WorldWideScience

Sample records for castor ricinus communis

  1. CastorDB: a comprehensive knowledge base for Ricinus communis

    Directory of Open Access Journals (Sweden)

    Chattoo Bharat B

    2011-09-01

    Full Text Available Abstract Background Ricinus communis is an industrially important non-edible oil seed crop, native to tropical and subtropical regions of the world. Although, R. communis genome was assembled in 4X draft by JCVI, and is predicted to contain 31,221 proteins, the function of most of the genes remains to be elucidated. A large amount of information of different aspects of the biology of R. communis is available, but most of the data are scattered one not easily accessible. Therefore a comprehensive resource on Castor, Castor DB, is required to facilitate research on this important plant. Findings CastorDB is a specialized and comprehensive database for the oil seed plant R. communis, integrating information from several diverse resources. CastorDB contains information on gene and protein sequences, gene expression and gene ontology annotation of protein sequences obtained from a variety of repositories, as primary data. In addition, computational analysis was used to predict cellular localization, domains, pathways, protein-protein interactions, sumoylation sites and biochemical properties and has been included as derived data. This database has an intuitive user interface that prompts the user to explore various possible information resources available on a given gene or a protein. Conclusion CastorDB provides a user friendly comprehensive resource on castor with particular emphasis on its genome, transcriptome, and proteome and on protein domains, pathways, protein localization, presence of sumoylation sites, expression data and protein interacting partners.

  2. Effect of copper on castor bean (Ricinus communis L.) growth

    Energy Technology Data Exchange (ETDEWEB)

    Chaves, Lucia Helena Garofalo; Cunha, Tassio Cavalcanti da Silva; Lima, Vinicius Mota; Cabral, Paulo Cesar Pinto; Barros Junior, Genival; Lacerda, Rogerio Dantas de [Universidade Federal de Campina Grande (UAEAg/UFCG), PB (Brazil). Unidade Academica de Engenharia Agricola

    2008-07-01

    Castor beans crop (Ricinus communis L.) is raising attention as an alternative crop for oil and biodiesel production. Despite the mineral fertilization is an important factor for increasing castor yield, few research has been made on this issue, mainly on the use de copper. In order to evaluate the effects of copper on growth of this plant an experiment was carried out in a greenhouse, in Campina Grande, Paraiba State, Brazil, from July to December 2007. The substrate for the pot plants was a 6 mm-sieved surface soil (Neossolo Quartzarenico). The experimental design was a completely randomized with three replications. The treatments were composed of five levels of Cu (0; 1; 2; 3 and 4 mg dm{sup -3}), which were applied at the time of planting. One plant of castor bean, cultivar BRS 188 - Paraguacu, was grown per pot after thinning and was irrigated whenever necessary. Data on plant height, number and length of leaves and stem diameter were measured at 21, 34, 77 and 103 days after planting. Copper levels used, in general, did not affect the plant height, stem diameter and leaf area, however they influenced the leaves and shoot biomass dry mass and the quadratic trend was the best to show the behavior of these. (author)

  3. Expression profile of the genes involved in reserve synthesis in castor (Ricinus communis L.)

    Science.gov (United States)

    Oil derived from the seed of castor (Ricinus communis L.) contains 90% ricinoleate (12-hydroxy-oleate) and has numerous industrial uses. Despite its economic importance, the production of castor oil is hampered by the presence of detrimental seed storage proteins, the toxin ricin and hyper-allergeni...

  4. Effect of glyphosate on the castor plant Ricinus communis L

    Science.gov (United States)

    The presence of a toxin in the castor seed has been a major impediment to the reintroduction of castor as a domestic crop in the US. Because dehiscent forms of castor are invasive and castor seed remains viable for years under the right conditions, there is concern that if castor were widely cultiva...

  5. Isotope labeling-based quantitative proteomics of developing seeds of castor oil seed (Ricinus communis L.)

    DEFF Research Database (Denmark)

    Nogueira, Fábio C S; Palmisano, Giuseppe; Schwämmle, Veit;

    2013-01-01

    In this study, we used a mass spectrometry-based quantification approach employing isotopic (ICPL) and isobaric (iTRAQ) labeling to investigate the pattern of protein deposition during castor oil seed (Ricinus communis L.) development, including that of proteins involved in fatty acid metabolism...... give important insights into certain aspects of the biology of castor oil seed development such as carbon flow, anabolism, and catabolism of fatty acid and the pattern of deposition of SSPs, toxins, and allergens such as ricin and 2S albumins. We also found, for the first time, some genes of SSP that...... could be mapped to extant castor gene models, considerably expanding the number of proteins so far identified from developing castor seeds. Cluster validation and statistical analysis resulted in 975 protein trend patterns and the relative abundance of 618 proteins. The results presented in this work...

  6. Gene Structures, Evolution, Classification and Expression Profiles of the Aquaporin Gene Family in Castor Bean (Ricinus communis L.)

    OpenAIRE

    Zhi Zou; Jun Gong; Qixing Huang; Yeyong Mo; Lifu Yang; Guishui Xie

    2015-01-01

    Aquaporins (AQPs) are a class of integral membrane proteins that facilitate the passive transport of water and other small solutes across biological membranes. Castor bean (Ricinus communis L., Euphobiaceae), an important non-edible oilseed crop, is widely cultivated for industrial, medicinal and cosmetic purposes. Its recently available genome provides an opportunity to analyze specific gene families. In this study, a total of 37 full-length AQP genes were identified from the castor bean gen...

  7. Effect of the organic garbage and castor oil plant pie on of crop growth characteristics of mamoneira (ricinus communis l.)

    OpenAIRE

    Márcia Maria Bezerra Guimarães; Edivan Silva Nunes Júnior; Vera Lúcia Antunes de Lima; Napoleão Esberard de Macedo Beltrão; Fabiana Xavier Costa; Francisco Ademilton Vieira Damaceno

    2009-01-01

    The main goal of this work was to evaluate the growth and development of the castor oil plant (Ricinus communis L.) submitted to the organic manuring, with castor oil plant pie and composed of organic garbage. The experiment was led at greenhouse, from October 2005 to March 2006, at Embrapa Algodão, state of Paraiba. The treatments were constituted from the addition of castor oil plant pie to the soil in the levels of 1.0; 2.0; 3.0 and 4.0 t ha-1 and organic garbage in the levels of 11.2; 22....

  8. Single nucleotide polymorphisms for assessing genetic diversity in castor bean (Ricinus communis

    Directory of Open Access Journals (Sweden)

    Rabinowicz Pablo D

    2010-01-01

    Full Text Available Abstract Background Castor bean (Ricinus communis is an agricultural crop and garden ornamental that is widely cultivated and has been introduced worldwide. Understanding population structure and the distribution of castor bean cultivars has been challenging because of limited genetic variability. We analyzed the population genetics of R. communis in a worldwide collection of plants from germplasm and from naturalized populations in Florida, U.S. To assess genetic diversity we conducted survey sequencing of the genomes of seven diverse cultivars and compared the data to a reference genome assembly of a widespread cultivar (Hale. We determined the population genetic structure of 676 samples using single nucleotide polymorphisms (SNPs at 48 loci. Results Bayesian clustering indicated five main groups worldwide and a repeated pattern of mixed genotypes in most countries. High levels of population differentiation occurred between most populations but this structure was not geographically based. Most molecular variance occurred within populations (74% followed by 22% among populations, and 4% among continents. Samples from naturalized populations in Florida indicated significant population structuring consistent with local demes. There was significant population differentiation for 56 of 78 comparisons in Florida (pairwise population ϕPT values, p Conclusion Low levels of genetic diversity and mixing of genotypes have led to minimal geographic structuring of castor bean populations worldwide. Relatively few lineages occur and these are widely distributed. Our approach of determining population genetic structure using SNPs from genome-wide comparisons constitutes a framework for high-throughput analyses of genetic diversity in plants, particularly in species with limited genetic diversity.

  9. In-vitro regeneration of castor bean (ricinus communis, L) and physic nut (jatropha curcas, L.)

    International Nuclear Information System (INIS)

    Investigations were conducted on in vitro regeneration of physic nut (Jatropha curcas, 1.) and castor bean (Ricinus communis, 1.) using zygotic embryo culture, shoot tip and meristem culture as well as somatic embryogenesis. Zygotic embryos from different stages of fruit maturity cultured on Murashige and Skoog (MS) medium supplemented with benzylaminopurine (BAP), kinetin and 2-isopentyl (2iP) produced vigorous seedlings with roots. However the optimal concentration of cytokinin for seedling development depended on the type cytokinin as well as the maturity stage of the fruit. Embryos from yellow fruits of Jatropha had the highest germination (100%) on an MS medium supplemented with 0.5 mg/L kinetin or 1 mg/L BAP while in Ricinus embryos from black fruits had the highest percentage germination (97%) on an MS medium modified with I mg/L 2iP or 0.5 or I mg/L BAP. Decrease in embryo viability especially in Jatropha as the seed matured may be due to high oil content in matured (black) fruit. Oil content in both Jatropha and Ricinus increased as the fruit matured from green to black and this may have effect on germination of zygotic embryos. In vitro culture response of shoot tip or meristem was significantly influenced by the concentration of growth regulators in the culture medium as well as the plant species. In both plant species, 2iP resulted in highest percentage shoot regeneration. The optimal concentration of 2iP was 0.5 mg/L for Ricinus shoot tip and 1.5 or 2.0 mg/L for Jatropha, indicating genotypic difference between the species. However excessive callus formation and browning in Ricinus led to the loss of all the regenerants. Shoot regeneration from meristem explants was also influenced by growth regulators with 2iP again being the best. Cultures of cotyledon and leaf lobe explants on MS medium supplemented with 2, 4-D and picloram resulted in callus induction with the exception of cotyledons obtained from black fruits. However transfer of calli onto fresh

  10. Genome-wide survey and expression profiles of the AP2/ERF family in castor bean (Ricinus communis L.)

    OpenAIRE

    Xu, Wei; Li, Fei; Ling, Lizhen; Liu, Aizhong

    2013-01-01

    Background The AP2/ERF transcription factor, one of the largest gene families in plants, plays a crucial role in the regulation of growth and development, metabolism, and responses to biotic and abiotic stresses. Castor bean (Ricinus communis L., Euphobiaceae) is one of most important non-edible oilseed crops and its seed oil is broadly used for industrial applications. The available genome provides a great chance to identify and characterize the global information on AP2/ERF transcription fa...

  11. CastorDB: a comprehensive knowledge base for Ricinus communis

    OpenAIRE

    Chattoo Bharat B; Jha Sanjay; Thakur Shalabh

    2011-01-01

    Abstract Background Ricinus communis is an industrially important non-edible oil seed crop, native to tropical and subtropical regions of the world. Although, R. communis genome was assembled in 4X draft by JCVI, and is predicted to contain 31,221 proteins, the function of most of the genes remains to be elucidated. A large amount of information of different aspects of the biology of R. communis is available, but most of the data are scattered one not easily accessible. Therefore a comprehens...

  12. Proteomic profile of the nucellus of castor bean (Ricinus communis L.) seeds during development

    DEFF Research Database (Denmark)

    Nogueira, Fábio C S; Palmisano, Giuseppe; Soares, Emanoella L; Shah, Mohibullah; Soares, Arlete A; Roepstorff, Peter; Campos, Francisco A P; Domont, Gilberto B

    2012-01-01

    In this study, we performed a proteomic analysis of nucellus from two developmental stages of Ricinus communis seeds by a GeLC-MS/MS approach, using of a high resolution orbitrap mass spectrometer, which resulted in the identification of a total of 766 proteins that were grouped into 553 protein ...

  13. Energy flow in castor bean (Ricinus communis L. production systems Fluxos de energia em sistemas de produção de mamona (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Adilson Nunes da Silva

    2010-12-01

    Full Text Available Although energy analysis is a way to evaluate the sustainability of production systems, this practice is not often used in the agribusiness. In this context, the castor bean (Ricinus communis L is an agricultural crop not yet well studied despite its great potential in the Brazilian energetic scenario. This article aimed to evaluate the productive potential of the castor bean oil, using an energetic view applied to two management systems: low (System 1 and medium (System 2 technologies. The quantification of the used material fluxes was made converting these factors in energy units. The input energy fluxes were 3,170.6 MJ ha¹ and 10,366.0 MJ ha¹ for Systems 1 and 2, respectively. The energy balance of System 1 was 11,938.2 MJ ha¹ and that of System 2 16,296.5 MJ ha¹. The net energetic gain or the energy gain over the invested energy (EROI of System 1 was 3.8 and of System 2, 2.6. Although presenting a greater energy demand and a lower EROI, System 2 had a greater energy balance, demonstrating a better viability of this cultivation system for the production of castor bean oil.A análise energética é uma forma de se avaliar a sustentabilidade de um sistema produtivo, apesar de ainda pouco utilizada no setor agropecuário. Inserida neste setor encontra-se a produção da mamoneira (Ricinus communis L., cultura ainda pouco estudada e que apresenta grande importância para o agronegócio brasileiro. Avaliou-se sob a ótica energética a produção potencial de óleo de mamona em dois sistemas de cultivo: com baixa (Sistema 1 e média (Sistema 2 tecnologias. Foi realizada a quantificação dos fluxos de materiais empregados nos dois sistemas de produção e conversão destes fatores em unidades de energia. Os fluxos de energia de entrada foram de 3.170,6 MJ ha¹ e 10.366 MJ ha¹ para os sistemas 1 e 2, respectivamente. O balanço de energia foi de 11.938,2 MJ ha¹ no sistema 1 e 16.296,5 MJ ha¹ no sistema 2. A lucratividade energética, retorno

  14. Exploiting EST databases for the development and characterization of EST-SSR markers in castor bean (Ricinus communis L.)

    OpenAIRE

    Yang Jun-Bo; Tian Bo; Yang Chun; Qiu Lijun; Liu Aizhong

    2010-01-01

    Abstract Background The castor bean (Ricinus communis L.), a monotypic species in the spurge family (Euphorbiaceae, 2n = 20), is an important non-edible oilseed crop widely cultivated in tropical, sub-tropical and temperate countries for its high economic value. Because of the high level of ricinoleic acid (over 85%) in its seed oil, the castor bean seed derivatives are often used in aviation oil, lubricants, nylon, dyes, inks, soaps, adhesive and biodiesel. Due to lack of efficient molecular...

  15. Exploiting EST databases for the development and characterization of EST-SSR markers in castor bean (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Yang Jun-Bo

    2010-12-01

    Full Text Available Abstract Background The castor bean (Ricinus communis L., a monotypic species in the spurge family (Euphorbiaceae, 2n = 20, is an important non-edible oilseed crop widely cultivated in tropical, sub-tropical and temperate countries for its high economic value. Because of the high level of ricinoleic acid (over 85% in its seed oil, the castor bean seed derivatives are often used in aviation oil, lubricants, nylon, dyes, inks, soaps, adhesive and biodiesel. Due to lack of efficient molecular markers, little is known about the population genetic diversity and the genetic relationships among castor bean germplasm. Efficient and robust molecular markers are increasingly needed for breeding and improving varieties in castor bean. The advent of modern genomics has produced large amounts of publicly available DNA sequence data. In particular, expressed sequence tags (ESTs provide valuable resources to develop gene-associated SSR markers. Results In total, 18,928 publicly available non-redundant castor bean EST sequences, representing approximately 17.03 Mb, were evaluated and 7732 SSR sites in 5,122 ESTs were identified by data mining. Castor bean exhibited considerably high frequency of EST-SSRs. We developed and characterized 118 polymorphic EST-SSR markers from 379 primer pairs flanking repeats by screening 24 castor bean samples collected from different countries. A total of 350 alleles were identified from 118 polymorphic SSR loci, ranging from 2-6 per locus (A with an average of 2.97. The EST-SSR markers developed displayed moderate gene diversity (He with an average of 0.41. Genetic relationships among 24 germplasms were investigated using the genotypes of 350 alleles, showing geographic pattern of genotypes across genetic diversity centers of castor bean. Conclusion Castor bean EST sequences exhibited considerably high frequency of SSR sites, and were rich resources for developing EST-SSR markers. These EST-SSR markers would be particularly

  16. Gene Structures, Evolution and Transcriptional Profiling of the WRKY Gene Family in Castor Bean (Ricinus communis L.).

    Science.gov (United States)

    Zou, Zhi; Yang, Lifu; Wang, Danhua; Huang, Qixing; Mo, Yeyong; Xie, Guishui

    2016-01-01

    WRKY proteins comprise one of the largest transcription factor families in plants and form key regulators of many plant processes. This study presents the characterization of 58 WRKY genes from the castor bean (Ricinus communis L., Euphorbiaceae) genome. Compared with the automatic genome annotation, one more WRKY-encoding locus was identified and 20 out of the 57 predicted gene models were manually corrected. All RcWRKY genes were shown to contain at least one intron in their coding sequences. According to the structural features of the present WRKY domains, the identified RcWRKY genes were assigned to three previously defined groups (I-III). Although castor bean underwent no recent whole-genome duplication event like physic nut (Jatropha curcas L., Euphorbiaceae), comparative genomics analysis indicated that one gene loss, one intron loss and one recent proximal duplication occurred in the RcWRKY gene family. The expression of all 58 RcWRKY genes was supported by ESTs and/or RNA sequencing reads derived from roots, leaves, flowers, seeds and endosperms. Further global expression profiles with RNA sequencing data revealed diverse expression patterns among various tissues. Results obtained from this study not only provide valuable information for future functional analysis and utilization of the castor bean WRKY genes, but also provide a useful reference to investigate the gene family expansion and evolution in Euphorbiaceus plants. PMID:26849139

  17. Gene Structures, Evolution, Classification and Expression Profiles of the Aquaporin Gene Family in Castor Bean (Ricinus communis L..

    Directory of Open Access Journals (Sweden)

    Zhi Zou

    Full Text Available Aquaporins (AQPs are a class of integral membrane proteins that facilitate the passive transport of water and other small solutes across biological membranes. Castor bean (Ricinus communis L., Euphobiaceae, an important non-edible oilseed crop, is widely cultivated for industrial, medicinal and cosmetic purposes. Its recently available genome provides an opportunity to analyze specific gene families. In this study, a total of 37 full-length AQP genes were identified from the castor bean genome, which were assigned to five subfamilies, including 10 plasma membrane intrinsic proteins (PIPs, 9 tonoplast intrinsic proteins (TIPs, 8 NOD26-like intrinsic proteins (NIPs, 6 X intrinsic proteins (XIPs and 4 small basic intrinsic proteins (SIPs on the basis of sequence similarities. Functional prediction based on the analysis of the aromatic/arginine (ar/R selectivity filter, Froger's positions and specificity-determining positions (SDPs showed a remarkable difference in substrate specificity among subfamilies. Homology analysis supported the expression of all 37 RcAQP genes in at least one of examined tissues, e.g., root, leaf, flower, seed and endosperm. Furthermore, global expression profiles with deep transcriptome sequencing data revealed diverse expression patterns among various tissues. The current study presents the first genome-wide analysis of the AQP gene family in castor bean. Results obtained from this study provide valuable information for future functional analysis and utilization.

  18. Gene Structures, Evolution, Classification and Expression Profiles of the Aquaporin Gene Family in Castor Bean (Ricinus communis L.).

    Science.gov (United States)

    Zou, Zhi; Gong, Jun; Huang, Qixing; Mo, Yeyong; Yang, Lifu; Xie, Guishui

    2015-01-01

    Aquaporins (AQPs) are a class of integral membrane proteins that facilitate the passive transport of water and other small solutes across biological membranes. Castor bean (Ricinus communis L., Euphobiaceae), an important non-edible oilseed crop, is widely cultivated for industrial, medicinal and cosmetic purposes. Its recently available genome provides an opportunity to analyze specific gene families. In this study, a total of 37 full-length AQP genes were identified from the castor bean genome, which were assigned to five subfamilies, including 10 plasma membrane intrinsic proteins (PIPs), 9 tonoplast intrinsic proteins (TIPs), 8 NOD26-like intrinsic proteins (NIPs), 6 X intrinsic proteins (XIPs) and 4 small basic intrinsic proteins (SIPs) on the basis of sequence similarities. Functional prediction based on the analysis of the aromatic/arginine (ar/R) selectivity filter, Froger's positions and specificity-determining positions (SDPs) showed a remarkable difference in substrate specificity among subfamilies. Homology analysis supported the expression of all 37 RcAQP genes in at least one of examined tissues, e.g., root, leaf, flower, seed and endosperm. Furthermore, global expression profiles with deep transcriptome sequencing data revealed diverse expression patterns among various tissues. The current study presents the first genome-wide analysis of the AQP gene family in castor bean. Results obtained from this study provide valuable information for future functional analysis and utilization. PMID:26509832

  19. Radiation and water use efficiencies of rainfed castor beans (Ricinus communis L.) in relation to different weather parameters

    International Nuclear Information System (INIS)

    Field experiments on rainfed castor beans (Ricinus communis L.) were conducted for 4 years (1990–1993) to explain the variability in radiation use efficiency (RUE) and water use efficiency (WUE) in relation to meteorological parameters. In these experiments castor c.v. Aruna was sown on three different dates (treatments) in each year. The results from this study indicate that both RUE and WUE vary from year to year and also were influenced by the planting dates. Variations in RUE and WUE ranged from 0.79–1.19 g MJ−1 and 0.72–1.25 g kg−1, respectively. The variability in RUE and WUE before and after flower initiation were quite contrasting. The variability in RUE and WUE was associated with saturation vapour pressure deficit (SVPD), drought index, temperature and wind velocity. RUE was related positively with SVPD and wind velocity and negatively with drought index and temperature. WUE showed inverse relationships with SVPD and temperature and a direct relation with wind velocity. The study emphasises the need for incorporation of the effect of weather on RUE and WUE in the algorithms for biomass estimation of crop simulation models. (author)

  20. Antibody interactions with Ricinus communis agglutinins studied by biolayer interferometry

    Science.gov (United States)

    Two related agglutinins are present in the seeds of Ricinus communis (castor): ricin, a dichain ribosome-inactivating protein and Ricinus communis agglutinin-1 (RCA-1), a much less toxic hemagglutinin. Because ricin has been used for experimental cancer chemotherapy as well as for intentional poison...

  1. Use of acid phosphatase as biomarker during the castor bean seeds germination (ricinus communis

    Directory of Open Access Journals (Sweden)

    Carmen Ferreira Veríssima

    2008-12-01

    Full Text Available One of the main oil crop of prominent social and economic importance is to mamoneira (Ricinus communis L.; with countless application in the industry and agricultural. Broadly it distributed in Brazil; his cultivation can be an alternative of sustainability in the Brazilian northeast. It know the physiological and biochemical mechanisms of the germination they are important for the best utilization of the plant. The objective of this work was use acid phosphatase as biomarker during the germination. In the rough extract occurred the dosage of the activity for pNPP; Tyr-Pi and PPi; determination of protein and inorganic phosphatse. The peak of activity for pNPP was in the seventh day; for PPi and Tyr-Pi in the ninth and for PEP in the fifth. The concentration of protein increased according to the days of germination; with peak of activity in the eighth day; being coincidental with the peaks of the activities for the substrates. The content of inorganic phosphate diminished with the time of germination and after the third day occurred a fall accentuated of its concentration. We concluded that acid phosphatase is important for the germination of the seeds and his paper is related with the mobilization of inorganic phosphate; the main nutrients for the development.

  2. Genotyping and Bioforensics of Ricinus communis

    Energy Technology Data Exchange (ETDEWEB)

    Hinckley, A C

    2006-11-20

    The castor bean plant (Ricinus communis) is a member of the family Euphorbiaceae. In spite of its common name, the castor plant is not a true bean (i.e., leguminous plants belonging to the family, Fabaceae). Ricinus communis is native to tropical Africa, but because the plant was recognized for its production of oil with many desirable properties, it has been introduced and cultivated in warm temperate regions throughout the world (Armstrong 1999 and Brown 2005). Castor bean plants have also been valued by gardeners as an ornamental plant and, historically, as a natural rodenticide. Today, escaped plants grow like weeds throughout much of the southwestern United States, and castor seeds are even widely available to the public for order through the Internet. In this study, multiple loci of chloroplast noncoding sequence data and a few nuclear noncoding regions were examined to identify DNA polymorphisms present among representatives from a geographically diverse panel of Ricinus communis cultivated varieties. The primary objectives for this research were (1) to successfully cultivate castor plants and extract sufficient yields of high quality DNA from an assortment of castor cultivated varieties, (2) to use PCR and sequencing to screen available universal oligos against a small panel of castor cultivars, (3) to identify DNA polymorphisms within the amplified regions, and (4) to evaluate these DNA polymorphisms as appropriate candidates for assay development (see Figure 1). Additional goals were to design, test and optimize assays targeting any DNA polymorphisms that were discovered and to rapidly screen many castor cultivars to determine the amount of diversity present at that particular locus. Ultimately, the goal of this study was to construct a phylogeographic tree representing the genetic relationships present among Ricinus communis cultivars from diverse geographic regions. These research objectives were designed to test the hypothesis that cultivated varieties

  3. Seed borne mycoflora of castor bean (ricinus communis l.) from pakistan

    International Nuclear Information System (INIS)

    Castor bean seeds were analyzed by using ISTA (International seed testing association) for the detection of seed borne mycoflora. Thirty one fungal species belonging to 15 genera were isolated from 12 samples of castor bean seeds collected from different areas of Pakistan. Fusarium solani, Alternaria alternata, Cephaliophora tropica were most predominant fungal species isolated while the saprophytic fungi like A. niger, A. flavus were common in all samples of castor bean seed tested. Blotter method was considered to be better technique which gave maximum number of fungi followed by agar plate and deep freezing methods. (author)

  4. Pattern of genetic diversity among Fusarium wilt resistant castor germplasm accessions (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    K. Anjani

    2010-03-01

    Full Text Available Wilt caused by Fusarium oxysporum f.sp. ricini (Wr Gordon is one of the major yield losing diseases in castor.Cultivating wilt resistant cultivars is an effective strategy to control the disease. Utilization of diverse sources ofstable resistance is a prerequisite for durable resistance breeding. The experiment was conducted to identifygenetically diverse resistant sources in castor germplasm. Genetic diversity among 20 identified wilt resistantgermplasm was assessed using multivariate classificatory methods. Wide genetic diversity was demonstratedamong these accessions. These accessions are valuable in wilt resistance breeding programme. They wouldserve as base diverse material for wilt resistance breeding, wilt resistant genepool construction and moleculartagging of resistant genes.

  5. Regiospecific analysis of diricinoleoylacylglycerols in castor (Ricinus communis L.) oil by electrospray ionization-mass spectrometry

    Science.gov (United States)

    HPLC fractions of diricinoleoyl-acyl-glycerols containing one non-ricinoleoyl chain from castor oil were used to identify the regiospecific location of this non-ricinoleoyl chain on glycerol backbone using electrospray ionization-MS3 of lithium adducts. The regiospecific ions used were from the loss...

