncho-interstitial pattern suspicious for bronchopneumonia. The echocardiographic findings of a hypertrophied right ventricle, ventricular septal defect with overriding aorta, and infundibular pulmonic stenosis were consistent with Fallot's tetralogy. Even though the bronchopneumonia rather than the congenital cardiac defect was considered of primary importance for the presenting clinical signs, the latter was relevant for the decision not to continue any medical treatment. Both disease processes were confirmed on necropsy. Fallot's tetralogy, European beaver, Castor fiber, heart murmur, ultrasound.

  1. Extraction, Characterization and Modification of Castor Seed Oil

    Directory of Open Access Journals (Sweden)

    A. D. MOHAMMED

    2006-01-01

    Full Text Available This paper carried out experimental study, through extraction and characterization of both crude and refined castor oil. Normal hexane was used as solvent for the extraction process. The oil produced was refined through degumming, neutralization and bleaching process using local adsorbent (activated clay. The characterization analysis revealed that tested parameters, which include specific gravity, refractive index, acid value, saponification value and iodine value for both crude and refined castor oil produced, were within the ASTM standard specifications. In fact the iodine value obtained (84.8 for the refined oil indicates that the oil could certainly be used as lubricant, hydraulic break fluid and protecting coatings. The oil was modified via sulphation method to produce Turkey – red oil that was tested on wooden material, paper and cloth. The test revealed that the Turkey – red oil produced is suitable to be used as a good dying agent and polish.

  2. pre-germination treatments in castor seeds, cultivar IAC 226

    International Nuclear Information System (INIS)

    Costa Nobre, Danubia Aparecida; Gomes Damascena, Joyce; Marcia, Andreia; Santos de Souza, David; Pereira dos Santos, Marlucia; Rodrigues Pereira, Adriana; Goncalves Pereira, Cassio

    2013-01-01

    The present study aimed to evaluate the efficiency of different pre-germination treatments in castor beans, IAC 226. The experimental design was completely randomized in a factorial 4 x 4 (four temperatures and four immersion times), with four replications. Pre-germination treatments were: immersion in water at room temperature (25 Celsius degrade) and immersion in hot water at temperatures of 60, 70 and 80 Celsius degrade for 2, 4, 6 and 8 minutes. Water content of the seeds was determined before treatments. Before and after each treatment, seeds were subjected to germination test; 20-30 Celsius degrade alternating temperature, determining the percentages of normal and abnormal seedlings, dormant and dead seeds. Independent of time, immersion in 70 Celsius degrade, water was the most efficient treatment for accelerating germination of castor bean cultivar IAC 226.

  3. "Castor Oil" - The Culprit of Acute Hair Felting.

    Science.gov (United States)

    Maduri, V Ramya; Vedachalam, Ahalya; Kiruthika, S

    2017-01-01

    Acute hair felting is a rare disorder of scalp hair. In this condition, the hair becomes twisted, entangled as a hard stony mass resembling a bird's nest. Sudden hair matting has been reported earlier in the literature after vigorous use of chemical and herbal shampoos. Plica polonica is a patchy area of hair matting occurring in due course of time in neglected hair or underlying psychiatric illness. This case is interesting as the whole scalp hair matted immediately after using coconut oil and castor oil following washing. Growing long hair and taking oil bath are cultural and religious customs in South India. The high viscosity of castor oil and long hair had contributed to sudden felting of hair. This disorder of hair is irreversible and the hair should be cut off. Acute nature of this disorder will result in a serious psychological impact on the patient and the family.

  4. The experiences from interim spent fuel storage operation with CASTOR 440/84 CASKS in NPP Dukovany

    International Nuclear Information System (INIS)

    Kuba, S.

    1999-01-01

    In this lecture are presented: principles of the CASTOR 440/84 design; design development works; commissioning of interim spent fuel storage facility; international transports of spent fuel utilising CASTOR 440/84 casks

  5. Low-modulus PMMA bone cement modified with castor oil.

    Science.gov (United States)

    López, Alejandro; Hoess, Andreas; Thersleff, Thomas; Ott, Marjam; Engqvist, Håkan; Persson, Cecilia

    2011-01-01

    Some of the current clinical and biomechanical data suggest that vertebroplasty causes the development of adjacent vertebral fractures shortly after augmentation. These findings have been attributed to high injection volumes as well as high Young's moduli of PMMA bone cements compared to that of the osteoporotic cancellous bone. The aim of this study was to evaluate the use of castor oil as a plasticizer for PMMA bone cements. The Young's modulus, yield strength, maximum polymerization temperature, doughing time, setting time and the complex viscosity curves during curing, were determined. The cytotoxicity of the materials extracts was assessed on cells of an osteoblast-like cell line. The addition of up to 12 wt% castor oil decreased yield strength from 88 to 15 MPa, Young's modulus from 1500 to 446 MPa and maximum polymerization temperature from 41.3 to 25.6°C, without affecting the setting time. However, castor oil seemed to interfere with the polymerization reaction, giving a negative effect on cell viability in a worst-case scenario.

  6. Measurement of quadratic electrogyration effect in castor oil

    Science.gov (United States)

    Izdebski, Marek; Ledzion, Rafał; Górski, Piotr

    2015-07-01

    This work presents a detailed analysis of electrogyration measurement in liquids with the usage of an optical polarimetric technique. Theoretical analysis of the optical response to an applied electric field is illustrated by experimental data for castor oil which exhibits natural optical activity, quadratic electro-optic effect and quadratic electrogyration effect. Moreover, the experimental data show that interaction of the oil with a pair of flat electrodes induces a significant dichroism and natural linear birefringence. The combination of these effects occurring at the same time complicates the procedure of measurements. It has been found that a single measurement is insufficient to separate the contribution of the electrogyration effect, but it is possible on the basis of several measurements performed with various orientations of the polarizer and the analyser. The obtained average values of the quadratic electrogyration coefficient β13 in castor oil at room temperature are from - 0.92 ×10-22 to - 1.44 ×10-22m2V-2 depending on the origin of the oil. Although this study is focused on measurements in castor oil, the presented analysis is much more general.

  7. EMISSÕES DE GASES DE EFEITO ESTUFA NA PRODUÇÃO DE MAMONA E DE SEUS SUBPRODUTOS

    Directory of Open Access Journals (Sweden)

    FELIPE JOSÉ CURY FRACETTO

    2015-01-01

    Full Text Available The largest production of castor bean ( Ricinus communis L . focuses on Bahia savanna, where the change of land use to their cultivation has been considered a strategy of degraded areas recovery. However, changes in the native soil can arise environmental impacts as greenhouse gases (GHG emissions. We have assumed that higher GHG emissions come from a change of land use for castor bean cultivation and their sub - products contribute to GHG emissions. The objective of this study was to make the inventory of the emission of GHG resulting from the castor bean cultivation and their sub - products. It was done a study in the municipality of Irecê - BA and were evaluated: changes in carbon (C soil stocks in cultivated areas with castor bean and Lo- cal native forest; a number of senescent leaves and the biomass produced epigeal; GHG emissions from the sub - products of castor bean. The results showed that the sum of senescent leaves and epigeal biomass obtained by castor bean pruning is more than 1.6 Mg ha - 1 ano - 1 and the castor bean residues used in this soil presented N 2 O emissions close to 600 μg m - 2 . The emissions from the use of castor oil biodiesel represented less than 10% of the emissions. The change in land use handled high emissions of greenhouse gases, accounting for 87% of the total in CO 2 eq. Compared to emissions estimated for sugarcane ethanol, castor biodiesel showed emissions 32% lower.

  8. Different methods evaluation of antioxidant properties of Myrtus communis extract and its fractions

    Directory of Open Access Journals (Sweden)

    Soheila Moein

    2015-09-01

    Full Text Available Myrtus communis L. is a plant traditionally used as an antiseptic and disinfectant drug. In this research, the antioxidant activity of Myrtus communis was assayed by evaluating radical scavenging activity, reducing power, FRAP method and determination of phenolic compounds. The methanolic extract of leaves of Myrtus communis was fractionated by using petroleum ether, chloroform, ethyl acetate and buthanol. In reducing power, different concentrations of samples were mixed with phosphate buffer, ferrocyanate, TCA and ferric chloride. Different concentrations of samples were mixed with DPPH and after 30 min the absorbances were measured. For determination of phenolic content, 500 μl of sample was mixed with Folin-Ciocalteu and sodium carbonate. For determination of flavonoids, 500 μl of sample was mixed with 2 ml of distilled water, NaNO2 and NaOH. In reducing power method, chloroform fraction showed the highest reducing capacity. In the DPPH radical scavenging method, the highest antioxidant capacity was found in buthanol fraction (IC50=84.42±1.8 μg/ml. In FRAP method, the highest antioxidant capacity was found in crude extract (5.4±0.3 mg/ml and buthanol fractions (5.51±0.4 mg/ml, respectively. The highest amount of phenolic compounds was detected in ethyl acetate fraction of Myrtus communis (17.5±0.001 μg/g. The highest amount of flavonoids was found in crude extract of Myrtus communis (171.9±7.3 μg/ml. Overall, we can suggest that the leaves of Myrtus communis can be used as antioxidant and as a food additives to avoid oxidative degradation of foods.

  9. Hypnotic effect of the essential oil from the leaves of Myrtus communis on mice

    Directory of Open Access Journals (Sweden)

    Birhanie MW

    2016-08-01

    Full Text Available Muluken Walle Birhanie,1 Bizuayehu Walle,1 Kidist Rebba2 1Department of Physiology, 2Department of Nursing, College of Medicine and Health Sciences, Bahir Dar University, Bahir Dar, Ethiopia Background: Myrtus communis has been suggested as a sleep aid in unconventional medicine. Moreover, previous studies have also indicated its sedative- and hypnotic-like activity. In this study, the hypnotic effect of M. communis was investigated.Methods: Essential oil (EO of M. communis (600, 800, and 1,000 mg/kg was given orally to Swiss albino mice of both sex, and the hypnotic effect was evaluated. In addition, the EO of M. communis (500, 600, 800, and 1,000 mg/kg was administered orally to Swiss albino mice of both sex 60 minutes prior to pentobarbital injection (50 mg/kg. Latency to sleep and sleep duration were recorded. The effect of the EO on motor coordination and muscle relaxation was evaluated using chimney and traction tests, 60 and 90 minutes after administration of the respective doses of the EO, respectively.Results: There was no induction of hypnosis as the presence of the righting reflex was intact. However the EO prolonged pentobarbital-induced sleeping time and there was also 50% negative response on the chimney and traction test in a dose dependent manner.Conclusion: The EO of M. communis did not produce a hypnotic effect, but it potentiated a hypnotic effect with significant central nervous system depressant activity. Keywords: Myrtus communis, hypnotic, motor coordination, muscle relaxation, essential oil

  10. 78 FR 20029 - Castor Oil, Polymer With Adipic Acid, Linoleic Acid, Oleic Acid and Ricinoleic Acid; Tolerance...

    Science.gov (United States)

    2013-04-03

    ... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 180 [EPA-HQ-OPP-2013-0057; FRL-9381-2] Castor Oil... from the requirement of a tolerance for residues of castor oil, polymer with adipic acid, linoleic acid... eliminates the need to establish a maximum permissible level for residues of castor oil, polymer with adipic...

  11. Mass spectrometry of the lithium adducts of diacylglycerols containing hydroxy FA in castor oil and two normal FA

    Science.gov (United States)

    Castor oil can be used in industry. The molecular species of triacylglycerols containing hydroxy fatty acids (FA) in castor oil have been identified. We report here the identification of twelve diacylglycerols (DAG) containing hydroxy FA in castor oil using positive ion electrospray ionization mass ...

  12. Occurrence of Francisella spp. in Dermacentor reticulatus and Ixodes ricinus ticks collected in eastern Poland.

    Science.gov (United States)

    Wójcik-Fatla, Angelina; Zając, Violetta; Sawczyn, Anna; Cisak, Ewa; Sroka, Jacek; Dutkiewicz, Jacek

    2015-04-01

    A total of 530 questing Dermacentor reticulatus ticks and 861 questing Ixodes ricinus ticks were collected from Lublin province (eastern Poland) and examined for the presence of Francisella by PCR for 16S rRNA (rrs) and tul4 genes. Only one female D. reticulatus tick out of 530 examined (0.2%) was infected with Francisella tularensis subspecies holarctica, as determined by PCR of the rrs gene. None of 861 I. ricinus ticks were infected with F. tularensis. In contrast, the presence of Francisella-like endosymbionts (FLEs) was detected in more than half of the D. reticulatus ticks (50.4%) and 0.8% of the I. ricinus ticks. The nucleotide sequences of the FLEs detected in D. reticulatus exhibited 100% homology with the nucleotide sequence of the FLE strain FDrH detected in Hungary in D. reticulatus. In conclusion, our results suggest a low contribution of D. reticulatus and I. ricinus ticks to the circulation of F. tularensis in eastern Poland. This finding, however, needs to be confirmed by further studies in other areas. Our study confirmed the common infection of D. reticulatus with Francisella-like endosymbionts (FLEs) of unknown pathogenic potential and revealed, for the first time, a low grade of infection of I. ricinus with FLEs. Copyright © 2015 Elsevier GmbH. All rights reserved.

  13. First detection of murine herpesvirus 68 in adult Ixodes ricinus ticks.

    Science.gov (United States)

    Kúdelová, Marcela; Jánošová, Monika; Belvončíková, Petra

    2018-01-19

    Murine herpesvirus 68 (MHV-68) is a natural pathogen that infects murid rodents, which serves as hosts for Ixodes ricinus ticks. For the first time, MHV-68 was detected in immature I. ricinus ticks feeding on Lacerta viridis lizards trapped in Slovakia, which supports the idea that ticks can acquire the virus from feeding on infected hosts. The recent discovery of MHV-68 infection and MHV-68 M3 gene transcripts in Dermacentor reticulatus ticks collected in Slovakia also supports this suggestion. Here, for the first time, we report MHV-68 infection, which was detected by nested PCR, in I. ricinus adults collected from the vegetation, and the viral load in infected ticks was determined by quantitative PCR. The viral incidence in ticks was 38.1% (21/55), and the viral load varied from 1.5 × 10 3 to 2.85 × 10 4 genome copies per tick. These results suggest that the I. ricinus ticks became infected with MHV-68 from biting infected rodents; thus, I. ricinus ticks may play a role in the spread of this virus in nature.

  14. Studies on the Effect of Wet Castor Leaf Feeding and Feeding ...

    African Journals Online (AJOL)

    Rearing of castor feeding silkworm by giving tender wet leaf daily twice at young age (1st and 2nd instars)) and matured wet castor plant leaf daily thrice for late age (3rd, 4th and 5th instars) silkworm significantly reduced the larval duration and diseases incidences and improved all the larval, cocoon and silk traits as ...

  15. Synthesis and membrane performance characterization of self-emulsified waterborne nitrocellulose dispersion modified with castor oil

    Energy Technology Data Exchange (ETDEWEB)

    Su, Xiuxia; Zhao, Qingxiao, E-mail: 934481965@qq.com; Zhang, Dan; Dong, Wei

    2015-11-30

    Graphical abstract: - Highlights: • Waterborne nitrocellulose dispersion modified with castor oil (CWNC) was synthesized successfully. • It is a kind of environment-friendly coatings, in which volatile organic content (VOC) is near zero. • Castor oil used as an internal crosslinking agent for WNC improved the properties of the coating. • When the mass fraction of castor oil to total reactants is 7%, emulsion and the coating are of the best comprehensive performance. - Abstract: Waterborne nitrocellulose dispersion modified with castor oil (CWNC) was designed and successfully synthesized by self emulsification and reaction among isophorone diisocyanate (IPDI) trimer, dimethylol propionic acid (DMPA), nitrocellulose (NC) and castor oil (C.O.). The CWNC was characterized by transmission electron microscope (TEM), Fourier transform infrared (FTIR) spectroscopy and thermal gravimetric analysis (TGA), etc. The particle size of CWNC increased with the increase of mass fraction of castor oil to total reactants, ω (C.O.). The morphology of particles is an approximate core–shell structure indicated by TEM. FTIR confirmed that the reactions (i.e. IPDI trimer and castor oil, IPDI trimer and NC) occurred, the NCO groups of IPDI trimer were consumed totally and the backbone of NC was retained. The water contact angle measurements confirmed that introduced castor oil increased hydrophobicity of the film, thereby increasing the contact angle. TGA revealed that the CWNC film had better thermal resistance.

  16. Identification of minor acylglycerols less polar than triricinolein in castor oil by mass spectrometry

    Science.gov (United States)

    Triacylglycerols in castor oil less polar than triricinolein were identified by electrospray ionization – mass spectrometry using the lithium adducts of the acylglycerols from the HPLC fractions of castor oil. Thirty four new molecular species of acylglycerols containing hydroxy fatty acids in casto...

  17. the use of castor oil as a flame retardant in polyurethane foam

    African Journals Online (AJOL)

    Dr Abdusalam

    ABSTRACT. Thirteen polyurethane foam samples were prepared with varying quantity of castor oil as a reactant with polyisocyanate and their flammability test was carried out using various flame test procedures. Physical properties of the foam samples were found to increase with the increasing in the quantity of castor oil.

  18. Synthesis and membrane performance characterization of self-emulsified waterborne nitrocellulose dispersion modified with castor oil

    International Nuclear Information System (INIS)

    Su, Xiuxia; Zhao, Qingxiao; Zhang, Dan; Dong, Wei

    2015-01-01

    Graphical abstract: - Highlights: • Waterborne nitrocellulose dispersion modified with castor oil (CWNC) was synthesized successfully. • It is a kind of environment-friendly coatings, in which volatile organic content (VOC) is near zero. • Castor oil used as an internal crosslinking agent for WNC improved the properties of the coating. • When the mass fraction of castor oil to total reactants is 7%, emulsion and the coating are of the best comprehensive performance. - Abstract: Waterborne nitrocellulose dispersion modified with castor oil (CWNC) was designed and successfully synthesized by self emulsification and reaction among isophorone diisocyanate (IPDI) trimer, dimethylol propionic acid (DMPA), nitrocellulose (NC) and castor oil (C.O.). The CWNC was characterized by transmission electron microscope (TEM), Fourier transform infrared (FTIR) spectroscopy and thermal gravimetric analysis (TGA), etc. The particle size of CWNC increased with the increase of mass fraction of castor oil to total reactants, ω (C.O.). The morphology of particles is an approximate core–shell structure indicated by TEM. FTIR confirmed that the reactions (i.e. IPDI trimer and castor oil, IPDI trimer and NC) occurred, the NCO groups of IPDI trimer were consumed totally and the backbone of NC was retained. The water contact angle measurements confirmed that introduced castor oil increased hydrophobicity of the film, thereby increasing the contact angle. TGA revealed that the CWNC film had better thermal resistance.

  19. Methyl esters from vegetable oils with hydroxy fatty acids: Comparison of lesquerella and castor methyl esters

    Science.gov (United States)

    The search for alternative feedstocks for biodiesel as partial replacement for petrodiesel has recently extended to castor oil. In this work, the castor oil methyl esters were prepared and their properties determined in comparison to the methyl esters of lesquerella oil, which in turn is seen as alt...

  20. Castor oil induces laxation and uterus contraction via ricinoleic acid activating prostaglandin EP3 receptors.

    Science.gov (United States)

    Tunaru, Sorin; Althoff, Till F; Nüsing, Rolf M; Diener, Martin; Offermanns, Stefan

    2012-06-05

    Castor oil is one of the oldest drugs. When given orally, it has a laxative effect and induces labor in pregnant females. The effects of castor oil are mediated by ricinoleic acid, a hydroxylated fatty acid released from castor oil by intestinal lipases. Despite the wide-spread use of castor oil in conventional and folk medicine, the molecular mechanism by which ricinoleic acid acts remains unknown. Here we show that the EP(3) prostanoid receptor is specifically activated by ricinoleic acid and that it mediates the pharmacological effects of castor oil. In mice lacking EP(3) receptors, the laxative effect and the uterus contraction induced via ricinoleic acid are absent. Although a conditional deletion of the EP(3) receptor gene in intestinal epithelial cells did not affect castor oil-induced diarrhea, mice lacking EP(3) receptors only in smooth-muscle cells were unresponsive to this drug. Thus, the castor oil metabolite ricinoleic acid activates intestinal and uterine smooth-muscle cells via EP(3) prostanoid receptors. These findings identify the cellular and molecular mechanism underlying the pharmacological effects of castor oil and indicate a role of the EP(3) receptor as a target to induce laxative effects.

  1. Effect of castor cake and elephant grass composting on edaphic fauna

    Directory of Open Access Journals (Sweden)

    Rafael Nogueira Scoriza

    Full Text Available ABSTRACT: Elephant grass and castor cake when combined can make a promising organic fertilizer. However, castor cake contains potentially toxic chemicals, such as ricin and ricinine. To test potential effects of these chemicals, compost piles of elephant grass ( Pennisetum purpureum Schum. with castor cake were prepared with different C:N ratios (T1 = 40, T2 = 30, T3 = 20; T4 = 30 [control, elephant grass + crotalaria] to evaluate colonization by edaphic fauna and any suppressive effects of castor cake. Soil organisms were collected with Berlese-Tullgren funnels. There were temporal differences between the treatments, and the epigeous fauna was mainly represented by members of the Acari and Entomobryomorpha. Elapsed time is the major factor in determining the composition of the epigeous fauna community associated with composting, indicating that castor cake has no suppressive effect.

  2. Physicochemical and sensory characteristics of milk from goats supplemented with castor or licuri oil.

    Science.gov (United States)

    Pereira, R A G; Oliveira, C J B; Medeiros, A N; Costa, R G; Bomfim, M A D; Queiroga, R C R E

    2010-02-01

    The purpose of this study was to evaluate the influence of castor and licuri palm oils supplemented to milking goats on the physical, chemical, and sensory characteristics of milk. A double Latin square experimental design (5x5) using 10 confined crossbred Moxotó-Alpine goats was performed according to the following treatments: nonsupplemented (control), 3% castor oil, 5% castor oil, 3% licuri oil, and 5% licuri oil. Oils in each treatment were supplemented in the dry matter. Castor oil supplementation reduced the fat content and increased the lactose and density of milk. Considering the sensory analysis, a lower acceptability was observed for milk from goats supplemented with castor oil. On the other hand, licuri oil supplementation led to higher acceptability scores for flavor and odor of goat milk. Copyright 2010 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

  3. Synthesis and membrane performance characterization of self-emulsified waterborne nitrocellulose dispersion modified with castor oil

    Science.gov (United States)

    Su, Xiuxia; Zhao, Qingxiao; Zhang, Dan; Dong, Wei

    2015-11-01

    Waterborne nitrocellulose dispersion modified with castor oil (CWNC) was designed and successfully synthesized by self emulsification and reaction among isophorone diisocyanate (IPDI) trimer, dimethylol propionic acid (DMPA), nitrocellulose (NC) and castor oil (C.O.). The CWNC was characterized by transmission electron microscope (TEM), Fourier transform infrared (FTIR) spectroscopy and thermal gravimetric analysis (TGA), etc. The particle size of CWNC increased with the increase of mass fraction of castor oil to total reactants, ω (C.O.). The morphology of particles is an approximate core-shell structure indicated by TEM. FTIR confirmed that the reactions (i.e. IPDI trimer and castor oil, IPDI trimer and NC) occurred, the NCO groups of IPDI trimer were consumed totally and the backbone of NC was retained. The water contact angle measurements confirmed that introduced castor oil increased hydrophobicity of the film, thereby increasing the contact angle. TGA revealed that the CWNC film had better thermal resistance.

  4. Characterization and Digestibility of Detoxified Castor Oil Meal for Japanese Quails

    Directory of Open Access Journals (Sweden)

    PA dos Santos

    2015-12-01

    Full Text Available ABSTRACT These experiments were performed to determine the chemical composition, coefficients of nutrient and energy metabolizability, amino acid composition, and cytotoxicity of different castor oil meals subjected to different detoxification processes and added to the diet of Japanese quails. In the trial, 180 46-d-old female Japanese quails were distributed according to a completely randomized design into five treatments and with replicates of six bird each. The treatments consisted of following detoxification methods of castor oil meal: Castor oil meal A (CMA - recovery in alcohol at 80 °C for 20 minutes and drying at 80 °C; castor oil meal B (CMB and C (CMC - recovery in alcohol at 80 °C for 6 minutes, neutralization with 5% NaOH, and drying under direct sunlight sun for two days (CMB or pelleted (CMC; castor oil meal D (CMD - recovery in alcohol at 110 °C for 15 minutes and drying at 110 °C. Castor oil meal was added replacing 20% of the reference diet. There was slight chemical composition variation (1.21% in crude protein, 6% in dry matter, 2.2% in ether extract and 64 kcal/kg in gross energy among the castor oil meals submitted to the different treatments. The castor oil meal submitted to treatment C showed the highest amino acid values. In the cytotoxicity test, treatment D presented lower ricin activity. Castor oil meals A, C, and D may be included in Japanese quail diets; however, castor oil meal D is recommended due to the simplicity its industrial process, its low toxicity, and metabolizability coefficients obtained.

  5. Borrelia miyamotoi in host-seeking Ixodes ricinus ticks in England.

    Science.gov (United States)

    Hansford, K M; Fonville, M; Jahfari, S; Sprong, H; Medlock, J M

    2015-04-01

    This paper reports the first detection of Borrelia miyamotoi in UK Ixodes ricinus ticks. It also reports on the presence and infection rates of I. ricinus for a number of other tick-borne pathogens of public health importance. Ticks from seven regions in southern England were screened for B. miyamotoi, Borrelia burgdorferi sensu lato (s.l.), Anaplasma phagocytophilum and Neoehrlichia mikurensis using qPCR. A total of 954 I. ricinus ticks were tested, 40 were positive for B. burgdorferi s.l., 22 positive for A. phagocytophilum and three positive for B. miyamotoi, with no N. mikurensis detected. The three positive B. miyamotoi ticks came from three geographically distinct areas, suggesting a widespread distribution, and from two separate years, suggesting some degree of endemicity. Understanding the prevalence of Borrelia and other tick-borne pathogens in ticks is crucial for locating high-risk areas of disease transmission.

  6. Medicinal significance, pharmacological activities, and analytical aspects of ricinine: A concise report

    Directory of Open Access Journals (Sweden)

    Kanika Patel

    2016-08-01

    Full Text Available Ricinine (3-cyano-4-methoxy-N-methyl-2-pyridone is an alkaloid present in leaves and seeds of castor plant i.e. Ricinus communis. It can cause vomiting, convulsions, hypotension, liver and kidney damage and several other complications in human. Ricinine presents mainly in young plant and it is the only cyano-substituted pyridine compounds occurred naturally. Ricinine also found in some other plants such as Piper nigrum, Discocleidion rufescens, Aparisthmium cordatum and Nicotiana tabacum. Accidental and intended Ricinus communis intoxications in humans and animals have been known for centuries. In the present review, we summarize the information regarding its medicinal uses, pharmacological activities, analytical techniques and intended and unintended poisoning cases in humans and animals. This review will be beneficial for the researcher in the field of herbal medicine and other allied sciences.

  7. Toxicity of copper sulphate on some haematological parameters of a freshwater teleost Cyprinus carpio var. communis

    OpenAIRE

    Ramesh, M.

    2001-01-01

    Haematological changes in a freshwater teleost, Cyprinus carpio var. communis, exposed to acute and sublethal toxicity of copper sulphate were studied. During the acute treatment, erythrocyte and leucocyte count, and haemoglobin content increased, whereas during the sublethal treatment, erythrocyte count and haemoglobin content decreased and leucocyte count increased.

  8. ANTIMICROBIAL ACTIVITY OF THE ESSENTIAL OIL OF Myrtus communis L BERRIES GROWING WILD IN ALGERIA

    Directory of Open Access Journals (Sweden)

    M. Toauibia

    2015-05-01

    Full Text Available The development of microbial resistance to antibiotics is a global concern. The present study was carried out to determine the composition and the antimicrobial potential of the essential oil of Myrtus communis L. against 13 pathogenic strains responsible of many infections. The results show that levels of MIC observed range from 0.563 to 36 mg/ml. 

  9. Antidiabetic Activity of Different Extracts of Myrtus Communis in Streptozotocin Induced Diabetic Rats

    Directory of Open Access Journals (Sweden)

    Panjeshahin Mohammad Reza

    2016-06-01

    Full Text Available Background and aim: Hydroalcoholic (70° extract of leaves of Myrtus communis has been shown to have antidiabetic effect in streptozotocin induced diabetic rats in our previous study. In this study, we intended to determine the components of the mentioned extract and identify the mechanism for its action.

  10. ANTIMICROBIAL ACTIVITY OF THE ESSENTIAL OIL OF Myrtus communis L BERRIES GROWING WILD IN ALGERIA

    OpenAIRE

    M. Toauibia

    2015-01-01

    The development of microbial resistance to antibiotics is a global concern. The present study was carried out to determine the composition and the antimicrobial potential of the essential oil of Myrtus communis L. against 13 pathogenic strains responsible of many infections. The results show that levels of MIC observed range from 0.563 to 36 mg/ml. 

  11. ANTIMICROBIAL ACTIVITY OF THE ESSENTIAL OIL OF MYRTUS COMMUNIS L BERRIES GROWING WILD IN ALGERIA

    Directory of Open Access Journals (Sweden)

    M. Toauibia

    2015-02-01

    Full Text Available The development of microbial resistance to antibiotics is a global concern. The present study was carried out to determine the composition and the antimicrobial potential of the essential oil of Myrtus communis L. against 13 pathogenic strains responsible of many infections. The results show that levels of MIC observed range from 0.563 to 36 mg/ml.

  12. An Ixodes ricinus Tick Salivary Lectin Pathway Inhibitor Protects Borrelia burgdorferi sensu lato from Human Complement.

    Science.gov (United States)

    Wagemakers, Alex; Coumou, Jeroen; Schuijt, Tim J; Oei, Anneke; Nijhof, Ard M; van 't Veer, Cornelis; van der Poll, Tom; Bins, Adriaan D; Hovius, Joppe W R

    2016-04-01

    We previously identified tick salivary lectin pathway inhibitor (TSLPI) in Ixodes scapularis, a vector for Borrelia burgdorferi sensu stricto (s.s.) in North America. TSLPI is a salivary protein facilitating B. burgdorferi s.s. transmission and acquisition by inhibiting the host lectin complement pathway through interference with mannose binding lectin (MBL) activity. Since Ixodes ricinus is the predominant vector for Lyme borreliosis in Europe and transmits several complement sensitive B. burgdorferi sensu lato (s.l.) strains, we aimed to identify, describe, and characterize the I. ricinus ortholog of TSLPI. We performed (q)PCRs on I. ricinus salivary gland cDNA to identify a TSLPI ortholog. Next, we generated recombinant (r)TSLPI in a Drosophila expression system and examined inhibition of the MBL complement pathway and complement-mediated killing of B. burgdorferi s.l. in vitro. We identified a TSLPI ortholog in I. ricinus salivary glands with 93% homology at the RNA and 89% at the protein level compared to I. scapularis TSLPI, which was upregulated during tick feeding. In silico analysis revealed that TSLPI appears to be part of a larger family of Ixodes salivary proteins among which I. persulcatus basic tail salivary proteins and I. scapularis TSLPI and Salp14. I. ricinus rTSLPI inhibited the MBL complement pathway and protected B. burgdorferi s.s. and Borrelia garinii from complement-mediated killing. We have identified a TSLPI ortholog, which protects B. burgdorferi s.l. from complement-mediated killing in I. ricinus, the major vector for tick-borne diseases in Europe.

  13. Mitogenomes reveal diversity of the European Lyme borreliosis vector Ixodes ricinus in Italy.

    Science.gov (United States)

    Carpi, Giovanna; Kitchen, Andrew; Kim, Hie Lim; Ratan, Aakrosh; Drautz-Moses, Daniela I; McGraw, John J; Kazimirova, Maria; Rizzoli, Annapaola; Schuster, Stephan C

    2016-08-01

    In Europe, the Ixodes ricinus tick is the most important vector of the etiological agents of Lyme borreliosis and several other emerging tick-borne diseases. Because tick-borne pathogens are dependent on their vectors for transmission, understanding the vector population structure is crucial to inform public health research of pathogen dynamics and spread. However, the population structure and dynamics of this important vector species are not well understood as most genetic studies utilize short mitochondrial and nuclear sequences with little diversity. Herein we obtained and analyzed complete mitochondrial genome (hereafter "mitogenome") sequences to better understand the genetic diversity and the population structure of I. ricinus from two long-standing tick-borne disease foci in northern Italy. Complete mitogenomes of 23 I. ricinus ticks were sequenced at high coverage. Out of 23 mitogenome sequences we identified 17 unique haplotypes composed of 244 segregating sites. Phylogenetic reconstruction using 18 complete mitogenome sequences revealed the coexistence of four highly divergent I. ricinus maternal lineages despite the narrow spatial scale over which these samples were obtained (100km). Notably, the estimated coalescence time of the 18 mitogenome haplotypes is ∼427 thousand years ago (95% HPD 330, 540). This divergence between I. ricinus lineages is consistent with the mitochondrial diversity of other arthropod vector species and indicates that long-term I. ricinus populations may have been less structured and larger than previously thought. Thus, this study suggests that a rapid and accurate retrieval of full mitochondrial genomes from this disease vector enables fine-resolution studies of tick intraspecies genetic relationships, population differentiation, and demographic history. Copyright © 2016 Elsevier Inc. All rights reserved.

  14. Safety analysis report for packaging (onsite) Castor GSF cask

    International Nuclear Information System (INIS)

    Clements, E.P.

    1997-01-01

    The CASTOR GSF packaging was designed and fabricated to be a certified Type B(U) packaging and comply with the requirements of the International Atomic Energy Agency (IAEA) for transport of up to five sealed canisters of vitrified radioactive materials. This onsite Safety Analysis Report for Packaging (SARP) provides the analysis and evaluations necessary to demonstrate that the casks, with the canister payload, meet the intent of the Type B packaging regulations set forth in 10 CFR 71 and therefore meet the onsite transportation safety requirements of WHC-CM-2-14, Hazardous Material Packaging and Shipping

  15. Control of plasma position in the CASTOR tokamak

    International Nuclear Information System (INIS)

    Valovic, M.

    1988-11-01

    A simple servo-system designed for plasma position control in the CASTOR tokamak is described. Both radial and vertical plasma displacements were minimized using two servo-loops consisting of detection coils, a conventional electric controller and an amplifier operated as an unipolar voltage-controlled current source. To ensure the optimum conditions in the start-up phase of the discharge, currents in the servo-systems were externally preprogrammed. The prescribed plasma position was maintained with the accuracy of 3 mm. The feedback control improves plasma parameters, e.g. it removes the positional disruption at the end of the tokamak discharge. (J.U.). 4 figs., 3 refs

  16. LDPE/PHB blends filled with castor oil cake

    Science.gov (United States)

    Burlein, Gustavo A.; Rocha, Marisa C. G.

    2015-05-01

    The response surface methodology (RSM) is a collection of mathematical techniques useful for developing, improving and optimizing process. In this study, RSM technique was applied to evaluate the effect of the components proportion on the mechanical properties of low density polyethylene (LDPE)/ poly (3-hydroxy-butyrate) (PHB) blends filled with castor oil cake (CC). The blends were prepared by melt mixing in a twin screw extruder. Low density polyethylene, poly (3-hydroxy-butyrate) and castor oil pressed cake were represented by the input variables designated as LDPE, PHB and CC, respectively. As it was desirable to consider the largest LDPE content in the ternary system, the components of the mixture were subjected to the following constraints: 0.7 ≤ LDPE ≤ 1.0, 0≤ PHB≤0.3 e 0 ≤ CC ≤0.3. The mechanical properties of the different mixtures were determined by conventional ASTM tests and were evaluated through analysis of variance performed by the Minitab software. Some polynomial equations were tested in order to describe the mechanical behavior of the samples. The quadratic model in pseudo components was selected for describing the tensile behavior because it was the most efficient from a statistical point of view (p-value ≤ 0.05; coefficient of determination (r2) close to 1 and variation inflation factor (VIF) values castor oil cake to LDPE. The morphological study of the materials obtained showed that LDPE/PHB blends are immiscible and form morphological structures with well distinguished phase boundaries between dispersed phase and matrix. Biodegradation was evaluated burying the samples in simulated soil for different periods of time. The LDPE/PHB/CC mixtures with higher content of PHB showed more pronounced degradation. Under the experimental conditions studied the LDPE/CC compositions presented no degradation. However, the loss of mass of the LDPE/PHB/CC mixtures was higher than the loss of mass of the corresponding LDPE/PHB binary blend. This

  17. Isocyanate-functionalized castor oil as a novel bitumen modifier

    OpenAIRE

    Cuadri Vega, Antonio Abad; García Morales, Moisés; Navarro Domínguez, Francisco Javier; Partal López, Pedro

    2013-01-01

    The use of biomaterials from renewable sources in the synthesis of polyurethane-derived polymers is lately receiving great attention from social, environmental and economic standpoints. In this work, prepolymers having different -NCO/-OH ratio were synthesized, by reaction of 4,4´-diphenylmethane diisocyanate (MDI) with castor oil (CO), to be used as modifying agent of asphaltic bitumen. Reactions between MDI and CO, performed with -NCO/-OH molar ratios of 8:1 and 4:1, have led to suitable bi...