  6. Inibição do desenvolvimento de fungos fitopatogênicos por detergente derivado de óleo da mamona (Ricinus communis The castor oil plant detergent (Ricinus communis inhibits the asexual development of phytopathogenic fungi

    Directory of Open Access Journals (Sweden)

    Eunice Hitomi Takano

    2007-10-01

    Full Text Available No presente estudo avaliou-se o efeito fungitóxico do detergente derivado do óleo da mamona (Ricinus communis sobre o desenvolvimento dos fitopatógenos: Pyricularia grisea, Fusarium graminearum e Colletotrichum lindemuthianum. Seis concentrações do detergente (12,5mL L-1 a 300mL L-1 foram, individualmente, incorporadas ao Meio Basal; a seguir, após inoculação fúngica, o crescimento radial dos micélios foi avaliado. A inibição total do desenvolvimento de C. lindemuthianum e P. grisea foi observada entre as concentrações de 50mL L-1 e 200mL L-1, respectivamente. Com base no crescimento miceliano das colônias de F. graminearum, a atividade antifúngica do detergente do óleo da mamona (DOM determinou inibição variável entre 79,4 e 91% para a raça F2 e entre 80,7 e 90,7% para a raça F4. O detergente, nas concentrações de 100 a 300mL L-1, inibiu em 100% a germinação de conídios de F. graminearum (raças F-4 e F-2. Os resultados demonstram nítida atividade antifúngica do detergente derivado do óleo da mamona sobre fitopatógenos.In the present study the fungitoxic effect of the castor oil plant detergent (Ricinus communis on the development of the phytopathogens Pyricularia grisea, Fusarium graminearum and Colletotrichum lindemuthianum was evaluated. Six concentrations of the detergent (12.5mL L-1 to 300mL L-1 had been, individually, incorporated to the Basal Medium. After fungi inoculations, the radial growth of mycelia were evaluated. Detergent at 50mL L-1 and 200mL L-1 inhibited completely the development of P. grisea and C. lindemuthianum, respectively. On the basis of the mycelial growth of F. graminearum, the fungitoxic activity of the castor oil plant detergent (DOM determined inhibition in the range of 79.4 and 91% for the F2 race and 80.7 and 90.7% for the F4 race. Detergent at the concentrations of 100mL L-1 to 300mL L-1 inhibited in 100% the F. graminearum germination conidia (races F-4 and F-2. Results

  7. Enhanced accumulation of Cd in castor (Ricinus communis L) by soil-applied chelators.

    Science.gov (United States)

    Chhajro, Muhammad Afzal; Rizwan, Muhammad Shahid; Guoyong, Huang; Jun, Zhu; Kubar, Kashif Ali; Hongqing, Hu

    2016-07-01

    Phytoextraction has been identified as one of the most propitious methods of phytoremediation. This pot experiment were treated with varying amounts of (ethylenediamine triacetic acid) EDTA 3-15, (Nitriloacetic acid) NTA 3-10, (Ammonium citrate) NH4 citrate 10 - 25 mmol and one mg kg(-1)Cd, filled with 5 kg soil. The addition of chelators significantly increased Cd concentration in soil and plant. The results showed that maximum Cd uptake was noted under root, shoot and leaf of castor plant tissue (2.26, 1.54, and 0.72 mg kg(-1)) under EDTA 15, NTA 10, and NH4 citrate 25 mmol treatments respectively, and in soil 1.08, 1.06 and 0.52 mg kg(-1) pot(-1) under NH4 citrate 25, NTA 10 and EDTA 15 mmol treatments respectively, as against to control (p EDTA 15 mmol as compared to other treatments, However, Bioconcentration factor (BCF), translocation factor (TF) and remediation factor (RF) were significantly increased under EDTA 15 and NH4 citrate 25 mmol as against control. Our results demonstrated that castor plant proved satisfactory for phytoextraction on contaminated soil, and EDTA 15 and NH4 citrate 25 mmol had the affirmative effect on the Cd uptake in the artificial Cd-contaminated soil. PMID:26588431

  8. Rhipicephalus sanguineus (Acari: Ixodidae) female ticks exposed to castor oil (Ricinus communis): an ultrastructural overview.

    Science.gov (United States)

    Sampieri, B R; Furquim, K C S; Nunes, P H; Camargo-Mathias, M I

    2013-02-01

    Tick control has been accomplished through the use of synthetic acaricides, which has created resistant individuals, as well as contaminating the environment and nontarget organisms. Substances of plant origin, such as oils and extracts of eucalyptus and neem leaves, have been researched as an alternative to replace the synthetic acaricides. Ricinoleic acid esters from castor oil have recently been shown as a promising alternative in eliminating bacterial contamination during ethanol fermentation, by acting as an effective biocide. The same positive results have been observed when these esters are added to the food given to tick-infested rabbits. This study tested the effect of these substance on the reproductive system of Rhipicephalus sanguineus females, added to rabbit food, more specifically on oogenesis. For this, four groups were established: four control groups (CG1, CG2, CG3, and CG4) and four treatment groups (TG1, TG2, TG3, and TG4) with one rabbit in each (New Zealand White), used as hosts. After full 4 days feeding (semi-engorgement), the females were collected and had their ovaries extracted. In this study, it was observed that R. sanguineus females exposed to esters had their ovaries modified, which was demonstrated through transmission electron microscopy techniques. The addition of ricinoleic esters to the diet of tick-infested rabbits revealed how toxic such substances are for the cytoplasmic organelles of oocytes and pedicel cells. These compounds can change the morphophysiology of germ and somatic cells, consequently influencing their viability and, therefore, confirming that the ricinoleic acid esters from castor oil are a promising substance in the control of R. sanguineus. PMID:23086445

  9. Polyurethane resins derived from castor oil (Ricinus communis) for tibial crest deviation in dogs

    International Nuclear Information System (INIS)

    Medial patellar luxation is one of the most common orthopedic problems in small breeds of dogs and tibial crest deviation is a frequent accompaining anatomical abnormality. For that reason, the purpose of this study was to evaluate the behavior of castor oil derived polyurethane implants when apllied to experimental defects created on the medial side of the proximal tibia of normal puppies. Twelve dogs were randomly divided in 3 groups of 4 animals and were submitted to the same treatment. Histopathological study was performed respectively at 30 (GI), 60 (GII) and 90 (GIII) days post-surgery. Evaluations methods included clinical assessment, radiology, gross and macroscopic study, tomography and statistical analysis. Clinically, there were no signs of implant rejection. Radiology revealed intense periosteal reaction and new bone formation. On gross examination, there was thickening and lateral deviation of the tibial crest and new bone neoformation. On microscopic examination, there was fibrous tissue around the polyurethane, periosteal proliferation on the medial side of the tibia and no bone proliferation towards the implant. Cat scans reveled lateral deviation of the tibial crest in eleven animals, which was statistically significant (p<5; pared T test)

  10. Heterosis and inbreeding depression for seed yield and its component traits in castor (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Singh A. P., Mehta D. R. and Desale C. S.

    2013-06-01

    Full Text Available The present investigation was undertaken with a view to generate genetic information on heterosis and inbreeding depression for seed yield and its component traits. The heterosis over better parent was found significant in desirable direction for number of capsules on main raceme in JP 96 x JI 368; for length of main raceme, effective length of main raceme and number of capsules on main raceme in cross JP 96 x JI 372; and for oil content in cross JP 101 x SKI 215. Inbreeding depression was observed significant for shelling outturn, seed yield per plant and 100-seed weight in JP 96 x JI 368; for length and effective length of main raceme, number of capsules per plant and oil content in cross JP 96 x JI 372; and for days to maturity, plant height, number of nodes and 100-seed weight in cross JP 101 x SKI 215. In majority of cases, a close agreement was seen between the observed and the expected values of relative heterosis, heterobeltiosis and inbreeding depression in all the three castor crossses with few exemptions

  11. Balanço energético para a produção de biodiesel pela cultura da mamona (Ricinus communis L. Energy balance for biodiesel production by the castor bean crop (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Rodolfo Glauber Chechetto

    2010-12-01

    Full Text Available A cultura da mamona (Ricinus communis L. adquiriu prestígio ao interesse da indústria pela qualidade de seu óleo e, recentemente, pela busca de novas fontes de energias. O experimento que serviu como base para os dados utilizados nesse trabalho foi realizado na Fazenda Experimental Lageado, FCA - UNESP, no município de Botucatu - SP, no ano de 2008. O objetivo deste trabalho foi avaliar a viabilidade energética da cultura através do balanço e da eficiência energética, desde a implantação até a produção de biodiesel, utilizando parâmetros de consumo operacional no manejo para instalação e manutenção da cultura, colheita e processamento de óleo. As operações de manejo de solo, semeadura e colheita consumiramo total de 266,20 MJ ha-1, que juntamente com fertilizantes, agrotóxicos, combustíveis e lubrificantes, mão-de-obra, sementes e processamento industrial totalizaram uma entrada de energia de 56.808,10 MJ ha-1. A produção de energia foi de 72.814,00 MJ ha-1. O setor ainda carece de estudos que contribuiriam para o levantamento de dados e coeficientes energéticos mais específicos. A cultura da mamona foi considerada eficiente, permitindo ganho de 15.983,44 MJ ha-1, equivalente a aproximadamente 415 L de óleo diesel.The castor bean crop (Ricinus communis L. has acquired prestige due to industries interest in the oil quality and recently for new sources of energy demand. The experiment that served as basis for the data used in this study was conducted at the Lageado Experimental Farm, in Botucatu - SP, 2008. This study aimed to avaluate the crop viability through energy balance and energy efficiency since the implantation until biodiesel production using parameters of consumption in operational management for installation and maintenance of culture harvest and oil production. The soil management operations, sow and harvest consumed the total of 266.20 MJ ha-1, gathering with the fertilizers, pesticides, fuels

  12. Semeadura do híbrido Lyra de mamona (Ricinus communis L. sob plantio direto Seeding of castor bean (Ricinus communis L. hybrid Lyra in no-tillage system

    Directory of Open Access Journals (Sweden)

    Nilza Patrícia Ramos

    2008-04-01

    Full Text Available A semeadura mecanizada da mamona (Ricinus communis L. pode reduzir o tempo de operação e os custos associados à mão-de-obra, porém a escassez de informações nesta área tem prejudicado a adoção correta desta tecnologia. Assim, objetivou-se com esse trabalho verificar a regularidade da distribuição longitudinal de sementes do híbrido Lyra de mamona, em área de plantio direto e sua relação com rendimento de grãos; bem como a viabilidade da aplicação de cartas de controle para a avaliação do processo de semeadura, nesta cultura. O ensaio foi conduzido em área comercial de produção de grãos de mamona sob plantio direto, sendo avaliadas: distribuição longitudinal, porcentagens de espaçamentos normais, falhos e duplos na linha, número de planta por metro linear, altura de plantas, altura e comprimento do racemo primário e rendimento de grãos. Utilizou-se a estatística descritiva, a análise de correlações e as cartas de controle para a avaliação dos parâmetros propostos. Há necessidade de refinamento nas regulagens de semeadoras-adubadoras de precisão para a semeadura do híbrido Lyra de mamona, em áreas de plantio direto; a distribuição longitudinal de sementes de mamona influencia vários parâmetros fitotécnicos, incluindo o rendimento de grãos; a aplicação da carta de controle é uma ferramenta eficiente para a avaliação do processo de semeadura da mamona.The mechanized sowing of castor bean (Ricinus communis L. can reduce the operation time and the costs associated to labor, however the privation of information in this area have damaged the correct adoption of this technology. Thus, the research had as an aim to verify the regularity of longitudinal distribution of hybrid Lyra castor bean seeds, in a no-tillage system area, and its relationship with yield; and the viability of control charts for evaluation of sowing in this crop. The essay was carded out in a commercial area of grain production in no

  13. High light exposure on seed coat increases lipid accumulation in seeds of castor bean (Ricinus communis L.), a nongreen oilseed crop.

    Science.gov (United States)

    Zhang, Yang; Mulpuri, Sujatha; Liu, Aizhong

    2016-05-01

    Little was known on how sunlight affects the seed metabolism in nongreen seeds. Castor bean (Ricinus communis L.) is a typical nongreen oilseed crop and its seed oil is an important feedstock in industry. In this study, photosynthetic activity of seed coat tissues of castor bean in natural conditions was evaluated in comparison to shaded conditions. Our results indicate that exposure to high light enhances photosynthetic activity in seed coats and consequently increases oil accumulation. Consistent results were also reached using cultured seeds. High-throughput RNA-Seq analyses further revealed that genes involved in photosynthesis and carbon conversion in both the Calvin-Benson cycle and malate transport were differentially expressed between seeds cultured under light and dark conditions, implying several venues potentially contributing to light-enhanced lipid accumulation such as increased reducing power and CO2 refixation which underlie the overall lipid biosynthesis. This study demonstrated the effects of light exposure on oil accumulation in nongreen oilseeds and greatly expands our understanding of the physiological roles that light may play during seed development in nongreen oilseeds. Essentially, our studies suggest that potential exists to enhance castor oil yield through increasing exposure of the inflorescences to sunlight either by genetically changing the plant architecture (smart canopy) or its growing environment. PMID:26589321

  14. Eficiência da seleção recorrente para redução da estatura de plantas em mamoneira (Ricinus communis L. Recurrent selection efficiency for stature reduction of castor bean (Ricinus communis L. plants

    Directory of Open Access Journals (Sweden)

    Inocencio Junior de Oliveira

    2008-08-01

    Full Text Available Realizou-se, o presente trabalho, com o objetivo de avaliar a eficiência da seleção recorrente para a redução da estatura de plantas de mamona da cultivar Guarani (Ricinus communis L., tornando-a com porte adequado para facilitar a colheita manual e/ou mecânica. Foram realizados quatro ciclos de seleção recorrente com a utilização de progênies autofecundadas na cultivar Guarani para redução da estatura das plantas, nas condições edafoclimáticas dos municípios de São Manuel - SP, Botucatu - SP e Penápolis - SP. As avaliações de estatura das plantas e de produtividade de grãos (kg.ha-1, dos quatro ciclos de seleção e do ciclo original foram realizadas nos municípios de São Manuel - SP, Botucatu - SP e Penápolis - SP na safra 2005/2006, sob um delineamento de blocos casualizados com cinco repetições e parcela útil de 30 m². A análise de variância para as características avaliadas foi feita separadamente para cada local e conjuntamente para os três locais e, posteriormente, realizada a comparação das médias pelo teste de Tukey, a 5%. Foram estimados, para as três localidades, por análise de regressão, os ganhos genéticos dos quatros ciclos de seleção para estatura de plantas. A partir dos resultados obtidos pôde-se concluir que a seleção recorrente foi eficiente para a redução da estatura de plantas e que a cultivar de mamona Guarani apresenta variabilidade genética para essa característica e que a produtividade não foi influenciada pela redução da estatura de plantas.The aim of this work was to evaluate the recurrent selection efficiency for reduction of stature of the castor bean plants of the Guarani cultivar (Ricinus communis L., turning it with appropriate strucuture to facilitate the manual and/or mechanic harvest. Four cycles of recurrent selection were accomplished through the utilization of self-pollinated progenies in the Guarani cultivar for reduction of plants stature, in

  15. Irrigation of Castor Bean (Ricinus communis L. and Sunflower (Helianthus annus L. Plant Species with Municipal Wastewater Effluent: Impacts on Soil Properties and Seed Yield

    Directory of Open Access Journals (Sweden)

    Vasileios A. Tzanakakis

    2011-11-01

    Full Text Available The effects of plant species (castor bean (Ricinus communis L. versus sunflower (Helianthus annus L. and irrigation regime (freshwater versus secondary treated municipal wastewater on soil properties and on seed and biodiesel yield were studied in a three year pot trial. Plant species were irrigated at rates according to their water requirements with either freshwater or wastewater effluent. Pots irrigated with freshwater received commercial fertilizer, containing N, P, and K, applied at the beginning of each irrigation period. The results obtained in this study showed that irrigation with effluent did not result in significant changes in soil pH, soil organic matter (SOM, total kjeldahl nitrogen (TKN, and dehydrogenase activity, whereas soil available P was found to increase in the upper soil layer. Soil salinity varied slightly throughout the experiment in effluent irrigated pots but no change was detected at the end of the experiment compared to the initial value, suggesting sufficient salt leaching. Pots irrigated with effluent had higher soil salinity, P, and dehydrogenase activity but lower SOM and TKN than freshwater irrigated pots. Sunflower showed greater SOM and TKN values than castor bean suggesting differences between plant species in the microorganisms carrying out C and N mineralization in the soil. Plant species irrigated with freshwater achieved higher seed yield compared to those irrigated with effluent probably reflecting the lower level of soil salinity in freshwater irrigated pots. Castor bean achieved greater seed yield than sunflower. Biodiesel production followed the pattern of seed yield. The findings of this study suggest that wastewater effluent can constitute an important source of irrigation water and nutrients for bioenergy crop cultivations with minor adverse impacts on soil properties and seed yield. Plant species play an important role with regard to the changes in soil properties and to the related factors of

  16. IDENTIFICATION OF CASTOR (RICINUS COMMUNIS L. ECOTYPES THROUGH MOLECULAR CHARACTERIZATION IN THE SELECTED REGIONS OF THE WESTERN GHATS OF KARNATAKA, INDIA

    Directory of Open Access Journals (Sweden)

    KG Manjunath and B Sannappa*

    2014-10-01

    Full Text Available Castor (Ricinus communis L. being a perennial crop widely grown for oil seed production in tropical and sub-tropical regions of the world.  Nevertheless, the leaf of castor serves as a primary food for the eri silkworm, Samia cynthia ricini Boisduval. Eri silkworm being a polyvoltine requires leaf throughout the year for its survival and cocoon production. Keeping this in view, an attempt has been made to identify (through molecular characterization the best castor ecotype(s found in different regions of Western Ghats of Karnataka, India for leaf production. The ecotypes were processed through DNA sequencing using ITS4 and ITS5 primers. The sequence results were authenticated through National Centre for Biotechnology Information by way of obtaining accession numbers (phylogenetic tree. Further, leaf samples were subjected to SDS-PAGE to know the variations existed among the ecotypes in protein profile. The results revealed that, ecotypes of different regions exhibits close relation among them and some marginal variations were evident in phylogenetic tree as well as in dendrogram. However, phylogenetic relationship of ecotypes in the major clade II and cluster III showed similar in both phylogeny and dendrogram for eight among 12 ecotypes representing different agro-ecological regions of Western Ghats of Karnataka.  Further, five ecotypes showed close relationship in both phylogenetic as well as in cluster dendrogram, but in clades I and III, bootstrap values showed minor variation among the ecotypes representing different regions of the Western Ghats. Whereas, in protein profile clusters I and II showed similarities between the ecotypes having genetic distance of 0.57. The maximum of 18 protein bands were found in KJ130046 ecotype, accordingly, minimum bands (10 were noticed in both KJ000404 and KJ000405 ecotypes.

  17. Life history of Neoseiulus californicus (McGregor, 1954) (Acari: Phytoseiidae) fed with castor bean (Ricinus communis L.) pollen in laboratory conditions.

    Science.gov (United States)

    Marafeli, P P; Reis, P R; Silveira, E C da; Souza-Pimentel, G C; de Toledo, M A

    2014-08-01

    The predatory mite, Neoseiulus californicus (McGregor, 1954) (Acari: Phytoseiidae) is one of the principal natural enemies of tetranychid mites in several countries, promoting efficient control of those mites in several food and ornamental crops. Pest attacks such as that of the spider mite, Tetranychus urticae Koch, 1836 (Acari: Tetranychidae), is one of the problems faced by farmers, especially in the greenhouse, due to the difficulty of its control with the use of chemicals because of the development of fast resistance making it hard to control it. The objective of this work was to study the life history of the predatory mite N. californicus as a contribution to its mass laboratory rearing, having castor bean plant [Ricinus communis L. (Euphorbiaceae)] pollen as food, for its subsequent use as a natural enemy of T. urticae on a cultivation of greenhouse rosebushes. The studies were carried out in the laboratory, at 25 ± 2°C of temperature, 70 ± 10% RH and a 14 hour photophase. The biological aspects and the fertility life table were appraised. Longevity of 32.9 days was verified for adult females and 40.4 days for males. The intrinsic rate of increase (rm) was 0.2 and the mean generation time (T) was 17.2 days. The population doubled every 4.1 days. The results obtained were similar to those in which the predatory mite N. californicus fed on T. urticae. PMID:25296220

  18. Identification of acylglycerols containing dihydroxy fatty acids in castor (Ricinus communis L.)oil by mass spectrometry

    Science.gov (United States)

    Ricinoleate, a monohydroxy fatty acid, in castor oil has many industrial uses. Dihydroxy fatty acids can also be used in industry. The C18 HPLC fractions of castor oil were used for mass spectrometry to identify the acylglycerols containing dihydroxy fatty acids. Four diacylglycerols identified were...

  19. Evaluation of Drought Stress and Foliar Chitosan on Biochemical Characterices of Castor Bean (Ricinus communis L.)

    OpenAIRE

    Hassan Makarian; Jafar Masoud Sinaki; Hossein Abbaspour; Sara Karimi

    2012-01-01

    Drought is the most significant factor restricting plant production on majority of agricultural fields of the world. In order to study the effects of drought stress and chitosan foliar on antioxidant enzymes and proline content of three castor bean cultivars under field conditions. The results showed that with an increase in the intensity of drought stress on castor bean cultivars there was a increased CAT, POD enzymes activity. That highest CAT activity related to drought stress levels (D2, ...

  20. Characterization of a pollen-specific and desiccation-associated AP2/ERF type transcription factor gene from castor bean (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Thaís de Moura Cipriano

    2013-09-01

    Full Text Available DREB transcription factors (TF belong to the superfamily of AP2/ERF and their involvement in protein-protein interactions and DNA binding has been proposed. AP2/ERF proteins have important functions in the transcriptional regulation of a variety of biological processes related to growth and development, as well as various responses to environmental stimuli, regulating expression of plant biotic and abiotic stress-responsive genes. In this study an AP2/ERF TF gene (named RcDREB1 was isolated from castor bean (Ricinus communis L. and its expression was analyzed in developing seeds, leaves, ovules, stems and petals of plants cultivated under field conditions. Transcripts were only observed in pollen grains, peaking during anthesis. The RcDREB1 deduced amino acid sequence was compared to other AP2/ERF TF proteins and presented 38-78% identity. Phylogenetic analysis classified it as a member of the CBF/DREB subfamily, rooting with the subgroup A-5. The RcDREB1 promoter was fused to the gus reporter gene and used to transform tobacco. Transgenic plants were exposed to various abiotic stress treatments (low and high tempera- tures, drought, salinity and exogenous ABA and no detectable GUS expression was observed, suggesting that the RcDREB1 promoter is not active under tested conditions. In silico analyses revealed the presence of three copies of the regulatory late pollen-specific element (AGAAA in the RcDREB1 5 ́-region. Interestingly, GUS expression was only observed in pollen grains, starting when the flower opened and initiating the senescence process; at this point, desiccated mature pollen grains are released from anthers. In addition, dehydrated developing pollen grains also expressed the gus gene. This is the first study on a DREB gene presenting pollen-specific expression.

  1. Exogenous glutamine increases lipid accumulation in developing seeds of castor bean (Ricinus communis L. cultured in vitro

    Directory of Open Access Journals (Sweden)

    Zhang Yang

    2015-01-01

    Full Text Available This report describes biomass production and compositional changes of developing castor seeds in response to change in the nitrogen resource (glutamine of the medium. During the early developmental period (24-36 days after pollination, oil was found to initially accumulate in the developing seeds. Carbohydrates and oil were inversely related after glutamine provision (35 mM, in the culture medium. [U-14C] sucrose labeling was used to investigate the effect of metabolic fluxes among different storage materials. Addition of glutamine led to a 7% increase of labeling in lipids and an inverse decrease of labeling in carbohydrates. It was postulated that changes in the glutamine concentration in the medium are likely to influence the partitioning of resources between the various storage products, especially carbohydrates and oil. These observations will contribute to a better understanding of assimilate partitioning in developing castor seeds and the development of molecular strategies to improve castor bean seed quality and plant breeding studies.

  2. A review of nutritional and toxicological implications of castor bean (Ricinus communis L.) meal in animal feeding systems.

    Science.gov (United States)

    Akande, T O; Odunsi, A A; Akinfala, E O

    2016-04-01

    The nutrient-rich defatted castor meal has been tested as a potential source of protein in diets of many livestock species but has limitation due to challenges of toxins. This review was conducted to compile the relevant research information on advances in the use of raw and differently processed castor seed meal in animal feed. In this article, distribution and uses of castor and its products were identified. Research findings on the nutrients profile, principal toxins, various detoxification strategies, nutritional value and toxicity on common livestock species were compiled and reviewed. The defatted seed meal had crude protein range of 32-48%, gross energy of about 3200 kcal/kg. Ricin content was 9.3 mg/g seed, and the average RCA content was 9.9 mg/g. The meal had high activity of lectin, which produced agglutination at about 4.70 mg/ml minimum assays. Reports of detoxification strategies showed varying degrees of success but high pH, moist heating and microbial techniques appeared to exert greater effect on deactivating ricin. Detoxification strategy for the allergen component is inconclusive. Tannins and the phenolic contents were present at trace level and did not constitute notable threat. It was concluded that castor seed holds great potential as feedstuff when upgraded but such upgrading must be safe, cost-effective and labour efficient for commercial acceptability. PMID:26150062

  3. Exogenous glutamine increases lipid accumulation in developing seeds of castor bean (Ricinus communis L.) cultured in vitro

    OpenAIRE

    Zhang Yang; Mulpuri Sujatha; Liu Aizhong

    2015-01-01

    This report describes biomass production and compositional changes of developing castor seeds in response to change in the nitrogen resource (glutamine) of the medium. During the early developmental period (24-36 days after pollination), oil was found to initially accumulate in the developing seeds. Carbohydrates and oil were inversely related after glutamine provision (35 mM, in the culture medium). [U-14C] sucrose labeling was used to investigate the effe...

  4. HETEROSIS AND COMBINING ABILITY FOR YIELD AND YIELD COMPONENT CHARACTERS OF NEWLY DEVELOPED CASTOR (RICINUS COMMUNIS L. HYBRID

    Directory of Open Access Journals (Sweden)

    M RAMESH

    2013-12-01

    Full Text Available The estimates of the components of genetic variation were worked out by Kempthorne method from a Line x Tester analysis in castor for fourteen plant type related traits. The analysis for combining ability revealed significant mean sum of squares of both general combining ability (GCA and specific combining ability (SCA for all the characters which indicated the presence of both additive and non-additive gene actions. The ratio of GCA variance and SCA variance ratio revealed the predominance of non-additive gene action for all the traits except plant height up to primary spike, no. of nodes up to primary spike, no. of capsules/primary spike and total spike length of secondary. JP-87 was good general combiner for most of the characters including seed yield. The line DCS-106 was also a good general combiner for early flowering, days to maturity and number of capsules on secondary spike. Cross JP-87 × RG-1740/A was a good specific combiner for seed yield per plant and for other yield component. The hybrid DPC-9 × RG-156 with good specific combining ability for days to maturity can be used for yield improvement in castor. In general for yield and other yield attributing traits the promising hybrids with high heterosis were JP-87 × RG-1740/A, JP-87 × DCS-106, DPC-17 × RG-156, DPC-17 × DCS-106 and DPC-17 × DCS-107 were on par with the check. These cross combinations could be utilized for further use in breeding programme for improvement in yield of castor.

  5. Phytochemical and Pharmacological Investigations of Ricinus communis Linn.

    Directory of Open Access Journals (Sweden)

    Ram Singh

    2015-01-01

    Full Text Available Medicinal plants have always played a vital role for the healthy human life. The family Euphorbiaceous is a family of flowering plants and contains nearly about 300 genera and 7,500 species. Amongst all, the species Ricinus communis or castor plant has high traditional and modern medicinal values. The individual parts of the plant like the seed, seed oil, leaves and the roots showed their importance in pharmacology. Traditionally, the plant has been used for the treatment of various diseases in traditional or folk remedies throughout the world. In modern pharmacology, this plant is reported to possess antioxidant, anti-inflammatory, anti-diabetic, central analgesic, antitumor, anti-nociceptive, antiasthmatic activity and other medicinal properties. These activities of the plant are due to the presence of important phytochemical constituents like flavonoids, glycosides, alkaloids, steroids, terpenoids etc. The aim of present article is to explore the chemical constituents, their structures and medicinal importance of Ricinus communis.