  18. Example of industrial valorisation of derivative products of Castor oil

    Directory of Open Access Journals (Sweden)

    Borg Patrick

    2009-07-01

    Full Text Available Known since antiquity, Castor Oil has been first used in medicine. Now, even if it remains present in small quantities as an excipient in many pharmaceutical specialties, it finds a lot of applicationsin cosmetics, industrial applications and chemical industry. Castor Oil specificity comes from its high content of ricinoleic acid (up to 85% that combines a double bond and an hydroxyl function in the heart of a 18 carbons linear chain. This particular structure is the key of an unique chemistry developed by ARKEMA that gives by thermal cracking a wide range of compounds with either 7 or 11 carbon atoms. A whole range of innovative chemistries and end use products are generated from these base reaction products. They are used in every-day life, to improve our comfort and safety but also in very specific applications with very high technical requirements. Synthesized from undecylenic acid, 11-amino-undecanoic acid, 100% based on renewable resources, is the precursor to biobased polymers combining high performance and sustainability: Rilsan®, Rilsan Fine Powder®, Pebax Rnew®.

  19. Characterization of Novel Castor Oil-Based Polyurethane Polymer Electrolytes

    Directory of Open Access Journals (Sweden)

    Salmiah Ibrahim

    2015-04-01

    Full Text Available Castor oil-based polyurethane as a renewable resource polymer has been synthesized for application as a host in polymer electrolyte for electrochemical devices. The polyurethane was added with LiI and NaI in different wt% to form a film of polymer electrolytes. The films were characterized by using attenuated total reflectance-Fourier transform infrared spectroscopy, dynamic mechanical analysis, electrochemical impedance spectroscopy, linear sweep voltammetry and transference number measurement. The highest conductivity of 1.42 × 10−6 S cm−1 was achieved with the addition of 30 wt% LiI and 4.28 × 10−7 S·cm−1 upon addition of 30 wt% NaI at room temperature. The temperature dependence conductivity plot indicated that both systems obeyed Arrhenius law. The activation energy for the PU-LiI and PU-NaI systems were 0.13 and 0.22 eV. Glass transition temperature of the synthesized polyurethane decreased from −15.8 °C to ~ −26 to −28 °C upon salts addition. These characterizations exhibited the castor oil-based polyurethane polymer electrolytes have potential to be used as alternative membrane for electrochemical devices.

  20. Mating activity and physiological age of females in population of Ixodes ricinus (L.) (Acari: Ixodidae)

    Czech Academy of Sciences Publication Activity Database

    Mikulová, N.; Dusbábek, František; Bouman, Edwin Arien Poul

    2005-01-01

    Roč. 13, č. 1 (2005), s. 85-92 ISSN 0132-8077 R&D Projects: GA ČR GA206/04/0751 Institutional research plan: CEZ:AV0Z60220518 Keywords : Ixodes ricinus * age structure * mating activity Subject RIV: EG - Zoology

  1. Ultrastructure and lectin characterization of granular salivary cells from Ixodes ricinus females

    Czech Academy of Sciences Publication Activity Database

    Vancová, Marie; Zacharovová, Klára; Grubhoffer, Libor; Nebesářová, Jana

    2006-01-01

    Roč. 92, č. 3 (2006), s. 431-440 ISSN 0022-3395 R&D Projects: GA ČR GA206/03/1323 Institutional research plan: CEZ:AV0Z60220518 Keywords : Ixodes ricinus * salivary glands * lectin labeling Subject RIV: EE - Microbiology, Virology Impact factor: 1.300, year: 2006

  2. Ixodes ricinus tick saliva modulates tick-borne encephalitis virus infection of dendritic cells

    Czech Academy of Sciences Publication Activity Database

    Fialová, Anna; Cimburek, Zdeněk; Iezzi, G.; Kopecký, Jan

    2010-01-01

    Roč. 12, č. 7 (2010), s. 580-585 ISSN 1286-4579 R&D Projects: GA AV ČR IAA600960811 Institutional research plan: CEZ:AV0Z60220518; CEZ:AV0Z50200510 Keywords : Tick-borne encephalitis virus * Dendritic cell * Tick saliva * Ixodes ricinus Subject RIV: EC - Immunology Impact factor: 2.726, year: 2010

  3. Differential expression of Ixodes ricinus tick genes induced by blood feeding or Borrelia burgdorferi infection

    Czech Academy of Sciences Publication Activity Database

    Rudenko, Natalia; Golovchenko, Maryna; Edwards, M. J.; Grubhoffer, Libor

    2005-01-01

    Roč. 42, č. 1 (2005), s. 36-41 ISSN 0022-2585 R&D Projects: GA AV ČR IAA6022306 Institutional research plan: CEZ:AV0Z60220518 Keywords : Ixodes ricinus * Borrelia burgdorferi * subtractive hybridization Subject RIV: EE - Microbiology, Virology Impact factor: 1.489, year: 2005

  4. Anti-tumour necrosis factor-alpha activity in Ixodes ricinus saliva

    Czech Academy of Sciences Publication Activity Database

    Koník, Peter; Slavíková, Veronika; Salát, Jiří; Řezníčková, Jana; Dvorožňáková, E.; Kopecký, Jan

    2006-01-01

    Roč. 28, č. 12 (2006), s. 649-656 ISSN 0141-9838 R&D Projects: GA ČR GA524/05/0811; GA MŠk(CZ) LC06009 Institutional research plan: CEZ:AV0Z60220518 Keywords : Ixodes ricinus * tick saliva * TNF Subject RIV: EC - Immunology Impact factor: 2.009, year: 2006

  5. The ecology of Lyme borreliosis risk : interactions between lxodes ricinus, rodents and Borrelia burgdorferi sensu lato

    NARCIS (Netherlands)

    Duijvendijk, van Gilian

    2016-01-01

    The sheep tick (Ixodes ricinus) is widespread throughout Europe and can transmit Borrelia burgdorferi sensu lato (s.l.), which can cause Lyme borreliosis and B. miyamotoi, the agent of Borrelia miyamotoi disease in humans.

  6. Human pathogenic borreliae in Ixodes ricinus ticks in natural and urban ecosystem (Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Venclíková, Kristýna; Betášová, Lenka; Šikutová, Silvie; Jedličková, Petra; Hubálek, Zdeněk; Rudolf, Ivo

    2014-01-01

    Roč. 59, č. 4 (2014), s. 717-720 ISSN 1230-2821 EU Projects: European Commission(XE) 261504 - EDENEXT Institutional support: RVO:68081766 Keywords : Ixodes ricinus * Borrelia burgdorgeri s.l. * genomic species * ixodid ticks Subject RIV: EE - Microbiology, Virology Impact factor: 0.905, year: 2014

  7. Detection and identification of Anaplasma phagocytophilum, Borrelia burgdorferi, and Rickettsia helvetica in Danish Ixodes ricinus ticks

    DEFF Research Database (Denmark)

    Skarphédinsson, Sigurdur; Lyholm, Birgitte Fjendbo; Ljungberg, Marianne

    2007-01-01

    Borreliosis is an endemic infection in Denmark. Recent serosurveys have indicated that human anaplasmosis may be equally common. The aim of this study was to look for Anaplasma phagocytophilum and related pathogens in Ixodes ricinus ticks and estimate their prevalence, compared to Borrelia, using...

  8. First detection of Borrelia miyamotoi in Ixodes ricinus ticks from northern Italy.

    NARCIS (Netherlands)

    Ravagnan, Silvia; Tomassone, Laura; Montarsi, Fabrizio; Krawczyk, Aleksandra Iwona; Mastrorilli, Eleonora; Sprong, Hein; Milani, Adelaide; Rossi, Luca; Capelli, Gioia

    2018-01-01

    Borrelia miyamotoi is a spirochete transmitted by several ixodid tick species. It causes a relapsing fever in humans and is currently considered as an emerging pathogen. In Europe, B. miyamotoi seems to occur at low prevalence in Ixodes ricinus ticks but has a wide distribution. Here we report the

  9. Behavioural responses of Ixodes ricinus nymphs to carbon dioxide and rodent odour

    NARCIS (Netherlands)

    Duijvendijk, van G.; Gort, G.; Sprong, H.; Takken, W.

    2017-01-01

    Many haematophagous ectoparasites use carbon dioxide (CO2) and host odour to detect and locate their hosts. The tick Ixodes ricinus (Linnaeus) (Ixodida: Ixodidae) walks only small distances and quests in vegetation until it encounters a host. The differential effects of CO2 and host odour on the

  10. Occurrence of multiple infections with different Borrelia burgdorferi genospecies in Danish Ixodes ricinus nymphs

    DEFF Research Database (Denmark)

    Andersen, Jean Vennestrøm; Egholm, H.; Mikkelsen, Per Jensen

    2008-01-01

    The pathogen Borrelia burgdorferi causes Lyme Borreliosis in human and animals world-wide. In Europe the pathogen is transmitted to the host by the vector Ixodes ricinus. The nymph is the primary instar for transmission to humans. We here study the infection rate of five Borrelia genospecies: B...

  11. Ixodes ricinus and Borrelia prevalence at the Arctic Circle in Norway.

    Science.gov (United States)

    Hvidsten, Dag; Stuen, Snorre; Jenkins, Andrew; Dienus, Olaf; Olsen, Renate S; Kristiansen, Bjørn-Erik; Mehl, Reidar; Matussek, Andreas

    2014-03-01

    The distribution limit of Ixodes ricinus ticks in northwestern Europe (Brønnøy, Norway, 1° south of the Arctic Circle), has been known since the 1930s. To reconfirm this finding and extend studies in the areas adjacent to the Arctic Circle (66°33' N), ticks were collected from dogs and cats in 8 districts in northern Norway from 64°56' N to 68°48' N. We detected 549 I. ricinus, 244 (44%) of them in Brønnøy district, and 305 (range 6-87 ticks) in 7 districts in the northern part of the study area. The prevalence of Borrelia in these ticks was determined by real-time PCR. In the Brønnøy district (65°28' N, 12°12' E), 29% of the I. ricinus were Borrelia spp.-positive, and the species B. afzelii was nearly twice as prevalent as B. garinii and/or B. valaisiana. In the study area north of Brønnøy district, only 12 (4%) of the collected ticks contained Borrelia spp. In conclusion, tick occurrence and Borrelia prevalence are high in the Brønnøy district. In contrast, I. ricinus occurrence and Borrelia prevalence are low further north across the Arctic Circle in Norway. Copyright © 2013 Elsevier GmbH. All rights reserved.

  12. Diversity of Ixodes ricinus tick-associated bacterial communities from different forests

    NARCIS (Netherlands)

    Overbeek, van L.S.; Gassner, F.; Lombaers-van der Plas, C.H.; Kastelein, P.; Nunes da Rocha, U.; Takken, W.

    2008-01-01

    Nymphal Ixodes ricinus ticks (n=180) were collected from three different areas in the Netherlands to investigate the effect of forest composition on tick-associated microbial communities. Sampled habitats differed in thickness of leaf litter and humus layers and vegetation associations and were

  13. Babesia sp. EU1 from Roe Deer and Transmission within Ixodes ricinus

    Science.gov (United States)

    Jouglin, Maggy; L’Hostis, Monique; Chauvin, Alain

    2007-01-01

    We report in vitro culture of zoonotic Babesia sp. EU1 from blood samples of roe deer in France. This study provides evidence of transovarial and transstadial transmission of the parasite within Ixodes ricinus, which suggests that this tick could be a vector and reservoir of EU1. PMID:17953093

  14. Influence of meteorological parameters during the preceding fall and winter on the questing activity of nymphal Ixodes ricinus ticks

    DEFF Research Database (Denmark)

    Vollack, Ken; Sodoudi, Sahar; Névir, Peter

    2017-01-01

    Wood ticks, Ixodes ricinus L., serve as vectors for various pathogens and are ubiquitous throughout Central Europe. Survival and development of I. ricinus depend on biotic and abiotic factors. We examined whether relative humidity (RH), air (T a ) and soil temperatures (T s ), or snow depth during...... the average number of nymphs questing during spring. Our observations suggest that RH, T s , and snow cover during the preceding months affect the questing activity of nymphal I. ricinus during their first peak of activity. Snow cover serves as an insulator between the atmosphere and soil, which not only...

  15. Antifungal activity of Myrtus communis against Malassezia sp. isolated from the skin of patients with pityriasis versicolor.

    Science.gov (United States)

    Barac, Aleksandra; Donadu, Matthew; Usai, Donatella; Spiric, Vesna Tomic; Mazzarello, Vittorio; Zanetti, Stefania; Aleksic, Ema; Stevanovic, Goran; Nikolic, Natasa; Rubino, Salvatore

    2017-11-20

    The increasing incidence of fungal infections and antifungal resistance has prompted the search for novel antifungal drugs and alternative agents. We explored the antifungal activity of Myrtus communis essential oil (EO) against Malassezia sp. isolated from the skin of patients with pityriasis versicolor. These broad-spectrum antimicrobial activities of M. communis EO and its potent inhibiting activity on Malassezia growth deserve further research with aim to considerate this EO as candidate for topical use in treatment of skin diseases.

  16. Unbodied dehydrated castor oil from oil of castor beans cultivated in tropical and sub tropical zones of pakistan

    International Nuclear Information System (INIS)

    Saleem, R.; Sultana, R.; Ambrat, A.; Kandhro, A.

    2014-01-01

    Commercially available castor oil was analysed for specific gravity at 25/25 degree C (0.959), acid value (0.5), iodine value (85), refractive index at 25 degree C (1.4769), viscosity at 25 degree C (6.8), and hydroxyl value (162). Fatty acid composition, including palmitic acid (I. 7%), stearic acid (1.39%), oleic acid (5.73%), linoleic acid (6.25%), and ricinoleic acid (84.2%) was estimated by means of GLC. Unbodied dehydrated castor oil (DCO- 15) 93% was prepared by using sodium bisulphate and sodium bisulphite and other reaction conditions. Unbodied DCO was analysed for iodine value (139), acid value (3.6), refractive index at 25 degree C (1.4820), specific gravity at 25/25 degree C and 30/30 degree C (0.9333 and 0.925) viscosity at 25 degree C and 30 degree C (200 cps and 1.85 poise), respectively. Fatty acid composition was also determined to ascertain the extent of dehydration due to the formation of conjugated linoleic acid (CLA, 36.9%) and non conjugated linoleic acid (NCLA, 46.8%). Ricinoleic acid was estimated as 3.83%. Unbodied DCO-15 was in good conformance with the standard specification of ASTM and other values cited in the literature. (author)

  17. Enzymatic incorporation of caffeoyl into castor oil to prepare the novel castor oil-based caffeoyl structured lipids.

    Science.gov (United States)

    Sun, Shangde; Wang, Ping; Zhu, Sha

    2017-05-10

    In this work, a novel castor oil-based caffeoyl structured lipids was successfully prepared by the enzymatic transesterification using castor oil (CO) as caffeoyl acceptor. During the structured lipids preparation, two competitive reactions, the hydrolysis of CO to form hydrophilic caffeoyl glycerols (CG)+dicaffeoyl glycerols (DCG) and the transesterification of CO with ethyl caffeate (EC) to form lipophilic caffeoyl mono- and di-acylglycerols (CMAG and CDAG), were found. Reaction progress was monitored using HPLC-ESI-MS and HPLC-UV. The effects of by-product ethanol removal and reaction variables on the transesterification and reaction selectivity were evaluated. Results showed that, the activation energies for the transesterification and for the selective formations of CMAG+CDAG and CG+DCG were 57.60kJ/mol, 58.86kJ/mol, and 60.53kJ/mol, respectively. Under the optimal reaction conditions (enzyme load 23%, 90°C, 1:3 molar ratio of EC to CO, and 46.5h), EC conversion and the yield of CMAG+CDAG were 93.68±2.52% and 78.11±1.35%, respectively. Copyright © 2017 Elsevier B.V. All rights reserved.

  18. Determination of the parameters of the parasitic stage in Ixodes ricinus females.

    Science.gov (United States)

    Bartosik, Katarzyna; Buczek, Alicja

    2013-01-01

    Ixodes ricinus is a tick commonly found on human and animals and of great medical and veterinary importance. The aim of the study was to determine the parameters of different stages of feeding in Ixodes ricinus females. 229 Ixodes ricinus females were collected from 102 animals--roe deer (Capreolus capreolus) and red deer (Cervus elaphus) culled in southern and south-eastern Poland in 2002. Each female was weighed and the length and width of the scutum as well as the width of the idiosoma were measured. 20 tick females were collected from vegetation growing in the region and analysed in order to compare the changes in the parameters studied to those exhibited by unengorged specimens. Three groups were identified on the basis of female body weight; group I consisted of 52 females in feeding phase I with body weight in the range of 0.0003-0.0043 g (mean 0.0019 g), group II comprised 150 females in feeding phase II with weight in the range of 0.0017-0.3075 g (mean 0.0263 g), and group III consisted of 27 females in feeding phase III with weight in the range of 0.0904-0.3122 g (mean 0.1913 g). Indices characterizing the various feeding phases, such as body index, scutal index, alloscutal index, growth index, engorgement index I and II, and the relative body mass index, were determined. The investigations demonstrated that the values of the morphometric traits in feeding phase I, II and III differe in I. ricinus females. The values of the morphometric features and indices can be helpful in identification of the parasitic stage of I. ricinus females removed from host skin, and assessment of the risk of infection of the host with various parasites injected with tick saliva at the respective feeding phases.

  19. Temporal dynamics of the tick Ixodes ricinus in northern Europe: epidemiological implications.

    Science.gov (United States)

    Cayol, Claire; Koskela, Esa; Mappes, Tapio; Siukkola, Anja; Kallio, Eva R

    2017-03-31

    Tick-borne pathogens pose an increasing threat to human and veterinary health across the northern hemisphere. While the seasonal activity of ticks is largely determined by climatic conditions, host-population dynamics are also likely to affect tick abundance. Consequently, abundance fluctuations of rodents in northern Europe are expected to be translated into tick dynamics, and can hence potentially affect the circulation of tick-borne pathogens. We quantified and explained the temporal dynamics of the tick Ixodes ricinus in the northernmost part of its European geographical range, by estimating (i) abundance in vegetation and (ii) infestation load in the most common rodent species in the study area, the bank vole Myodes glareolus. Ixodes ricinus nymphs and adult females, the life stages responsible for the most of tick bites in humans, peaked in May-June and August-September. Larvae and nymphs were simultaneously active in June and abundance of questing larvae and nymphs in the vegetation showed a positive association with bank vole abundance. Moreover, infesting larvae and nymphs were aggregated on bank voles, and the infestation of bank voles with I. ricinus larvae and nymphs was positively associated with bank vole abundance. Our results indicate early summer and early autumn as periods of increased risk for humans to encounter I. ricinus ticks in boreal urban forests and suggest a 2 years life-cycle for I. ricinus with two cohorts of ticks during the same year. Moreover, we identified a simultaneous activity of larvae and nymphs which allows co-feeding on the rodent host, which in turn supports the transmission of several important zoonotic tick-borne pathogens. Finally, we showed that a high density of the rodent host may enhance the risk that ticks and, potentially, tick-borne pathogens pose to human health.

  20. Avaliação da atividade antibacteriana de folhas de Myrtus communis L. (Myrtaceae

    Directory of Open Access Journals (Sweden)

    Luiz Estevão Salvagnini

    Full Text Available O óleo essencial e o extrato etanólico obtidos a partir de folhas de Myrtus communis foram avaliados quanto 'a atividade inibitória frente a vários microrganismos. Os halos de inibição de crescimento foram avaliados através das técnicas de "template" e difusão em disco para as linhagens de Staphylococcus aureus, Staphylococcus epidermidis, Escherichia coli, Bacillus subtilis e Serratia marcescens. Os resultados obtidos evidenciaram que o óleo de M. communis apresentou atividade antibacteriana superior ao extrato etanólico frente a todas as bactérias. A atividade demonstrada tanto para o óleo como para o extrato etanólico frente a algumas linhagens, foi melhor evidenciada pela técnica "template". E. coli foi resistente ao óleo e extrato etanólico testados.

  1. Flue-gas-influenced heavy metal bioaccumulation by the indigenous microalgae Desmodesmus communis LUCC 002.

    Science.gov (United States)

    Palanisami, Swaminathan; Lee, Keesoo; Balakrishnan, Baskar; Nam, Paul Ki-souk

    2015-01-01

    Desmodesmus communis LUCC 002 was cultivated using flue gas originating from a coal-fired power plant as a carbon dioxide (CO2) source. The flue gas contains various heavy metals. For investigating the fate of flue-gas-introduced metals on the cultivation system, bioaccumulation was measured in the microalgal biomass and milieu. The accumulated biomass was found to contain eight heavy metals: arsenic, chromium, barium, lead, selenium, silver, cadmium, and mercury. High heavy metal accumulations were also found in the control group of algae grown without the addition of flue gas at the same location. Further testing revealed that some of the heavy metals originated from well water used in the cultivation. The flue-gas-influenced bioaccumulation pattern of different heavy metals was observed. The responses of individual heavy metals and the influence of well water microbial flora on the algal growth were investigated, this study showed that hormesis was developed by the D. communis LUCC 002.

  2. Comparative clinical trial of castor oil and diclofenac sodium in patients with osteoarthritis.

    Science.gov (United States)

    Medhi, B; Kishore, K; Singh, U; Seth, S D

    2009-10-01

    A randomized, double-blind, comparative clinical study was conducted to compare the safety and efficacy of castor oil with diclofenac sodium in patients with knee osteoarthritis. Subjects with symptoms of knee osteoarthritis were given a castor oil capsule 0.9 mL (n = 50) thrice daily for 4 weeks or a capsule of diclofenac sodium (n = 50), 50 mg thrice daily for 4 weeks. The subjects completed an overall evaluation of symptom relief at 2 weeks and 4 weeks of completed treatment. The subjects were evaluated by clinical, routine laboratory and radiographic investigations for improvement of disease conditions and also for adverse drug reaction. On completion of 4 weeks treatment it was observed that both drugs were significantly effective in the treatment of knee osteoarthritis (p castor oil there were no adverse effects reported. The present study indicates that castor oil can be used as an effective therapy in primary knee osteoarthritis. (c) 2009 John Wiley & Sons, Ltd.

  3. Performance of the CASTOR calorimeter at CMS during Run II of LHC

    CERN Document Server

    Van De Klundert, Merijn H F

    2016-01-01

    The detector has pseudorapidity borders at -5.2 and -6.6. An overview is presented on the various aspects of CASTOR's performance and their relations during LHC Run 2. The equalisation of CASTOR's channels is performed using beam-halo muons. Thereafter, CASTOR's pedestal spectrum is studied. It is shown that noise estimates which are extracted using a fit, give on average a 10\\% lower threshold than statistical estimates. Gain correction factors, which are needed for the intercalibration, are obtained using a statistical, in-situ applicable method. The results of this method are shown to be reasonably consistent with laboratory measurements. Penultimately the absolute calibration is discussed, with emphasis on the relation between the scale uncertainty and CASTOR's alignment. It is shown that the alignment's contribution to the systematic uncerta...

  4. Extracting Extensor Digitorum Communis Activation Patterns using High-Density Surface Electromyography

    Directory of Open Access Journals (Sweden)

    Xiaogang eHu

    2015-10-01

    Full Text Available The extensor digitorum communis muscle plays an important role in hand dexterity during object manipulations. This multi-tendinous muscle is believed to be controlled through separate motoneuron pools, thereby forming different compartments that control individual digits. However, due to the complex anatomical variations across individuals and the flexibility of neural control strategies, the spatial activation patterns of the extensor digitorum communis compartments during individual finger extension have not been fully tracked under different task conditions.The objective of this study was to quantify the global spatial activation patterns of the extensor digitorum communis using high-density (7×9 surface electromyogram (EMG recordings. The muscle activation map (based on the root mean square of the EMG was constructed when subjects performed individual four finger extensions at the metacarpophalangeal joint, at different effort levels and under different finger constraints (static and dynamic. Our results revealed distinct activation patterns during individual finger extensions, especially between index and middle finger extensions, although the activation between ring and little finger extensions showed strong covariance. The activation map was relatively consistent at different muscle contraction levels and for different finger constraint conditions. We also found that distinct activation patterns were more discernible in the proximal-distal direction than in the radial-ulnar direction. The global spatial activation map utilizing surface grid EMG of the extensor digitorum communis muscle provides information for localizing individual compartments of the extensor muscle during finger extensions. This is of potential value for identifying more selective control input for assistive devices. Such information can also provide a basis for understanding hand impairment in individuals with neural disorders.

  5. Bio-based polyurethane prepared from Kraft lignin and modified castor oil

    OpenAIRE

    L. B. Tavares; C. V. Boas; G. R. Schleder; A. M. Nacas; D. S. Rosa; D. J. Santos

    2016-01-01

    Current challenges highlight the need for polymer research using renewable natural sources as a substitute for petroleum-based polymers. The use of polyols obtained from renewable sources combined with the reuse of industrial residues such as lignin is an important agent in this process. Different compositions of polyurethane-type materials were prepared by combining technical Kraft lignin (TKL) with castor oil (CO) or modified castor oil (MCO1 and MCO2) to increase their reactivity towards d...

  6. Evaluation of antibacterial effect of Myrtus communis against Acinetobacter baumannii clinical strains

    Directory of Open Access Journals (Sweden)

    Venous Akhavan

    2016-09-01

    Full Text Available Because of inappropriate use of antibiotics and prevalence of resistant bacteria, there is urgent need for antibacterial drugs that have fewer side effects than antibiotics. Myrtus communis is a medicinal plant which had many uses in traditional medicine. In this study, ethanol leave extract of this plant is tested on Acinetobacter baumannii. In the case of antimicrobial evaluation of plants, one of the effecting factors on effectiveness of the microbial inhibition is extraction techniques. In the presents study, the antibacterial activity of the Ethanol, Methanol, and Ethyl acetate extracts of M. communis plant was evaluated at seven different concentrations by broth microdilution method. The results of this study showed that the antimicrobial effect of M. communis extract is concentration dependent. Different extracts were obtained by the maceration method. Extracts of the plant exhibited antibacterial activity at varied levels against A. baumannii. Obtained results from our antibacterial experiments showed that all extracts have anti-bacterial activity against tested bacterial isolates According to the results, the ethyl acetate extracted fraction showed the highest level of activity at a MIC 400 mg/ml for A. baumannii. The results of this study indicate that, different extracts had growth inhibitory effect on A. baumannii. Therefore this plant has the potential to be evaluated as an alternative or adjunct to antibiotics to treat Acinetobacter infections.

  7. Antifungal and Herbicidal Effects of Fruit Essential Oils of Four Myrtus communis Genotypes.

    Science.gov (United States)

    Kordali, Saban; Usanmaz, Ayse; Cakir, Ahmet; Komaki, Amanmohammad; Ercisli, Sezai

    2016-01-01

    The chemical composition of the essential oils isolated by hydrodistillation from the fruits of four selected Myrtus communis L. genotypes from Turkey was characterized by GC-FID and GC/MS analyses. 1,8-Cineole (29.20-31.40%), linalool (15.67-19.13%), α-terpineol (8.40-18.43%), α-pinene (6.04-20.71%), and geranyl acetate (3.98-7.54%) were found to be the major constituents of the fruit essential oils of all M. communis genotypes investigated. The oils were characterized by high amounts of oxygenated monoterpenes, representing 73.02-83.83% of the total oil compositions. The results of the fungal growth inhibition assays showed that the oils inhibited the growth of 19 phytopathogenic fungi. However, their antifungal activity was generally lower than that of the commercial pesticide benomyl. The herbicidal effects of the oils on the seed germination and seedling growth of Amaranthus retroflexus L., Chenopodium album L., Cirsium arvense (L.) Scop., Lactuca serriola L., and Rumex crispus L. were also determined. The oils completely or partly inhibited the seed germinations and seedling growths of the plants. The findings of the present study suggest that the M. communis essential oils might have potential to be used as natural herbicides as well as fungicides. Copyright © 2016 Verlag Helvetica Chimica Acta AG, Zürich.

  8. Experimental and empirical study of diesel and castor biodiesel blending effect, on kinematic viscosity, density and calorific value

    Directory of Open Access Journals (Sweden)

    A. Amin

    2016-12-01

    Full Text Available This study aimed to investigate the fuel properties like density, viscosity and calorific value of trans-esterified methyl ester using castor biodiesel and their blends with No. 2 diesel. Empirical correlations are proposed to predict the kinematic viscosity, density, and calorific value for a mixture of castor oil and No. 2 diesel. Kay mixing rule shows a good prediction for the fuel properties under study. Several polynomials are fitted using least square method, and the fitted equations show a good agreement with the experimental data from our study. The developed equations could be used as universal formulas to predict the kinematic viscosity, density, and calorific value for castor oil and No. 2 diesel blend. The equations can be used to optimize the mixing ratio of the castor oil/No. 2 diesel for different applications. Blending of castor oil with No. 2 diesel- in the range of 20% castor oil, will not violate the required specification of diesel engines.

  9. Some properties of castor oil affecting its performance as a capacitor impregnant and their significance to future impregnant research

    International Nuclear Information System (INIS)

    Boicourt, G.P.

    1975-01-01

    For a considerable time castor oil and polychlorinated biphenyl (PCB) have been the principal impregnants used in energy-storage capacitors. Castor oil has proven to be better than PCB for pulsed applications. PCB's have come under attack as an environmental hazard, while castor oil is a vegetable product and its supply and quality are subject to fluctuation. These two facts make the development of new impregnants desirable. The properties of PCB as a capacitor impregnant are well known. This paper first compares a number of properties of castor oil and PCB's. A comparison is made between the lives of castor oil capacitors and comparable PCB energy-storage capacitors. Some of the physical and chemical properties of castor oil which make it a good pulse capacitor impregnant are examined. These properties can be used as a guide for future research on new pulse capacitor impregnants

  10. Castor and Pollux - shielded cells for studying fuel treatment processes

    International Nuclear Information System (INIS)

    Faudot, G.; Bathellier, A.

    1969-01-01

    CASTOR and POLLUX, two alpha, beta, gamma cells are described in the present paper. They are located in the CEN at Fontenay-aux-Roses (France). They are designed for improvement studies of the various aqueous separation processes used in irradiated fuels reprocessing plants. Located in the same air-tight steel encasement, they arc inter-connected by a pneumatic transfer. These two cells have a similar in-line conception and they include: a gamma shielding in lead of 10 cm of thickness; an inner air-tight box, made with stainless steel and plexiglas, is maintained in lowering in comparison to room pressure. Eleven Hobson model seven master-slave manipulators allow inner manipulations. Then the inner equipment is described briefly. (author) [fr

  11. Ingestive behavior of lambs fed diets containing castor seed meal.

    Science.gov (United States)

    Nicory, Isis Miranda Carvalho; de Carvalho, Gleidson Giordano Pinto; Ribeiro, Ossival Lolato; Silva, Robério Rodrigues; Tosto, Manuela Silva Libanio; Costa-Lopes, Lívia Santos; Souza, Fábio Nicory Costa; de Oliveira Nascimento, Camila

    2015-06-01

    The objective of this study was to evaluate the substitution of soybean meal for castor seed meal (CSM) in diets for feedlot lambs and the effects of these diets on their ingestive behavior. Fifty male Santa Inês lambs were used. The diets were composed of Tifton 85 hay and a concentrate containing detoxified CSM substituting 0, 25, 50, 75, or 100 % of the soybean meal. There was no effect (P > 0.05) of the CSM levels on the feeding, rumination, idle times, chews and time spent chewing per bolus, total chewing time, number of boli chewed, and number of chews per day. The dry matter (DM) intake decreased linearly (P  0.05) the numbers of feeding, rumination, and idle periods, but had a quadratic effect (P ingestive behavior.

  12. Castor oil polyurethane containing silica nanoparticles as filling material of bone defect in rats.

    Science.gov (United States)

    Nacer, Renato Silva; Poppi, Rodrigo Ré; Carvalho, Paulo de Tarso Camilo de; Silva, Baldomero Antonio Kato da; Odashiro, Alexandre Nakao; Silva, Iandara Schettert; Delben, José Renato Jurkevicz; Delben, Angela Antonia Sanches Tardivo

    2012-01-01

    To evaluate the biologic behavior of the castor polymer containing silica nanoparticles as a bone substitute in diafisary defect. Twenty seven male Rattus norvegicus albinus Wistar lineage were submitted to bone defect filled with castor oil polymer. Three experimental groups had been formed with nine animals each: (1) castor oil polymer containing only calcium carbonate; (2) castor oil polymer with calcium carbonate and doped with 5% of silica nanoparticles; (3) castor polymer with calcium carbonate doped with 10% of silica nanoparticles; 3 animals of each group were submitted to euthanasia 15, 30 and 60 days after experimental procedure, and their femurs were removed to histological evaluation. there was bone growth in all the studied groups, with a greater tendency of growth in the group 1. After 30 days all the groups presented similar results. After 60 days a greater amount of fibroblasts, osteoblasts, osteocytes and osteoclasts in group 3 was observed, with integrated activity of 3 kinds of cells involved in the bone activation-reabsorption-formation. The castor polymer associated to the silica nanoparticles is biocompatible and allows osteoconduction. The presence of osteoprogenitors cells suggests silica osteoinduction capacity.

  13. Dominance of Dermacentor reticulatus over Ixodes ricinus (Ixodidae) on livestock, companion animals and wild ruminants in eastern and central Poland

    OpenAIRE

    Mierzejewska, Ewa J.; Welc-Faleciak, Renata; Karbowiak, Grzegorz; Kowalec, Maciej; Behnke, Jerzy M.; Bajer, Anna

    2015-01-01

    The most common tick species parasitizing animals in Poland are Ixodes ricinus and Dermacentor reticulatus. These tick species differ in their distribution, habitats, seasonal activity and host specificity. Ixodes ricinus is the most prevalent and widely distributed, whereas the range of D. reticulatus is limited to eastern and central parts of the country with several new foci in the middle-west and the west. However, as in many central European countries, the range of D. reticulatus is expa...

  14. Secure and documented screwing down of Castor containers

    International Nuclear Information System (INIS)

    Yilmaz, Asir; Junkers, Patrick

    2011-01-01

    The castor container is sealed using a multiple lid system comprising a primary lid and a secondary lid. The two lids are positioned one above the other and screwed securely to the body of the container. In addition, the tightness of the lids is guaranteed by a special metal seal. A further steel plate is screwed securely over the lids providing additional protection for the lids from moisture and various influences. The central element connecting the lids to the container comprises fixed threaded connections which must be accurately tightened with a torque of 900 Nm, 1500 Nm or more. The basic function of a threaded connection, in terms of a positive fit and detachable joint, is to join together two or more parts in such a way that they always behave as a single part whatever operational forces are present. This can only be achieved by means of an accurate and sufficient pre-tensioning force. This pretensioning force is transferred to the threaded connection with the help of a particular torque and presses the components together. This loading brought about by the pretensioning force is referred to as the prestress. In order to create a correct and high quality connection, this prestress must be arrived at in an optimum manner. The prestress must therefore be high enough to withstand the full loading for which the connection is designed. In addition the connection should not come loose unintentionally if it is exposed to externally acting forces. Since under no circumstances should threaded connections on a castor container fail, a suitable screwing process must guarantee that this does not happen. The securing of threaded joints can only be ensured by introducing and maintaining a constant and accurate prestress. VDI Guideline 2230, Part 1, mentions various threaded connection or tightening processes, including torque-controlled tightening, angle-controlled tightening and yield-controlled tightening. (orig.)

  15. Identification of Critical Amino Acids in the IgE Epitopes of Ric c 1 and Ric c 3 and the Application of Glutamic Acid as an IgE Blocker

    Science.gov (United States)

    Deus-de-Oliveira, Natalia; Felix, Shayany P.; Carrielo-Gama, Camila; Fernandes, Keysson V.; DaMatta, Renato Augusto; Machado, Olga L. T.

    2011-01-01

    Background The allergenicity of Ricinus communis L. (castor bean, Euphorbiaceae) is associated with components of its seeds and pollen. Castor bean allergy has been described not only in laboratory workers, but also in personnel working in oil processing mills, fertilizer retail, the upholstery industry and other industrial fields. In the present study, we describe the critical amino acids in the IgE-binding epitopes in Ric c 1 and Ric c 3, two major allergens of R. communis. In addition, we also investigate the cross-reactivity between castor bean and some air and food allergen extracts commonly used in allergy diagnosis. Methodology/Principal Findings The IgE reactivity of human sera from atopic patients was screened by immune-dot blot against castor bean allergens. Allergenic activity was evaluated in vitro using a rat mast cell activation assay and by ELISA. Cross-reactivity was observed between castor bean allergens and extracts from shrimp, fish, gluten, wheat, soybean, peanut, corn, house dust, tobacco and airborne fungal allergens. We observed that treatment of rat and human sera (from atopic patients) with glutamic acid reduced the IgE-epitope interaction. Conclusions/Significance The identification of glutamic acid residues with critical roles in IgE-binding to Ric c 3 and Ric c 1 support the potential use of free amino acids in allergy treatment. PMID:21738671

  16. Identification of critical amino acids in the IgE epitopes of Ric c 1 and Ric c 3 and the application of glutamic acid as an IgE blocker.

    Science.gov (United States)

    Deus-de-Oliveira, Natalia; Felix, Shayany P; Carrielo-Gama, Camila; Fernandes, Keysson V; DaMatta, Renato Augusto; Machado, Olga L T

    2011-01-01

    The allergenicity of Ricinus communis L. (castor bean, Euphorbiaceae) is associated with components of its seeds and pollen. Castor bean allergy has been described not only in laboratory workers, but also in personnel working in oil processing mills, fertilizer retail, the upholstery industry and other industrial fields. In the present study, we describe the critical amino acids in the IgE-binding epitopes in Ric c 1 and Ric c 3, two major allergens of R. communis. In addition, we also investigate the cross-reactivity between castor bean and some air and food allergen extracts commonly used in allergy diagnosis. The IgE reactivity of human sera from atopic patients was screened by immune-dot blot against castor bean allergens. Allergenic activity was evaluated in vitro using a rat mast cell activation assay and by ELISA. Cross-reactivity was observed between castor bean allergens and extracts from shrimp, fish, gluten, wheat, soybean, peanut, corn, house dust, tobacco and airborne fungal allergens. We observed that treatment of rat and human sera (from atopic patients) with glutamic acid reduced the IgE-epitope interaction. The identification of glutamic acid residues with critical roles in IgE-binding to Ric c 3 and Ric c 1 support the potential use of free amino acids in allergy treatment.