  6. Use of gamma rays for development of leaf hopper resistant pistillate lines in castor (Ricinus communis L.)

    International Nuclear Information System (INIS)

    A non revertant stable pistillate line -DPC 9 of castor was developed at Directorate of Oilseeds Research, Hyderabad. It is resistant to a major biotic stress like soil borne Fusarium wilt but susceptible to the incidence of leaf hopper - Empoasca flavescenes (Fabr). Resistance to leaf hopper is linked to presence of waxy coating called bloom on plant parts which is a highly heritable character and controlled by dominant, single to oligogenes. Castor is a sexually polymorphic species and pistillate character in S type is controlled by dominant and epistatic factors. Mutation breeding is resorted to strike a balance between a complex character like non revertant pistillate expression and a simply inherited character like presence of bloom. Seeds of DPC 9 were treated with different doses of gamma rays starting from 400, 450, 500, 550 and 600 Gy rays in 2001. Observations recorded on germination (%), hypocotyl length and root length in 50 seedlings of 15 day age, grown under pot culture conditions indicated that 600Gy gamma rays resulted in 25-30% reduction in these parameters. Three hundred M1 plants of 550Gy gamma ray treated lot were raised in Rabi season, 2002-03 at a spacing of 90 x 45 cm and continued up to 6th to 7th order of spike for selection of stable pistillate expression and selfed. Plant to row progenies were continued in M2 and selection for pistillate expression continued up to M5 in Rabi season every year. Break down of resistance to Fusarium wilt was observed in M3 and majority of the plant progenies succumbed to wilt under filed conditions of the inoculum. In M5, DPC 9 plants with the presence of bloom on all parts (triple bloom), stem and lower side of the leaf (double bloom) were observed and advanced to M6. In M6, DPC 9 pistillate plants with triple bloom and high intensity of bloom on older leaves were identified. The pistillate line is under stabilization for its presence of bloom and stable pistillate character. Selection criteria in the

  7. Ricinus communis Intoxications in Human and Veterinary Medicine—A Summary of Real Cases

    Directory of Open Access Journals (Sweden)

    Martin Schaer

    2011-10-01

    Full Text Available Accidental and intended Ricinus communis intoxications in humans and animals have been known for centuries but the causative agent remained elusive until 1888 when Stillmark attributed the toxicity to the lectin ricin. Ricinus communis is grown worldwide on an industrial scale for the production of castor oil. As by-product in castor oil production ricin is mass produced above 1 million tons per year. On the basis of its availability, toxicity, ease of preparation and the current lack of medical countermeasures, ricin has gained attention as potential biological warfare agent. The seeds also contain the less toxic, but highly homologous Ricinus communis agglutinin and the alkaloid ricinine, and especially the latter can be used to track intoxications. After oil extraction and detoxification, the defatted press cake is used as organic fertilizer and as low-value feed. In this context there have been sporadic reports from different countries describing animal intoxications after uptake of obviously insufficiently detoxified fertilizer. Observations in Germany over several years, however, have led us to speculate that the detoxification process is not always performed thoroughly and controlled, calling for international regulations which clearly state a ricin threshold in fertilizer. In this review we summarize knowledge on intended and unintended poisoning with ricin or castor seeds both in humans and animals, with a particular emphasis on intoxications due to improperly detoxified castor bean meal and forensic analysis.

  8. Development of a bioassay to quantify the ricin toxin content of castor bean (Ricinus communis L. seeds=Desenvolvimento de um bioensaio para quantificar o teor da toxina ricina em sementes de mamona (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Dick Auld

    2012-10-01

    Full Text Available In this study, we developed a bioassay to quantify the ricin toxin content of castor bean seeds. Existing quantification methods do not always reflect actual toxicity of the seeds analyzed, which may present lower ricin content even though they are more toxic than seeds presenting a higher content of ricin. This is because these methods actually measure the addition of ricin RCA, which is a compound less toxic than pure ricin. We decided to use in this study, the nematode Caenorhabditis elegans, which has been widely used by the pharmaceutical industry. We tested two strains of C. elegans using different methods in 8 experiments. We examined 4 methods of extracting the ricin complex and 3 methods of exposing the nematodes. Among the nematode strains and ricin extraction methods tested, we concluded that the best strain for testing ricin toxicity was the strain called N2 and that the best method for ricin extraction was a rotating bath followed by centrifugation and exposing the nematodes in 24 well plates with a solution of nematodes extracted from the media with destilated waterexposing the nematodes in 24-well plates This method is inexpensive, quick and adequate for the selection of offspring with lower RIP content.Foi desenvolvido um bioensaio para quantificar o teor de ricina nas sementes de mamona. Os métodos de quantificação existentes não refletem a toxidez real das sementes analizadas, que pode mostrar um resultado de menor teor de ricina e ainda assim ser mais toxico do que as sementes que apresentaram teores maiores. Isto ocorre por que estes métodos medem alem da ricina a RCA, que é um composto menos tóxico que a ricina pura. Foi decidido utilizar neste estudo o nematoide Caenorhabditis elegans, que tem sido amplamente utilizado na industria farmacêutica. Foram testadas duas estirpes de C.elegans usadas em diferentes métodos contando com 8 experimentos distintos. nós examinamos 4 métodos de extração de ricina e 3 m

  9. Effect of castor bean (Ricinus communis L.) aqueous extracts on the performance of root-knot nematodes (Meloidogyne spp.) on tomato (Solanum lycopersicum L.)

    International Nuclear Information System (INIS)

    The increased concern for environmental and health hazards have called for a reduction in the use of synthetic nematicides for nematode control. Experiments were, therefore, conducted to ascertain the nematicidal potential of castor bean's crude extract and its five lower concentrations with water as control. In the in vitro studies, crude castor bean aqueous extract and 10, 20, 30 and 40% different concentrations with 100 root-knot nematode eggs or juveniles in separate Petri dishes showed that all the different concentrations had toxic effects on eggs and juveniles of root-knot nematode. Egg hatch inhibition and juvenile mortality increased with increased concentration of the extracts. With an increase in exposure time, juvenile mortality increased. In potted plant studies, crude castor bean aqueous extracts and its lower concentrations of 20, 40 and 60% caused significant improvement in plant growth measures such as height and fresh shoot weight over the water blank control. The crude castor bean extract was nematotoxic to root -knot nematodes in vitro and in potted-tomato plants, but this was not demonstrated in field studies. Further work needs to be done before a firm recommendation can be made. (au)

  10. Forensic Applications of Light-Element Stable Isotope Ratios of Ricinus communis Seeds and Ricin Preparations

    Energy Technology Data Exchange (ETDEWEB)

    Kreuzer, Helen W.; West, Jason B.; Ehleringer, James

    2013-01-01

    Seeds of the castor plant Ricinus communis, also known as castor beans, are of forensic interest because they are the source of the poison ricin. We have tested whether stable isotope ratios of castor seeds and ricin prepared by various methods can be used as a forensic signature. We collected over 300 castor seed samples from locations around the world and measured the C, N, O, and H stable isotope ratios of the whole seeds, oil, and three types of ricin preparations. Our results demonstrate that N isotope ratios can be used to correlate ricin prepared by any of these methods to source seeds. Further, stable isotope ratios distinguished >99% of crude and purified ricin protein samples in pair-wise comparison tests. Stable isotope ratios therefore constitute a valuable forensic signature for ricin preparations.

  11. Evaluation of dentin cleansing by a detergent derived from castor oil (Ricinus communis) used as root canal irrigant: a scanning electron miscroscopy study

    OpenAIRE

    Letícia Molteni Aguiar; Lilian Eiko Maekawa; Adriana Chung; Maria Renata Giazzi Nassri

    2010-01-01

    Introduction and objective: To evaluate, by scanning electron microscopy (SEM), the cleaning of root canal walls after biomechanical preparation and irrigation with castor oil (Endoquil®) and 0.5% sodium hypochlorite (NaOCl). Material and methods: Fifteen maxillary incisors were subjected to standardized root canal instrumentation with different irrigants (n = 5): G1 – Endoquil; G2 – 0.5% NaOCl; G3 – saline solution (control). After instrumentation, the teeth were prepared for SEM analysis (...

  12. Effet comparé des poudres de Nicotiana tabacum L, Cymbopogon citratus (D.C.) Stapf et de l'huile de Ricinus communis L sur la conservation des graines de Vigna unguiculata (L) Walp

    OpenAIRE

    Gakuru, S.; Buledi, MK.

    1995-01-01

    Compared Effect of Nicotiana tabacum L, Cymbopogon citratus (D.C.) Stapf Powders and Castor Oil Ricinus communis L. on Conservation of Cowpea Vigna Unguiculata (L.) Walp Grains. The effect of powder of tobacco Nicotiana tabacum L. and citronella grass Cymbopogon citratus (D.C.) Stapf and castor oil Ricinus communis L. on conservation of cowpea Vigna unguiculata (L.) Walp. grains was investigated in Kisangani, Zaire. After 5 months of conservation, infestation rates by bean weevil Acanthosceli...

  13. Identification of reference genes for quantitative RT-PCR analysis of microRNAs and mRNAs in castor bean (Ricinus communis L.) under drought stress.

    Science.gov (United States)

    Cassol, Daniela; Cruz, Fernanda P; Espindola, Kauê; Mangeon, Amanda; Müller, Caroline; Loureiro, Marcelo Ehlers; Corrêa, Régis L; Sachetto-Martins, Gilberto

    2016-09-01

    Quantitative real-time PCR (RT-qPCR) is one of the most powerful and sensitive techniques to the study of gene expression. Several factors influence RT-qPCR performance though, including the stability of the reference genes used for data normalization. While the selection of appropriate reference genes is crucial for accurate and reliable gene expression analysis, no suitable reference genes have been previously identified in castor bean under drought stress. In this study, the expression stability of eleven mRNAs, thirteen microRNAs (miRNAs) and one small nuclear RNA were analyzed in roots and leaves across different levels of water deficit. Three different algorithms were employed to analyze the RT-qPCR data, and the resulting outputs were merged using a non-weighted unsupervised rank aggregation method. Our analysis indicated that the Elongation factor 1-beta (EF1B), Protein phosphatase 2A (PP2A) and ADP-ribosylation factor (ADP) ranked as the best candidates across diverse samples submitted to different levels of drought conditions. EF1B and Glyceraldehyde 3-phosphate dehydrogenase (GAPDH), and EF1B and SKP1/ASK-interacting protein 16 (SKIP16) were found as the most suitable reference genes for expression analysis in roots and leaves, respectively. In addition, miRNAs miR168, miR160 and miR397 were selected as optimal reference genes across all tissues and treatments. miR168 and miR156 were recommended as reference for roots, while miR168 and miR160 were recommended for leaves. Together, our results constitute the first attempt to identify and validate the most suitable reference genes for accurate normalization of gene expression in castor bean under drought stress. PMID:27156134

  14. Ricinus communis and Jatropha curcas (Euphorbiaceae) seed oil toxicity against Atta sexdens rubropilosa (Hymenoptera: Formicidae).

    Science.gov (United States)

    Alonso, E C; Santos, D Y A C

    2013-04-01

    Leaf-cutting ants are the main herbivores in the New World tropics. Although the toxicity of seed oils against these ants has been poorly investigated, previous results revealed that seed oils exert considerable toxic activity against these insects. This paper analyzes the toxic action and deterrent properties of castor oil, Ricinus communis L., and physic nut oil, Jatropha curcas L., against workers of the leaf-cutting ant Atta sexdens rubropilosa reared in laboratory. Toxic effect was analyzed by feeding insects artificial diets supplemented with different oil concentrations and direct contact with the two oils. Deterrent activity was assessed by measuring the frequency of attendance to diets during the first 48 h of the ingestion bioassay. Castor oil at 10 and 30 mg/ml and physic nut oil at 5, 10, and 30 mg/ml were toxic by ingestion. In the direct contact bioassay, toxicity was observed for physic nut oil at 0.1 and 0.2 mg/ml, whereas castor oil exerted toxic effects only when the highest concentration was applied. Also, castor oil had a more pronounced deterrent effect against the leaf-cutting ant, compared with physic nut oil. Methods to apply these oils to control these insects are discussed. PMID:23786062

  15. Influência da concentração de NaCl e pH na extração de ricina em torta de mamona (Ricinus communis L. e sua caracterização por eletroforese Influence of NaCl and pH concentration on the extraction of ricin in castor bean (Ricinus communis L. and its characterization by electrophoresis

    Directory of Open Access Journals (Sweden)

    Bárbara Amorim Silva

    2012-07-01

    Full Text Available A mamoneira (Ricinus communis L. é uma oleaginosa de alto valor econômico pelo fato de apresentar um mercado bem definido para o óleo extraído de suas sementes. A torta, que é um resíduo desta extração, se destaca pelo alto teor em proteínas. Dentre as proteínas encontradas na torta destaca-se a ricina, uma citotoxina, que inviabiliza sua utilização como fonte protéica alternativa para alimentação animal. O presente trabalho tem como objetivo identificar um melhor tratamento experimental para a extração de ricina da torta de mamona, visando futuros estudos de perda de integridade da ricina, o que garantiria a inocuidade do produto. Para tanto, buscou-se identificar a solução de maior capacidade de extração de proteínas, empregando a metodologia de superfície de resposta. Um delineamento composto central rotacional foi elaborado a fim de verificar o melhor pH e concentração de NaCl para a extração. Dos cinco diferentes valores de pH (4,0; 4,6; 6,0; 7,4; 8,0 e concentração de NaCl (0,0M; 0,3M; 1,0M; 1,7M; 2,0M utilizados, o tratamento associando fosfato de potássio 0,2M/NaCl 1,7M pH 7,4 foi escolhido como o melhor. A concentração de proteína extraída neste tratamento chegou a valores quatro vezes maiores que o encontrado no de mínima extração de proteína. Pela evidenciação do gel de eletroforese não houve extração preferencial de ricina nos tratamentos testados, entretanto etapas de purificação usando diálise e precipitação com sulfato de amônio, permitiram uma evidenciação melhor das duas cadeias polipeptídicas de ricina.Castor bean (Ricinus communis L. is an oilseed crop of high economic value due to the fact of presenting a clearly defined market for the oil extracted from its seeds. Castor cake, which is a residue of oil extraction, is at the moment receiving special attention because of its high protein content. However, among the proteins found in this cake it is observed the presence of

  16. IMUNIDADE CRUZADA PELAS SEMENTES DE Abrus precatorius E Ricinus communis EM BOVINOS Crossimmunity by the seeds of Abrus precatorius and Ricinus communis in cattle

    Directory of Open Access Journals (Sweden)

    Carlos Hubinger Tokarnia

    1997-01-01

    ão imunizados, demonstrando que a imunidade conferida pela ricina não inibe a ação da ricinina, o principio tóxico das folhas e do pericarpo.Five bovines immunized against the toxicity of the seeds of Abrus precatorius L. (jequiriti bean did not get poisoned or only slightly so when the seeds of Ricinus communis L. (castor bean were given in amounts that in bovines, which never before ingested the seeds of A. precatorius or R. communis, caused moderate to severe poisoning or even death. A sixth bovine, which was not well immunized against the toxic action of the seeds of A. precatorius, was severely poisoned when given a high dose of the seeds of R. communis. On the other side, from five bovines immunized against the toxic action of the seeds of R. communis four were severely poisoned and the fifth one moderately when the seeds of A. precatorius were given in doses that in bovines, which never before ingested seeds of R. communis or A. precatorius, caused slight to severe poisoning. It is concluded that bovines immunized against the toxic action of the seeds of A. precatorius are resistant to the toxic action of the seeds of R. communis, but that the contrary is not the case; this is, bovines immunized against the toxic action of the seeds of R. communis were not protected against the poisoning by A. precatorius. Earlier studies by other authors had shown that the toxalbumins of the seeds of A. precatorius and R. communis, respectively abrin and ricin, are different as to their antigenic properties. A possible explanation for the difference in results can be.that in the present study polygastric animals were used which received the seeds orally, but in the earlier studies monogastric animals received the seeds or toxins by parenteral route. The administration of the fresh leaves or the pericarp of the fruits R. communis to bovines, which had been immunized against the action of the seeds of the plant, had the same toxic effect as to not immunized animals, showing that the

  17. Physicochemical characterization of seven Mexican Ricinus communis L. seeds and oil contents

    International Nuclear Information System (INIS)

    This paper presents a rigorous study and characterization of seven Mexican Ricinus communis L. seeds and its respective extracted oil. Several physical–chemical properties were measured in order to know moisture, total lipid content, fiber content, starch presence, morphology, acidity, free fatty acid profile, ricinoleic acid content, viscosity and crude oil density. Three different methodologies were implemented for the oil extraction in each variety (extraction with chemical solvents and mechanical compression heated and non-heated). The yield percentage of the oil extraction was evaluated as well as the extraction method influence over the oil's nature. -- Highlights: ► We characterized seven different Castor seeds and oils from semi deserted region. ► We evaluate the performance of three different methods to obtain Castor Oils. ► It was found that the density and fatty acid profile depend on the method of extraction. ► According to x-ray diffraction experiments no crystalline compounds were found in the defatted mass. ► The viscosity of the Castor Oils was strongly influence by the extractive method

  18. Studies on Ricinus Lipase Enzyme Isolated from Castor Seeds

    OpenAIRE

    Alka Srivastava; Rashmi Mohan Mathur; Rachna Prakash; Shashi Agrawal

    2016-01-01

    Healthy and bold seeds of castor variety “Aruna“ were collected. The de-hulled castor kernels were separated from seed coat and finely grounded in an electric grinder. The powdered kernels were passed through 60 mesh sieve and defatted using n-hexane in a soxhlet extractor. After complete extraction of oil seed meal was made free from solvent at low temperature. The defatted seed meal was pulverized and again passed through 60-mesh sieve to get final product .The RICINUS LIPASE source thus, o...

  19. Studies on Ricinus Lipase Enzyme Isolated from Castor Seeds

    Directory of Open Access Journals (Sweden)

    Alka Srivastava

    2016-05-01

    Full Text Available Healthy and bold seeds of castor variety “Aruna“ were collected. The de-hulled castor kernels were separated from seed coat and finely grounded in an electric grinder. The powdered kernels were passed through 60 mesh sieve and defatted using n-hexane in a soxhlet extractor. After complete extraction of oil seed meal was made free from solvent at low temperature. The defatted seed meal was pulverized and again passed through 60-mesh sieve to get final product .The RICINUS LIPASE source thus, obtained was stored in a screw capped glass vial and kept in a desiccator. As and when required portions from this preparation were used in further enzymatic studies.

  20. Standardization parameters and HPTLC fingerprinting of the roots of Ricinus communis Linn

    Directory of Open Access Journals (Sweden)

    Abhilasha Mittal

    2013-03-01

    Full Text Available Ricinus communis L. (Euphorbiaceae, known as castor plant, is widespread throughout tropical regions of India and grows as an annual or perennial soft wooded small tree. A decoction of the root is administered to relieve lumbago, and a root paste is applied to alleviate toothache. The roots contained glycosides, phenolic compounds, steroids and acidic components. The root bark of R. communis furnished 5.74% of the total ash, 2.03% of the acid insoluble ash and 2.98% of the water soluble ash. There was 9.46 % of water content. Successive extraction of the roots (50 g yielded 0.362 g, 0.482 g, 1.243 g and 2.643 g of the extracts in petroleum ether, chloroform, methanol and water, respectively. Individual extractions of the roots (15 g with these solvents produced 0.235 g, 0.727 g, 7.425 g and 12.017 g of the extracts, respectively. Fluorescence behavior of powdered root bark of R. communis indicated that the light yellow powder of the bark powder changed to black at max 366 nm. Among the nine elements, calcium (350.45 ppm was present in the maximum amount followed by followed by potassium (330.50 ppm, magnesium (230.68 ppm and cadmium (198.57 ppm. Sodium (56.26 ppm and lead (8.18 ppm were detected in trace amounts. The HPTLC scanning of the petroleum ether, chloroform and methanol extracts of the roots exhibited 5, 4 and 4 major bands, respectively.

  1. Survey of the castor bean production (Ricinus communis L. in a collection of producers from five counties of Bahia State. = Levantamento da produção de mamona (Ricinus communis L. em uma amostra de produtores em cinco municípios do Estado da Bahia.

    Directory of Open Access Journals (Sweden)

    Vicente de Paula Queiroga

    2011-08-01

    Full Text Available The objective of this study was to verify the situation of the culture of castor bean from a collection of producers located in five counties of Bahia state, highlighting the technical conditions of production and commercialization of the product, beyond its social aspects. Twenty-five castor bean producers were interviewed during the 2005 agricultural year by a team of researchers from the Embrapa Cotton. A present questionnaire with 15 variable questions pertaining to agro-economic and social-economic was applied to producers with the objective to diagnose the agricultural social-economic profiles of theproducers of castor bean that are used for the production of berries to be used within the energy market of the Program of Biodiesel and Ricin chemistry. Data analysis concluded that the family farmers of Bahia have the culture of castor oil as, a major source of income, but the cultivation techniques, promising cultivars, and oil content are underutilized. It was shown that a technology gap can be solved by a adopting a differential pricing policy that is based on a feasibility comprehensive recovery program that increases the ricin culture productivity throughout the production chain, reduce costs, and increase the oil content of cultivars.ResumoObjetivou-se com este estudo verificar a situação da cultura da mamona em uma amostra de produtores levantados em cinco municípios localizados no noroeste do estado da Bahia (São Gabriel, Irecê, Lapão, Ibititá e Cafarnaum, destacando-se as condições técnicas de produção e de comercialização do produto, além dos seus aspectos sociais. Um total de 25 produtores de mamona foi entrevistado no ano agrícola de 2005, por uma equipe de pesquisadores da Embrapa Algodão. Um questionário preestabelecido com 15 variáveis agronômicas e socioecononômicas foi aplicado junto aos produtores, visando o diagnóstico do perfil agrossocioeconômico dos produtores de mamona que estão destinando sua

  2. Effet comparé des poudres de Nicotiana tabacum L, Cymbopogon citratus (D.C. Stapf et de l'huile de Ricinus communis L sur la conservation des graines de Vigna unguiculata (L Walp

    Directory of Open Access Journals (Sweden)

    Gakuru, S.

    1995-01-01

    Full Text Available Compared Effect of Nicotiana tabacum L, Cymbopogon citratus (D.C. Stapf Powders and Castor Oil Ricinus communis L. on Conservation of Cowpea Vigna Unguiculata (L. Walp Grains. The effect of powder of tobacco Nicotiana tabacum L. and citronella grass Cymbopogon citratus (D.C. Stapf and castor oil Ricinus communis L. on conservation of cowpea Vigna unguiculata (L. Walp. grains was investigated in Kisangani, Zaire. After 5 months of conservation, infestation rates by bean weevil Acanthoscelides obtectus Say were 72.5 %, 74.5 %, 49.5 % and 5 % respectively for the check, the samples treated by 1 % of citronella grass and tobacco powder and 1 % of castor oil. The powder dose of 7.5 % did not give more interesting results.

  3. Toxin content of commercial castor cultivars

    Science.gov (United States)

    The castor plant Ricinus communis L. is the source of castor oil which has numerous uses and is a key chemical feedstock for an array of products from polymers to cosmetics. Although castor was once widely grown throughout the world, the presence of the toxic protein ricin has deterred the re-introd...

  4. Essential oil of the leaves of Ricinus communis L.: In vitro cytotoxicity and antimicrobial properties

    Directory of Open Access Journals (Sweden)

    Zarai Zied

    2012-08-01

    Full Text Available Abstract Background The aim of the present study was to appraise the antimicrobial activity of Ricinus communis L. essential oil against different pathogenic microorganisms and the cytotoxic activity against HeLa cell lines. Methods The agar disk diffusion method was used to study the antibacterial activity of Ricinus communis L. essential oil against 12 bacterial and 4 fungi strains. The disc diameters of zone of inhibition (DD, the minimum inhibitory concentrations (MIC and the concentration inhibiting 50% (IC50 were investigated to characterize the antimicrobial activities of this essential oil. The in vitro cytotoxicity of Ricinus communis L. essential oil was examined using a modified MTT assay; the viability and the IC50 were used to evaluate this test. Results The essential oil from the leaves of Ricinus communis L. was analyzed by GC–MS and bioassays were carried out. Five constituents of the oil were identified by GC–MS. The antimicrobial activity of the oil was investigated in order to evaluate its efficacy against twelve bacteria and four fungi species, using disc diffusion and minimum inhibitory concentration methods. The essential oil showed strong antimicrobial activity against all microorganisms tested with higher sensitivity for Bacillus subtilis, Staphylococcus aureus and Enterobacter cloacae. The cytotoxic and apoptotic effects of the essential oil on HeLa cell lines were examined by MTT assay. The cytotoxicity of the oil was quite strong with IC50 values less than 2.63 mg/ml for both cell lines. Conclusion The present study showed the potential antimicrobial and anticarcinogenic properties of the essential oil of Ricinus communis L., indicating the possibilities of its potential use in the formula of natural remedies for the topical treatment of infections.

  5. Evaluation of hepatoprotective activity of aqueous extract of ricinus communis in Wistar rats

    OpenAIRE

    Naveen, A.; Shankar J.; Premendran John; N. Venkatanarayana

    2016-01-01

    Background: The aim of the present study was to evaluate hepatoprotective activity of aqueous extract of ricinus communis in wistar rats. Methods: Liver, the key organ of metabolism and excretion, is constantly endowed with the task of detoxification of xenobiotics, environmental pollutants and chemotherapeutic agents. The animals were divided into six groups with six rats in each group. First group were taken as control, and they received 0.9% normal saline 10ml/kg body weight orally. Sec...

  6. Fractionation of Stable Cadmium Isotopes in the Cadmium Tolerant Ricinus communis and Hyperaccumulator Solanum nigrum

    OpenAIRE

    Rongfei Wei; Qingjun Guo; Hanjie Wen; Congqiang Liu; Junxing Yang; Marc Peters; Jian Hu; Guangxu Zhu; Hanzhi Zhang; Liyan Tian; Xiaokun Han; Jie Ma; Chuanwei Zhu; Yingxin Wan

    2016-01-01

    Cadmium (Cd) isotopes provide new insights into Cd uptake, transport and storage mechanisms in plants. Therefore, the present study adopted the Cd-tolerant Ricinus communis and Cd-hyperaccumulator Solanum nigrum, which were cultured under controlled conditions in a nutrient solution with variable Cd supply, to test the isotopic fractionation of Cd during plant uptake. The Cd isotope compositions of nutrient solutions and organs of the plants were measured by multiple collector inductively cou...

  7. Antimicrobial potential of Ricinus communis leaf extracts in different solvents against pathogenic bacterial and fungal strains

    Institute of Scientific and Technical Information of China (English)

    Rabia Naz; Asghari Bano

    2012-01-01

    Objective: To investigate the in vitro antimicrobial activities of the leaf extract in different solvents viz., methanol, ethanol and water extracts of the selected plant Ricinus communis. Methods:Agar well diffusion method and agar tube dilution method were carried out to perform the antibacterial and antifungal activity of methanol, ethanol and aqueous extracts. Results:Methanol leaf extracts were found to be more active against Gram positive bacteria (Bacillus subtilis: ATCC 6059 and Staphylococcus aureus: ATCC 6538) as well as Gram negative bacteria (Pseudomonas aeruginosa: ATCC 7221 and Klebsiella pneumoniae) than ethanol and aqueous leaf extracts. Antifungal activity of methanol and aqueous leaf extracts were also carried out against selected fungal strains as Aspergillus fumigatus and Aspergillus flavus. Methanolic as well as aqueous leaf extracts of Ricinus communis were effective in inhibiting the fungal growth. Conclusions: The efficient antibacterial and antifungal activity of Ricinus communis from the present investigation revealed that the methanol leaf extracts of the selected plant have significant potential to inhibit the growth of pathogenic bacterial and fungal strains than ethanol and aqueous leaf extracts.