  17. Identification of critical amino acids in the IgE epitopes of Ric c 1 and Ric c 3 and the application of glutamic acid as an IgE blocker.

    Directory of Open Access Journals (Sweden)

    Natalia Deus-de-Oliveira

    Full Text Available BACKGROUND: The allergenicity of Ricinus communis L. (castor bean, Euphorbiaceae is associated with components of its seeds and pollen. Castor bean allergy has been described not only in laboratory workers, but also in personnel working in oil processing mills, fertilizer retail, the upholstery industry and other industrial fields. In the present study, we describe the critical amino acids in the IgE-binding epitopes in Ric c 1 and Ric c 3, two major allergens of R. communis. In addition, we also investigate the cross-reactivity between castor bean and some air and food allergen extracts commonly used in allergy diagnosis. METHODOLOGY/PRINCIPAL FINDINGS: The IgE reactivity of human sera from atopic patients was screened by immune-dot blot against castor bean allergens. Allergenic activity was evaluated in vitro using a rat mast cell activation assay and by ELISA. Cross-reactivity was observed between castor bean allergens and extracts from shrimp, fish, gluten, wheat, soybean, peanut, corn, house dust, tobacco and airborne fungal allergens. We observed that treatment of rat and human sera (from atopic patients with glutamic acid reduced the IgE-epitope interaction. CONCLUSIONS/SIGNIFICANCE: The identification of glutamic acid residues with critical roles in IgE-binding to Ric c 3 and Ric c 1 support the potential use of free amino acids in allergy treatment.

  18. Assessment of MALDI-TOF MS biotyping for Borrelia burgdorferi sl detection in Ixodes ricinus

    Science.gov (United States)

    Boyer, Pierre H.; Boulanger, Nathalie; Nebbak, Amira; Collin, Elodie; Jaulhac, Benoit; Almeras, Lionel

    2017-01-01

    Matrix Assisted Laser Desorption/Ionization Time-of-Flight Mass Spectrometry (MALDI-TOF MS) has been demonstrated to be useful for tick identification at the species level. More recently, this tool has been successfully applied for the detection of bacterial pathogens directly in tick vectors. The present work has assessed the detection of Borrelia burgdorferi sensu lato in Ixodes ricinus tick vector by MALDI-TOF MS. To this aim, experimental infection model of I. ricinus ticks by B. afzelii was carried out and specimens collected in the field were also included in the study. Borrelia infectious status of I. ricinus ticks was molecularly controlled using half-idiosome to classify specimens. Among the 39 ticks engorged on infected mice, 14 were confirmed to be infected by B. afzelii. For field collection, 14.8% (n = 12/81) I. ricinus ticks were validated molecularly as infected by B. burgdorferi sl. To determine the body part allowing the detection of MS protein profile changes between non-infected and B. afzelii infected specimens, ticks were dissected in three compartments (i.e. 4 legs, capitulum and half-idiosome) prior to MS analysis. Highly reproducible MS spectra were obtained for I. ricinus ticks according to the compartment tested and their infectious status. However, no MS profile change was found when paired body part comparison between non-infected and B. afzelii infected specimens was made. Statistical analyses did not succeed to discover, per body part, specific MS peaks distinguishing Borrelia-infected from non-infected ticks whatever their origins, laboratory reared or field collected. Despite the unsuccessful of MALDI-TOF MS to classify tick specimens according to their B. afzelii infectious status, this proteomic tool remains a promising method for rapid, economic and accurate identification of tick species. Moreover, the singularity of MS spectra between legs and half-idiosome of I. ricinus could be used to reinforce this proteomic identification

  19. Screening of the entire USDA castor germplasm collection for oil content and fatty acid composition for optimum biodiesel production.

    Science.gov (United States)

    Wang, Ming Li; Morris, J Bradley; Tonnis, Brandon; Pinnow, David; Davis, Jerry; Raymer, Paul; Pederson, Gary A

    2011-09-14

    Castor has tremendous potential as a feedstock for biodiesel production. The oil content and fatty acid composition in castor seed are important factors determining the price for production and affecting the key fuel properties of biodiesel. There are 1033 available castor accessions collected or donated from 48 countries worldwide in the USDA germplasm collection. The entire castor collection was screened for oil content and fatty acid composition by nuclear magnetic resonance (NMR) and gas chromatography (GC), respectively. Castor seeds on the average contain 48.2% oil with significant variability ranging from 37.2 to 60.6%. Methyl esters were prepared from castor seed by alkaline transmethylation. GC analysis of methyl esters confirmed that castor oil was composed primarily of eight fatty acids: 1.48% palmitic (C16:0), 1.58% stearic (C18:0), 4.41% oleic (C18:1), 6.42% linoleic (C18:2), 0.68% linolenic (C18:3), 0.45% gadoleic (C20:1), 84.51% ricinoleic (C18:1-1OH), and 0.47% dihydroxystearic (C18:0-2OH) acids. Significant variability in fatty acid composition was detected among castor accessions. Ricinoleic acid (RA) was positively correlated with dihydroxystearic acid (DHSA) but highly negatively correlated with the five other fatty acids except linolenic acid. The results for oil content and fatty acid composition obtained from this study will be useful for end-users to explore castor germplasm for biodiesel production.

  20. Castor oil, bath and/or enema for cervical priming and induction of labour.

    Science.gov (United States)

    Kelly, Anthony J; Kavanagh, Josephine; Thomas, Jane

    2013-07-24

    Castor oil, a potent cathartic, is derived from the bean of the castor plant. Anecdotal reports, which date back to ancient Egypt have suggested the use of castor oil to stimulate labour. Castor oil has been widely used as a traditional method of initiating labour in midwifery practice. Its role in the initiation of labour is poorly understood and data examining its efficacy within a clinical trial are limited. This is one of a series of reviews of methods of cervical ripening and labour induction using standardised methodology. To determine the effects of castor oil or enemas for third trimester cervical ripening or induction of labour in comparison with other methods of cervical ripening or induction of labour. We searched the Cochrane Pregnancy and Childbirth Group's Trials Register (30 April 2013) and bibliographies of relevant papers. Clinical trials comparing castor oil, bath or enemas used for third trimester cervical ripening or labour induction with placebo/no treatment or other methods listed above it on a predefined list of labour induction methods. A strategy was developed to deal with the large volume and complexity of trial data relating to labour induction. This involved a two-stage method of data extraction. Three trials, involving 233 women, are included. There was no evidence of differences in caesarean section rates between the two interventions in the two trials reporting this outcome (risk ratio (RR) 2.04, 95% confidence interval (CI) 0.92 to 4.55). There were no data presented on neonatal or maternal mortality or morbidity.There was no evidence of a difference between castor oil and placebo/no treatment for the rate of instrumental delivery, meconium-stained liquor, or Apgar score less than seven at five minutes. The number of participants was too small to detect all but large differences in outcome. All women who ingested castor oil felt nauseous (RR 59.92, 95% CI 8.46 to 424.52). The three trials included in the review contain small numbers

  1. Contrasting patterns of genetic divergence in two sympatric pseudo-metallophytes: Rumex acetosa L. and Commelina communis L.

    Directory of Open Access Journals (Sweden)

    Ye M

    2012-06-01

    Full Text Available Abstract Background Patterns of genetic divergence between populations of facultative metallophytes have been investigated extensively. However, most previous investigations have focused on a single plant species making it unclear if genetic divergence shows common patterns or, conversely, is species-specific. The herbs Rumex acetosa L. and Commelina communis L. are two pseudo-metallophytes thriving in both normal and cupriferous soils along the middle and lower reaches of the Yangtze River in China. Their non-metallicolous and metallicolous populations are often sympatric thus providing an ideal opportunity for comparative estimation of genetic structures and divergence under the selective pressure derived from copper toxicity. Results In the present study, patterns of genetic divergence of R. acetosa and C. communis , including metal tolerance, genetic structure and genetic relationships between populations, were investigated and compared using hydroponic experiments, AFLP, ISSR and chloroplast genetic markers. Our results show a significant reduction in genetic diversity in metallicolous populations of C. communis but not in R. acetosa . Moreover, genetic differentiation is less in R. acetosa than in C. communis , the latter species also shows a clustering of its metallicolous populations. Conclusions We propose that the genetic divergences apparent in R. acetosa and C. communis , and the contrasting responses of the two species to copper contamination, might be attributed to the differences in their intrinsic physiological and ecological properties. No simple and generalised conclusions on genetic divergence in pseudo-metallophytes can thus be drawn.

  2. Babesia microti (Piroplasmida: Babesiidae) in nymphal Ixodes ricinus (Acari: Ixodidae) in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Rudolf, Ivo; Golovchenko, Maryna; Šikutová, Silvie; Rudenko, Natalia; Grubhoffer, Libor; Hubálek, Zdeněk

    2005-01-01

    Roč. 52, č. 3 (2005), s. 274-276 ISSN 0015-5683 R&D Projects: GA ČR(CZ) GA206/03/0726 Institutional research plan: CEZ:AV0Z60930519; CEZ:AV0Z60220518 Keywords : Babesia microti * Ixodes ricinus Subject RIV: EE - Microbiology, Virology Impact factor: 1.138, year: 2005 http://folia.paru.cas.cz/pdfs/showpdf.php?pdf=20766

  3. Optimization of the solid-phase microextraction method in the determination of Ixodes ricinus (L.) volatiles

    Czech Academy of Sciences Publication Activity Database

    Zahradníčková, Helena; Bouman, Edwin Arien Poul

    2006-01-01

    Roč. 29, č. 2 (2006), s. 236-241 ISSN 1615-9306 R&D Projects: GA ČR(CZ) GA206/04/0751 Institutional research plan: CEZ:AV0Z50070508; CEZ:AV0Z60220518 Keywords : GC/MS * Ixodes ricinus * solid-phase microextraction Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.535, year: 2006

  4. Antibiotic treatment of the hard tick Ixodes ricinus: Influence on Midichloria mitochondrii load following blood meal.

    Science.gov (United States)

    Ninio, Camille; Plantard, Olivier; Serra, Valentina; Pollera, Claudia; Ferrari, Nicola; Cafiso, Alessandra; Sassera, Davide; Bazzocchi, Chiara

    2015-07-01

    Midichloria mitochondrii is the most prevalent symbiont of the hard tick Ixodes ricinus, present in 100% of eggs and adult females of wild ticks. This bacterium is intracellular, and is the only known symbiont able to invade the mitochondria of the host cells. However, the role that M. mitochondrii plays in the host metabolism has yet to be elucidated. Multiple lines of evidence indicate the possibility of transmission of this bacterium to the vertebrate host during the tick blood meal. In order to investigate the role of M. mitochondrii in the biology of the tick host, we performed an antibiotic treatment on Ixodes ricinus individuals, with the aim of reducing/eliminating the symbiont, and to potentially observe the dynamic of bacterial infection in the tick host. We microinjected engorged adult females of I. ricinus with tetracycline, and we allowed the resulting larvae to feed on gerbils treated with the same antibiotic. The amount of M. mitochondrii was evaluated at different stages of the experiment using molecular techniques. In addition we evaluated the presence/absence of the symbiont DNA in the blood of gerbils used for the larval feeding. The performed treatments did not allow to eliminate the symbiont population from the host tick, however it allowed to reduce the multiplication that occurs after the larval blood meal. These results open the way for future experiments, using different antibiotic molecules, different administration methods and antibiotic administration on subsequent tick stages, to fulfill the goal of eliminating M. mitochondrii from the host I. ricinus, a major step in our understanding of the impact of this bacterium on ticks. Copyright © 2015 Elsevier GmbH. All rights reserved.

  5. Identification and partial characterisation of new members of the Ixodes ricinus defensin family

    Czech Academy of Sciences Publication Activity Database

    Tonk, Miray; Cabezas Cruz, Alejandro; Valdés, James J.; Rego, Ryan O. M.; Rudenko, Natalia; Golovchenko, Maryna; Bell-Sakyi, L.; de la Fuente, J.; Grubhoffer, Libor

    2014-01-01

    Roč. 540, č. 2 (2014), s. 146-152 ISSN 0378-1119 R&D Projects: GA ČR(CZ) GAP302/11/1901; GA MŠk(CZ) EE2.3.30.0032 Institutional support: RVO:60077344 Keywords : antimicrobial peptide * defensin * Ixodes ricinus * tick * tick cell line Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.138, year: 2014

  6. Efficiency of experimental infection of Ixodes ricinus ticks with Borrelia burgdorferi spirochetes

    Czech Academy of Sciences Publication Activity Database

    Horká, Helena; Černá-Kýčková, Kateřina; Fišerová, L.; Kopecký, Jan

    2008-01-01

    Roč. 298, S1 (2008), s. 177-179 ISSN 1438-4221. [International Jena Symposium on Tick-borne Diseases (formerly IPS). Jena, 15.03.2007-17.03.2007] R&D Projects: GA MŠk(CZ) LC06009; GA ČR GA524/05/0811 Institutional research plan: CEZ:AV0Z60220518 Keywords : Ixodes ricinus * Borrelia burgdorferi * immersion of larvae * pathogen transmission Subject RIV: EC - Immunology Impact factor: 3.486, year: 2008

  7. Prevalence and phylogenetic analysis of Babesia spp. in Ixodes ricinus and Ixodes persulcatus ticks in Latvia.

    Science.gov (United States)

    Capligina, Valentina; Berzina, Inese; Bormane, Antra; Salmane, Ineta; Vilks, Karlis; Kazarina, Alisa; Bandere, Dace; Baumanis, Viesturs; Ranka, Renate

    2016-03-01

    Babesia spp. are tick-borne protozoan parasites that have been reported in many European countries and are considered to be emerging pathogens. Several Babesia spp. have been identified in ticks in Latvia. Recently, canine babesiosis cases were diagnosed for the first time in Latvia; therefore, continued studies on the prevalence and occurrence of new species are warranted. In the present study, questing tick samples collected in 2005-2007 were screened for the presence of Babesia spp.; in total, 432 Ixodes ricinus and 693 Ixodes persulcatus ticks were analyzed. Babesia spp. were detected in 1.4% of the I. ricinus ticks and in 1.9% of I. persulcatus ticks. Sequencing revealed that ixodid ticks in Latvia contained Babesia microti, Babesia capreoli, and Babesia venatorum. Babesia microti was the most prevalent species, accounting for 58% of all positive samples; moreover, two distinct B. microti genotypes were identified. Phylogenetic analysis of the full-length 18S rRNA gene of two B. capreoli/B. divergens isolates indicated a closer relationship to the B. capreoli clade than B. divergens. This is the first report of B. venatorum in I. persulcatus ticks in Latvia. Our results suggest that both I. ricinus and I. persulcatus ticks play important roles in the epidemiology of these zoonotic pathogens in Latvia.

  8. Arsenophonus nasoniae and Rickettsiae Infection of Ixodes ricinus Due to Parasitic Wasp Ixodiphagus hookeri.

    Directory of Open Access Journals (Sweden)

    Monika Bohacsova

    Full Text Available Arsenophonus nasoniae, a male-killing endosymbiont of chalcid wasps, was recently detected in several hard tick species. Following the hypothesis that its presence in ticks may not be linked to the direct occurrence of bacteria in tick's organs, we identified A. nasoniae in wasps emerging from parasitised nymphs. We confirmed that 28.1% of Ixodiphagus hookeri wasps parasitizing Ixodes ricinus ticks were infected by A. nasoniae. Moreover, in examined I. ricinus nymphs, A. nasoniae was detected only in those, which were parasitized by the wasp. However, in part of the adult wasps as well as in some ticks that contained wasp's DNA, we did not confirm A. nasoniae. We also found, that in spite of reported male-killing, some newly emerged adult wasp males were also infected by A. nasoniae. Additionally, we amplified the DNA of Rickettsia helvetica and Rickettsia monacensis (known to be Ixodes ricinus-associated bacteria in adult parasitoid wasps. This may be related either with the digested bacterial DNA in wasp body lumen or with a role of wasps in circulation of rickettsiae among tick vectors.

  9. Vector competence of the tick Ixodes ricinus for transmission of Bartonella birtlesii.

    Directory of Open Access Journals (Sweden)

    Caroline Reis

    Full Text Available Bartonella spp. are facultative intracellular vector-borne bacteria associated with several emerging diseases in humans and animals all over the world. The potential for involvement of ticks in transmission of Bartonella spp. has been heartily debated for many years. However, most of the data supporting bartonellae transmission by ticks come from molecular and serological epidemiological surveys in humans and animals providing only indirect evidences without a direct proof of tick vector competence for transmission of bartonellae. We used a murine model to assess the vector competence of Ixodes ricinus for Bartonella birtlesii. Larval and nymphal I. ricinus were fed on a B. birtlesii-infected mouse. The nymphs successfully transmitted B. birtlesii to naïve mice as bacteria were recovered from both the mouse blood and liver at seven and 16 days after tick bites. The female adults successfully emitted the bacteria into uninfected blood after three or more days of tick attachment, when fed via membrane feeding system. Histochemical staining showed the presence of bacteria in salivary glands and muscle tissues of partially engorged adult ticks, which had molted from the infected nymphs. These results confirm the vector competence of I. ricinus for B. birtlesii and represent the first in vivo demonstration of a Bartonella sp. transmission by ticks. Consequently, bartonelloses should be now included in the differential diagnosis for patients exposed to tick bites.

  10. Low prevalence of Borrelia bavariensis in Ixodes ricinus ticks in southeastern Austria.

    Science.gov (United States)

    Glatz, Martin; Muellegger, Robert R; Hizo-Teufel, Cecilia; Fingerle, Volker

    2014-10-01

    Borrelia bavariensis was recently described as a distinct genospecies among the B. burgdorferi sensu lato complex. The prevalence of B. bavariensis in Austria, a highly endemic area for tick-transmitted pathogens, is scarcely characterized. To investigate the prevalence of B. bavariensis in Ixodes ricinus ticks we reevaluated the results of a study conducted in 518 ticks from southeastern Austria collected in 2002 and 2003. The presence of B. burgdorferi s.l.-specific DNA in ticks was analyzed by a PCR for the outer surface protein A (ospA) gene. Borrelia species were differentiated by restriction fragment length polymorphism (RFLP) analysis, and samples positive for B. bavariensis were further analyzed by multilocus sequence analysis. Two of 133 (1.5%) B. burgdorferi s.l.-positive I. ricinus ticks were infected with B. bavariensis. Both specimens were coinfected with the OspA serotype 5 of B. garinii. Borrelia bavariensis is present; however, seem to be rare in I. ricinus ticks in southeastern Austria. Copyright © 2014 Elsevier GmbH. All rights reserved.

  11. Production and characterization of an extracellular lipase from Candida guilliermondii

    OpenAIRE

    Oliveira,Anne Caroline Defranceschi; Fernandes,Maria Luiza; Mariano,André Bellin

    2014-01-01

    Extracellular lipases from the endophytic yeast Candida guilliermondii isolated from castor leaves (Ricinus communis L.) were produced using low-cost raw materials such as agro-industrial residues and applying them in the esterification of oleic acid for evaluating their potential use in biodiesel production. After partial purification using ammonium sulfate, the enzyme was characterized and presented higher activity (26.8 ± 1.5 U mL-1) in the presence of 5 mmol L-1 NaCl at 30 ºC and pH ...