  8. Synthesis of carboxylate complexes and evaluation of their catalytic activities for polyesterification of castor oil (Ricinum communis with terephthalic acid

    Directory of Open Access Journals (Sweden)

    Eduardo Ulisses Xavier Peres

    2015-07-01

    Full Text Available The use of castor oil (Ricinus communis has been pointed out as an interesting alternative to produce several polymers obtained from step-growth polymerization and are suitable to be used as resins and coatings. The ricinoleate metal complexes Ni[C17H34(OHCOO]2, Sn[C17H34(OHCOO]2, Co[C17H34(OHCOO]2 and Fe[C17H34(OHCOO]2 have been prepared and used as catalyst precursors for polyesterification of castor oil and terephthalic acid (TFA. The observed catalytic activity decreased in the order: Fe[C17H34(OHCOO]2 > Co[C17H34(OHCOO]2 > Sn[C17H34(OHCOO]2 > Ni[C17H34(OHCOO]2. The new polymeric materials did not show homogeneity in their chains, as indicated by their high polydispersity. Indeed, the polydispersity index value varied from 5.49 for the polymer produced in the presence of the nickel complex to 12.42 for these prepared with the cobalt compound. On the other hand, the final material presented high molecular weight, being the lower value (Mw = 13400 Da observed for the polymer prepared with the nickel complex and the highest (Mw = 36400 Da verified for the one obtained with the cobalt compound. It was observed only a glass transition temperature for all the materials, suggesting an amorphous structure of polymeric chains.

  9. A BATCH REACTOR CONSTRUCTION FOR OBTAINING BIODIESEL FROM OIL Ricinus communis

    OpenAIRE

    Yolimar Fernández; Osmely Floiran; Era Maurelys; Milena Villalobos; América Garcia

    2014-01-01

    A batch reactor was constructed to obtain biodiesel from 5 liters of extracted from the seed of Ricinus communis. The reactor is made of stainless steel, 29cm length, 15.24 cm of inner diameter and a conical base of 20cm long, wall thickness of 0.2 cm, 1000 W tubular resistance and 110 volt motor. It is extracted and compared with the respective norms the physical and chemical properties of crude oil. Preliminary tests catalyzed transesterification of the oil with NaOH to verify the feasibil...

  10. Exploration of larvicidal and adult emergence inhibition activities of Ricinus communis seed extract against three potential mosquito vectors in Kolkata, India

    Institute of Scientific and Technical Information of China (English)

    Shyamapada Mandal

    2010-01-01

    Objective:To determine the larvicidal and adult emergence inhibition activities of castor (Ricinus communis) seed extract against three potential mosquito vectorsAnopheles stephensi (An. stephensi), Culex quinquefasciatus (Cx. quinquefasciatus) andAedes albopictus (Ae. albopictus) in India.Methods: TheR. communis seed extract was tested, employingWHO procedure, against fourth larval instars of the three mosquito species for 24 h and larval mortalities were recorded at various concentrations (2-64 μg/mL); the 24 hLC50 values of theR. communis seed extract were determined following Probit analysis. The larval killing, antipupation and adult emergence inhibition rates of the test extract, using a single concentration of2μLC50, were studied at different time periods (24-72 h); the extract toxicity was tested against a fish,Oreochromis niloticus (O. niloticus).Results: TheR. communis seed extract exhibited larvicidal effects with 100 % killing activities at concentrations32-64 μg/mL, and withLC50values 7.10, 11.64 and 16.84μg/mL forCx. quinquefasciatus, An. stephensiand Ae. albopictuslarvae, respectively. When the larvae were treated with the extract at a single concentration of2×LC50, significant differences were observed, compared to control groups, in rate of pupation (P<0.001) as well as in adult formation (P<0.001).Conclusions: The present findings suggest that theR. communis seed extract provided an excellent potential for controllingAn. stephensi, Cx. quinquefasciatus andAe. albopictus mosquito vectors.

  11. Draft genome sequence of the ricin-producing oilseed castor bean

    OpenAIRE

    Chan, Agnes P.; Crabtree, Jonathan; Zhao, Qi; Lorenzi, Hernan; Orvis, Joshua; Puiu, Daniela; Melake-Berhan, Admasu; Kristine M Jones; Redman, Julia; Chen, Grace; Cahoon, Edgar B.; Gedil, Melaku; Stanke, Mario; Haas, Brian J.; Wortman, Jennifer R

    2010-01-01

    Castor bean (Ricinus communis) is an oil crop that belongs to the spurge (Euphorbiaceae) family. Its seeds are the source of castor oil, used for the production of high-quality lubricants due to its high proportion of the unusual fatty acid ricinoleic acid. Castor bean seeds also produce ricin, a highly toxic ribosome inactivating protein, making castor bean relevant for biosafety. We report here the 4.6X draft genome sequence of castor bean, representing the first reported Euphorbiaceae geno...

  12. Evaluation of Ricinus communis L. for the Phytoremediation of Polluted Soil with Organochlorine Pesticides

    Directory of Open Access Journals (Sweden)

    Sandra Regina Rissato

    2015-01-01

    Full Text Available Phytoremediation is an attractive alternative to conventional treatments of soil due to advantages such as low cost, large application areas, and the possibility of in situ treatment. This study presents the assessment of phytoremediation processes conducted under controlled experimental conditions to evaluate the ability of Ricinus communis L., tropical plant species, to promote the degradation of 15 persistent organic pollutants (POPs, in a 66-day period. The contaminants tested were hexachlorocyclohexane (HCH, DDT, heptachlor, aldrin, and others. Measurements made in rhizosphere soil indicate that the roots of the studied species reduce the concentration of pesticides. Results obtained during this study indicated that the higher the hydrophobicity of the organic compound and its molecular interaction with soil or root matrix the greater its tendency to concentrate in root tissues and the research showed the following trend: HCHs < diclofop-methyl < chlorpyrifos < methoxychlor < heptachlor epoxide < endrin < o,p′-DDE < heptachlor < dieldrin < aldrin < o,p′-DDT < p,p′-DDT by increasing order of log Kow values. The experimental results confirm the importance of vegetation in removing pollutants, obtaining remediation from 25% to 70%, and demonstrated that Ricinus communis L. can be used for the phytoremediation of such compounds.

  13. Fractionation of Stable Cadmium Isotopes in the Cadmium Tolerant Ricinus communis and Hyperaccumulator Solanum nigrum

    Science.gov (United States)

    Wei, Rongfei; Guo, Qingjun; Wen, Hanjie; Liu, Congqiang; Yang, Junxing; Peters, Marc; Hu, Jian; Zhu, Guangxu; Zhang, Hanzhi; Tian, Liyan; Han, Xiaokun; Ma, Jie; Zhu, Chuanwei; Wan, Yingxin

    2016-04-01

    Cadmium (Cd) isotopes provide new insights into Cd uptake, transport and storage mechanisms in plants. Therefore, the present study adopted the Cd-tolerant Ricinus communis and Cd-hyperaccumulator Solanum nigrum, which were cultured under controlled conditions in a nutrient solution with variable Cd supply, to test the isotopic fractionation of Cd during plant uptake. The Cd isotope compositions of nutrient solutions and organs of the plants were measured by multiple collector inductively coupled plasma mass spectrometry (MC-ICPMS). The mass balance of Cd isotope yields isotope fractionations between plant and Cd source (δ114/110Cdorgans-solution) of ‑0.70‰ to ‑0.22‰ in Ricinus communis and ‑0.51‰ to ‑0.33‰ in Solanum nigrum. Moreover, Cd isotope fractionation during Cd transport from stem to leaf differs between the Cd-tolerant and -hyperaccumulator species. Based on these results, the processes (diffusion, adsorption, uptake or complexation), which may induce Cd isotope fractionation in plants, have been discussed. Overall, the present study indicates potential applications of Cd isotopes for investigating plant physiology.

  14. Acaricidal properties of Ricinus communis leaf extracts against organophosphate and pyrethroids resistant Rhipicephalus (Boophilus) microplus.

    Science.gov (United States)

    Ghosh, Srikanta; Tiwari, Shashi Shankar; Srivastava, Sharad; Sharma, Anil Kumar; Kumar, Sachin; Ray, D D; Rawat, A K S

    2013-02-18

    Indian cattle ticks have developed resistance to commonly used acaricides and an attempt has been made to formulate an ecofriendly herbal preparation for the control of acaricide resistant ticks. A 95% ethanolic extract of Ricinus communis was used to test the efficacy against reference acaricide resistant lines by in vitro assay. In in vitro assay, the extract significantly affects the mortality rate of ticks in dose-dependent manner ranging from 35.0 ± 5.0 to 95.0 ± 5.0% with an additional effect on reproductive physiology of ticks by inhibiting 36.4-63.1% of oviposition. The leaf extract was found effective in killing 48.0, 56.7 and 60.0% diazinon, deltamethrin and multi-acaricide resistant ticks, respectively. However, the cidal and oviposition limiting properties of the extract were separated when the extract was fractionated with hexane, chloroform, n-butanol and water. The HPTLC finger printing profile of R. communis leaf extract under λ(max.) - 254 showed presence of quercetin, gallic acid, flavone and kaempferol which seemed to have synergistic acaricidal action. In vivo experiment resulted in 59.9% efficacy on Ist challenge, however, following 2nd challenge the efficacy was reduced to 48.5%. The results indicated that the 95% ethanolic leaf extract of R. communis can be used effectively in integrated format for the control of acaricide resistant ticks. PMID:23084038

  15. Evaluation of Genetic Diversity of Castor Bean for Biodiesel Utilization

    Science.gov (United States)

    Castor bean (Ricinus communis L., 2n=20) is a cross-pollinated diploid species belonging to the family Euphorbiaceae instead of the Leguminosae. It is a native of Africa but may have originated in India. Castor bean plants grow as annual or perennial, depending on geographical locations, climate a...

  16. Higroscopic properties of castor seeds (Ricinus Comunis L.

    Directory of Open Access Journals (Sweden)

    M. C. Gely

    2009-03-01

    Full Text Available Sorption isotherms of castor seeds were evaluated at 30, 40, 50 and 60ºC using the static gravimetric method. Sigmoid trends were observed for isotherms obtained showing a clear effect of temperature. Experimental values were adjusted using the modified isotherms of Henderson, Halsey, Oswin and Guggenheim-Anderson-de Boer (GAB. Models were compared using four statistics parameters. The results showed that Modified Henderson model adjusted adequately the experimental values in the range of temperature evaluated. The experimental values of the safe storage moisture content for castor seeds varied between 6.1 to 8.4 % (d.b. between 20 and 40ºC, showing lower values than those reported for other traditional oilseeds as sunflower or rapeseed. The sorption heats evaluated from the combination of Clapeyron equation and Modified Henderson equation varied between 3400 and 2373 kJ/kg for moisture contents between 1 and 28 % (d.b.. Through Othmer relationship the value of the ratio Lb/Lf varied between 1.01 and 1.34 (for 14.5 and 1% d.b. moisture content respectively. The values obtained showed an exponential relationship with moisture content, of the form Lb/Lf=1+0.44exp(-0.17M with a determination coefficient R² of 0.97.

  17. In vitro activity of total aqueous ethanol leaf extracts of Ricinus communis on Leishmania major promastigotes

    International Nuclear Information System (INIS)

    The activity of aqueous and ethanol extracts of Ricinus communis was tested on Leishmania promastigotes in cell-free culture media. Serial dilutions of the extracts ranging from 500μg/ml, 250 μg/ml and 62.5μg/ml were prepared in triplicate using Schneiders Drosophila medium supplemented with 20% fetal bovine serum in the absence of antibiotics and the growth of approximately 1x 10 (power 6) parasites monitored every two days for a period of 8 days. Parasite density was estimated every two days using the Neuabeur counting chamber. At the end of the 8-day period cell morphology was observed and photographed. Significant growth inihibitory effect was observed on the promastigotes by the aqueous and ethanol extracts especially at high concentrations. However, there was an enhanced growth effect initially thereafter leading to to a rapid decline in promastigote cell population. Flagellar motility was also greatly affected at high concentration and it appeared that there was a linear relationship between flagellar motilities and the level of concentrations. Parasite morphology was affected severely. Most of the cultures observed appeared to have abnormal round morphology. Rosseting was also evident in the extract treated cultures. The aqueous leaf extract interfered with parasite morphology but this was dose dependent. The importance of R. communis plant as a potential source for chemotypes with antileishmanial activity is discussed. (author)

  18. An experimental evaluation of in vitro immunomodulatory activity of isolated compound of Ricinus communis on human neutrophils

    Directory of Open Access Journals (Sweden)

    Arvind Kumar

    2011-01-01

    Full Text Available In the present study, the in vitro immunomodulatory activity of Ricinus communis Linn (Euphorbiaceae was determined on human neutrophils. The isolated compound (tannin of R. communis leaves was screened for its possible immunomodulatory activity by carrying out nitroblue tetrazolium test, phagocytosis of killed Candida albicans, neutrophil locomotion and chemotaxis. The isolated compound was tested at concentrations, viz. 10 μg/ml, 20 μg/ml, 40 μg/ml, 100 μg/ml and 1000 μg/ml. The isolated compound of R. communis showed predominantly significant activity on human neutrophils in all the parameters tested, which was comparable to the standard and control at different concentrations, indicating the possible immunostimulating effect.

  19. Gamma ray induced female mutation in castor

    International Nuclear Information System (INIS)

    Three female mutants in castor (Ricinus communis L.) were obtained from 100 to 125 kR gamma-rays treated M2 population. The racemes of these mutants bore only pistillate flowers. This character is monogenic, recessive and these mutants can be used for large scale hybrid seed production

  20. IDENTIFICACIÓN DE MICROORGANISMOS ASOCIADOS A RESIDUOS DE HIGUERILLA (Ricinus communis

    Directory of Open Access Journals (Sweden)

    Teresa Cabra Cendales

    2015-05-01

    Full Text Available El objetivo de este artículo fue aislar e identificar los microorganismos presentes en los residuos de fruto y torta de higuerilla (Ricinus communis. Se utilizaron medios de cultivo selectivos para la caracterización morfológica y bioquímica y para la identificación molecular se usó la técnica de PCR con oligonucleótidos universales RM y RB del gen 16S para bacterias y secuencias intergénicas ITS1 e ITS4 para hongos y levaduras. Las secuencias fueron analizadas identificándose nueve especies de hongos, siendo Penicillium brevicompactum predominante; 12 especies de bacterias, donde el género más recurrente fue Bacillus sp. y dos especies de levaduras, Rhodosporidium paludigenum y Pichia burtonni. La identificación de la microbiota nativa presente en los residuos de higuerilla es muy promisoria, aportando un amplio conocimiento sobre la versatilidad metabólica de cada una de las cepas aisladas. El mayor número de aislamientos se obtuvieron de la torta probablemente debido al alto contenido de nutrientes presentes en este residuo.

  1. Root cooling strongly affects diel leaf growth dynamics, water and carbohydrate relations in Ricinus communis.

    Science.gov (United States)

    Poiré, Richard; Schneider, Heike; Thorpe, Michael R; Kuhn, Arnd J; Schurr, Ulrich; Walter, Achim

    2010-03-01

    In laboratory and greenhouse experiments with potted plants, shoots and roots are exposed to temperature regimes throughout a 24 h (diel) cycle that can differ strongly from the regime under which these plants have evolved. In the field, roots are often exposed to lower temperatures than shoots. When the root-zone temperature in Ricinus communis was decreased below a threshold value, leaf growth occurred preferentially at night and was strongly inhibited during the day. Overall, leaf expansion, shoot biomass growth, root elongation and ramification decreased rapidly, carbon fluxes from shoot to root were diminished and carbohydrate contents of both root and shoot increased. Further, transpiration rate was not affected, yet hydrostatic tensions in shoot xylem increased. When root temperature was increased again, xylem tension reduced, leaf growth recovered rapidly, carbon fluxes from shoot to root increased, and carbohydrate pools were depleted. We hypothesize that the decreased uptake of water in cool roots diminishes the growth potential of the entire plant - especially diurnally, when the growing leaf loses water via transpiration. As a consequence, leaf growth and metabolite concentrations can vary enormously, depending on root-zone temperature and its heterogeneity inside pots. PMID:19968824

  2. Eficiencia del extracto de Ricinus communis para el control del mosquito Culex

    Directory of Open Access Journals (Sweden)

    Diego Tomás Corradine Mora

    2014-05-01

    Full Text Available Este artículo evaluó el efecto insecticida del extracto de Ricinus communis sobre larvas de mosquitos Culex. A las 24 h la mortalidad es de 8.33 % con dosis de 1 mL del extracto en una concentración de 500 ppm; 35 % en dosis de 1 mL de una concentración de 1000 ppm; 65 % en dosis de 5 mL de una concentración de 1000 ppm; 98.33 % con 10 mL en concentración de 1000 ppm; testigos 3.3 %. Cuando se evaluó el efecto insecticida del extracto aplicado por aspersión en concentraciones de 500, 750 y 1000 ppm, se consiguieron mortalidades de 18.33, 36.66 y 48.32 %, respectivamente. Ninguna de las concentraciones evaluadas alcanzó el cien por ciento de letalidad. En la prueba de semicampo, solo se logró una mortalidad de 9 %. Se evidenció que el extracto tiene un mejor efecto insecticida para el control de ejemplares inmaduros en estado larvario que sobre los adultos.

  3. The Effect of Experimental Denture Cleanser Solution Ricinus communis on Acrylic Resin Properties

    Directory of Open Access Journals (Sweden)

    Marina Xavier Pisani

    2010-09-01

    Full Text Available This study evaluated heat-polymerized (HPR and microwave-polymerized acrylic resins (MPR, after immersion in water, 1% hypochlorite and Ricinus communis solution (RC. Knoop hardness, color alteration, roughness and flexural strength tests were performed after obtaining the specimens and after time intervals of 15 (T15 and 183 (T183 days. Variations in data (Δ were submitted to ANOVA and Tukey tests (P = 0.05. For ΔT15 HPR there was greater variation in hardness when immersed in water (P = 0.00 and for MPR, after immersion in RC (P = 0.00. RC caused the greatest variation in roughness (P = 0.015. Color alteration was not significant (P = 24.46. Hypochlorite caused a decrease in flexural strength (P = 0.37. After ΔT183, hypochlorite and RC caused a decrease in HPR hardness value (P = 0.00. MPR showed the greatest variation in roughness (P = 0.01. HPR presented the most color alteration after immersion in RC (P = 0.214. Hypochlorite and RC caused the lowest flexural strength values for MPR (P = 0.89. RC caused alterations in resin properties, and was not shown to be superior to hypochlorite.

  4. Isolamento do alcalóide ricinina das folhas de Ricinus communis (Euphorbiaceae através de cromatografias em contracorrente Isolation of the alkaloid ricinine from the leaves of Ricinus communis (Euphorbiaceae through counter-current chromatography

    Directory of Open Access Journals (Sweden)

    Ana Cristina Leite

    2005-12-01

    Full Text Available Droplet counter-current chromatography, rotation locular counter-current chromatography and high-speed counter-current chromatography were applied to the preparative separation of the alkaloid ricinine from the dichloromethane extracts of Ricinus communis leaves. The solvent system used was composed of dichloromethane-methanol-water (93:35:72 v/v/v and all techniques led to the isolation of large amounts of the alkaloid. The best result was obtained through HSCCC, since the ricinine yield was respectively 50% and 30% higher than when using RLCCC or DCCC.

  5. Evaluation for yield and quality of oil from seven Ricinus communis varieties.

    Directory of Open Access Journals (Sweden)

    Paola Andrea Rivera-Brenes

    2015-12-01

    Full Text Available The objective of this work was to evaluate the yield and quality of oil from seven Ricinus communis varieties. The morphological properties (height of plant, productive branches, length of clusters, yield of seed, and oil quality. The evaluation was conducted at the Fabio Baudrit Moreno Experimental Station of the University of Costa Rica, Alajuela, Costa Rica, from September 2013 to April 2014. A randomized complete block design with a density of 5000 plants/ha was used for the evaluation. The varieties evaluated were ColBio RH 171,09, ColBio HR 205, ColBio HR 268, ColBioHR 157, 401, and NIC. The parameters evaluated showed significant difference (a<0.05. The seven varieties constituted all medium-sized plants. The average was four productive branches for all varieties. ColBio HR 268, ColBio HR 205, and ColBio HR 171 obtained the longer cluster. Stem diameter showed an average between 3 and 4 cm for the seven treatments. In relation toseed yield, variety NIC had the lowest value (860 kg/ha, while ColBio HR 171, 09, ColBio HR 205, and 268 had the highest yield with an average of 2377kg/ha. Oil content was higher for treatments 401 (88% and ColBio HR 171 (87%. The array 09 showed the highest content of ricinoleic acid (80%, followed by ColBio HR 268 (69% placing both also among the varieties with higer seed yield, but with lower oil content.

  6. Effect of methanol extract of Ricinus communis seed on reproduction of male rats

    Institute of Scientific and Technical Information of China (English)

    Yinusa Raji; Ahmed Kolade Oloyo; Ayodele Olufemi Morakinyo

    2006-01-01

    Aim: To investigate the effect of methanol extract of Ricinus communis seed (RCE) on male rats reproductive functions. Methods: Thirty-two male albino rats were divided into four groups. Groups 1, 2 and 3 were gavaged with 0.2 mL of 2.5 % tween 80 (RCE vehicle; control) or 20 mg/(kg.d) and 40 mg/(kg.d) of RCE, respectively, for 30 days, and group 4 was also gavaged with 40 mg/(kg·d) of RCE, but was allowed a recovery periold of 30 days.Five untreated female rats were cohabited with male rats in each group from day 25 of RCE treatment for 5 days,except group 4, where cohabitation began on day 25 of the recovery period. All male rats were sacrificed 24 h after the experiments. The female rats were laparatomized on day 19 of pregnancy and the number and weight of litters were recorded. Results: There was a significant decrease (P < 0.01) in the weight of the reproductive organs,sperm functions and serum levels of testosterone in RCE treated rats. There was disorganization in the cytoarchitecture of the testes, disruption of the seminiferous tubules and erosion of the germinal epithelium. The number and weight of litters of rats in groups 2 and 4 decreased significantly (P < 0.05) but no changes were observed in group 3. RCE caused no changes in liver, kidney, heart or body weights in male rats. Conclusion: RCE has a reversible negative impact on male reproductive functions, which appears to be mediated via gonadal disruption in testosterone secretion.

  7. Accumulation, selection and covariation of amino acids in sieve tube sap of tansy (Tanacetum vulgare) and castor bean (Ricinus communis): evidence for the function of a basic amino acid transporter and the absence of a γ-amino butyric acid transporter.

    Science.gov (United States)

    Bauer, Susanne N; Nowak, Heike; Keller, Frank; Kallarackal, Jose; Hajirezaei, Mohamad-Reza; Komor, Ewald

    2014-09-01

    Sieve tube sap was obtained from Tanacetum by aphid stylectomy and from Ricinus after apical bud decapitation. The amino acids in sieve tube sap were analyzed and compared with those from leaves. Arginine and lysine accumulated in the sieve tube sap of Tanacetum more than 10-fold compared to the leaf extracts and they were, together with asparagine and serine, preferably selected into the sieve tube sap, whereas glycine, methionine/tryptophan and γ-amino butyric acid were partially or completely excluded. The two basic amino acids also showed a close covariation in sieve tube sap. The acidic amino acids also grouped together, but antagonistic to the other amino acids. The accumulation ratios between sieve tube sap and leaf extracts were smaller in Ricinus than in Tanacetum. Arginine, histidine, lysine and glutamine were enriched and preferentially loaded into the phloem, together with isoleucine and valine. In contrast, glycine and methionine/tryptophan were partially and γ-amino butyric acid almost completely excluded from sieve tube sap. The covariation analysis grouped arginine together with several neutral amino acids. The acidic amino acids were loaded under competition with neutral amino acids. It is concluded from comparison with the substrate specificities of already characterized plant amino acid transporters, that an AtCAT1-like transporter functions in phloem loading of basic amino acids, whereas a transporter like AtGAT1 is absent in phloem. Although Tanacetum and Ricinus have different minor vein architecture, their phloem loading specificities for amino acids are relatively similar. PMID:24446756

  8. In Vitro Assessment of Cytotoxicity, Antioxidant, and Anti-Inflammatory Activities of Ricinus communis (Euphorbiaceae) Leaf Extracts.

    Science.gov (United States)

    Nemudzivhadi, Vhutshilo; Masoko, Peter

    2014-01-01

    Ricinus communis has been utilized traditionally as medicine to treat inflammatory related diseases including wounds, sores, and boils. The leaves of R. communis were sequentially extracted with n-hexane, dichloromethane, acetone, and methanol using serial exhaustive extraction method. Antioxidant activity of all crude extracts was quantitatively measured against 2,2'-azino-bis (3-ethylbenzothiazoline-6-sulphonic acid) free radical molecules using ABTS(+) assay. Cytotoxic effect and anti-inflammatory activity of R. communis leaves extracts were evaluated on Human Caucasian skin fibroblast and Raw 264.7 macrophage cell lines, respectively. Methanol extract had the highest percentage free radical (ABTS(+)) scavenging activity of 95% at 2.50 mg/mL, acetone 91%, dichloromethane 62%, and hexane the least (50%). Percentage scavenging activity of ABTS(+) free radical molecules increases with increase in concentrations of the plant extracts. Hexane and dichloromethane extracts had more than 90% cell viability at 100 µg/mL after 24 and 48 hours of exposure. Methanol extract had LC50 of 784 µg/mL after 24-hour exposure, hexane had 629.3 µg/mL and dichloromethane 573.6 µg/mL, and 544.6 µg/mL was the lowest with acetone extract. The study present the first report on the scavenging activity of R. communis leaf extracts against ABTS(+) radicals and cytotoxic effects on human Caucasian skin fibroblast cell lines. PMID:25477994

  9. In Vitro Assessment of Cytotoxicity, Antioxidant, and Anti-Inflammatory Activities of Ricinus communis (Euphorbiaceae Leaf Extracts

    Directory of Open Access Journals (Sweden)

    Vhutshilo Nemudzivhadi

    2014-01-01

    Full Text Available Ricinus communis has been utilized traditionally as medicine to treat inflammatory related diseases including wounds, sores, and boils. The leaves of R. communis were sequentially extracted with n-hexane, dichloromethane, acetone, and methanol using serial exhaustive extraction method. Antioxidant activity of all crude extracts was quantitatively measured against 2,2′-azino-bis (3-ethylbenzothiazoline-6-sulphonic acid free radical molecules using ABTS+ assay. Cytotoxic effect and anti-inflammatory activity of R. communis leaves extracts were evaluated on Human Caucasian skin fibroblast and Raw 264.7 macrophage cell lines, respectively. Methanol extract had the highest percentage free radical (ABTS+ scavenging activity of 95% at 2.50 mg/mL, acetone 91%, dichloromethane 62%, and hexane the least (50%. Percentage scavenging activity of ABTS+ free radical molecules increases with increase in concentrations of the plant extracts. Hexane and dichloromethane extracts had more than 90% cell viability at 100 µg/mL after 24 and 48 hours of exposure. Methanol extract had LC50 of 784 µg/mL after 24-hour exposure, hexane had 629.3 µg/mL and dichloromethane 573.6 µg/mL, and 544.6 µg/mL was the lowest with acetone extract. The study present the first report on the scavenging activity of R. communis leaf extracts against ABTS+ radicals and cytotoxic effects on human Caucasian skin fibroblast cell lines.