  12. THE EFFECTS OF POSSIBLE CONTAMINATION ON THE RADIOCARBON DATING OF THE DEAD SEA SCROLLS II : EMPIRICAL METHODS TO REMOVE CASTOR OIL AND SUGGESTIONS FOR REDATING

    NARCIS (Netherlands)

    Rasmussen, Kaare Lund; van der Plicht, Johannes; Doudna, Gregory; Nielsen, Frederik; Hojrup, Peter; Stenby, Erling Halfdan; Pedersen, Carl Th; Højrup, Peter

    2009-01-01

    While kept at the Rockefeller Museum in East Jerusalem, many Dead Sea Scroll fragments were exposed to castor oil by the original team of editors in the course of cleaning the parchments. Castor oil must be regarded as a serious contaminant in relation to radiocarbon dating. If modern castor oil is

  13. Identification of diacylglycerol and triacylglycerols containing 11,12,13-trihydroxy-9,14-octadecadienoic acid in castor oil by mass spectrometry

    Science.gov (United States)

    Castor oil has many industrial uses. Molecular species of acylglycerols containing monohydroxy, dihydroxy and trihydroxy fatty acids in castor oil have been reported. The identification of acylglycerols containing a triOH18:2 fatty acid in castor oil is reported here. The structure of this novel fat...

  14. Measurements of essential oil extract and antioxidant in Syrian Myrtus communis L. leaves using photo chemiluminescence assay

    International Nuclear Information System (INIS)

    Zayzafoon, G.; Odeh, A.; Mahzia, Y.

    2012-01-01

    The essential oil extracts and antioxidant measurements of Syrian Myrtus communis L. leaves as hydrophilic and hydrophobic existence species have been carried out. The plant leaves as a source of antioxidants was tested by the influence of its aqueous and essential oil extracts on the yield of photo chemiluminescence, PCL solution applying very sensitive and reliable method. By means of a photo chemiluminescence assay, it was possible to assess the total antioxidants capacity of hydrophilic and hydrophobic species existence in Syrian Myrtus communis L. leaves. It has been found that, the integral antioxidant capacity measurements value of Syrian Myrtus communis L. leaves was found in Kurdaha site which has a value of 465.67 1.18 nmol TE/g DM (total Trolox equivalent /gram of Dry material) . The following three mainly chemical species were found in the essential oil extracts: -Pinene, Cineole and Limonene. (author)

  15. Bowel Preparation of Outpatients for Intravenous Urography: Efficacy of Castor Oil Versus Bisacodyl

    Directory of Open Access Journals (Sweden)

    Huei-Chen Yang

    2005-04-01

    Full Text Available The purpose of this study was to compare the efficacy of two laxatives, castor oil and bisacodyl, in the routine bowel preparation of outpatients for intravenous urography (IVU. We used castor oil in patients undergoing IVU for 1 month, and then used bisacodyl in patients undergoing IVU for another month. Two uroradiologists, unaware of the method of bowel preparation, reviewed the standard radiographs and graded the residue in the large bowel and the clearness of the opacified urinary collecting system. In total, 71 consecutive outpatients received castor oil, and 84 received bisacodyl. For the castor oil group, grades from the two uroradiologists did not differ in terms of fecal residue on plain abdominal images (p = 0.54, and visualization of the urinary system on the left (p = 0.36 and right sides (p = 0.63. Findings were similar for bisacodyl recipients (p = 0.11, 0.59, and 0.32, respectively. When the laxative effect of the two agents was compared, we found no difference in the grading of fecal residue on plain abdominal images (p = 0.14, or in visualization of the urinary system on the left (p = 0.31 and right sides (p = 0.98. In conclusion, we observed no difference in laxative efficacy between castor oil and bisacodyl; thus, bisacodyl may be a useful alternative for bowel preparation before IVU.

  16. Castor oil as a natural alternative to labor induction: A retrospective descriptive study.

    Science.gov (United States)

    DeMaria, Andrea L; Sundstrom, Beth; Moxley, Grace E; Banks, Kendall; Bishop, Ashlan; Rathbun, Lesley

    2018-04-01

    To describe birthing outcomes among women who consumed castor oil cocktail as part of a freestanding birth center labor induction protocol. De-identified data from birth logs and electronic medical records were entered into SPSS Statistics 22.0 for analysis for all women who received the castor oil cocktail (n=323) to induce labor between January 2008 and May 2015 at a birth center in the United States. Descriptive statistics were analyzed for trends in safety and birthing outcomes. Of the women who utilized the castor oil cocktail to stimulate labor, 293 (90.7%) birthed vaginally at the birth center or hospital. The incidence of maternal adverse effects (e.g., nausea, vomiting, extreme diarrhea) was less than 7%, and adverse effects of any kind were reported in less than 15% of births. An independent sample t-test revealed that parous women were more likely to birth vaginally at the birth center after using the castor oil cocktail than their nulliparous counterparts (pcastor oil cocktail to induce labor were able to give birth vaginally with little to no maternal or fetal complications. Findings indicate further research is needed to compare the safety and effectiveness of natural labor induction methodologies, including castor oil, to commonly used labor induction techniques in a prospective study or clinical trial. Copyright © 2017 Australian College of Midwives. Published by Elsevier Ltd. All rights reserved.

  17. Effectiveness of castor oil extract on Escherichia coli and its endotoxins in root canals.

    Science.gov (United States)

    Valera, Marcia Carneiro; Maekawa, Lilian Eiko; Chung, Adriana; de Oliveira, Luciane Dias; Carvalho, Claudio Antonio Talge; Koga-Ito, Cristiane Yumi; Jorge, Antonio Olavo Cardoso

    2012-01-01

    This in vitro study sought to evaluate the effectiveness of castor oil extract used as an irrigating solution on Escherichia coli and its endotoxins in root canals. Sixty single-rooted teeth were prepared (using castor oil extract as irrigating solution) and divided into five groups (n = 12): Group 1 samples were treated with calcium hydroxide (Ca(OH)2), Group 2 samples were treated with polymyxin B, Group 3 samples were treated with Ca(OH)2 and 2% chlorhexidine gel (CHX), and Group 4 samples were treated with castor oil extract. A control group used physiological saline solution as an irrigant. Canal content samples were collected at four different times: immediately after instrumentation, seven days after instrumentation, after 14 days of intracanal medication, and seven days after removal of intracanal medication. A plating method was used to assess antimicrobial activity and the quantification of endotoxins was evaluated by the chromogenic Limulus lysate assay. Data were submitted to ANOVA and a Dunn test (a = 5%). Irrigation with castor oil extract decreased E. coli counts but had no effect on the level of endotoxins. Samples taken seven days after removal of medication revealed a significant reduction in endotoxin levels in Groups 3 and 4. Compared to the saline solution irrigation, castor oil extract decreased microorganism counts in root canals immediately after canal preparation. None of the medications used completely eliminated endotoxins in the root canal.

  18. Optimization of biodiesel production from castor oil using response surface methodology.

    Science.gov (United States)

    Jeong, Gwi-Taek; Park, Don-Hee

    2009-05-01

    The short supply of edible vegetable oils is the limiting factor in the progression of biodiesel technology; thus, in this study, we applied response surface methodology in order to optimize the reaction factors for biodiesel synthesis from inedible castor oil. Specifically, we evaluated the effects of multiple parameters and their reciprocal interactions using a five-level three-factor design. In a total of 20 individual experiments, we optimized the reaction temperature, oil-to-methanol molar ratio, and quantity of catalyst. Our model equation predicted that the following conditions would generate the maximum quantity of castor biodiesel (92 wt.%): a 40-min reaction at 35.5 degrees C, with an oil-to-methanol molar ratio of 1:8.24, and a catalyst concentration of 1.45% of KOH by weight of castor oil. Subsequent empirical analyses of the biodiesel generated under the predicted conditions showed that the model equation accurately predicted castor biodiesel yields within the tested ranges. The biodiesel produced from castor oil satisfied the relevant quality standards without regard to viscosity and cold filter plugging point.

  19. The castor oil production in Brazil and the biodiesel program (Probiodiesel); A producao de mamona no Brasil e o Probiodiesel

    Energy Technology Data Exchange (ETDEWEB)

    Almeida, Cezar Menezes; Almeida Neto, Jose Adolfo de; Pires, Monica de Moura [Universidade Estadual de Santa Cruz, Ilheus, BA (Brazil). Grupo Bioenergia e Meio Ambiente]. E-mails: biocomb@uesc.br; Rocha, Pauletti Karllien [Secretaria de Ciencia, Tecnologia e Inovacao do Estado da Bahia (SECTI), Salvador, BA (Brazil)]. E-mail: pauletti@secti.ba.gov.br

    2004-07-01

    The objective of this work is to present a prospective study of the national production of biodiesel and castor oil and to determine the level of the public investment necessary to attain the proposed production. For replacement of 2% of the diesel internal consumption, 786 millions of liters of biodiesel will be necessary, based on the consumption of 2003. From this amount 293 millions of liters (40%) will be derived from the castor oil. Considering the castor oil agricultural productivity of 1.8 t/ha and the 45% industrial income in oil, it will be necessary the planting of 360.000 ha and investment amount of R$ 370 million. An idleness of 71% of the castor oil crushing industry has been detected, but this sector works with profit as function of castor oil price. An deficit of 55% between the castor oil planting area and the necessary one for biodiesel production was identified, considering that all the castor oil will be exclusively used for this purpose. With the proposed goals and without the necessary allocation of public resources for castor oil production, probably it will not be possible to expect that 1/5 of the biodiesel national production can come from the domestic agricultural planting.

  20. Evaluation of reaction mechanisms and the kinetic parameters for the transesterification of castor oil by liquid enzymes

    DEFF Research Database (Denmark)

    Andrade, Thalles Allan; Errico, Massimiliano; Christensen, Knud Villy

    2017-01-01

    of the transesterification of castor oil with methanol using the enzyme Eversa® Transform as catalyst were investigated. Reactions were carried out for 8 hours at 35 °C with: an alcohol-to-oil molar ratio equal to 6:1, a 5 wt% of liquid enzyme solution and addition of 5 wt% of water by weight of castor oil. From...

  1. Hyperglycaemic effect of Artocarpus communis Forst (Moraceae) root bark aqueous extract in Wistar rats.

    Science.gov (United States)

    Adewole, S O; Ojewole, J O

    2007-01-01

    Decoctions and infusions of Artocarpus communis (Forst) (family: Moraceae) root bark are traditionally used among the Yoruba-speaking people of western Nigeria as folk remedies for the management, control and treatment of an array of human diseases, including type 2 diabetes mellitus. Although numerous bioactive prenylflavonoids have been isolated from the roots, stem bark and leaves of A communis, to the best of our knowledge, the effects of the plant's root bark extract on animal models of diabetes mellitus have hitherto not been reported in the biomedical literature. In our pilot study, we observed that A communis root bark aqueous extract (ACE) raised blood glucose concentrations in rats. In view of this finding, the present study was undertaken to investigate the glycaemic effect of ACE in comparison with that of streptozotocin (STZ) in Wistar rats. Four groups (A, B, C and D) of Wistar rats, each group consisting of 10 rats, were used in this study. Group A rats received distilled water in quantities equivalent to the volume of ACE administered. Diabetes mellitus was induced in the animals in groups B and C by intraperitoneal (ip) injections of STZ (75 mg/kg body weight). The rats in group C were additionally treated with ACE (50 mg/kg body weight ip) from the third to the tenth day following STZ treatment. Group D rats received ACE (12.5-100 mg/kg body weight ip) only. The effects of ACE were compared with those of STZ on blood glucose concentrations, serum and pancreatic insulin levels, hepatic hexokinase (HXK) and glucokinase (GCK) activities, and hepatic glycogen contents in the experimental animal paradigm used. The rats in treated groups B, C and D exhibited pronounced polyuria, hypo-insulinaemia and hyperglycaemia. Group D rats developed significant hyperglycaemia (p < 0.05) immediately after ACE administration, whereas groups B and C rats became hyperglycaemic 24 to 72 hours post STZ and STZ + ACE treatments, when compared with the control group A

  2. Gregarine Cephaloidophora communis mawrodiadi, 1908 in the barnacle Euraphia rhyzophorae, Oliveira, 1940 from Brazil

    Directory of Open Access Journals (Sweden)

    Lacombe Dyrce

    2002-01-01

    Full Text Available The gregarine Cephaloidophora communis was observed for the first time in Brazil in the barnacles Euraphia rhyzophorae collected in Angra dos Reis, Rio de Janeiro, Brazil, between 1990 and 1996. Histological studies showed growth phases of the parasite in specific parts of the digestive system. The intracellular forms occurred in the vacuoles of the intestinal cells. Syzygy was frequent, and the most common form following syzygy was cylindrical, with a single membrane. The cytoplasm of the gregarines was always irregular, dense, and occasionally presenting a dark stoch area.

  3. Phytosynthesis of Silver Nanoparticles Using Myrtus communis L. Leaf Extract and Investigation of Bactericidal Activity

    Science.gov (United States)

    Ajdari, M. R.; Tondro, G. H.; Sattarahmady, N.; Parsa, A.; Heli, H.

    2017-12-01

    Silver nanoparticles have been synthesized using only Myrtus communis L. leaf extract by a facile procedure without other reagents. The extract played the roles of both reducing and capping agent. The nanoparticles were characterized using field-emission scanning microscopy, and remained stable for at least 3 weeks. Antibacterial activity of the nanoparticles was evaluated toward Escherichia coli, Bacillus subtilis, Pseudomonas aeruginosa, Staphylococcus aureus, methicillin-resistant Staphylococcus aureus, and Enterococcus faecalis based on inhibition zone disk diffusion assays. The minimum inhibitory and bactericidal concentrations of the nanoparticles were obtained. Mechanisms for the antibacterial activity were proposed.

  4. HPLC-DAD-MS identification of bioactive secondary metabolites from Ferula communis roots.

    Science.gov (United States)

    Arnoldi, Lolita; Ballero, Mauro; Fuzzati, Nicola; Maxia, Andrea; Mercalli, Enrico; Pagni, Luca

    2004-06-01

    A simple HPLC method was developed to distinguish between 'poisonous' and 'non-poisonous' chemotypes of Ferula communis. The method was performed on a C8 reverse phase analytical column using a binary eluent (aqueous TFA 0.01%-TFA 0.01% in acetonitrile) under gradient condition. The two chemotypes showed different fingerprints. The identification of five coumarins and eleven daucane derivatives by HPLC-diode array detection (HPLC-DAD) and HPLC-MS is described. A coumarin, not yet described, was detected. Copyright 2004 Elsevier B.V.

  5. Where and How Wolves (Canis lupus) Kill Beavers (Castor canadensis).

    Science.gov (United States)

    Gable, Thomas D; Windels, Steve K; Bruggink, John G; Homkes, Austin T

    2016-01-01

    Beavers (Castor canadensis) can be a significant prey item for wolves (Canis lupus) in boreal ecosystems due to their abundance and vulnerability on land. How wolves hunt beavers in these systems is largely unknown, however, because observing predation is challenging. We inferred how wolves hunt beavers by identifying kill sites using clusters of locations from GPS-collared wolves in Voyageurs National Park, Minnesota. We identified 22 sites where wolves from 4 different packs killed beavers. We classified these kill sites into 8 categories based on the beaver-habitat type near which each kill occurred. Seasonal variation existed in types of kill sites as 7 of 12 (58%) kills in the spring occurred at sites below dams and on shorelines, and 8 of 10 (80%) kills in the fall occurred near feeding trails and canals. From these kill sites we deduced that the typical hunting strategy has 3 components: 1) waiting near areas of high beaver use (e.g., feeding trails) until a beaver comes near shore or ashore, 2) using vegetation, the dam, or other habitat features for concealment, and 3) immediately attacking the beaver, or ambushing the beaver by cutting off access to water. By identifying kill sites and inferring hunting behavior we have provided the most complete description available of how and where wolves hunt and kill beavers.

  6. The performance of the CASTOR calorimeter during LHC Run 2

    CERN Document Server

    van de Klundert, Merijn H F

    2016-01-01

    CASTOR is an electromagnetic and hadronic tungsten-quartz sampling Cerenkov calorimeter located at the Compact Muon Solenoid experiment at the Large Hadron Collider. The detector has pseudorapidity borders at -5.2 and -6.6. An overview is presented on the various aspects of CASTOR’s performance and their relations during LHC Run 2. The equalisation of CASTOR’s channels is performed using beam-halo muons. Thereafter, CASTOR’s pedestal spectrum is studied. It is shown that noise estimates which are extracted using a fit, give on average a 10% lower threshold than statistical estimates. Gain correction factors, which are needed for the intercalibration, are obtained using a statistical, in-situ applicable method. The results of this method are shown to be reasonably consistent with laboratory measurements. Penultimately the absolute calibration is discussed, with emphasis on the relation between the scale uncertainty and CASTOR’s alignment. It is shown that the alignment’s contribution to the systemati...

  7. Characterization of the North American beaver (Castor canadensis) papillomavirus genome.

    Science.gov (United States)

    Rogovskyy, Artem S; Chen, Zigui; Burk, Robert D; Bankhead, Troy

    2014-01-10

    The papillomaviruses comprise a large group of viruses that cause proliferations of the stratified squamous epithelium of skin and mucosa in a variety of animals. An earlier report identified a novel papillomavirus of the North American beaver, Castor canadensis (CcanPV1) that was associated with cutaneous exophytic lesions. In the current study, we determined the sequence of the complete 7435 basepair genome of CcanPV1. The genome contains an Upstream Regulatory Region located between the end of L1 and the start of E6, and seven canonical papillomavirus open reading frames encoding five early (E6, E7, E1, E2, and E4) and two late (L2 and L1) proteins. No E5 open reading frame was detected. Phylogenetic analysis of the CcanPV1 genome places the virus between the genera Kappapapillomavirus and Mupapillomavirus. Analyses of the papillomavirus genomes detected in different species of the order Rodentia indicate these viruses do not form a monophyletic clade. Copyright © 2013 Elsevier B.V. All rights reserved.

  8. Where and How Wolves (Canis lupus Kill Beavers (Castor canadensis.

    Directory of Open Access Journals (Sweden)

    Thomas D Gable

    Full Text Available Beavers (Castor canadensis can be a significant prey item for wolves (Canis lupus in boreal ecosystems due to their abundance and vulnerability on land. How wolves hunt beavers in these systems is largely unknown, however, because observing predation is challenging. We inferred how wolves hunt beavers by identifying kill sites using clusters of locations from GPS-collared wolves in Voyageurs National Park, Minnesota. We identified 22 sites where wolves from 4 different packs killed beavers. We classified these kill sites into 8 categories based on the beaver-habitat type near which each kill occurred. Seasonal variation existed in types of kill sites as 7 of 12 (58% kills in the spring occurred at sites below dams and on shorelines, and 8 of 10 (80% kills in the fall occurred near feeding trails and canals. From these kill sites we deduced that the typical hunting strategy has 3 components: 1 waiting near areas of high beaver use (e.g., feeding trails until a beaver comes near shore or ashore, 2 using vegetation, the dam, or other habitat features for concealment, and 3 immediately attacking the beaver, or ambushing the beaver by cutting off access to water. By identifying kill sites and inferring hunting behavior we have provided the most complete description available of how and where wolves hunt and kill beavers.