  10. Evaluación del rendimiento y calidad del aceite de siete variedades de Ricinus communis.

    Directory of Open Access Journals (Sweden)

    Paola Andrea Rivera-Brenes

    2015-12-01

    Full Text Available El objetivo de este trabajo consistió en evaluar el rendimiento y calidad del aceite en siete variedades de Ricinus communis. Se evaluaron las características morfológicas (altura de la planta, ramas productivas, longitud de racimos, rendimiento de la semilla y la calidad del aceite. La evaluación se llevó a cabo en la Estación Experimental Fabio Baudrit Moreno de la Universidad de Costa Rica, Alajuela, Costa Rica, durante los meses de setiembre de 2013 a abril de 2014. Se estableció un diseño de bloques completos al azar, con una densidad de 5000 plantas/ha. Las variedades evaluadas fueron ColBio HR 171, 09, ColBio HR 205, ColBio HR 268, ColBio HR 157, 401 y NIC. Los parámetros evaluados mostraron diferencia significativa (a<0,05. Las siete variedades mostraron todas las plantas de porte medio. El promedio de ramas productivas fue de cuatro para todas las variedades. La mayor longitud de racimo la obtuvieron las variedades ColBio HR 268, ColBio HR 205 y ColBio HR 171. El grosor del tallo mostró una media entre los 3 y 4 cm para los siete tratamientos. En cuanto a rendimiento de la semilla, la variedad NIC presentó el menor (860 kg/ha, mientras que ColBio HR 171, 09, ColBio HR 205 y ColBio 268 presentaron el mayor rendimiento con un promedio de 2377 kg/ha. El contenido de aceite fue mayor para los tratamientos 401 (88% y ColBio HR 171 (87%. La variedad 09 presentó el mayor contenido de ácido ricinoleico con 80%, seguido por ColBio HR 268 con 69% colocándose ambas también entre las variedades con mejor rendimiento de semilla, pero con los menores contenidos de aceite. 

  11. Expression profiles of genes related to carbohydrate metabolism provide new insights into carbohydrate accumulation in seeds and seedlings of Ricinus communis in response to temperature

    NARCIS (Netherlands)

    Ribeiro de Jesus, P.R.; Ligterink, W.; Hilhorst, H.W.M.

    2015-01-01

    Ricinus communis possesses a specific metabolic signature to adjust growth and developmental processes in response to temperature: carbohydrates are accumulated at low temperatures, whereas amino acids are accumulated at elevated temperatures. Our objective was to assess tissue-specific changes in t

  12. Amino acid profile of raw and locally processed seeds of Prosopis africana and Ricinus communis: potential antidotes to protein malnutrition

    Directory of Open Access Journals (Sweden)

    Chidi U. Igwe

    2012-04-01

    Full Text Available Background: Increasing incidence of malnutrition occasioned by high incidence of hunger,worsening food situation in the world, insufficient availability and high cost of animal protein sources, has necessitated extensive research into and use of alternative plant protein sources especially underexploited leguminous seeds.Methods: Flours from raw, boiled and fermented seeds of Prosopis africana and Ricinus communis were evaluated for crude protein and amino acid (AA profiles, and their protein qualities determined. Results: Fermentation improved the protein contents of raw seeds of P. africana and R. communis by 18.70% and 3.95% respectively. In the raw and fermented P. africana seeds, glutamate at 132.60 ± 1.30 and 182.70 ± 3.02 mg/g crude protein (mg/gcp was the most abundant amino acid (AA, while leucine (62.80 ± 0.60 and 79.50 ± 2.01 mg/gcp was the most concentrated essential amino acid (EAA. Aspartate (151.90 ± 2.01 and 170.10 ± 2.00 mg/gcp and arginine (72.80 ± 2.01 and 78.60 ± 2.00 mg/gcp were the most concentrated and abundant non-essential amino acid (NEAA and EAA in the raw and fermented samples of R. communisrespectively. The total AA concentrations (mg/gcp of raw and fermented P. africana were 733.00 and 962.60 respectively, while those of R. communis were 823.50 and 894.10 respectively. The total EAA contents (mg/gcp for P. africana were 311.00 (raw and 404.50 (fermented, and for R. communis; 401.10 (raw and 430.30 (fermented. Threonine was the limiting EAA in raw and fermented P. africana, whereas lysine was the limiting EAA in R. communis raw sample. Fermentation significantly (p<0.05 increased the individual AA compositions of P. africana and R. communis by 94% and 53% respectively, while boiling reduced these parameters significantly (p<0.05 by 47% and 82% respectively. Conclusion: P. africana and R. communis seeds are potentially important plant sources of protein and essential amino acids, and so could be of great

  13. Toxicity of ricin present in castor bean seeds

    OpenAIRE

    Nayanna Brunna da Silva Fonseca; Benito Soto-Blanco

    2014-01-01

    The castor bean (Ricinus communis) is a bush from Euphorbiacea family cultivated for obtaining oil from the seeds. This oil has broad industrial employment, particularly for biodiesel. However, castor bean seeds exhibit a potent toxin, ricin. It is a glycoprotein with highly toxic action of inactivating ribosomes. The toxic action of ricin is due to inhibition of protein synthesis in eukaryotic cells, causing cell death. Only one molecule of ricin that enters the cytosol is able to inactivate...

  14. Control of papaya fruits anthracnose by essential oil of Ricinus communis

    OpenAIRE

    César Luis Siqueira Júnior; Maria das Graças Machado Freire; Antônio Sérgio Nascimento Moreira; Maria Ligia Rodrigues Macedo

    2012-01-01

    The aim of this work was to investigate the potential of castor oil for the control of papaya diseases caused by the fungus Colletotrichum gloeosporioides and the bacterium Pseudomonas caricapapayae. The treatment with 1% castor oil did not significantly affect the fungal growth. The effectiveness of castor oil for the control of anthracnose was shown when 5% and 10% (v/v) were used in the assays resulting in reduced mycelial growth. Fungal sporulation was strongly inhibited at 10% (v/v) conc...

  15. Sintesis Surfaktan Metil Ester Sulfonat dari Sulfonasi Metil Ester Asam Lemak Minyak Kastor (Ricinus communis L)

    OpenAIRE

    Aritonang, Rianti E J

    2011-01-01

    Methyl ester sulfonate (MES) surfactant is an anionic surfactant which could be synthesized from oil. Surfactant have a capability to reduce surface tension, interface tension and elevate the stability of emulsion system. The material sources to produce surfactant was derived from petroleum oil, vegetables oil and animals fats. One of vegetables oil is polar castor oil, because it contained of ricinoleic acid as the major compound which has –OH group. Castor oil could be synthesize became ...

  16. Control of papaya fruits anthracnose by essential oil of Ricinus communis

    Directory of Open Access Journals (Sweden)

    César Luis Siqueira Júnior

    2012-02-01

    Full Text Available The aim of this work was to investigate the potential of castor oil for the control of papaya diseases caused by the fungus Colletotrichum gloeosporioides and the bacterium Pseudomonas caricapapayae. The treatment with 1% castor oil did not significantly affect the fungal growth. The effectiveness of castor oil for the control of anthracnose was shown when 5% and 10% (v/v were used in the assays resulting in reduced mycelial growth. Fungal sporulation was strongly inhibited at 10% (v/v concentration of essential oil. The studies with the fresh fruits treated with 5% (v/v castor oil in aqueous emulsions resulted in effective reduction of pathogen spread in these fruits. No lesion was found in the fruits treated with oil, when compared to the control fruits. Castor oil showed no effect against the P. caricapapayae when tested in vitro. These results suggested the potential use of the castor bean essential oil and its fatty acids constituents for the control of anthracnose in papaya fruits.

  17. Ricinus communis biocompatibility histological study in the nose of Cebus apella monkeys Avaliação histológica da biocompatibilidade do polímero da mamona no dorso nasal de macacos-pregos (Cebus apella

    Directory of Open Access Journals (Sweden)

    Paulo Cesar de Jesus Dias

    2009-06-01

    Full Text Available Bone tissue lesions can be caused by congenital and acquired factors, and result in nasal deformities with cosmetic and functional repercussion. Surgical treatment in these cases frequently requires complex reconstructions and the use of biomaterials. The polyurethane derived from castor beans (Ricinus communis has a favorable formulation in terms of ease of processing, flexibility, no emission of toxic vapors and low cost. Nonetheless, despite favorable results, studies about the use of castor beam polymer (Ricinus communis assessing tissue reaction on the nasal dorsum are still missing in the literature. AIM: the goal of the present investigation is to histologically assess the Ricinus communis polymer implant biocompatibility with the nasal dorsum. STUDY DESING: experimental. MATERIALS AND METHODS: we used four Cebus appela monkeys, in which we created a nasal dorsal defect in all the animals and there we placed the aforementioned implant. The animals were sacrificed 270 days after surgery and the samples were submitted to histological study. RESULTS: in the histology analysis we did not observe the presence of foreign body granulomas or phagocytic cells. We also observed a progressive bone formation and maturation. CONCLUSION: macroscopic and microscopic results showed that the castor oil polymer implant was biocompatible.Lesões do tecido ósseo podem ser causadas por fatores congênitos e adquiridos e resultar em deformidade nasal com repercussão estética e funcional. O tratamento cirúrgico desses casos requer reconstruções complexas e frequentemente o uso de biomateriais. O poliuretano derivado do óleo da mamona apresenta uma fórmula com aspectos favoráveis de processabilidade, flexibilidade de formulação, ausência de emissão de vapores tóxicos e baixo custo. Entretanto, a despeito dos resultados favoráveis, estudos referentes ao uso do polímero de mamona, avaliando a reação tecidual no dorso nasal, ainda não foram

  18. Bis(β-lactosyl-[60]fullerene as novel class of glycolipids useful for the detection and the decontamination of biological toxins of the Ricinus communis family

    Directory of Open Access Journals (Sweden)

    Hirofumi Dohi

    2014-07-01

    Full Text Available Glycosyl-[60]fullerenes were first used as decontaminants against ricin, a lactose recognition proteotoxin in the Ricinus communis family. A fullerene glycoconjugate carrying two lactose units was synthesized by a [3 + 2] cycloaddition reaction between C60 and the azide group in 6-azidohexyl β-lactoside per-O-acetate. A colloidal aqueous solution with brown color was prepared from deprotected bis(lactosyl-C60 and was found stable for more than 6 months keeping its red color. Upon mixing with an aqueous solution of Ricinus communis agglutinin (RCA120, the colloidal solution soon caused precipitations, while becoming colorless and transparent. In contrast, a solution of concanavalin A (Con A caused no apparent change, indicating that the precipitation was caused specifically by carbohydrate–protein interactions. This notable phenomenon was quantified by means of sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE, and the results were discussed in terms of detection and decontamination of the deadly biological toxin in the Ricinus communis family.

  19. Light and electron microscopic observations in connection with the developing pistil and seed-appendix (caruncle of Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Katherine Liszt

    2014-02-01

    Full Text Available The development of the particularly organized stigma and obturator, their fine structure, their function as well as the histological differentiation and the role of the seed-appendix i.e. the caruncle of Ricinus communis L. have been investigated in several developmental phases from the so called "gynoecial primordium" state to the ripe state, 'using the terminology introduced by S a t t 1 e r (1974. The stigma cells are characterized by dens cytoplasm, numerous vesicles mostly of ER origin, ribosomes and negatively stained mitochondria. Dilatation of ER, the appearance of electron opaque substances in it and between the plasmamembran and cell wall are frequent. The degenerating process of some stigma cells will start before the pollination because of autolysis. In the cells of the obturator and young caruncle however dictyosomes can be found more frequently than in stigma cells and the starch content of the ;plastids is remarkable. The thickening of the cell wall is connected with the function of these tissues.

  20. Rat sperm immobilisation effects of a protein from Ricinus communis (Linn.): an in vitro comparative study with nonoxynol-9.

    Science.gov (United States)

    Nithya, R S; Anuja, M M; Rajamanickam, C; Indira, M

    2012-12-01

    Previous study conducted in our department showed that 50% ethanolic extract of the root of Ricinus communis possess reversible antifertility effect and a 62-kDa protein (Rp) from this extract is responsible for the antifertility effects. In this study, we compared the spermicidal effect of this Rp with nonoxynol-9 (N-9) in vitro. The sperm immobilisation studies showed that 100 μg ml(-1) of Rp was able to immobilise the sperms completely within 30 s. Sperm revival test revealed that the spermicidal effect was irreversible. There was also a significant reduction in sperm viability and hypo-osmotic swelling in Rp and N-9 treated groups in comparison with the control. In Rp and N-9 treated groups, the number of acrosome-reacted cells was found to be high and also caused agglutination of the spermatozoa, indicating the loss of intactness of the plasma membrane, which was further supported by the significant reduction in the activity of membrane bound 5'-nucleotidase, acrosomal acrosin. In short, the protein Rp possesses spermicidal activity in vitro and its effects are similar to that of nonoxynol 9. PMID:22486240

  1. Dynamics and control of phloem loading of indole-3-acetic acid in seedling cotyledons of Ricinus communis.

    Science.gov (United States)

    Tamas, Imre A; Davies, Peter J

    2016-08-01

    During seed germination, sugars and auxin are produced from stored precursors or conjugates respectively, and transported to the seedling axis. To elucidate the mode of travel of indole-3-acetic acid (IAA) into the phloem, a solution of [(3)H]IAA, together with [(14)C]sucrose, was injected into the endosperm cavity harboring the cotyledons of germinating seedlings of Ricinus communis Phloem exudate from the cut hypocotyl was collected and the radioactivity recorded. Sucrose loading into the phloem was inhibited at higher IAA levels, and the rate of filling of the transient pool(s) was reduced by IAA. IAA was detected within 10min, with the concentration increasing over 30min and reaching a steady-state by 60min. The kinetics indicated that phloem loading of IAA involving both an active, carrier-based, and a passive, diffusion-based component, with IAA traveling along a pathway containing an intermediary pool, possibly the protoplasts of mesophyll cells. Phloem loading of IAA was altered by sucrose, K(+), and a range of non-specific and IAA-specific analogs and inhibitors in a manner that showed that IAA moves into the phloem from the extra cotyledonary solution by multiple pathways, with a carrier-mediated pathway playing a principal role. PMID:27371947

  2. Growth and carbon assimilation limitations in Ricinus communis (Euphorbiaceae under soil water stress conditions Crescimento e limitações à assimilação de carbono em Ricinus communis (Euphorbiaceae sob condições de estresse hídrico do solo

    Directory of Open Access Journals (Sweden)

    Tanise Luisa Sausen

    2010-09-01

    Full Text Available Water availability may influence plant carbon gain and growth, with large impacts on plant yield. Ricinus communis (L., a drought resistant species, is a crop with increasing economic importance in Brazil, due to its use in chemical industry and for the production of biofuels. Some of the mechanisms involved in this drought resistance were analyzed in this study by imposing progressive water stress to pot-grown plants under glasshouse conditions. Water withholding for 53 days decreased soil water gravimetric content and the leaf water potential. Plant growth was negatively and significantly reduced by increasing soil water deficits. With irrigation suspension, carbon assimilation and transpiration were reduced and remained mostly constant throughout the day. Analysis of A/Ci curves showed increased stomatal limitation, indicating that limitation imposed by stomatal closure is the main factor responsible for photosynthesis reduction. Carboxylation efficiency and electron transport rate were not affected by water stress up to 15 days after withholding water. Drought resistance of castor bean seems to be related to a pronounced, early growth response, an efficient stomatal control and the capacity to keep high net CO2 fixation rates under water stress conditions.A disponibilidade hídrica pode influenciar o ganho de carbono e o crescimento, com grande impacto na produtividade das plantas. Ricinus communis (L., uma espécie resistente à seca, é uma cultura de grande importância econômica no Brasil, devido ao seu uso na indústria química e para a produção de biocombustíveis. Alguns dos mecanismos envolvidos na resistência à seca desta espécie foram analisados através de um progressivo estresse hídrico em plantas cultivadas em vasos sob condições de casa de vegetação. A suspensão da irrigação por 53 dias decresceu o conteúdo gravimétrico de água no solo e o potencial hídrico das folhas. O crescimento das plantas foi

  3. Synthesis of amides and sulfonamides of β-D- galactopyranosylamine and β-lactosylamine and evaluation of their interactions with the lectins from Erythrina cristagalli and Ricinus communis

    International Nuclear Information System (INIS)

    We report herein the synthesis of some β-D-galactopyranosylamine and β-lactosylamine amides and sulfonamides. The interactions of these compounds with lectins from the seeds of Erythrina cristagalli (LEC) and Ricinus communis (RCA120) were evaluated in a hemagglutination inhibitory activity assay. D-Galactose and lactose were used as reference compounds. The β-lactosylamine amides and sulfonamides were nearly as active as lactose in inhibiting LEC mediated hemagglutination and were less active against RCA120 agglutinin. The β-D-galactopyranosylamine amides and sulfonamides were, with one exception, considerably less active than D-galactose in the assay with both lectins. (author)

  4. Comportamiento ecofisiológico de variedades de higuerilla (Ricinus communis L.) para la producción sostenible de aceite y biodiesel en diferentes agroecosistemas colombianos

    OpenAIRE

    Córdoba Gaona, Oscar de Jesús

    2013-01-01

    Resumen: Higuerilla (Ricinus communis L.) es una especie cultivada en todas las regiones tropicales y subtropicales del mundo, y ha sido recomendada para altitudes no mayores a los 1.500 msnm, ya que se ha pensado que, ambientes fríos afectan el desempeño de la especie, al alterar el crecimiento y desarrollo del vegetal, y al reducir la cantidad y calidad final de aceite. Por lo anterior, a través de la presente investigación, se determinó el comportamiento fisiológico de la higuerilla en dif...

  5. RESTORATIVE ASPECT OF CASTOR PLANT ON MAMMALIAN PHYSIOLOGY: A REVIEW

    OpenAIRE

    Attila Kádasi; Zuzana Baková; Sirotkin, Alexander V; Anupam Das Talukdar; Shubhadeep Roychoudhury; Manabendra Dutta Choudhury; Sushmita Nath; Nora Maruniaková; Adriana Kolesárová

    2011-01-01

    The castor plant (Ricinus communis L.) is a robust perennial shrub of Euphorbiaceae family and different parts of the plant are widely used by various communities and forest dwellers in many regions of the world for treating a variety of ailments. About 80% of world population is still dependent on traditional herbal medicines. The plant is documented to possess beneficial effects as anti-oxidant, antifertility, anti inflammatory, antimicrobial, central nervous system stimulant, anti diabetic...

  6. Insight into the sialome of the castor bean tick, Ixodes ricinus

    Czech Academy of Sciences Publication Activity Database

    Chmelař, Jindřich; Anderson, J. M.; Mu, J.; Jochim, R. C.; Valenzuela, J. G.; Kopecký, Jan

    2008-01-01

    Roč. 9, č. 233 (2008), s. 1-21. ISSN 1471-2164 R&D Projects: GA MŠk(CZ) LC06009; GA ČR GA524/05/0811 Institutional research plan: CEZ:AV0Z60220518 Keywords : Ixodes ricinus * cDNA libraries * bioinformatics * tick feeding Subject RIV: EC - Immunology Impact factor: 3.926, year: 2008

  7. Studi Alkoksilasi Dengan Gliserol Terhadap Hasil Epoksidasi Metil Risinoleat Yang Diperoleh Dari Minyak Jarak (Ricinus communis Linn).

    OpenAIRE

    Ginting, Dina Ocha

    2011-01-01

    Polyhidroxy compound (polyol) derivative from fatty acid is used as material of polymer compound such as polyurethane, polyesther and ubstituent material of petrochemical industry. Castor oil that isolated from castor seed reacted with methanol using sulfate acid catalys on benzene solvent in reflux condition produced fatty acid methyl ester castor oil. Methyl ricinoleic has been separated from mixture of fatty acid methyl ester castor oil using column chromatography with hexan...

  8. Antimicrobial activity of complete denture cleanser solutions based on sodium hypochlorite and Ricinus communis – a randomized clinical study

    Science.gov (United States)

    SALLES, Marcela Moreira; BADARÓ, Maurício Malheiros; de ARRUDA, Carolina Noronha Ferraz; LEITE, Vanessa Maria Fagundes; da SILVA, Cláudia Helena Lovato; WATANABE, Evandro; OLIVEIRA, Viviane de Cássia; PARANHOS, Helena de Freitas Oliveira

    2015-01-01

    ABSTRACT To preserve oral health and to maintain the prosthetic devices, it is important not only to improve the properties of commonly known hygiene products, but also to investigate new materials with antimicrobial action. Objectives This study evaluated the antimicrobial activity of sodium hypochlorite (0.25% and 0.50%) and 10% Ricinus communis’ solutions against specific microorganisms. Material and Methods Sixty four maxillary complete denture wearers were instructed to brush their dentures three times a day and to soak them (20 min/day) in the solutions: SH1: 0.25% sodium hypochlorite; SH2: 0.5% sodium hypochlorite; RC: 10% R. communis oil; and C: 0.85% saline (control). The solutions were used for 7 days in a randomized sequence. Following each period of use, there was a 1-week washout period. Antimicrobial activity was determined by Colony Forming Units (CFU) counts of Streptococcus mutans, Candida spp., and gram-negative microorganisms. For collecting biofilm, the internal surface of maxillary dentures was brushed with saline solution, and biofilm suspension obtained. After dilutions (100 - 10-3), aliquots were seeded in Mitis salivarius, CHROMagar Candida®, and MacConkey agar for detecting S. mutans, Candida spp., or gram-negative microorganisms, respectively. After incubation, colonies were counted, and CFU/mL values were calculated. Then, transformation - log10 (CFU+1) - data were analyzed using the Friedman test (α=0.05). Results showed significant differences between the solutions (p<0.001). Results All three solutions showed antimicrobial activity against S. mutans. Against Candida spp., RC and SH1 solutions showed similar effect while SH2 showed superior activity. SH1 and SH2 solutions showed antimicrobial action against gram-negative microorganisms. The Candida species most frequently isolated was C. albicans, followed by C. tropicalis and C. glabrata. Conclusions The 0.5% sodium hypochlorite solution was the most effective and might be used to

  9. Interaction Effect Between Herbivory and Plant Fertilization on Extrafloral Nectar Production and on Seed Traits: An Experimental Study With Ricinus communis (Euphorbiaceae).

    Science.gov (United States)

    De Sibio, P R; Rossi, M N

    2016-08-01

    It is known that the release of volatile chemicals by many plants can attract the natural enemies of herbivorous insects. Such indirect interactions are likely when plants produce nectar from their extrafloral nectaries, and particularly when the production of extrafloral nectar (EFN) is induced by herbivory. In the present study, we conducted experiments to test whether foliar herbivory inflicted by Spodoptera frugiperda Smith (Noctuidae) increases nectar production by extrafloral nectaries on one of its host plants, Ricinus communis L. (Euphorbiaceae). Due to the current economic importance of R. communis, we also investigated whether the following seed traits-water content, dry mass, and essential oil production-are negatively affected by herbivory. Finally, we tested whether or not nectar production and seed traits are influenced by plant fertilization (plant quality). We found that nectar production was increased after herbivory, but it was not affected by the type of fertilization. Seed dry mass was higher in plants that were subjected to full fertilization, without herbivory; plants maintained in low fertilization conditions, however, had higher seed mass when subjected to herbivory. The same inverted pattern was observed for oil production. Therefore, our results suggest that EFN production in R. communis may act as an indirect defense strategy against herbivores, and that there is a trade-off between reproduction and plant growth when low-fertilized plants are subjected to herbivory. PMID:27247300

  10. EVALUATION OF ANTIULCER ACTIVITY OF CASTOR OIL IN RATS

    OpenAIRE

    Rachhadiya Rakesh M.; Kabra Mahaveer Prasad; Shete Rajkumar V

    2011-01-01

    To study the antiulcer activity of oil of Ricinus communis seed using different models of gastric ulceration in rats. Antiulcer activity of castor oil was studied in rats by administration of ethanol or aspirin or by pyloric ligation. Castor oil was administered in the dose of 500 mg/kg and 1000 mg/kg orally 30 min prior to ulcer induction. The antiulcer activity was assessed by determining and comparing the ulcer index in the test drug group with that of the ulcerated control group. Gastric ...

  11. Insight into the sialome of the castor bean tick, Ixodes ricinus

    Directory of Open Access Journals (Sweden)

    Valenzuela Jesus G

    2008-05-01

    Full Text Available Abstract Background In recent years, there have been several sialome projects revealing transcripts expressed in the salivary glands of ticks, which are important vectors of several human diseases. Here, we focused on the sialome of the European vector of Lyme disease, Ixodes ricinus. Results In the attempt to describe expressed genes and their dynamics throughout the feeding period, we constructed cDNA libraries from four different feeding stages of Ixodes ricinus females: unfed, 24 hours after attachment, four (partially fed and seven days (fully engorged after attachment. Approximately 600 randomly selected clones from each cDNA library were sequenced and analyzed. From a total 2304 sequenced clones, 1881 sequences forming 1274 clusters underwent subsequent functional analysis using customized bioinformatics software. Clusters were sorted according to their predicted function and quantitative comparison among the four libraries was made. We found several groups of over-expressed genes associated with feeding that posses a secretion signal and may be involved in tick attachment, feeding or evading the host immune system. Many transcripts clustered into families of related genes with stage-specific expression. Comparison to Ixodes scapularis and I. pacificus transcripts was made. Conclusion In addition to a large number of homologues of the known transcripts, we obtained several novel predicted protein sequences. Our work contributes to the growing list of proteins associated with tick feeding and sheds more light on the dynamics of the gene expression during tick feeding. Additionally, our results corroborate previous evidence of gene duplication in the evolution of ticks.

  12. Estudio Químico, Micrográfico y Morfológico del Ricinus communis L., y su Aplicación en Pulpa Blanqueable

    Directory of Open Access Journals (Sweden)

    Teófilo Escoto García

    2014-01-01

    Full Text Available México posee una gran gama de especies vegetales no maderables o arbustivos, de los cuales se sabe muy poco, y para el caso del Ricinus communis L., existen trabajos sobre el uso de la semilla en biocombustibles y en la obtención de celulosa a partir del tallo. Con estos antecedentes se recolectó un espécimen de Ricinus communis , se descortezó y astilló para llevar a cabo los análisis de composición química, micrográfico y morfológico del tejido leñoso; aplicando además un proceso químico a la sosa para la obtención de celulosa blanqueable mediante secuencia OD/OP/D, evaluando las propiedades de resistencia fisicomecánica y viscosidad, así como blancura y opacidad. La composición química indica que el contenido en holocelulosa (85.0 % y alfa celulosa (66.3 % se encuentra dentro de los parámetros para papel. El análisis micrográfico reportó la relación de Runkel con un grado II y el análisis morfológico reportó que las fibras tienen una longitud promedio de 1.057 mm y pared de 4.4 m de espesor; con gran posibilidad de producir papel de buena calidad. Las condiciones para la obtención de pulpa se dan en 25 % reactivo, 160 °C, 120 minutos de cocción y 26 minutos de refinación. El tratamiento de blanqueo reportó un grado de blancura de 86.8 % y una viscosidad de 10.7 cp. Concluyendo que de acuerdo a sus componentes químicos, características micrográficas y morfológicas el Ricinus communis L ., técnicamente es viable para su aplicación en pulpa blanqueable.

  13. Secondary seed dispersal of Ricinus communis Linnaeus (Euphorbiaceae) by ants in secondary growth vegetation in Minas Gerais Dispersão secundária de sementes de Ricinus communis Linnaeus (Euphorbiaceae) por formigas em vegetação secundária em Minas Gerais

    OpenAIRE

    Mário Marcos do Espírito Santo

    2007-01-01

    In this study, I tested the efficacy of ants as secondary seed dispersers of Ricinus communis in southeastern Brazil. In a natural population of 143 individuals, I determined the ballistic dispersal distance for 62 seeds and 100 additional seeds were experimentally offered to ants in groups of ten seeds along a transect of 50 m. Fifty-three seeds were removed by ants, mainly by the leafcutter Atta sexdens (90.4%). The dispersal distance by ants was high, compared to the global average (4.38 m...