  9. Transesterification of Castor Oil Catalyzed by Liquid Enzymes

    DEFF Research Database (Denmark)

    Andrade, Thalles Allan; Errico, Massimiliano; Christensen, Knud Villy

    2017-01-01

    economy. Based on this, and considering its low influence with food production, castor oil was investigated as a potential feedstock. Compared to other vegetable oils, it has a higher polarity resulting in better system homogeneity during reaction. The enzyme tested as catalyst was Eversa Transform. Four...... main reaction parameters were investigated for the optimization of the reaction route: the temperature was varied from 35 to 45 °C, the water content between 0-10 wt%, the enzyme content in the range of 2-10 wt%, and the alcohol-to-oil molar ratio from 4.5 to 7.5. The Response Surface Methodology...... was used to determine the optimal reaction conditions to get a high biodiesel yield and a low free fatty acids concentration. The results obtained showed that at 35 °C, 5 wt% of enzymes, 5 wt% of water, and a 6.0 alcohol-to-oil molar ratio, the yield in biodiesel was about 94% with a content of free fatty...

  10. Identification of diacylglycerol and triacylglycerol containing 11,12,13-trihydroxy-9,14-octadecadienoic acid in castor oil.

    Science.gov (United States)

    Lin, Jiann-Tsyh; Chen, Grace Q

    2011-02-28

    Castor oil has many industrial uses. Molecular species of acylglycerols containing monohydroxy, dihydroxy and trihydroxy fatty acids in castor oil have been reported. We report here the identification of acylglycerols containing a triOH18:2 fatty acid in castor oil. The structure of this novel fatty acid was proposed as 11,12,13-trihydroxy-9,14-octadecadienoic acid by the mass spectrometry of the lithiated adducts of acylglycerols in the HPLC fractions of castor oil. The fragmentation pathways of the lithiated adduct of 11,12,13-trihydroxy-9,14-octadecadienoic acid were proposed. We also proposed the biosynthetic pathways of polyhydroxy fatty acids in castor. Published by Elsevier B.V.

  11. Prevalence of tick-borne pathogens in questing Ixodes ricinus ticks in urban and suburban areas of Switzerland

    Directory of Open Access Journals (Sweden)

    Corinne P. Oechslin

    2017-11-01

    Full Text Available Abstract Background Throughout Europe, Ixodes ricinus transmits numerous pathogens. Its widespread distribution is not limited to rural but also includes urbanized areas. To date, comprehensive data on pathogen carrier rates of I. ricinus ticks in urban areas of Switzerland is lacking. Results Ixodes ricinus ticks sampled at 18 (sub- urban collection sites throughout Switzerland showed carrier rates of 0% for tick-borne encephalitis virus, 18.0% for Borrelia burgdorferi (sensu lato, 2.5% for Borrelia miyamotoi, 13.5% for Rickettsia spp., 1.4% for Anaplasma phagocytophilum, 6.2% for "Candidatus Neoehrlichia mikurensis", and 0.8% for Babesia venatorum (Babesia sp., EU1. Site-specific prevalence at collection sites with n > 45 ticks (n = 9 significantly differed for B. burgdorferi (s.l., Rickettsia spp., and "Ca. N. mikurensis", but were not related to the habitat type. Three hundred fifty eight out of 1078 I. ricinus ticks (33.2% tested positive for at least one pathogen. Thereof, about 20% (71/358 were carrying two or three different potentially disease-causing agents. Using next generation sequencing, we could detect true pathogens, tick symbionts and organisms of environmental or human origin in ten selected samples. Conclusions Our data document the presence of pathogens in the (sub- urban I. ricinus tick population in Switzerland, with carrier rates as high as those in rural regions. Carriage of multiple pathogens was repeatedly observed, demonstrating the risk of acquiring multiple infections as a consequence of a tick bite.

  12. First evidence of Babesia venatorum and Babesia capreoli in questing Ixodes ricinus ticks in the Czech Republic.

    Science.gov (United States)

    Venclikova, Kristyna; Mendel, Jan; Betasova, Lenka; Hubalek, Zdenek; Rudolf, Ivo

    2015-01-01

    Ixodes ricinus is the most common tick species occurring in Central Europe and it serves as a principal vector of emerging human pathogens. The aim of this study was to determine the prevalence of Babesia spp. in host-seeking I. ricinus in urban and natural habitats. PCR was applied on samples to assess prevalence of Babesia spp. in questing ixodid ticks. Sequencing was used for Babesia species determination. 1,473 I. ricinus ticks (1,294 nymphs, 99 males and 80 females) were examined for the presence of Babesia spp. at the two study sites. Minimum infection rate for Babesia spp. was found to be 0.5% (infected I. ricinus nymphs were only detected in the natural ecosystem). Two Babesia species were identified by sequencing: B. venatorum (formerly called Babesia sp. EU1) and B. capreoli. The results obtained represent the first evidence of the occurrence of B. venatorum and B. capreoli in host-seeking I. ricinus ticks in the Czech Republic.

  13. Dynamics of the nearby multiple stellar systems. The Castor system (ADS 6175)

    International Nuclear Information System (INIS)

    Anosova, Zh.P.; Orlov, V.V.; Chernyshev, M.V.

    1989-01-01

    Statistical analysis of the astrometrical and astrophysical data for the components of the multiple stellar system Castor (ADS 6175) was used to determined the probability of physical connection among components and the dynamical state of this system. The uncertainties of the observational data are taken into account. It is shown that in this visual triple star system the components have a certain gravitational and dynamical connection. The relative orbit of close components AB is elliptical. The probability that the motion of the distant star C in relation to the centre of mass AB is elliptical and the Castor system is stable is 40.7%. The probability that the orbit of C is hyperbolic is 59.1%. The probability that the Castor system may be unstable non-hierarchical is 0.2%

  14. Thermophysical properties of biodiesel and related systems: (Liquid + liquid) equilibrium data for castor oil biodiesel

    International Nuclear Information System (INIS)

    Mazutti, Marcio A.; Voll, Fernando A.P.; Cardozo-Filho, Lúcio; Corazza, Marcos L.; Lanza, Marcelo; Priamo, Wagner L.; Oliveira, J. Vladimir

    2013-01-01

    Highlights: ► (Liquid + liquid) equilibrium data for multicomponent castor oil FAME and FAEE castor oil. ► Tie-lines and solubility curves (binodal) by cloud-point method for FAME and FAEE systems. ► Experimental data correlated using the UNIQUAC model. -- Abstract: This work reports new liquid–liquid solubility values (binodal curves) as well as (liquid + liquid) equilibrium data for, ternary and quaternary systems containing fatty acid methyl esters (FAME) and fatty acid ethyl esters (FAEE) from castor oil, water, glycerol, methanol and anhydrous ethanol at T = (303.15, 318.15, and 333.15) K. Solubility curves (binodal) were also obtained by the cloud-point method for binary systems containing FAME, FAEE, water, or glycerol. All results obtained can be considered of good quality. The experimental values were correlated using the UNIQUAC model, whose results presented good performance and satisfactory fitting of equilibrium values

  15. Study on Emission and Performance of Diesel Engine Using Castor Biodiesel

    Directory of Open Access Journals (Sweden)

    Md. Saiful Islam

    2014-01-01

    performance of diesel engine using the castor biodiesel and its blend with diesel from 0% to 40% by volume. The acid-based catalyzed transesterification system was used to produce castor biodiesel and the highest yield of 82.5% was obtained under the optimized condition. The FTIR spectrum of castor biodiesel indicates the presence of C=O and C–O functional groups, which is due to the ester compound in biodiesel. The smoke emission test revealed that B40 (biodiesel blend with 40% biodiesel and 60% diesel had the least black smoke compared to the conventional diesel. Diesel engine performance test indicated that the specific fuel consumption of biodiesel blend was increased sufficiently when the blending ratio was optimized. Thus, the reduction in exhaust emissions and reduction in brake-specific fuel consumption made the blends of caster seed oil (B20 a suitable alternative fuel for diesel and could help in controlling air pollution.

  16. Castor oil biodiesel: an economic evaluation; Biodiesel de mamona: uma avaliacao economica

    Energy Technology Data Exchange (ETDEWEB)

    Pires, Monica de Moura; Alves, Jaenes Miranda; Almeida Neto, Jose Adolfo de; Almeida, Cezar Menezes; Sousa, Geovania Silva de; Cruz, Rosenira Serpa da; Monteiro, Renata; Lopes, Beatriz Sampaio; Robra, Sabine [Universidade Estadual de Santa Cruz, Ilheus, BA (Brazil). Grupo Bioenergia e Meio Ambiente]. E-mails: mpires@uesc.br; jaenes@uesc.br; jalmeida@uesc.br; roserpa@uesc.br

    2004-07-01

    The production cost of castor oil biodiesel by methyl way and its economic viability, using as reference the production cost data of castor oil and the implantation of the pilot plant at UESC - state university of Santa Cruz, Bahia State, Brazil was determined. From this information, it was seen that the estimated price of castor oil biodiesel is close to the diesel price in the Itabuna market, Bahia state, Brazil. The indicators show economic viability of the mini-power plant installation. Such information are preliminary estimative for the market and can be modified as function of changes in the main factors used to have the production costs, as well as the sectorial policies that drives the activity as much in levels of raw material production as in biodiesel.

  17. Antibacterial effects of castor oil on foodborne pathogens: comparative evaluation of the components

    Directory of Open Access Journals (Sweden)

    samaneh hatami

    2016-01-01

    Full Text Available For centuries, antimicrobial compounds derived from plants, have been used for medicinal treatment. The aim of this study was to evaluate the antibacterial activity of castor seed oil extracted from Mashhad and Isfahan varieties on Staphylococcus aureus, Escherichia coli and Listeria inocula. The sensitivity of the indicator bacteria was evaluated using disc diffusion technique and minimum inhibitory concentration (MIC and minimum bactericidal concentration (MBC were tested by broth micro-dilution assays. Oil from castor seeds was extract by Soxhlet method and the extracted oils were analyzed by a gas chromatograph connected to a mass spectrometer (GC/MS. According to the results of various dilutions of the extracts, MIC for castor oils ranged 12.5-25%, except for the Isfahan variety that was estimated at 6.25-12.5% for E. coli. The two varieties of castor oils showed the MBC activity on the indicator organisms at the original (100% concentration. Based on GC/MS data, ricinoleic acid (1.307%, genetistic acid (0.597% and palmitic acid (1.947% were detected in oil extracted from Isfahan variety; meanwhile these compounds did not found in Mashhad variety. According to the results, the two castor varieties had antibacterial impact on E. coli. In addition, the overall antimicrobial activity of Isfahan variety was higher than Mashhad type. It seems that the presence of phenolic compounds as well as camphoric and unsaturated fatty acids is the major reason for the higher antibacterial effect of Isfahan variety on E. coli. Considering the inhibitory impact of castor oil, it can be used as a natural preservative in food industry.

  18. Castor oil for induction of labor in post-date pregnancies: A randomized controlled trial.

    Science.gov (United States)

    Gilad, Ronit; Hochner, Hagit; Savitsky, Bella; Porat, Shay; Hochner-Celnikier, Drorith

    2018-02-01

    Castor oil is a substance used for labor induction in an inpatient setting. However, its efficacy as an agent for the induction of labor, for post-date pregnancies in an outpatient setup is unknown. Efficacy of castor oil as an agent for the induction of labor, for post-date pregnancies in outpatient settings. Eighty-one women with a low-risk post-date singleton pregnancy with a Bishop score≤7, without effective uterine contractions were randomized to the intervention, 60ml of castor oil, or the control, 60ml of sun-flower oil. The primary outcome was proportion of women entering the active phase of labor 24, 36, 48h after ingestion. Secondary outcomes included meconium stained amniotic fluid, abnormal fetal heart rate tracing, cesarean section rate, instrumental deliveries, birth weight, 5min Apgar score, chorioamnionitis, hypertensive complications, retained placenta, and post-partum hemorrhage. Intervention and control groups included 38 and 43 women, respectively. No differences in baseline characteristics, except for age were noted. The observed interaction between castor oil and parity was significant (p interaction =0.02). Multiparous women in the intervention group exhibited a significant beneficial effect on entering active labor within 24, 36 and 48h after castor oil consumption compared with the placebo (Hazard Ratio=2.93, p=0.048; Hazard Ratio=3.29, p=0.026; Hazard Ratio=2.78, p=0.042 respectively). This effect was not noted among primiparous women. No differences in rate of obstetric complications or adverse neonatal outcomes were noted. Castor oil is effective for labor induction, in post-date multiparous women in outpatient settings. Copyright © 2017. Published by Elsevier Ltd.

  19. Evaluation of Sebostatic Activity of Juniperus communis Fruit Oil and Pelargonium graveolens Oil Compared to Niacinamide

    Directory of Open Access Journals (Sweden)

    Justyna Kozlowska

    2017-09-01

    Full Text Available As a facial skin condition, oily skin causes cosmetic problems, such as large pores, shiny appearance, and the feeling of greasiness and heaviness. Furthermore, extensive sebum production leads to common skin disorders such as acne vulgaris or seborrheic dermatitis. This study investigated the efficacy of sebum control tonics containing Juniperus communis fruit oil, Pelargonium graveolens oil, or niacinamide. The effects of Juniperus communis fruit oil, Pelargonium graveolens oil, and niacinamide on sebum excretion rates were investigated using Sebumeter®. Sebum measurements (Sebumeter® SM 815, Courage & Khazaka®, Köln, Germany were made on the skin surface in three places by applying the sebumeter probe to the forehead after 10, 60, and 120 min from application of the tonic. The results indicated that the application of the tonic maintained a lower sebum secretion 10 min and 60 min after the application of the cosmetic, compared to those before it. However, a visible sebum-reducing efficacy after 2 h was reported only for tonic containing 0.25% Pelargonium graveolens oil and for the tonic with the addition of 3% niacinamide. After 2 h, the values of sebum measurements were 44 ± 5.13 a.u. and 58 ± 9.07 a.u., respectively. Our results show that the tonic with the addition of 0.25% Pelargonium graveolens oil is the most effective in reducing sebum production.

  20. Antimicrobial activities of the methanol extract and compounds from Artocarpus communis (Moraceae

    Directory of Open Access Journals (Sweden)

    Ngadjui Bonaventure T

    2011-05-01

    Full Text Available Abstract Background Artocarpus communis is used traditionally in Cameroon to treat several ailments, including infectious and associated diseases. This work was therefore designed to investigate the antimicrobial activities of the methanol extract (ACB and compounds isolated from the bark of this plant, namely peruvianursenyl acetate C (1, α-amyrenol or viminalol (2, artonin E (4 and 2-[(3,5-dihydroxy-(Z-4-(3-methylbut-1-enylphenyl]benzofuran-6-ol (5. Methods The liquid microdilution assay was used in the determination of the minimal inhibitory concentration (MIC and the minimal microbicidal concentration (MMC, against seven bacterial and one fungal species. Results The MIC results indicated that ACB as well as compounds 4 and 5 were able to prevent the growth of all tested microbial species. All other compounds showed selective activities. The lowest MIC value of 64 μg/ml for the crude extract was recorded on Staphylococcus aureus ATCC 25922 and Escherichia coli ATCC 8739. The corresponding value of 32 μg/ml was recorded with compounds 4 and 5 on Pseudomonas aeruginosa PA01 and compound 5 on E. coli ATCC 8739, their inhibition effect on P. aeruginosa PA01 being more than that of chloramphenicol used as reference antibiotic. Conclusion The overall results of this study provided supportive data for the use of A. communis as well as some of its constituents for the treatment of infections associated with the studied microorganisms.

  1. Antimicrobial activities of the methanol extract and compounds from Artocarpus communis (Moraceae).

    Science.gov (United States)

    Kuete, Victor; Ango, Patrick Y; Fotso, Ghislain W; Kapche, Gilbert D W F; Dzoyem, Jean P; Wouking, Arlette G; Ngadjui, Bonaventure T; Abegaz, Berhanu M

    2011-05-25

    Artocarpus communis is used traditionally in Cameroon to treat several ailments, including infectious and associated diseases. This work was therefore designed to investigate the antimicrobial activities of the methanol extract (ACB) and compounds isolated from the bark of this plant, namely peruvianursenyl acetate C (1), α-amyrenol or viminalol (2), artonin E (4) and 2-[(3,5-dihydroxy)-(Z)-4-(3-methylbut-1-enyl)phenyl]benzofuran-6-ol (5). The liquid microdilution assay was used in the determination of the minimal inhibitory concentration (MIC) and the minimal microbicidal concentration (MMC), against seven bacterial and one fungal species. The MIC results indicated that ACB as well as compounds 4 and 5 were able to prevent the growth of all tested microbial species. All other compounds showed selective activities. The lowest MIC value of 64 μg/ml for the crude extract was recorded on Staphylococcus aureus ATCC 25922 and Escherichia coli ATCC 8739. The corresponding value of 32 μg/ml was recorded with compounds 4 and 5 on Pseudomonas aeruginosa PA01 and compound 5 on E. coli ATCC 8739, their inhibition effect on P. aeruginosa PA01 being more than that of chloramphenicol used as reference antibiotic. The overall results of this study provided supportive data for the use of A. communis as well as some of its constituents for the treatment of infections associated with the studied microorganisms.

  2. Antioxidant properties and xanthine oxidase inhibitory effects of Tamus communis L. root extracts.

    Science.gov (United States)

    Boumerfeg, Sabah; Baghiani, Abderrahmane; Messaoudi, Dalila; Khennouf, Seddik; Arrar, Lekhmici

    2009-02-01

    This study was conducted to search for xanthine oxidase (XO) inhibitors from the root extracts of Tamus communis L. traditionally used in folk medicine in Algeria. Root extracts with different solvents were screened for purified milk xanthine oxidase inhibition. The root extracts (methanol, chloroform and ethyl acetate) and proteins, obtained in distilled water, inhibited bovine, sheep and human milk XO from three species in a concentration-dependent manner, with an additional superoxide scavenging capacity, which reached its highest level with ethyl acetate extract (IC(50) = 0.15, 0.04 and 0.09 g/L) for bovine XO, sheep XO and human XO, respectively. The antioxidant potential was confirmed with the non-enzymatic method, total radical-trapping antioxidant parameter (TRAP) assay, which showed that the Tamus communis L. extracts have a potential antioxidant activity in the same order obtained by using the reduction of cytochrome c, an enzymatic method, in which the antioxidant activity followed a decreasing order: ethyl acetate extract > chloroform extract > protein. Copyright (c) 2008 John Wiley & Sons, Ltd.