  14. In vitro antibacterial activity of leaf extracts of Zehneria scabra and Ricinus communis against Escherichia coli and methicillin resistance Staphylococcus aureus

    Institute of Scientific and Technical Information of China (English)

    Bereket Abew; Samuel Sahile; Feleke Moges

    2014-01-01

    Objective: To evaluate the antibacterial activities of the crude leaves extracts of Zehneria scabra (Z. scabra) and Ricinus communis (R. communis) against Escherichia coli (E. coli), Staphylococcusaureus (S. aureus) and methicillin resistance S. aureus. Methods: The crude powdered leaves of Z. scabra and R. communis were extracted successively by organic solvents in increasing polarity [benzene, chloroform:acetone (1:1), 70% alcohol and distilled water]. The antibacterial susceptibility of the crude leaves extracts of were tested against standard strains of E. coli (ATCC 25922) and S. aureus (ATCC 2923) and clinical isolates of E. coli, S.aureus and methicillin resistance S. aureus using agar well diffusion method. Results: In Z. scabra and R. communis leaf extracts, the most sensitive standard strain was S. aureus with an inhibition zone of (14.00±1.20) mm and (15.90±2.13) mm, respectively. The minimum inhibitory concentration (MIC) values of Z. scabra extracts against test organisms ranged from 1.95 mg/mL for extract 3 in clinical and standard strains of S. aureus to 250 mg/mL for extract 1 and 4 in clinical and standard strains of E. coli. The MIC values of R. communis extracts against test organisms ranged from 1.95 mg/mL for extract 2 and 3 standard strains of S. aureus to 250 mg/mL for extract 1 in clinical isolate of E. coli. Most of the minimum bactericidal concentration and MIC values of plant extracts were almost similar particularly in R. communis, or minimum bactericidal concentration equal to one dilution factor less than MIC value of the extracts mainly in Z. scabra. Conclusions: The potency of plant extracts against test organisms were depend on different organic solvents used. Clinical isolate of bacterial pathogens showed less zones of diameter compared to the standard strains. Gram-positive had wide inhibition zones than Gram-negative bacteria. Further studies should be carried out to isolate the pure compounds and standardization of the methods

  15. In vitro antibacterial activity of leaf extracts of Zehneria scabra and Ricinus communis against Escherichia coli and methicillin resistance Staphylococcus aureus

    Institute of Scientific and Technical Information of China (English)

    Bereket; Abew; Samuel; Sahile; Feleke; Moges

    2014-01-01

    Objective:To evaluate the antibacterial activities of the crude leaves extracts of Zehneria scabra(Z.scabra) and Ricinus communis(R.communis) against Escherichia coli(E.coli).Staphylococcus aureus(S.aureus) and methicillin resistance 5.aureus.Methods:The crude powdered leaves of Z.scabra and R.communis were extracted successively by organic solvents in increasing polarity[benzene,chloroform:acetone(1:1),70%alcohol and distilled water].The antibacterial susceptibility of the crude leaves extracts of were tested against standard strains of E.coli(ATCC 25922) and S.aureus(ATCC 2923) and clinical isolates of E.coli,S.aureus and methicillin resistance 5.aureus using agar well diffusion method.Results:In Z.scabra and R.communis leaf extracts,the most sensitive standard strain was S.aureus with an inhibition zone of(14.00±1.20) mm and(15.90±2.13) mm,respectively.The minimum inhibitory concentration(MIC) values of Z.scabra extracts against test organisms ranged from 1.95mg/mL for extract 3 in clinical and standard strains of 5.aureus to 250 mg/mL for extract 1 and 4in clinical and standard strains of E.coli.The MIC values of R.communis extracts against test organisms ranged from 1.95 mg/mL for extract 2 and 3 standard strains of S.aureus to 250 mg/mL for extract 1 in clinical isolate of E.coli.Most of the minimum bactericidal concentration and MIC values of plant extracts were almost similar particularly in R.communis,or minimum bactericidal concentration equal to one dilution factor less than MIC value of the extracts mainly in Z.scabra.Conclusions:The potency of plant extracts against test organisms were depend on different organic solvents used.Clinical isolate of bacterial pathogens showed less zones of diameter compared to the standard strains.Gram-positive had wide inhibition zones than Gram-negative bacteria.Further studies should be carried out to isolate the pure compounds and standardization of the methods of plant extracts for an in vitro testing.

  16. Ectopic overexpression of castor bean LEAFY COTYLEDON2 (LEC2) in Arabidopsis triggers the expression of genes that encode regulators of seed maturation and oil body proteins in vegetative tissues ☆

    OpenAIRE

    Hyun Uk Kim; Su-Jin Jung; Kyeong-Ryeol Lee; Eun Ha Kim; Sang-Min Lee; Kyung Hee Roh; Jong-Bum Kim

    2013-01-01

    The LEAFY COTYLEDON2 (LEC2) gene plays critically important regulatory roles during both early and late embryonic development. Here, we report the identification of the LEC2 gene from the castor bean plant (Ricinus communis), and characterize the effects of its overexpression on gene regulation and lipid metabolism in transgenic Arabidopsis plants. LEC2 exists as a single-copy gene in castor bean, is expressed predominantly in embryos, and encodes a protein with a conserved B3 domain, but dif...

  17. Optimization of Preparation of Activated Carbon from Ricinus communis Leaves by Microwave-Assisted Zinc Chloride Chemical Activation: Competitive Adsorption of Ni2+ Ions from Aqueous Solution

    Directory of Open Access Journals (Sweden)

    M. Makeswari

    2013-01-01

    Full Text Available The preparation of activated carbon (AC from Ricinus communis leaves was investigated in this paper. Orthogonal array experimental design method was used to optimize the preparation of AC using microwave assisted zinc chloride. Optimized parameters were radiation power of 100 W, radiation time of 8 min, concentration of zinc chloride of 30% by volume, and impregnation time of 24 h, respectively. The surface characteristics of the AC prepared under optimized conditions were examined by pHZPC, SEM-EDAX, XRD, and FTIR. Competitive adsorption of Ni2+ ions on Ricinus communis leaves by microwave assisted zinc chloride chemical activation (ZLRC present in binary and ternary mixture was compared with the single metal solution. The effects of the presence of one metal ion on the adsorption of the other metal ion were investigated. The experimental results indicated that the uptake capacity of one metal ion was reduced by the presence of the other metal ion. The extent of adsorption capacity of the binary and ternary metal ions tested on ZLRC was low (48–69% as compared to single metal ions. Comparisons with the biosorption of Ni2+ ions by the biomass of ZLRC in the binary (48.98–68.41%-~Ni-Cu and 69.76–66.29%-~Ni-Cr and ternary solution (67.32–57.07%-~Ni–Cu and Cr could lead to the conclusion that biosorption of Ni2+ ions was reduced by the influence of Cu2+ and Cr3+ ions. The equilibrium data of the adsorption was well fitted to the Langmuir isotherm. The adsorption process follows the pseudo-second-order kinetic model.

  18. Glycinergic-Fipronil Uptake Is Mediated by an Amino Acid Carrier System and Induces the Expression of Amino Acid Transporter Genes in Ricinus communis Seedlings.

    Science.gov (United States)

    Xie, Yun; Zhao, Jun-Long; Wang, Chuan-Wei; Yu, Ai-Xin; Liu, Niu; Chen, Li; Lin, Fei; Xu, Han-Hong

    2016-05-18

    Phloem-mobile insecticides are efficient for piercing and sucking insect control. Introduction of sugar or amino acid groups to the parent compound can improve the phloem mobility of insecticides, so a glycinergic-fipronil conjugate (GlyF), 2-(3-(3-cyano-1-(2,6-dichloro-4-(trifluoromethyl)phenyl)-4-((trifluoromethyl)sulfinyl)-1H-pyrazole-5-yl)ureido) acetic acid, was designed and synthesized. Although the "Kleier model" predicted that this conjugate is not phloem mobile, GlyF can be continually detected during a 5 h collection of Ricinus communis phloem sap. Furthermore, an R. communis seedling cotyledon disk uptake experiment demonstrates that the uptake of GlyF is sensitive to pH, carbonyl cyanide m-chlorophenylhydrazone (CCCP), temperature, and p-chloromercuribenzenesulfonic acid (pCMBS) and is likely mediated by amino acid carrier system. To explore the roles of amino acid transporters (AATs) in GlyF uptake, a total of 62 AAT genes were identified from the R. communis genome in silico. Phylogenetic analysis revealed that AATs in R. communis were organized into the ATF (amino acid transporter) and APC (amino acid, polyaminem and choline transporter) superfamilies, with five subfamilies in ATF and two in APC. Furthermore, the expression profiles of 20 abundantly expressed AATs (cycle threshold (Ct) values AAT genes, RcLHT6, RcANT15, RcProT2, and RcCAT2, were induced by the GlyF treatment in R. communis seedlings. On the basis of the observation that the expression profile of the four candidate genes is similar to the time course observation for GlyF foliar disk uptake, it is suggested that those four genes are possible candidates involved in the uptake of GlyF. These results contribute to a better understanding of the mechanism of GlyF uptake as well as phloem loading from a molecular biology perspective and facilitate functional characterization of candidate AAT genes in future studies. PMID:27092815

  19. Implantes de resina de poliuretana vegetal (Ricinus communis na tração linear, fixação e fusão vertebral no cão: estudo experimental Implants of Ricinus communis polyurethane resin in distraction, fixation and vertebral fusion in dogs: experimental study

    Directory of Open Access Journals (Sweden)

    M.G. Laranjeira

    2004-10-01

    Full Text Available Placa e espaçador de polímero derivado do óleo de mamona (PDOM (Ricinus communis foram avaliados clínica, radiográfica e histologicamente na tração linear, fixação e fusão vertebral cervical em 20 cães adultos, sem raça definida, pesando entre 17 e 22kg. Foram sacrificados quatro animais aos 10, 30, 60, 90 e 120 dias de pós-operatório. Após exposição da coluna cervical, por acesso ventral, o disco intervertebral de C4-C5 foi fenestrado e a abordagem ao canal medular foi feita por meio de fenda óssea. Um espaçador de PDOM foi colocado preenchendo o defeito ósseo. Os corpos vertebrais C4-C5 foram fixados com placa do mesmo material, utilizando-se dois parafusos corticais em cada corpo vertebral. Apenas um animal apresentou déficit neurológico no pós-operatório imediato. Radiograficamente as vértebras mostravam-se normais e alinhadas, sem colapso do espaço intervertebral, porém não houve neoformação óssea entre as vértebras. Ao exame mielográfico, não houve compressão da medula espinhal. Os implantes foram efetivos em manter a tração linear e fixação das vértebras cervicais e não ocorreu a fusão vertebral.Clinical, radiographic and histological evaluation of plate and biomechanical spacer of Ricinus communis polyurethane resin were performed in distraction, fixation and vertebral cervical fusion in 20 adult dogs, weighting between 17 and 22kg. Four animals were euthanized at 10, 30, 60, 90 and 120 days after surgery. After ventral exposition of cervical spine, cervical disk fenestration was performed on intervertebral spaces C4-C5 and a slot was created. A biomechanical spacer of Ricinus communis polyurethane resin was placed to fill bone defect. C4-C5 spinous processes were fixed with plate of the same material, utilizing two cortical screws in each spinal process. Only one animal had neurological signs immediately after surgery. Radiographic examination indicated that vertebrae were normal and aligned

  20. Simultaneous allergen inactivation and detoxification of castor bean cake by treatment with calcium compounds

    OpenAIRE

    K.V. Fernandes; Deus-de-Oliveira, N.; Godoy, M.G.; Z.A.S. Guimarães; V.V. Nascimento; de Melo, E.J.T.; Freire, D. M.G.; M. Dansa-Petretski; O.L.T. Machado

    2012-01-01

    Ricinus communis L. is of great economic importance due to the oil extracted from its seeds. Castor oil has been used for pharmaceutical and industrial applications, as a lubricant or coating agent, as a component of plastic products, as a fungicide or in the synthesis of biodiesel fuels. After oil extraction, a castor cake with a large amount of protein is obtained. However, this by-product cannot be used as animal feed due to the presence of toxic (ricin) and allergenic (2S albumin) protein...

  1. Estudo da atividade mutagênica das plantas, Euphorbia milii Des Moulins e Ricinus communis L através do teste de Allium cepa

    Directory of Open Access Journals (Sweden)

    Sueli A. da Silva

    2009-06-01

    Full Text Available O objetivo deste trabalho foi avaliar a mutagenicidade e o grau de toxicidade de duas plantas tóxicas, a "mamona" (Ricinus communis e a "coroa-de-cristo" (Euphorbia milii, utilizando infusões das sementes de mamona e o látex da coroa-de-cristo, em células meristemáticas de Allium cepa. Foram analisados: o índice mitótico (IM, as anomalias do ciclo mitótico (ACM, anomalias interfásicas, (AI e o total de anomalias (TA. As soluções testes foram preparadas em três concentrações: MT1 - 0,5 g/l, MT2 - 1,0 g/l, MT3 - 2,0 g/l, e MT4 como controle. Da coroa-de-cristo extraiu-se o látex e dissolveu-se em água destilada nas concentrações CT1 -0,5 ml/l, CT2 - 1,0 ml/l, CT3 - 2,0 ml/l, e CT4 controle. Os resultados constataram que somente a mamona aumentou a freqüência de anomalias do ciclo mitótico, assim como, as anomalias interfásicas, demonstrando, dessa forma, uma ação tóxica para o material genético, através do teste de Allium cepa.

  2. Preliminary clinical investigation of the contraceptive efficacy and chemical pathological effects of RICOM-1013-J of Ricinus communis var minor on women volunteers.

    Science.gov (United States)

    Isichei, C O; Das, S C; Ogunkeye, O O; Okwuasaba, F K; Uguru, V E; Onoruvwe, O; Olayinka, A O; Dafur, S J; Ekwere, E O; Parry, O

    2000-02-01

    The seeds of Ricinus communis Linn, RICOM-1013-J, administered as a single oral dose of 2.3-2.5 g once per 12 months protected against pregnancy in 50 women volunteers for a period of one year. The antifertility and contraceptive efficacy of the seed was demonstrated in this study. Clinical observation revealed very minimal side effects. Some of the side effects investigated included headache, nausea, vomiting, weight gain, loss of appetite, raised blood pressure and dysmenorrhoea. Furthermore, both the renal and liver functions were not affected as revealed by urea, electrolyte and creatinine values as well as total bilirubin, conjugated bilirubin, serum albumin, total protein and transaminases values when compared with control values. In addition cholesterol and phospholipids were not significantly altered. When all these results are considered together, it seems unlikely that the antifertility and contraceptive efficacy of RICOM-1013-J is due to hormonal mechanisms alone since side effects, renal and liver function, and cholesterol effects attributable to oestrogen and/or progesterone were minimal in the volunteers. PMID:10641046

  3. Effect of the extract of Ricinus communis L. on the osmotic fragility, labeling of red blood cells with Technetium-99m and morphology of the cells

    Directory of Open Access Journals (Sweden)

    Kristiana Cerqueira Mousinho

    2008-12-01

    Full Text Available The aim of this study was to evaluate the influence of the proteic extract of R. communis on the cell physiology by the osmotic fragility, labeling of the blood elements with the 99mTc and cell morphology. To evaluate the osmotic fragility, the blood samples of the Wistar rats were incubated with the concentrations of R. communis and with the solutions of NaCl (0.4; 0.7; 0.9%. In the labeling of the blood elements procedure, the rat blood was treated with a solution of Tc-99m and TCA at 5%, determining the rate of radioactivity (%ATI in the plasma (P and in the red blood cells (RBC. The soluble and insoluble fractions of the plasma were also evaluated. The cells morphology submitted to the extract was evaluated by the optical microscopy (x40. The results indicated that the rate of the hemolysis increased in the presence of 0.125 mg/mL of the extract. There was a decay of 49.69% in the rate of ATI in the insoluble fraction of the cells, with the morphological alterations in the red blood cells. These results suggested that the extract changed the capability of binding of the red blood cells due to the stannous ion oxidation, modifying the cells structure.Produtos naturais são usados freqüentemente por muitas pessoas no tratamento do câncer. O Ricinus communis L é uma Euforbiaceae que apresenta propriedades laxativas, purgativas e antitumorais. O objetivo deste trabalho é estudar a influência da fração protéica do extrato hidroalcoólico de R. communis L. na fisiologia celular através da fragilidade osmótica, da marcação de elementos sanguíneo com 99mTc e da morfologia celular. Para avaliar a fragilidade osmótica, amostras de sangue de ratos Wistar foram incubadas com concentrações de R. communis e com soluções de NaCl (0,4; 0,7; 0,9%. No procedimento de marcação de elementos sanguíneos, as amostras de sangue foram tratadas com solução de Tc-99m e TCA à 5%, determinando o percentual de radioatividade (%ATI no plasma (P e

  4. Purification and Biochemical Characterisation of Ricin from Castor Seeds

    Directory of Open Access Journals (Sweden)

    Om Kumar

    2004-07-01

    Full Text Available Ricin is a highly toxic plant toxin of Ricinus comtnunis seeds, commonly known as castor seeds. The toxin was extracted and purified using affinity and size exclusion  chromatography. The purity of ricin was evaluated by the sodium dodecylsulphate-polyacrylamide gel electrophoresis. Purified ricin gives a single band under non-reduced condition and two bands under reduced condition. The molecular weight of ricin was 65,0000 approx. The subunit structure of ricin on treatment with p-mercaptoethanol (1 % at molecular level revealed that the reducing agent converts ricin into two peptides. The molecular weight of these two peptides was estimated to be 34000 and 32000. The western-blot analysis revealed two dots for its two peptides in 29 kDa to 36 kDa regions. The heamagglutination litres for ricin and Ricinus communis agglutinins were 1:8 and 1:256. The purity of purified ricin was further confirmed by the electrophoresis and the western-blot analysis. The Indian variety of castor seeds, known as Ricinus communis used in this study, contains approx. 0.12 per cent ricin.

  5. Induced mutations in castor

    International Nuclear Information System (INIS)

    Castor (Ricinus communis L.) is an important oilseed crop in India. To create variability mutations were induced in two cultivars 'TMV5' (maturing in 130-140 days) and 'CO1' (perennial type). Gamma rays and diethyl sulphate and ethidium bromide were used for seed treatment. Ten doses, from 100 to 1000 Gy were employed. For chemical mutagenesis five concentrations of mutagenes from 10 to 50 mM were tried. No economic mutants could be isolated after treatment with the chemical mutagens. The following economic mutants were identified in the dose 300 Gy of gamma rays. Annual types from perennial CO 1 castor CO 1 is a perennial variety (8-10 years) with bold seeds (100 seed weight 90 g) and high oil content (57%). Twenty-one lines were isolated with annual types (160-180 days) with high yield potential as well as bold seeds and high oil content. These mutants, identified in M3 generation were bred true in subsequent generations up to M8 generation. Critical evaluation of the mutants in yield evaluation trials is in progress

  6. Chemical, pathological and toxicological studies of the effects of RICOM-1013-J of Ricinus communis var minor on women volunteers and rodents.

    Science.gov (United States)

    Das, S C; Isichei, C O; Okwuasaba, F K; Uguru, V E; Onoruvwe, O; Olayinka, A O; Ekwere, E O; Dafur, S J; Parry, O

    2000-02-01

    RICOM-1013-J (Ricinus communis var minor) administered orally once to each of 12 women volunteers at a dose of 2.5-2.7 g per 8 months, protected against pregnancy over a period of 7-8 months of study. A study of the effect of a contraceptive dose (20 mg/kg) on metabolic parameters in rat (food and water in-take, urine and faecal output and body weight) over a period of 4 months showed a slight decrease in all the parameters in the first 1-8 weeks. This effect was reversible attaining pretreatment levels from week 16. The LD(50) in an acute toxicity test in mice was 63.1 +/- 16.0 g/kg s.c. Determination of blood urea, sodium (Na(+)), potassium (K(+)), chloride (Cl(-)) and bicarbonate (HCO$_¿3¿ ¿-¿$)as a measure of renal function and alkaline phosphatase (ALP), transaminases (GPT and GOT) and transpeptidases (GGT) as a measure of liver function showed that liver function profiles in pretreated rats were not significantly different from control (p 0.05) compared with the control. There were no significant changes in renal function profiles in pretreated rats (p < 0.05) compared with the control. The results of the liver and renal function profiles in women volunteers showed that there were no significant (p < 0.05) changes in renal functions on day 206 following RICOM-1013-J administration. However, serum levels of ALP and GGT showed a slight rise in about 70% of volunteers, whereas bilirubin and transaminases levels were normal. The present results indicate a very high efficacy and margin of safety of RICOM-1013-J in women volunteers. The increase in ALP and GGT in both animal and women volunteers suggest mild intrahepatic cholestatic changes which may be attributed to an oestrogenic effect of RICOM-1013-J. PMID:10641041

  7. Determinación de las condiciones óptimas para la producción de biodiesel a partir de aceite de Higuerilla (Ricinus Communis) y aceite de Palma Mil Pesos (Oenocarpus Bataua)

    OpenAIRE

    Pérez Muñoz, Natalia; Uribe Morón, Jacqueline

    2008-01-01

    Se desarrolla un diseño de experimentos de tres factores y dos niveles con una sola réplica para la producción de Biodiesel a escala de laboratorio a partir de dos fuentes de triglicéridos: Aceite de Higuerilla (Ricinus Communis) y aceite de Palma mil pesos (Oenocarpus bataua). La producción de Biodiesel se lleva a cabo a partir de la reacción de transesterificación alcalina usando como catalizador hidróxido de sodio con metanol para obtener finalmente el biodiesel y la glicerina como subprod...

  8. Secondary seed dispersal of Ricinus communis Linnaeus (Euphorbiaceae by ants in secondary growth vegetation in Minas Gerais Dispersão secundária de sementes de Ricinus communis Linnaeus (Euphorbiaceae por formigas em vegetação secundária em Minas Gerais

    Directory of Open Access Journals (Sweden)

    Mário Marcos do Espírito Santo

    2007-12-01

    Full Text Available In this study, I tested the efficacy of ants as secondary seed dispersers of Ricinus communis in southeastern Brazil. In a natural population of 143 individuals, I determined the ballistic dispersal distance for 62 seeds and 100 additional seeds were experimentally offered to ants in groups of ten seeds along a transect of 50 m. Fifty-three seeds were removed by ants, mainly by the leafcutter Atta sexdens (90.4%. The dispersal distance by ants was high, compared to the global average (4.38 m ± 0.74 m vs. 0.96 m, but was lower than the ballistic distance (7.27 m ± 0.13 m. Ants increased the total dispersal distance (8.66 m ± 0.60 m, but the main benefit for the plant was the directed dispersal, with seed deposition on the enriched soil of ant nests.Este estudo testou a eficiência de formigas como dispersores secundários de Ricinus communis no Brasil. Em uma população natural de 143 indivíduos, a distância de dispersão balística foi determinada para 62 sementes. Além disso, 100 sementes adicionais foram oferecidas a formigas em grupos de 10, ao longo de um transecto de 50 m. Cinqüenta e três sementes foram removidas por formigas, principalmente pela formiga-cortadeira Atta sexdens (90,4%. A distância de dispersão por formigas foi alta se comparada à média global (4,38m ± 0,74 m vs. 0,96 m, porém menor que a distância de dispersão balística (7,27 m ± 0,13 m. As formigas aumentaram a distância de dispersão total (8,66 m ± 0,60 m, mas o principal benefício para a planta foi a dispersão direcionada, com a deposição das sementes no solo enriquecido encontrado nos ninhos das formigas.

  9. Castor bean response to zinc fertilization

    Energy Technology Data Exchange (ETDEWEB)

    Chaves, Lucia Helena Garofalo; Cunha, Tassio Henrique Cavalcanti da Silva; Lima, Vinicius Mota; Cabral, Paulo Cesar Pinto; Barros Junior, Genival; Lacerda, Rogerio Dantas de [Universidade Federal de Campina Grande (UAEAg/UFCG), PB (Brazil). Unidade Academica de Engenharia Agricola

    2008-07-01

    Zinc is a trace element and it is absolutely essential for the normal healthy growth of plants. This element plays a part of several enzyme systems and other metabolic functions in the plants. Castor beans (Ricinus communis L.) crop is raising attention as an alternative crop for oil and biodiesel production. Despite the mineral fertilization is an important factor for increasing castor beans yield, few researches has been made on this issue, mainly on the use of zinc. In order to evaluate the effects of zinc on growth of this plant an experiment was carried out in a greenhouse, in Campina Grande, Paraiba State, Brazil, from July to December 2007. The substrate for the pot plants was a 6 mm-sieved surface soil (Neossolo Quartzarenico). The experimental design was a completely randomized with three replications. The treatments were composed of five levels of Zn (0; 2; 4; 6 and 8 mg dm{sup -3}), which were applied at the time of planting. One plant of castor bean, cultivar BRS 188 - Paraguacu, was grown per pot after thinning and was irrigated whenever necessary. Data on plant height, number and length of leaves and stem diameter were measured at 21, 34, 77 and 103 days after planting. Under conditions that the experiment was carried out the results showed that the Zn levels used, did not affect the castor bean plants growth. (author)

  10. Biodiesel production from castor oil in Brazil: A difficult reality

    International Nuclear Information System (INIS)

    The Brazilian National Program for Production and Use of Biodiesel (PNPB in Portuguese) has created a huge demand for biodiesel in Brazil. The PNPB is strongly based on social development through the inclusion of family farmers in projects integrated with biodiesel power plants. Among the various oilseeds, castor bean (Ricinus communis L.) was identified as the ideal one to promote social development in the semi-arid region. However, although promising, the mechanisms of the federal program are still insufficient to promote the effective participation of family farmers. This research shows that companies are facing huge problems in implementing contracts with family farmers. It describes and analyzes the functioning dynamics of this agro-production chain. This paper addresses the identification and the discussion of these obstacles, in order to increase the competitiveness of the biodiesel agribusiness chain, based on castor oil social projects in Brazil.

  11. EVALUATION OF ANTIULCER ACTIVITY OF CASTOR OIL IN RATS

    Directory of Open Access Journals (Sweden)

    Rachhadiya Rakesh M.

    2011-04-01

    Full Text Available To study the antiulcer activity of oil of Ricinus communis seed using different models of gastric ulceration in rats. Antiulcer activity of castor oil was studied in rats by administration of ethanol or aspirin or by pyloric ligation. Castor oil was administered in the dose of 500 mg/kg and 1000 mg/kg orally 30 min prior to ulcer induction. The antiulcer activity was assessed by determining and comparing the ulcer index in the test drug group with that of the ulcerated control group. Gastric total acid output and pepsin activity were estimated in the pylorus ligated rats. Ranitidine and Sucralfate were used as a reference drug. The ulcer index in the castor oil treated animals was found to be significantly less in all the models compared to ulcerated control animals. This antiulcer property was more prominent in animals in whom ulcers were induced by ethanol, aspirin and pyloric ligation. Ranitidine (30 mg/kg produced a significant gastric ulcer protection when compared with the control group. The anti-ulcer activity of castor oil was however, less than that of ranitidine. Our results suggest that castor oil possesses significant antiulcer property which could be either due to cytoprotective action of the drug or by strengthening of gastric mucosa and thus enhancing mucosal defence.