  3. Development of an energy-protein for animal food based crop residues pear (Pyrus communis

    Directory of Open Access Journals (Sweden)

    Néstor Julián Pulido-Suárez,

    2016-01-01

    Full Text Available Pear (Pyrus communis is a fruit from the species of deciduous, widely consumed worldwide for its high quality energ y. However, pear itself does not provide the amount of protein required for cattle feeding, so alternatives to improve its nutritional quality have been studied. On these grounds, the objective of this study was to evaluate the parameters of solid state fermentation, and compositional energ y value of a protein food based on pears (Pyrus communis with apparent physical damage. A completely random design was used to evaluate three treatments; these correspond to percentages of inclusion of calcium carbonate (0.25, 0.50, 0.75 formulation based on already established (40 % pear, 25 % rice flour, 25 % wheat bran and 10 % urea, the parameters evaluated were: pH, ashes (CZ, crude protein (CP and crude fiber (CF, and they were recorded at 0, 24, 48 and 72 hours. As a result, it was found that the pH dropped gradually for each treatment and at each sampling period; however, there were no significant differences. The lower value at the end of the process is recorded T2 (0.25 with 4.66, followed by T3 (0.50 with 4.50, the ash reached values of up to 6 % with T3, and T2 (0.50 reached the highest percentages in fiber and crude protein. Finally, decreasing the fermentation variables ensures a food with no presence of undesirable microorganisms and stable over time.

  4. Design of the CMS-CASTOR subdetector readout system by reusing existing designs

    CERN Document Server

    Beaumont, W

    2009-01-01

    CASTOR is a cylindrical calorimeter with a length of 1.5m and a diameter of 60cm located at 14.3 meters from the CMS interaction point and covering the range in pseudorapidity corresponding to 5.1 < | eta | < 6.6. The CASTOR project was approved in the middle of 2007. Given the limited resources and time, developing a readout system from scratch was excluded. Here the final implementations of the readout chain, the considerations for the different choices as well as the performance of the installed equipment are discussed.

  5. Design of the CMS-CASTOR sub detector readout system by reusing existing designs

    CERN Document Server

    Beaumont, Willem

    2009-01-01

    CASTOR is a cylindrical calorimeter with a length of 1.5m and a diameter of 60cm located at 14.3 meters from the CMS interaction point and covering the range in pseudo-rapidity corresponding to 5.1 ~\\textless~ \\textbar~ eta~ \\textbar ~ \\textless ~ 6.6. The CASTOR project was approved in the middle of 2007. Given the limited resources and time, developing a readout system from scratch was excluded. Here the final implementations of the readout chain, the considerations for the different choices as well as the performance of the installed equipment are discussed.

  6. Some Experiences with the Use of Castor Oil as a Dielectric.

    Science.gov (United States)

    1981-01-01

    Karl Fischer method. The first analysis was made after the oil vat had been in use for several weeks. The vat was covered with a polyethylene sheet but...parts by the oil, drying of the oil, and the determination of water in the two-phase sys- tem of castor oil in contact with mineral oil. Detailed...DRY CASTOR OIL The effect of moisture on the dielectric strength of organic liquids is well known2 .The dielectric strength of mineral oil, for example

  7. Reconstruction of the Cranial Vault Contour Using Tissue Expander and Castor Oil Prosthesis.

    Science.gov (United States)

    de Moraes, Sylvio Luiz Costa; Afonso, Alexandre Maurity de Paula; Santos, Roberto Gomes Dos; Mattos, Ricardo Pereira; Duarte, E Bruno Gomes

    2017-09-01

    Nowadays the reconstruction of craniofacial defects can be performed with different kinds of materials, which include the bone and the so-called biomaterials, which have the advantage of not needing a surgical site donor. Among these materials, great attention is given to polymers. In this large group, current attention is focused on the castor oil polymer, since this polymer is biocompatible, low cost, and has adequate strength for reconstruction of the craniomaxillofacial complex. This study aims to report the use of a prosthetic castor oil polymer for reconstruction of extensive defect, caused by a trauma, in the temporoparietal region.

  8. Morphological anomalies in Ixodes ricinus and Ixodes inopinatus collected from tick-borne encephalitis natural foci in Central Europe

    DEFF Research Database (Denmark)

    Chitimia-Dobler, Lidia; Bestehorn, Malena; Bröker, Michael

    2017-01-01

    In 2015, 0.02% nymphs displayed anomalies (ectromely) out of the 6744 collected ticks as part of a tick-borne encephalitis program in Germany. In 2016, questing Ixodes ricinus (n = 14,527) and Ixodes inopinatus (n = 75) ticks were collected by flagging as part of a tick-borne encephalitis program......, palps and exoskeleton. Anal groove deformation was observed in three females and three nymphs. In 2016, the frequency of anomalies in I. inopinatus was found five times higher (9.3%) than in I. ricinus (1.9%). This is the first report of anomaly (ectromely, leg atrophy, idiosoma deformation) in flagged...... I. inopinatus and the first report of schizomely in I. ricinus....

  9. Production of bran castor biochar through slow pyrolysis

    Science.gov (United States)

    Pissinati de Rezende, E. I.; Mangrich, A. S.; Batista, M. G. F.; Toledo, J. M. S.; Novotny, E. H.

    2012-04-01

    Pyrolysis is a thermal process of great importance in the present context, since it constitutes a significant alternative to adequate use of organic waste. The principal products obtained in the pyrolysis of discarded biomass are bio-oil, biogas and biochar. Biochar, in turn, may play a relevant role when applied to the soil to sequester carbon and as a soil conditioner, a material comparable to organic matter of Indians Black Earths from the Amazon Region [1]. Seeking to determine the best methods of preparation of biochar, we studied the pyrolysis of bran castor residue of the Brazilian biodiesel industry. Eight samples, from FM1 to FM8, were prepared in a factorial design 23 using two temperature (300 and 350 °C), two heating velocity (5 and 10 °C min-1) and two period of heating (30 and 60 min). The eight samples were studied using the spectroscopy: EPR, FTIR, RMN, XPS, and elemental analysis. By elemental analysis, the samples that keep for lower temperature of pyrolysis, 300 °C, showed H/C and N/C ratios greater than the samples of 350 °C. That higher value can be attributed to chemical structure more aliphatic than aromatic mainly in the FM7 sample (V = 10 °C min-1, T = 300 °C, P = 30 min). The greater N/C ratio correlated with a superior amount of nitrogenous functions, presenting by both FM7 and FM4 samples, as determined by 13C NMR spectroscopy with absorptions in 175 ppm (amide) and 55 ppm (N-alkyl).

  10. Antimicrobial activity of untenospongin B, a metabolic from the marine sponge Hippospongia communis collected from the Atlantic coast of Morocco

    NARCIS (Netherlands)

    Rifai, S.; Kijjoa, A.; van Soest, R.W.M.

    2004-01-01

    (-)-Untenospongin B isolated from the marine sponge Hippospongia communis has been tested for its antimicrobial activity against bacteria and human pathogenic fungi using agar disk method and was found to possess a broad and strong activity toward the test organisms. Its antifungal activity was

  11. Isolation and characterization of polyphenol oxidase from Sardinian poisonous and non-poisonous chemotypes of Ferula communis (L.).

    Science.gov (United States)

    Zucca, Paolo; Sanjust, Enrico; Loi, Martina; Sollai, Francesca; Ballero, Mauro; Pintus, Manuela; Rescigno, Antonio

    2013-06-01

    Ferula communis (L.), a plant belonging to Apiaceae, is widely present in Sardinia, Italy. Currently, interest in F. communis focuses on the presence of two chemotypes in the wild. One chemotype is poisonous to animals, whereas the other chemotype is non-poisonous. Polyphenol oxidase (PPO) has been extracted and partially purified from the two chemotypes of F. communis. The biochemical characterization of the enzymes showed significant differences. In particular, while the two PPOs were not able to use 6- and 7-hydroxycoumarin as substrates, they showed distinct specificity for 6,7- and 7,8-dihydroxycoumarin. Significant differences in the enzyme behavior towards common PPO inhibitors were also observed. In addition, activation energy and activation energy for denaturation were determined, showing significant differences between FP-PPO and FNP-PPO, particularly for denaturation kinetics. The possible roles of the two PPOs in determining differences in composition and toxicity of the two F. communis chemotypes are also discussed. Copyright © 2013 Elsevier Ltd. All rights reserved.

  12. Prevalence of tick-borne encephalitis virus in Ixodes ricinus ticks in northern Europe with particular reference to Southern Sweden

    Science.gov (United States)

    2014-01-01

    Background In northern Europe, the tick-borne encephalitis virus (TBEV) of the European subtype is usually transmitted to humans by the common tick Ixodes ricinus. The aims of the present study are (i) to obtain up-to-date information on the TBEV prevalence in host-seeking I. ricinus in southern and central Sweden; (ii) to compile and review all relevant published records on the prevalence of TBEV in ticks in northern Europe; and (iii) to analyse and try to explain how the TBE virus can be maintained in natural foci despite an apparently low TBEV infection prevalence in the vector population. Methods To estimate the mean minimum infection rate (MIR) of TBEV in I. ricinus in northern Europe (i.e. Denmark, Norway, Sweden and Finland) we reviewed all published TBEV prevalence data for host-seeking I. ricinus collected during 1958–2011. Moreover, we collected 2,074 nymphs and 906 adults of I. ricinus from 29 localities in Sweden during 2008. These ticks were screened for TBEV by RT-PCR. Results The MIR for TBEV in nymphal and adult I. ricinus was 0.28% for northern Europe and 0.23% for southern Sweden. The infection prevalence of TBEV was significantly lower in nymphs (0.10%) than in adult ticks (0.55%). At a well-known TBEV-endemic locality, Torö island south-east of Stockholm, the TBEV prevalence (MIR) was 0.51% in nymphs and 4.48% in adults of I. ricinus. Conclusions If the ratio of nymphs to adult ticks in the TBEV-analysed sample differs from that in the I. ricinus population in the field, the MIR obtained will not necessarily reflect the TBEV prevalence in the field. The relatively low TBEV prevalence in the potential vector population recorded in most studies may partly be due to: (i) inclusion of uninfected ticks from the ‘uninfected areas’ surrounding the TBEV endemic foci; (ii) inclusion of an unrepresentative, too large proportion of immature ticks, compared to adult ticks, in the analysed tick pools; and (iii) shortcomings in the laboratory

  13. [Patterns of morphological variability in reintroduced populations with two beaver subspecies Castor fiber orientoeuropaeus and Castor fiber belorussicus (Castoridae, Rodentia) as an example].

    Science.gov (United States)

    Korablev, N P; Korablev, P N

    2012-01-01

    Taking as an example two beaver subspecies (Castor fiber orientoeuropaeus and Castor fiber belorussicus) with documented history of population formation, the patterns of morphological variability in translocated groups of mammals are studied. The variability of quantitative and qualitative traits in the formed populations is not characterized by a single direction. The main trend consists in increasing of adaptive norms diversity as related to body size. There observed a slight increase in the level of fluctuating asymmetry, reduction in polymorphism of nonmetric traits, and increase in fraction of rare aberrations. All these may be caused by inbreeding taking place during the period of prapopulations formation. The results of the study allow for considering the intraspecific differentiation as a consequence of adaptive variability (adaptatiogenesis) or subspecies hybridization. As for stochastic processes (genetic drift, founder effect), they seem to not influence the morphological variability significantly. The differences between discrete and dimensional traits are indicative of population groups' peculiarity.

  14. Development of nine new microsatellite loci for the American beaver, Castor canadensis (Rodentia: Castoridae), and cross-species amplification in the European beaver, Castor fiber.

    Science.gov (United States)

    Pelz-Serrano, Karla; Munguia-Vega, Adrian; Piaggio, Antoinette J; Neubaum, Melissa; Munclinger, Pavel; Pártl, Adam; VAN Riper Iii, Charles; Culver, Melanie

    2009-03-01

    We developed nine new nuclear dinucleotide microsatellite loci for Castor canadensis. All loci were polymorphic, except for one. The number of alleles ranged from two to four and from five to 12 in populations from Arizona and Wisconsin, respectively. Average heterozygosity ranged from 0.13 to 0.86 per locus. Since cross-species amplification in Castor fiber was successful only in four loci, we tested also nine recently published C. canadensis loci in the Eurasian species. Eight of the published loci amplified; however, three were monomorphic. The number of alleles was lower in C. fiber than in C. canadensis at all loci tested. © 2009 The Authors. Journal compilation © 2009 Blackwell Publishing Ltd.

  15. Infections and Coinfections of Questing Ixodes ricinus Ticks by Emerging Zoonotic Pathogens in Western Switzerland

    Science.gov (United States)

    Lommano, Elena; Bertaiola, Luce; Dupasquier, Christèle

    2012-01-01

    In Europe, Ixodes ricinus is the vector of many pathogens of medical and veterinary relevance, among them Borrelia burgdorferi sensu lato and tick-borne encephalitis virus, which have been the subject of numerous investigations. Less is known about the occurrence of emerging tick-borne pathogens like Rickettsia spp., Babesia spp., “Candidatus Neoehrlichia mikurensis,” and Anaplasma phagocytophilum in questing ticks. In this study, questing nymph and adult I. ricinus ticks were collected at 11 sites located in Western Switzerland. A total of 1,476 ticks were analyzed individually for the simultaneous presence of B. burgdorferi sensu lato, Rickettsia spp., Babesia spp., “Candidatus Neoehrlichia mikurensis,” and A. phagocytophilum. B. burgdorferi sensu lato, Rickettsia spp., and “Candidatus Neoehrlichia mikurensis” were detected in ticks at all sites with global prevalences of 22.5%, 10.2%, and 6.4%, respectively. Babesia- and A. phagocytophilum-infected ticks showed a more restricted geographic distribution, and their prevalences were lower (1.9% and 1.5%, respectively). Species rarely reported in Switzerland, like Borrelia spielmanii, Borrelia lusitaniae, and Rickettsia monacensis, were identified. Infections with more than one pathogenic species, involving mostly Borrelia spp. and Rickettsia helvetica, were detected in 19.6% of infected ticks. Globally, 34.2% of ticks were infected with at least one pathogen. The diversity of tick-borne pathogens detected in I. ricinus in this study and the frequency of coinfections underline the need to take them seriously into consideration when evaluating the risks of infection following a tick bite. PMID:22522688

  16. Uptake and incorporation of sialic acid by the tick Ixodes ricinus

    Czech Academy of Sciences Publication Activity Database

    Vancová, Marie; Štěrba, J.; Dupejová, Jarmila; Simonová, Z.; Nebesářová, Jana; Novotný, M. V.; Grubhoffer, Libor

    2012-01-01

    Roč. 58, č. 9 (2012), s. 1277-1287 ISSN 0022-1910 R&D Projects: GA AV ČR KJB600960906; GA ČR GA206/09/1782; GA ČR GD206/09/H026; GA MŠk(CZ) LC06009 Institutional research plan: CEZ:AV0Z60220518 Keywords : Tick * Ixodes ricinus * Sialic acid * Basement membrane * Mass spectrometry * Electron microscopy Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.379, year: 2012

  17. IrFC - An Ixodes ricinus injury-responsive molecule related to Limulus Factor C

    Czech Academy of Sciences Publication Activity Database

    Urbanová, Veronika; Hartmann, David; Grunclová, Lenka; Šíma, Radek; Flemming, Tina; Hajdušek, Ondřej; Kopáček, Petr

    2014-01-01

    Roč. 46, č. 2 (2014), s. 439-447 ISSN 0145-305X R&D Projects: GA ČR GAP506/10/2136; GA ČR GP13-27630P; GA ČR GP13-12816P; GA MŠk(CZ) EE2.3.30.0032 Institutional support: RVO:60077344 Keywords : Complement * Innate immunity * Limulus Clotting Factor C * Phagocytosis * RNA interference * Tick Ixodes ricinus Subject RIV: EC - Immunology Impact factor: 2.815, year: 2014

  18. Functional characterization of two defensin isoforms of the hard tick Ixodes ricinus

    Czech Academy of Sciences Publication Activity Database

    Chrudimská, Tereza; Slaninová, Jiřina; Rudenko, Natalia; Růžek, Daniel; Grubhoffer, Libor

    2011-01-01

    Roč. 4, č. 1 (2011), e63 ISSN 1756-3305 R&D Projects: GA MŠk(CZ) LC06009; GA ČR GA206/09/1782; GA ČR GD206/09/H026; GA ČR(CZ) GAP302/11/1901 Institutional research plan: CEZ:AV0Z60220518; CEZ:AV0Z40550506 Keywords : defensin * antimicrobial compounds * Ixodes ricinus Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.937, year: 2011

  19. Presence of potentially pathogenic Babesia sp. for human in Ixodes ricinus in Switzerland.

    Science.gov (United States)

    Casati, Simona; Sager, Heinz; Gern, Lise; Piffaretti, Jean-Claude

    2006-01-01

    We have designed and performed a new PCR method based on the 18S rRNA in order to individuate the presence and the identity of Babesia parasites. Out of 1159 Ixodes ricinus (Acari: Ixodidae) ticks collected in four areas of Switzerland, nine were found to contain Babesia DNA. Sequencing of the short amplicon obtained (411-452 bp) allowed the identification of three human pathogenic species: Babesia microti, B. divergens, for the first time in Switzerland, Babesia sp. EU1. We also report coinfections with B. sp. EU1-Borrelia burgdorferi sensu stricto and Babesia sp. EU1-B. afzelii.

  20. Component composition of essential oils and ultrastructure of secretory cells of resin channel needles Juniperus communis (Cupressaceae

    Directory of Open Access Journals (Sweden)

    N. V. Gerling

    2015-12-01

    Full Text Available The results of determining the qualitative and quantitative composition of essential oil Juniperus communis, growing under the canopy of spruce blueberry sphagnum subzone middle taiga. Juniperus communis essential oil is liquid light yellow color. The content of essential oil was 0.46 % in shoots with needles. 37 substances of components identified. Mass fraction of components in the essential oil of Juniperus communis reached 89 %. The highest percentage of occupied fraction of monoterpenes (82.3 %, the proportion of sesquiterpenes less than 0.5 % of the total composition of essential oils, alcohols 3.5 and 0.7 % esters. In monoterpenes fraction predominant α-pinene (24.5–32.6 %, β-pinene (15–20.3 % and α-phellandrene (6.4–8.8 %. Essential oil of Juniperus communis is characterized by high content of monoterpenoids in contrast to other conifers of the taiga zone. All stages of biosynthesis essential oils occur in the epithelial cells of the resin channel (terpenoidogennyh cells. An oval shape have epithelial cells of the resin channel needles in transverse sections the Juniperus communis, which is situated vacuole in the center. Large number of lipid globules (up to 40 noted in the hyaloplasm of explored cells. Leucoplasts surrounded by membranes of smooth endoplasmic reticulum in cross sections of epithelial cells in resin channel of juniper. Endoplasmic reticulum is poorly developed in epithelial cells, which corresponds to the low content of sesquiterpenes in the needles during the study period. Development of large leucoplasts and large number of mitochondria associated with predominance of synthesis monoterpenoids the in the epithelium cells resin channel.