  12. Replacement of soybean meal by treated castor meal in supplements for grazing heifer during the dry-rainy season period Substituição do farelo de soja por farelo de mamona tratado em suplementos para novilhas em pastejo no período de transição seca-águas

    OpenAIRE

    Barros, L. V.; Paulino, M. F.; Detmann, E.; S.C. Valadares Filho; Lopes, S. A.; A.A. Rocha; E.E.L. Valente; D.M. Almeida

    2011-01-01

    The objective of this work was to evaluate the effect of multiple supplement with different levels of castor meal (Ricinus communis L.) treated with calcium oxide on intake, on the total apparent digestibility of dietary components, on the efficiency of microbial synthesis and on the performance of beef heifers grazing Brachiaria decumbens during the dry-rainy transition period. The experimental area was composed of five 2.5-ha paddocks with availability of potentially digestible dry matter o...

  13. Castor and jatropha oils: production strategies – A review

    Directory of Open Access Journals (Sweden)

    Lago Regina C.A.

    2009-07-01

    Full Text Available The Brazilian bioenergy matrix is based on four platforms: ethanol, energy forests, residues and co-products and biodiesel. The food-energy dichotomy in the use of edible oils is one factor which has stimulated the search for non-edible oleaginous energy crops, such as many native palms. By the year 2000 Brazil had an annual deficit of 80 thousand tons of castor oil, making necessary to import oil from China and India. After a strong debate the National Program on Biodiesel Production (NPBP was launched by December 2004. After an initial excessive enthusiasm, small producers being focused in the program, a more mature and realistic planning is undertaken. Production in semi arid lands is being stimulated, mainly castor (Ricinus communis and Jatropha (Jatropha curcas. Apart from belonging to the same botanical family (Euphorbiaceae, both plants are well resistant to poor soils. Castor plant is well adapted to practically the whole country, except for some extreme areas (too low water availability or too much rain. Castor keeps being an alternative for the semi arid region but much more technology is requested to make it largely exploited. Following the petroleum crisis of 1980’s an ambitious research program on Jatropha curcas was initiated, later on discontinued and presently retaken by Embrapa and some Universities. Progress is slower than in the case of Ricinus communis. The first agronomical observations confirmed low productivity, problems with pests and diseases, high harvesting costs etc. Some strategic factors should be considered for the production of castor and Jatropha oils: 1. Production of raw materials; 2. Production of oils; 3. Detoxification and value aggregation to the extraction cakes and residues. Regarding raw material production, it is necessary a strong, long term research program on genetic breeding (short cycle varieties, with high productivity and allowing a sole harvesting, soil fertility, pest control, domestication

  14. Penentuan Ph Dan Suhu Optimum Untuk Aktivitas Ekstrak Kasar Enzim Lipase Dari Kecambah Biji Jarak Kepyar (Ricinus communis L) Terhadap Hidrolisis Minyak Wijen

    OpenAIRE

    Siregar, Nora Anggiani

    2011-01-01

    Determination of optimum pH and temperature for crude lipase enzyme activity from castor bean seeds germination had been conducted. Castor bean seed germination made by soaking time process, seed separation from solution of soaking and seed germination in temperature 28 – 30oC during 4 days. Crude lipase enzyme was obtained by centrifugations during 30 minutes with the speed of rotation 5000 rpm and 3400 rpm, and addition of acetone and drying by freeze drier. Crude lipase enzyme powder gener...

  15. Growth of castor bean BRS-149 nordestina fertilized with nitrogen, phosphorus and potassium

    Directory of Open Access Journals (Sweden)

    Diva Lima de Araujo

    2009-12-01

    Full Text Available A trial was carried out in a greenhouse located at the Federal University of Campina Grande, in Campina Grande, Paraiba State, Brazil, with castor bean plants (Ricinus communis L., cv BRS Nordestina, in order to evaluate the effects of nitrogen, phosphorus and potassium on the growth. A completely randomized design with three replications and 15 treatments originated from a baconian matrix was adopted. Reference doses were 40:90:60 kg ha-1 of N:P2O5:K2O, respectively. Plant height, stem diameter, number and length of leaves were measured at 20, 40, 60, 80, 100, 120 and 140 days after planting (DAP. The unbalanced fertilization affected the development and seed production of castor bean, and the best response of the plants was observed at levels of 200 kg ha-1 de N; 150 kg ha-1 de P2O5 and 150 kg ha-1 de K2O.

  16. Performance of Amblyseius herbicolus on broad mites and on castor bean and sunnhemp pollen.

    Science.gov (United States)

    Rodríguez-Cruz, Fredy Alexander; Venzon, Madelaine; Pinto, Cleide Maria Ferreira

    2013-08-01

    Amblyseius herbicolus (Banks) is found associated with broad mites Polyphagotarsonemus latus in crops such as chili pepper in Brazil. The species has a potential for controlling P. latus, but little is known about its development and reproduction on this pest as well as on other food sources. We studied biological, reproductive and life table parameters of A. herbicolus on three different diets: broad mites, castor bean pollen (Ricinus communis) and sunnhemp pollen (Crotalaria juncea). The predator was able to develop and reproduce on all diets. However, its intrinsic growth rate was higher on the diet of broad mites or on castor bean pollen than on sunnhemp pollen. Differences among pollen species may be due to their nutritional content. Feeding on alternative food such as pollen can facilitate the predator's mass rearing and maintain its population on crops when prey is absent or scarce. Other strategies of using pollen to sustain predator population and reduce pest damage are discussed. PMID:23417701

  17. Jatropha curcasand Ricinus communisdisplay contrasting photosynthetic mechanisms in response to environmental conditions

    Directory of Open Access Journals (Sweden)

    Milton Costa Lima Neto

    2015-06-01

    Full Text Available Higher plants display different adaptive strategies in photosynthesis to cope with abiotic stress. In this study, photosynthetic mechanisms and water relationships displayed byJatropha curcasL. (physic nuts andRicinus communisL. (castor bean, in response to variations in environmental conditions, were assessed.R. communis showed higher CO2 assimilation, stomatal and mesophyll conductance thanJ. curcas as light intensity and intercellular CO2 pressure increased. On the other hand,R. communis was less effective in stomatal control in response to adverse environmental factors such as high temperature, water deficit and vapor pressure deficit, indicating lower water use efficiency. Conversely,J. curcas exhibited higher photosynthetic efficiency (gas exchange and photochemistry and water use efficiency under these adverse environmental conditions.R. communisdisplayed higher potential photosynthesis, but exhibited a lowerin vivo Rubisco carboxylation rate (Vcmax and maximum electron transport rate (Jmax. During the course of a typical day, in a semiarid environment, with high irradiation, high temperature and high vapor pressure deficit, but exposed to well-watered conditions, the two studied species presented similar photosynthesis. Losing potential photosynthesis, but maintaining favorable water status and increasing non-photochemical quenching to avoid photoinhibition, are important acclimation mechanisms developed byJ. curcas to cope with dry and hot conditions. We suggest thatJ. curcas is more tolerant to hot and dry environments thanR. communis but the latter species displays higher photosynthetic efficiency under well-watered and non-stressful conditions.

  18. EFEITO DA CALAGEM E ADUBAÇÃO POTÁSSICA NO CRESCIMENTO E NUTRIÇÃO DA CULTURA DA MAMONA (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Carlos Sérgio Tiritan

    2010-12-01

    Full Text Available The castor bean is an oilseed crop of outstanding importance in Brazil and worldwide. Besides the wide application in chemical industry, is important due to its tolerance to drought, making it a viable crop for the semi-arid region of Brazil, where there are few agricultural alternatives. However, this culture is not unique to semi-arid region and is also planted with excellent results in various regions of the country. The study aimed to evaluate the effects of liming and potassium fertilization on the crop of castor bean. The experiment was conducted in a greenhouse in a randomized complete block randomized in a factorial 3 x 2, where the first factor consisted of potassium (0, 30 and 60 kg ha-1 and in the presence or absence lime to raise the base saturation to 60%. It was found that liming in combination with an intermediate dose of K2O (30 kg ha-1 elevates the production of dry mass of the area, however not change the concentration nutrients in the castor bean.

  19. Diseño Factorial de un Proceso Alcalino para Obtener Celulosa de Higuerilla (Ricinus communis l. y su Aplicación en Cartón Ondulado

    Directory of Open Access Journals (Sweden)

    Teófilo Escoto García

    2010-01-01

    Full Text Available Se estudia la obtención de celulosa y su aplicación en papel corrugado a partir del tallo de higuerilla (Ricinus communis L.. Mediante un diseño factorial 23 se encontraron las mejores condiciones del proceso alcalino para obtener celulosa. A las pulpas se les determino; No. de Kappa, % rendimiento y sus propiedades físico-mecánicas. Los tratamientos seleccionados T4, T7 y T8 se refinaron durante 6, 12, 18 y 22 minutos, posteriormente se formaron hojas estándar para corrugar y evaluar sus propiedades funcionales; compresión en ondulado, en anillo y en lateral. Se determinó que las características fisicomecánicas fueron relativamente mejores en los niveles de refinación 18 y 22 minutos. El tratamiento T8 con 22 minutos fue el que obtuvo mejores resultados en el índice de tensión (76.3 N.m/g e índice de explosión (5.3 kPa.m2/g. En cuanto a las pruebas de compresión se observó que el tratamiento T8 con nivel de refinación de 18 minutos tuvo mejor resistencia de compresión (CMT 238.7 N. Se concluye que la pulpa de higuerilla al 100 %.

  20. Evaluation of Dwarf Caster (Ricinus communis L.) Varieties Introduced from America%美洲矮秆蓖麻品种的引进鉴定

    Institute of Scientific and Technical Information of China (English)

    陈小龙; 魏佳; 裘晓云; 姚陆松; 胡荣斌; 张红; 沈国新

    2013-01-01

    A field evaluation was conducted to 15 dwarf castor varieties introduced from America on their phenological periods, agronomic traits and major economic characters so as to obtain excellent varieties for production or materials for breeding. The results indicated that, the height of 15 introduced varieties was between 76. 1 cm and 89. 3 cm, in which 7 varieties were super-dwarf types with plant height below 80 cm. Among them, Zhe-intro 15, Zhe-intro 10, Zhe-intro 2, Zhe-intro 5, Zhe-intro 12, Zhe-intro 6 and Zhe-intro 14 produced 38 773 -42 647 kg/hm2 castor leaves, similar to those of domestic dwarf castor varieties as control. However, they produced 4 038. 0-4 657. 5 kg/hm2 castor beans, being significantly or extremely significantly higher than the control varieties. Among the 7 high yield varieties, 3 varieties had higher oil and ricinoleic acid contents than the domestic control varieties. A preliminary evaluation revealed that the above high yield dwarf castor varieties have good agronomic traits and adaptability, being excellent leaf- and bean-yielding castor varieties. After multi-point evaluation, it is promising to use them for production directly or as materials for breeding new varieties.%2011 ~2012年对从美洲引进的15个矮秆蓖麻品种进行物候期、农艺性状和主要经济性状的大田鉴定,选拔可直接应用于生产的优良品种或优异的育种材料.引进的15个品种株高在75.5 ~ 89.3 cm之间,其中有7个品种的株高在80 cm以下,为超矮秆蓖麻品种.浙引15号、浙引10号、浙引2号、浙引5号、浙引12号、浙引6号和浙引14号7个品种的蓖麻叶产量为38 773~42647 kg/hm2,与国内矮秆蓖麻对照品种相仿,而蓖麻籽产量为4 038.0 ~4 657.5 kg/hm2,均显著或极显著高于对照品种.7个高产品种中,有3个品种的含油率和蓖麻油酸含量高于国内对照矮秆品种.经初步鉴定,上述高产矮秆蓖麻品种的主要农艺性状及适应性优

  1. EFEITO DA CALAGEM E ADUBAÇÃO POTÁSSICA NO CRESCIMENTO E NUTRIÇÃO DA CULTURA DA MAMONA (Ricinus communis L.)

    OpenAIRE

    Carlos Sérgio Tiritan; Juliano Carlos Calonego; Diego Henriques Santos

    2010-01-01

    The castor bean is an oilseed crop of outstanding importance in Brazil and worldwide. Besides the wide application in chemical industry, is important due to its tolerance to drought, making it a viable crop for the semi-arid region of Brazil, where there are few agricultural alternatives. However, this culture is not unique to semi-arid region and is also planted with excellent results in various regions of the country. The study aimed to evaluate the effects of liming and potassium fertiliza...

  2. Análise clínica, radiológica, macroscópica e histológica do úmero de codornas domésticas (Coturnix japonica, submetido ao implante da poliuretana derivada do polímero de mamona (Ricinnus communis Clinical, radiological, macroscopical and histological analysis of domestic quail (Coturnix japonica humerus submitted to implant of polyurethane from castor oil polymer (Ricinnus communis

    Directory of Open Access Journals (Sweden)

    Juliano Bolson

    2005-10-01

    ça de trabéculas e medula óssea no interior do implante. Concluiu-se que a poliuretana derivada do polímero de mamona é biocompatível em aves, podendo ser utilizada na cirurgia ortopédica, ocorrendo osteointegração.In orthopedic surgery there are frequently situations in which the surgeon faces severe bone losses caused by high-energy trauma, tumors or infections. Repairing these losses require knowledge about filling materials. Those materials can be biological, synthetic or metallic, with emphasis in bony grafts and biomaterial implants. The increase of the use of birds as pets is leading to an increasing number of clinical and surgical cases related to this taxon, where fractures are the most commonly observed surgical problems. The objective of this study was to evaluate clinical, radiological, macroscopic and microscopic effects of the polyurethane derived from castor oil (Ricinus communis polymer, when implanted in the humerus of domestic quails (Coturnix japonica. Twenty male and female quails, were used randomly distributed in four groups of five individuals. The birds received the implants in the left humerus, being submitted to daily physical examination during the postoperative period, immediate and biweekly radiological examination, and macroscopic and microscopic evaluation at the 15th, 30th, 60th and 90th days. Clinically, there were not observed local, regional or systemic changes. Radiologically, increase in local density was observed with no signs of changes in bone or adjacent tissue, as well as in the air sacs. Macroscopic analysis revealed that the polyurethane derived from castor oil polymer was not absorbed in none of the four groups, remaining implanted within the pneumatic bone. Its resistance, however, has changed. Microscopic examination evidenced minimum inflammatory reaction, slight fibrosis around the implants, and osteo-integration with presence of trabeculi and bone marrow inside the implants. Concluding, implants of polyurethane

  3. Energetic balance of castor oil methyl and ethyl esters; Balanco energetico de esteres metilicos e etilicos de oleo de mamona

    Energy Technology Data Exchange (ETDEWEB)

    Almeida Neto, Jose Adolfo de; Cruz, Rosenira Serpa da; Alves, Jaenes Miranda; Pires, Monica de Moura; Robra, Sabine [Universidade Estadual de Santa Cruz, Ilheus BA (Brazil). Grupo Bioenergia e Meio Ambiente]. E-mails: jalmeida@uesc.br; Parente Junior, Expedito [Tecnologias Bioenergeticas Ltda. (TECBIO), Fortaleza, CE (Brazil); Fundacao Nucleo de Tecnologia Industrial (NUTEC), Fortaleza, CE (Brazil)]. E-mail: expeditojr@tecbio.com.br

    2004-07-01

    Castor oil (Ricinus communis L.) is one of the cultures chosen by the biodiesel federal and state programs to supply raw material for biodiesel production - a biofuel indicated as renewable and less pollutant than its fossil competitor. An energetic balance was performed based on LCA - Life Cycle Analysis principles and Input-Output Analysis, comparing the castor oil energy performance with others traditional cultures: colza (Brassica napus) in Europe and soybean (Glycine max) in the United States. Energy balance (O-I) was positive in both production ways (methyl and ethyl) independent of coproduct use allocation alternative. The relation Output-Input (O-I) calculated for castor oil biodiesel [1.3-2.9] was higher than the colza (1.2-1.9) and lower than the soybean (3.2--3.4), independent of the way and allocation of the used byproduct. Both indicators suggest the energy and environmental viability of the castor oil biodiesel, provided that high agricultural productivity (higher than 1.500 kg/ha year) can be guaranteed. The potentialization of the positive energetic and environmental effects depends on the adequate utilization of the coproducts and process residues, the improvement of the energy efficiency in the the castor oil and biodiesel processing and the implementation of efficient management in the use of the chemical inputs (specially the N), responsible for up 5% of the total energy input.

  4. Genome-Wide Identification, Evolutionary Analysis, and Stress Responses of the GRAS Gene Family in Castor Beans

    Directory of Open Access Journals (Sweden)

    Wei Xu

    2016-06-01

    Full Text Available Plant-specific GRAS transcription factors play important roles in regulating growth, development, and stress responses. Castor beans (Ricinus communis are important non-edible oilseed plants, cultivated worldwide for its seed oils and its adaptability to growth conditions. In this study, we identified and characterized a total of 48 GRAS genes based on the castor bean genome. Combined with phylogenetic analysis, the castor bean GRAS members were divided into 13 distinct groups. Functional divergence analysis revealed the presence of mostly Type-I functional divergence. The gene structures and conserved motifs, both within and outside the GRAS domain, were characterized. Gene expression analysis, performed in various tissues and under a range of abiotic stress conditions, uncovered the potential functions of GRAS members in regulating plant growth development and stress responses. The results obtained from this study provide valuable information toward understanding the potential molecular mechanisms of GRAS proteins in castor beans. These findings also serve as a resource for identifying the genes that allow castor beans to grow in stressful conditions and to enable further breeding and genetic improvements in agriculture.

  5. Impact of castor meal on root-knot and free-living nematodes

    Directory of Open Access Journals (Sweden)

    Cecilia Helena Silvino Prata Ritzinger

    2014-08-01

    Full Text Available Soil amendment may enhance soil quality as well as reduce plant-parasitic nematode. Despite the many applications already undertaken using castor meal, its efficiency in controlling root-knot nematodes (RKN, Meloidogyne incognita when applied to melon (Cucumis melo is still not clear. Three different amounts of castor meal (Ricinus communis applied were evaluated in microplots planted with melon either with or without RKN. The impact of castor meal on soil free-living nematode communities was also determined. Total nematode genera richness was estimated as 37 for the entire set of microplots sampled across both sampling dates. Rarefaction analysis resulted in 12 collector's curves out of the total of 30 that reached the horizontal asymptote. Univariate ANOVA with two factors yielded differences (p < 0.05 only with regard to the time factor. Simpson, Shannon, Evenness and Equitability indices showed a trend toward moderate increases by the end of the experiment, while the other indices were higher for tomato in pre-transplant sampling compared to harvest. Nematode community and diversity changed during the course of the experiment, although there was substantial confounding heterogeneity within and between the factorial combinations from the beginning. Root knot population was not reduced by the castor meal but increased throughout the period, regardless of treatment. RKN reduced melon yield, number and weight of melon.

  6. Simultaneous allergen inactivation and detoxification of castor bean cake by treatment with calcium compounds

    International Nuclear Information System (INIS)

    Ricinus communis L. is of great economic importance due to the oil extracted from its seeds. Castor oil has been used for pharmaceutical and industrial applications, as a lubricant or coating agent, as a component of plastic products, as a fungicide or in the synthesis of biodiesel fuels. After oil extraction, a castor cake with a large amount of protein is obtained. However, this by-product cannot be used as animal feed due to the presence of toxic (ricin) and allergenic (2S albumin) proteins. Here, we propose two processes for detoxification and allergen inactivation of the castor cake. In addition, we establish a biological test to detect ricin and validate these detoxification processes. In this test, Vero cells were treated with ricin, and cell death was assessed by cell counting and measurement of lactate dehydrogenase activity. The limit of detection of the Vero cell assay was 10 ng/mL using a concentration of 1.6 × 105 cells/well. Solid-state fermentation (SSF) and treatment with calcium compounds were used as cake detoxification processes. For SSF, Aspergillus niger was grown using a castor cake as a substrate, and this cake was analyzed after 24, 48, 72, and 96 h of SSF. Ricin was eliminated after 24 h of SSF treatment. The cake was treated with 4 or 8% Ca(OH)2 or CaO, and both the toxicity and the allergenic properties were entirely abolished. A by-product free of toxicity and allergens was obtained

  7. Effect of glycerine and essential oils (Anacardium occidentale and Ricinus communis on animal performance, feed efficiency and carcass characteristics of crossbred bulls finished in a feedlot system

    Directory of Open Access Journals (Sweden)

    Olga Teresa Barreto Cruz

    2014-11-01

    Full Text Available The effect of corn substitution by glycerine and essential oils on animal performance, apparent digestibility and red and white blood cells of crossbred bulls finished in feedlot was evaluated. Thirty bulls with average weight of 311±28.8 kg and 22±2 month-old were allocated in three diets: CON (without glycerine or essential oils, GLY (with glycerine and GEO (with glycerine and essential oils. The bulls were fed a diet of sorghum silage, cracked corn, soybean meal, urea, limestone and mineral salt. Three grams of cashew and castor oil/animal/day were included in GEO diet. Animals were kept in feedlot for 115 days and slaughtered at average weight of 467±40.6 kg. No differences (P<0.05 among diets regarding final body weight, average daily gain and feed conversion were reported. Ether extract intake was higher (P<0.05 in CON diet compared to the others. Dry matter, organic matter and crude protein digestibility was higher (P<0.05 in GLY diet compared to CON. Acid detergent fibre digestibility was higher (P<0.05 in CON compared to GLY diet. Nonfibrous carbohydrate, fibrous carbohydrate and ether extract digestibility were similar (P>0.05 among diets. No effect of glycerine and essential oil addition on total blood cholesterol, triglycerides, haemogram, leukogram and plasmatic proteins was observed. Corn replacement by glycerine and essential oils addition did not affect (P>0.05 carcass weight, dressing and conformation, carcass length and cushion thickness.

  8. Trial of an experimental castor oil solution for cleaning dentures.

    Science.gov (United States)

    Andrade, Ingrid Machado de; Andrade, Kelly Machado de; Pisani, Marina Xavier; Silva-Lovato, Cláudia Helena; de Souza, Raphael Freitas; Paranhos, Helena de Freitas Oliveira

    2014-01-01

    Denture hygiene is essential because denture biofilm is involved in oral infections and systemic diseases. Although there are chemical agents available on the market, none of them have ideal properties and research on such products is still necessary. The aim of this study was to evaluate the efficacy of a castor bean (Ricinus communis)-based solution for removing denture biofilm, compared to two traditional products (sodium hypochlorite and alkaline peroxide). Fifty maxillary complete denture wearers were instructed to brush their dentures after meals and to immerse their dentures once a day in the following solutions: Saline (20 min; control), Polident alkaline peroxide (3 min), NaOCl (20 min) and 2% castor oil solution (20 min). Participants used each solution for a period of 7 consecutive days, according to a random sequence. After each period, the internal surfaces of maxillary complete dentures were stained with a disclosing solution (1% neutral red), photographed and the disclosed biofilm was quantified with the aid of specific software. The influence of treatments on results was verified by the Friedman test (α=0.05). Tested solutions presented significant difference (Fr=51.67; pbiofilm removal. PMID:24789291

  9. The Mechanical Properties of Castor Seed Shell-polyester Matrix Composites

    Directory of Open Access Journals (Sweden)

    S.C. Nwigbo

    2013-05-01

    Full Text Available A composite with a polyester matrix reinforced with chemically modified shells of castor seed (Ricinus communis was produced. The effect of the shell (filler on the mechanical properties of the composite was experimentally quantified. A preliminary study was earlier carried out the shell in terms of their chemical constituents, functional group and mechanical strength. The shell was ground and chemically treated to enhance good bonding and adhesion to the matrix. Composites were fabricated using a hand lay-up or contact mould method for different percentage compositions of the filler. Tests, with respect to the mechanical properties (i.e., tensile, flexural and creep response were carried out. The result obtained was compared with the unreinforced polyester plate. It was observed that the inclusion of the filler (shell added strength to the composite. Scanning Electron Microscopy (SEM was taken on the composite samples to study the morphology of the composites.

  10. Effect of gamma radiation on the antioxidant activity of castor oil: Preliminary report

    International Nuclear Information System (INIS)

    The effect of gamma radiation in the antioxidant activity of castor oil, Ricinus communis L., has been studied by the DPPH method. The IC50 of the oil is 0,28 μL/mL, which indicates that this oil contain compounds with the ability to neutralize DPPH radicals. The antioxidant activity does not vary too much when the oil is irradiated up to 20 kGy, except for 15 kGy where it decreased 6%. If the oil was obtained from irradiated seeds, the activity does not vary too much up to 3 kGy. However, for 5 kGy it was observed a reduction of 20%. (orig.)

  11. Eficiência dos óleos de nim (Azadirachta indica A. Juss.) e mamona (Ricinus communis L.) na resistência da madeira de sumaúma (Ceiba pentandra (L.) Gaerth.) a fungos xilófagos em simuladores de campo

    OpenAIRE

    Juarez Benigno Paes; Ademilson Daniel de Souza; Carlos Roberto de Lima; Pierre Farias de Souza

    2012-01-01

    http://dx.doi.org/10.5902/198050986627A pesquisa objetivou avaliar a eficiência dos óleos de nim (Azadirachta indica) e de mamona (Ricinus communis) na melhoria da resistência da madeira de sumaúma (Ceiba pentandra) a fungos xilófagos em simulador de campo. Os óleos de nim e de mamona foram extraídos com álcool etílico absoluto e empregados no preparo das soluções preservativas. Amostras de madeira com dimensões de 1,5 x 0,5 x 15 cm (radial x tangencial x longitudinal) foram tratadas para ati...

  12. Energetic potential of the vegetable oil of Canton Tosagua ricinus comunnis

    International Nuclear Information System (INIS)

    The plantation of Higuerilla (Ricinus communis L.) can be considered as an alternative of high energy, economic and social importance for the climatic conditions of the Ecuador's coastal area, due to its easy cultivation, the resistance to the drought is being considered as a plant generator for rent and work for small farmers in the geography of Tosagua, Rocafuerte and other towns in the vicinity to Manabi province. The castor oil is a xerofila and heliofila plantation in other words , adapted to arid atmospheres and sun loving. The paper shows a characterization carried out to higuerilla seeds in the biotechnology laboratory of to the Polytechnic High School of Calceta (ESPAM). The seeds collected in different villages near Tosagua, let us estimate the energy potential of the Higuerilla plantation like energy source for the Manabi province. The industrialization of the product obtained from Higuerilla plantation would have as advantage the pure vegetable oil (PVO) as main by-product, besides it can obtain a cake rich in protein. The castor oil cake can be used to restore out lands; also, it contains products that can be used for the control of nematodes of the ground, due to the high toxicity that confers it toxic protein denominated ricine. (author)

  13. Characterization of castor bean genotypes under various environments using sds-page of total seed storage proteins

    International Nuclear Information System (INIS)

    Castor bean (Ricinus communis L.) is an indeterminate, non-edible oil seed crop grown in low rainfall regions of semi-arid tropics and sub-tropics. The present work was conducted to see the feasibility of electrophoresis for intra-specific characterization of castor bean on the basis of their total seed storage proteins. The protein profiles of all the four accessions were very much alike, both in number of bands and in their distribution on the gel, even though accessions represented a wide range of geographic origin. Occasionally, variation was observed in the density or sharpness of bands. The seed protein patterns were also uniform among various accessions grown under various environments. On the basis of banding pattern, polypeptides could be divided into three regions, A to C, equivalent to increasing Rf value and decreasing molecular weight. The present investigation revealed no variation in different accessions and under different environments with regards to their total seed protein profiles. The results clearly showed that it was impossible to discriminate various genotypes from each other, as they were characterized by same banding patterns. However, it might be useful to distinguish diverse forms of it from one another. The present investigation revealed very limited variation in castor bean genotypes in Pakistan. (author)

  14. Simultaneous allergen inactivation and detoxification of castor bean cake by treatment with calcium compounds

    Directory of Open Access Journals (Sweden)

    K.V. Fernandes

    2012-11-01

    Full Text Available Ricinus communis L. is of great economic importance due to the oil extracted from its seeds. Castor oil has been used for pharmaceutical and industrial applications, as a lubricant or coating agent, as a component of plastic products, as a fungicide or in the synthesis of biodiesel fuels. After oil extraction, a castor cake with a large amount of protein is obtained. However, this by-product cannot be used as animal feed due to the presence of toxic (ricin and allergenic (2S albumin proteins. Here, we propose two processes for detoxification and allergen inactivation of the castor cake. In addition, we establish a biological test to detect ricin and validate these detoxification processes. In this test, Vero cells were treated with ricin, and cell death was assessed by cell counting and measurement of lactate dehydrogenase activity. The limit of detection of the Vero cell assay was 10 ng/mL using a concentration of 1.6 x 10(5 cells/well. Solid-state fermentation (SSF and treatment with calcium compounds were used as cake detoxification processes. For SSF, Aspergillus niger was grown using a castor cake as a substrate, and this cake was analyzed after 24, 48, 72, and 96 h of SSF. Ricin was eliminated after 24 h of SSF treatment. The cake was treated with 4 or 8% Ca(OH2 or CaO, and both the toxicity and the allergenic properties were entirely abolished. A by-product free of toxicity and allergens was obtained.

  15. Simultaneous allergen inactivation and detoxification of castor bean cake by treatment with calcium compounds

    Energy Technology Data Exchange (ETDEWEB)

    Fernandes, K.V.; Deus-de-Oliveira, N. [Laboratório de Química e Função de Proteínas e Peptídeos, Centro de Biociências e Biotecnologia, Universidade Estadual do Norte Fluminense Darcy Ribeiro, Rio de Janeiro, RJ (Brazil); Godoy, M.G. [Laboratório de Biotecnologia Microbiana, Instituto de Química, Universidade Federal do Rio de Janeiro, Rio de Janeiro, RJ (Brazil); Guimarães, Z.A.S. [Laboratório de Biologia Celular e Tecidual, Centro de Biociências e Biotecnologia, Universidade Estadual do Norte Fluminense Darcy Ribeiro, Rio de Janeiro, RJ (Brazil); Nascimento, V.V. [Laboratório de Química e Função de Proteínas e Peptídeos, Centro de Biociências e Biotecnologia, Universidade Estadual do Norte Fluminense Darcy Ribeiro, Rio de Janeiro, RJ (Brazil); Melo, E.J.T. de [Laboratório de Biologia Celular e Tecidual, Centro de Biociências e Biotecnologia, Universidade Estadual do Norte Fluminense Darcy Ribeiro, Rio de Janeiro, RJ (Brazil); Freire, D.M.G. [Laboratório de Biotecnologia Microbiana, Instituto de Química, Universidade Federal do Rio de Janeiro, Rio de Janeiro, RJ (Brazil); Dansa-Petretski, M.; Machado, O.L.T. [Laboratório de Química e Função de Proteínas e Peptídeos, Centro de Biociências e Biotecnologia, Universidade Estadual do Norte Fluminense Darcy Ribeiro, Rio de Janeiro, RJ (Brazil)

    2012-08-24

    Ricinus communis L. is of great economic importance due to the oil extracted from its seeds. Castor oil has been used for pharmaceutical and industrial applications, as a lubricant or coating agent, as a component of plastic products, as a fungicide or in the synthesis of biodiesel fuels. After oil extraction, a castor cake with a large amount of protein is obtained. However, this by-product cannot be used as animal feed due to the presence of toxic (ricin) and allergenic (2S albumin) proteins. Here, we propose two processes for detoxification and allergen inactivation of the castor cake. In addition, we establish a biological test to detect ricin and validate these detoxification processes. In this test, Vero cells were treated with ricin, and cell death was assessed by cell counting and measurement of lactate dehydrogenase activity. The limit of detection of the Vero cell assay was 10 ng/mL using a concentration of 1.6 × 10{sup 5} cells/well. Solid-state fermentation (SSF) and treatment with calcium compounds were used as cake detoxification processes. For SSF, Aspergillus niger was grown using a castor cake as a substrate, and this cake was analyzed after 24, 48, 72, and 96 h of SSF. Ricin was eliminated after 24 h of SSF treatment. The cake was treated with 4 or 8% Ca(OH){sub 2} or CaO, and both the toxicity and the allergenic properties were entirely abolished. A by-product free of toxicity and allergens was obtained.

  16. Morphology and viability of castor bean genotypes pollen grains

    Directory of Open Access Journals (Sweden)

    Maria Selma Alves Silva Diamantino

    2016-01-01

    Full Text Available The objective of this work was to characterize the morphology and viability of the pollen of 15 genotypes of castor bean (Ricinus communis L. and to generate information that can assist in the selection of highly promising male parents for future use in genetic improvement programs aimed at producing seeds for oil extraction. Acetolysis and scanning electron microscopy was used to characterize the morphology of the pollen. The viability of the pollen grains was estimated by in vitro germination and colorimetric analysis (acetocarmine 2% and 2, 3, 5-triphenyltetrazolium chloride 1%. For the in vitro germination, pollen grains were grown in 10 types of solidified culture medium consisting of different concentrations of sucrose, boric acid, calcium nitrate, magnesium sulfate and potassium nitrate. The pollen grains had the following characteristics: medium size, isopolar and subspheroidal shape, radial symmetry, circular ambit, 3-colporate, elongated endoapertures, tectate exine and granulated sexine. The acetocarmine dye overestimated pollen viability. The media M5 and M8 were the most efficient at promoting the germination of pollen grains. The studied genotypes had high levels of viability and can therefore be used as male parents in genetic improvement programs.

  17. Crioconservação de sementes de mamona das variedades nordestina e pernambucana Cryoconservation of nordestina and pernambucana varieties of castor bean seeds

    Directory of Open Access Journals (Sweden)

    Francisco de A. C. Almeida

    2002-01-01

    Full Text Available É grande a importância da mamoneira (Ricinus communis L. para a economia do semi-árido nordestino, que é responsável por 80% da produção nacional, no entanto durante 1970 e 2000, a produção líquida dessa oleaginosa foi reduzida na mesma percentagem. Registrou-se também a existência de aproximadamente 90 tipos diferentes de sementes empregadas no cultivo desta Euforbiaceae. Devido a este problema, o trabalho desenvolvido no Laboratório de Processamento e Armazenamento de Produtos Agrícolas do DEAg/UFPB, objetivou desenvolver técnicas de crioconservação para duas variedades de Ricinus communis, com vistas a uma armazenagem segura e por tempo indefinido. O delineamento experimental utilizado foi o inteiramente casualizado, com os dados obtidos nos 7º e 14º dias depois da semeadura, dispostos em um arranjo fatorial 2 x 3 x 2 x 2 (duas variedades, três períodos de crioconservação, duas temperaturas de crioconservação e dois tipos de acondicionamento com oito repetições de vinte e cinco sementes cada uma. Os dados obtidos foram submetidos à análise de variância e as médias dos fatores qualitativos comparadas pelo teste de Tukey, a 5% de probabilidade. Com os resultados obtidos concluiu-se que: o nível máximo de umidade para a crioconservação das sementes das duas variedades de Ricinus communis (nordestina e pernambucana encontra-se entre 4 e 10% base úmida; os melhores resultados de qualidade fisiológica foram obtidos aos 30 dias da crioconservação, podendo essas sementes serem crioconservadas tanto no vapor (-176 ºC como na imersão (-196 ºC em nitrogênio líquido; o canister de alumínio utilizado para acondicionar as sementes mostrou-se superior ao de PVC.The castor bean (Ricinus communis L. has great importance for the economy of the semi-arid region of the northeast of Brazil, responsible for 80% of the national production, but during 1970 and 2000, the net production of this oil crop was reduced

  18. Optimizing row spacing and plant population arrangement for a new short-height castor genotype in fall-winter

    Directory of Open Access Journals (Sweden)

    Genivaldo David de Souza-Schlick

    2014-08-01

    Full Text Available Plant population and arrangement should be properly designed to maximize the seed yield of short-height genotypes of castor (Ricinus communis L. in each cropping season. Experiments were performed in the in the fall-winter cropping season of 2008 and 2009 in Botucatu, State of São Paulo, Brazil, to evaluate the effects of row spacing (0.45, 0.60, 0.75, and 0.90 m and plant population (25,000, 40,000, 55,000, and 70,000 plants ha-1 on agronomical traits, yield components, seed yield, and oil yield of the genotype FCA-PB. A high plant density caused a reduction in plant survival and increased the first raceme insertion height, particularly in the year with the higher rainfall. The basal stem diameter, number of racemes per plant, and seeds per raceme were reduced by increasing the plant density. However, the seed and oil yields were minimally influenced by plant population density and row spacing because the castor plant compensated for a low plant population with a high number of racemes and seeds. The maximum seed yield was achieved with an estimated 0.64 m of row spacing and 50,107 plants ha-1 (i.e., 3.2 plants m-1.

  19. Fractional characterisation of jatropha, neem, moringa, trisperma, castor and candlenut seeds as potential feedstocks for biodiesel production in Cuba

    Energy Technology Data Exchange (ETDEWEB)

    Martin, Carlos [Bioresource Technology group, Department of Chemistry and Chemical Engineering, University of Matanzas, Autopista a Varadero, km 3, Matanzas 44740 (Cuba); Department of Chemical Engineering, University of Vigo (Campus Ourense), Polytechnical Building, As Lagoas, 32004 Ourense (Spain); Moure, Andres; Dominguez, Herminia; Parajo, Juan C. [Department of Chemical Engineering, University of Vigo (Campus Ourense), Polytechnical Building, As Lagoas, 32004 Ourense (Spain); Martin, Giraldo [Experimental Station of Pastures and Forages ' ' Indio Hatuey' ' , Central Espana Republicana, CP 44280, Matanzas (Cuba); Carrillo, Eugenio [Biomass Energy Department, National Renewable Energy Centre (CENER), Ciudad de la Innovacion 4, Sarriguren, 31621 Pamplona (Spain)

    2010-04-15

    A preliminary investigation on the suitability of various non-edible oil seeds for the integral utilisation of their fractions for production of biodiesel and other products was carried out. The oil seeds considered were jatropha (Jatropha curcas), neem (Azadirachta indica), moringa (Moringa oleifera), trisperma (Aleurites trisperma), castor beans (Ricinus communis) and candlenut (Aleurites moluccana). The highest oil content (62.0% (w/w)) was found in trisperma seeds, but the use of that oil for biodiesel production is restricted by its high content of polyunsaturated fatty acids. The oils of castor beans and moringa contained 86.0% of ricinoleic acid and 70.6% of oleic acid, respectively, while in the oils from the other seeds no predominance of any acid was observed. According to the oil yield and to the fatty acid composition of the oil, jatropha was identified as the most promising oil seed for biodiesel production in Cuba. All the press cakes were rich in protein, the highest content (68.6%) being detected in moringa cake. The investigation revealed that the husks of neem and moringa can be considered potential substrates for ethanol production due to their high cellulose content (approximately 30%). A high concentration (4.3%) of acetyl groups was found in neem husks, what is favourable for the hydrolytic conversion of polysaccharides to simple sugars. A high protein content (15.2%) was detected in moringa husks, which is a positive feature for lowering the cost of nutrient supplementation in ethanolic fermentation. (author)

  20. Building Supply Systems from Scratch: The Case of the Castor Bean for Biodiesel Chain in Minas Gerais, Brazil

    Directory of Open Access Journals (Sweden)

    Kassia Watanabe

    2012-12-01

    Full Text Available The present study contributes to identifying obstacles to the development of a local biodiesel agro-industrial system (AGS in the state of Minas Gerais, Brazil. The research questions are: “How do local social characteristics influence the organizational effectiveness of agents involved in the joint production effort?”; and “How can the institutional arrangement of biodiesel production be described?” The method adopted is the case study, focused on family farmers served by the Family Farmers Rural Extension and Technical Assistance Company (EMATER. This state organization introduced castor beans (Ricinus communis L. to family farmers as an alternative crop to supply a processing plant (Darcy Ribeiro Biodiesel Plant—DRBP in northern Minas Gerais state, Brazil. These family farmers are not horizontally organized, and sign individual contracts with DRBP. The paper concludes that the primary obstacle to developing the biodiesel AGS with castor beans in Minas Gerais is the lack of horizontal organization among family farmers.

  1. Eficiência dos óleos de nim (Azadirachta indica A. Juss. e mamona (Ricinus communis L. na resistência da madeira de sumaúma (Ceiba pentandra (L. Gaerth. a fungos xilófagos em simuladores de campo

    Directory of Open Access Journals (Sweden)

    Juarez Benigno Paes

    2012-09-01

    Full Text Available http://dx.doi.org/10.5902/198050986627A pesquisa objetivou avaliar a eficiência dos óleos de nim (Azadirachta indica e de mamona (Ricinus communis na melhoria da resistência da madeira de sumaúma (Ceiba pentandra a fungos xilófagos em simulador de campo. Os óleos de nim e de mamona foram extraídos com álcool etílico absoluto e empregados no preparo das soluções preservativas. Amostras de madeira com dimensões de 1,5 x 0,5 x 15 cm (radial x tangencial x longitudinal foram tratadas para atingir uma retenção nominal de 10 a 16 kg de solução/m³ de madeira. As amostras permaneceram por 180 dias sob ação da microflora natural existente em três tipos de solos: de floresta, de uso agrícola e de pastagem natural. Entre os solos testados, o de uso agrícola apresentou maior atividade biológica, deteriorando mais as amostras. Dentre as soluções testadas, o óleo de nim puro proporcionou maior proteção à madeira. As soluções preparadas com os óleos de nim e mamona não protegeram bem a madeira do ataque de fungos xilófagos naturalmente existentes no solo de uso agrícola.

  2. Ectopic overexpression of castor bean LEAFY COTYLEDON2 (LEC2 in Arabidopsis triggers the expression of genes that encode regulators of seed maturation and oil body proteins in vegetative tissues

    Directory of Open Access Journals (Sweden)

    Hyun Uk Kim

    2014-01-01

    Full Text Available The LEAFY COTYLEDON2 (LEC2 gene plays critically important regulatory roles during both early and late embryonic development. Here, we report the identification of the LEC2 gene from the castor bean plant (Ricinus communis, and characterize the effects of its overexpression on gene regulation and lipid metabolism in transgenic Arabidopsis plants. LEC2 exists as a single-copy gene in castor bean, is expressed predominantly in embryos, and encodes a protein with a conserved B3 domain, but different N- and C-terminal domains to those found in LEC2 from Arabidopsis. Ectopic overexpression of LEC2 from castor bean under the control of the cauliflower mosaic virus (CaMV 35S promoter in Arabidopsis plants induces the accumulation of transcripts that encodes five major transcription factors (the LEAFY COTYLEDON1 (LEC1, LEAFY COTYLEDON1-LIKE (L1L, FUSCA3 (FUS3, and ABSCISIC ACID INSENSITIVE 3 (ABI3 transcripts for seed maturation, and WRINKELED1 (WRI1 transcripts for fatty acid biosynthesis, as well as OLEOSIN transcripts for the formation of oil bodies in vegetative tissues. Transgenic Arabidopsis plants that express the LEC2 gene from castor bean show a range of dose-dependent morphological phenotypes and effects on the expression of LEC2-regulated genes during seedling establishment and vegetative growth. Expression of castor bean LEC2 in Arabidopsis increased the expression of fatty acid elongase 1 (FAE1 and induced the accumulation of triacylglycerols, especially those containing the seed-specific fatty acid, eicosenoic acid (20:1Δ11, in vegetative tissues.

  3. SUBACUTE AND MULTIGENERATIONAL TOXICITY EVALUATION OF CASTOR OIL POLYMER INGESTION IN RATS AVALIAÇÃO DA TOXICIDADE SUBAGUDA E MULTIGERACIONAL DA INGESTÃO DE DERIVADO DO POLÍMERO DE MAMONA EM RATOS

    Directory of Open Access Journals (Sweden)

    Gilberto Chierice

    2009-04-01

    Full Text Available Castor oil polymer is a biomaterial that can be used to fill bone defects. Biomaterials should present some characteristics such as: biocompatibility, inert, absence of toxin radical and vapour discharge and permit the organism to recognize them as a part of their structure. The aim of this study was to investigate changes in water ingestion, feed intake, weight gain and toxic effects in rats (Rattus norvegicus after ingestion of 0, 10, 25 and 50% of castor oil polymer (COP, Ricinus communis. In groups that received 10 and 25% of COP the weight gain was smaller than the control group. Feed intake in control group was greater than in groups 10 and 50% COP. The intake of castor oil polymer reduced feed intake and water ingest probably because of the palatability of the product. In the second part of this study (multigenerational there were no toxic effects in the offspring, as external birth defects or alterations incompatible with life, in spite of the fact that lower weight were observed in males and females of the second generation.

    KEY WORDS: Biomaterials, bone defects, polymer, Ricinus communis. Os biomateriais são polímeros artificiais desenvolvidos para substituir tecidos orgânicos danificados e preencherem falhas ósseas. Eles devem apresentar características como a biocompatibilidade, serem inertes, não liberarem vapores e radicais tóxicos e permitirem ao organismo reconhecê-los como parte de sua estrutura. Procurou-se determinar a ingestão de água, o consumo de ração, ganho de peso e possível efeito tóxico decorrentes da ingestão de três doses (10%, 25% e 50% do derivado do polímero de mamona (PM, Ricinus communis, adicionado à água de bebida, em ratos (Rattus norvegicus. Nos grupos que receberam 10% e 25% do PM, o ganho de peso foi menor (P?0,05, quando comparado ao grupo-controle. O consumo de ração nos grupos que receberam 10% e 50% de PM foi menor em relação ao grupo-controle. A ingestão do pol

  4. Adding value to a toxic residue from the biodiesel industry: production of two distinct pool of lipases from Penicillium simplicissimum in castor bean waste.

    Science.gov (United States)

    Godoy, Mateus G; Gutarra, Melissa L E; Castro, Aline M; Machado, Olga L T; Freire, Denise M G

    2011-08-01

    In countries with a strong agricultural base, such as Brazil, the generation of solid residues is very high. In some cases, these wastes present no utility due to their toxic and allergenic compounds, and so are an environmental concern. The castor bean (Ricinus communis) is a promising candidate for biodiesel production. From the biodiesel production process developed in the Petrobras Research Center using castor bean seeds, a toxic and alkaline waste is produced. The use of agroindustrial wastes in solid-state fermentation (SSF) is a very interesting alternative for obtaining enzymes at low cost. Therefore, in this work, castor bean waste was used, without any treatment, as a culture medium for fungal growth and lipase production. The fungus Penicillium simplicissimum was able to grow and produce an enzyme in this waste. In order to maximize the enzyme production, two sequential designs-Plackett-Burman (variable screening) followed by central composite rotatable design (CCRD)-were carried out, attaining a considerable increase in lipase production, reaching an activity of 155.0 U/g after 96 h of fermentation. The use of experimental design strategy was efficient, leading to an increase of 340% in the lipase production. Zymography showed the presence of different lipases in the crude extract. The partial characterization of such extract showed the occurrence of two lipase pools with distinct characteristics of pH and temperature of action: one group with optimal action at pH 6.5 and 45°C and another one at pH 9.0 and 25°C. These results demonstrate how to add value to a toxic and worthless residue through the production of lipases with distinct characteristics. This pool of enzymes, produced through a low cost methodology, can be applied in different areas of biotechnology. PMID:20844923

  5. Performance and Emission Characteristics of a Compression Ignition Engine Operating on Blends of Castor Oil Biodiesel-Diesel

    Science.gov (United States)

    Kanwar, Roopesh; Sharma, Pushpendra Kumar; Singh, Aditya Narayan; Agrawal, Yadvendra Kumar

    2016-06-01

    Diesel vehicles are the nerves and veins of transportation, particularly in developing countries. With the rapid rate of modernization, increasing demand of fuel is inevitable. The exponential increase in fuel prices and the scarcity of its supply from the environment have promoted interest in the development of alternative sources of fuel. In this work, genus Ricinus communis L. was studied in order to delimit their potential as a raw material for biodiesel production. Further, castor oil, ethyl ester were prepared by transesterification using potassium hydroxide (KOH) as a catalyst and tested on a four-stroke, single-cylinder compression ignition engine. The test was carried out at a constant speed of 3000 rpm at different loads. The results represent a substantial decrease in carbon monoxide (CO) emission with an increasing biodiesel percentage. The reduction of CO in B05, B10, B15 and B20 averaged 11.75, 22.02, 24.23 and 28.79 %, respectively, compared to mineral diesel. The emission results of the comparative test indicated that CO, oxygen (O2) and smoke density emissions are found to be lower when the engine is filled with B05, B10, B15 and B20 as compared to mineral diesel, while carbon dioxide (CO2) and nitrogen oxide (NOx) with B05, B10, B15 and B20 are found to increase marginally. Brake thermal efficiency and brake specific fuel consumption decrease and increase respectively in biodiesel with different blends in comparison of mineral diesel.

  6. Inhibition of neutral lipase from castor bean lipid bodies by coenzyme A (CoA) and Oleoyl-CoA

    International Nuclear Information System (INIS)

    The neutral lipase (EC 3.1.1.3) in lipid body membranes isolated from the endosperm of 4 day old castor (Ricinus communis L.) seedlings catalyzes the hydrolysis of [14C]trioleoylglycerol, releasing [14C]oleic acid for up to 4 hours. However, the addition of Mg-ATP and coenzyme A (CoA), which are present in the cytoplasm of plant cells, caused a progressive inhibition of the neutral lipase such that after 15 minutes, release of [14C]oleic acid was almost undetectable. A fatty acyl CoA synthetase was found in the lipid body membrane which converts [14C]oleic acid produced from the lipase reaction to [14C]oleoyl-CoA under these conditions. The concentration of free oleoyl-CoA in the reaction mixture when the lipase was inhibited by 50% was calculated to be about 21 micromolar. It was found that a mixture of exogenously added oleoyl-CoA and CoA was most effective in causing lipase inhibition. Little inhibition of lipase was detected in the presence of CoA alone. It is possible that this effect is important in vivo in coordinating lipase activity with fatty acid oxidation

  7. Propolis or cashew and castor oils effects on composition of Longissimus muscle of crossbred bulls finished in feedlot

    Directory of Open Access Journals (Sweden)

    Maribel Velandia Valero

    2014-12-01

    Full Text Available The natural additive products (propolis or essential oils, in replacing antibiotics, could be used as an alternative for feed strategies to improve animal production. This work was performed to evaluate the effect of natural additives as propolis or essential oils on meat quality of crossbred (Aberdeen Angus vs. Nellore bulls. Thirty bulls were kept in feedlot (individual pen for 55 d and randomly assigned to one of three diets (n = 10: control (CON, propolis (PRO, or essential oils (OIL. CON diet consists of corn silage (45% DM and concentrate (cracked corn, soybean meal, glycerin, limestone, and mineral salt, 55% DM. The PRO group received same CON diet plus 3 g animal-1 d-1 of propolis premix added to the concentrate. The OIL group received same CON diet and 3 g animal-1 d-1 of a premix (cashew Anacardium occidentale L. and castor Ricinus communis L. oils added to the concentrate. Fat thickness (5.0 mm, pH (5.9, Longissimus muscle area 58.0 cm², marbling, texture, color (L* = 36.6, a* = 17.3, and b* = 5.9, lipid oxidation (0.08 malonaldehyde kg-1 meat, and Warner-Bratzler shear force (3.3 kg were unaffected by the diet. PRO and OIL diets had no effect neither on moisture (73.7%, ashes (1.1%, protein (23.8%, and lipids (1.7%, fatty acid composition or polyunsaturated/saturated fatty acid (PUFA/ SFA, 0.13, and n-6/n-3 ratio (6.9 on Longissimus muscle. Addition of natural additives as propolis extract or cashew and castor oils in the diet of bulls when they are finished in a feedlot did not change meat qualities.

  8. Comparative Bio-activity Guided Characterization of Biocide from Jatropha curcas and Ricinus communius L Seeds Oil

    OpenAIRE

    Asnake G. Ede; Abebe G. Demissie

    2013-01-01

    This study reports the characterization of biocide from Jatropha (Jatropha curca) and castor (Ricinus communius L) seeds oil. The biocide potential of the seeds oil was evaluated against termite (Odontotermes obesus) and cockroach (Blattela germanica). The bioassay study showed that Jatropha 10% oil caused 100% mortality in 48 hrs and 72 hrs against termite and cockroach, respectively. Castor 10% oil caused 100% mortality in 60hrs and 72 hrs against termite and cockroach, respectively. The L...

  9. Castor oil overdose

    Science.gov (United States)

    Castor oil is a yellowish liquid often used as a lubricant and in laxatives. This article discusses poisoning from swallowing a large amount (overdose) of castor oil. This is for information only and not for ...

  10. Variation in the oxygen isotope ratio of phloem sap sucrose from castor bean. Evidence in support of the Péclet effect.

    Science.gov (United States)

    Barbour, M M; Schurr, U; Henry, B K; Wong, S C; Farquhar, G D

    2000-06-01

    Theory suggests that the level of enrichment of (18)O above source water in plant organic material (Delta) may provide an integrative indicator of control of water loss. However, there are still gaps in our understanding of the processes affecting Delta. One such gap is the observed discrepancy between modeled enrichment of water at the sites of evaporation within the leaf and measured enrichment of the leaf water as a whole (Delta(L)). Farquhar and Lloyd (1993) suggested that this may be caused by a Péclet effect. It is also unclear whether organic material formed in the leaf reflects enrichment of water at the sites of evaporation within the leaf or Delta(L). To investigate this question castor bean (Ricinus communis L.) leaves, still attached to the plant, were sealed into a controlled-environment gas exchange chamber and subjected to a step change in leaf-to-air vapor pressure difference. Sucrose was collected from a cut on the petiole of the leaf in the chamber under equilibrium conditions and every hour for 6 h after the change in leaf-to-air vapor pressure difference. Oxygen isotope composition of sucrose in the phloem sap (Delta(suc)) reflected modeled Delta(L). A model is presented describing Delta(suc) at isotopic steady state, and accounts for 96% of variation in measured Delta(suc). The data strongly support the Péclet effect theory. PMID:10859197

  11. Fitotoxicidade e seletividade do herbicida trifloxysulfuron sodium na mamona cultivar BRS Nordestina Toxicity and selectivity of trifloxysulfuron-sodium herbicide in castor bean cultivar BRS Nordestina

    Directory of Open Access Journals (Sweden)

    Uilma C. de Q. Ferreira

    2009-12-01

    Full Text Available A mamoneira (Ricinus communis L. da família das Euforbiáceas, é uma planta rústica, heliófila e resistente à seca, caracteriza-se por sua sensibilidade a diversos herbicidas e à competição imposta pelas plantas daninhas. Objetivou-se neste trabalho estudar a influência de distintas doses do herbicida trifloxysulfuron-sodium* em vários estádios de desenvolvimento da mamoneira, cultivar BRS Nordestina. O experimento foi conduzido em 2006, em condições de casa de vegetação da EMBRAPA - Algodão de Campina Grande, PB. O delineamento experimental foi inteiramente ao acaso, com esquema fatorial 4 x 4 + 1, constando de quatro dosagens 5,0; 7,5; 10,0 e 12,5 g ha-1 de trifloxysulfuron sodium e quatro estádios do desenvolvimento da planta (folhas cotiledonares, duas folhas verdadeiras, duas folhas expandidas e quatro folhas e uma testemunha absoluta. Foram testados, no total, dezessete tratamentos com quatro repetições. As variáveis mensuradas foram redução de crescimento e matéria seca da mamoneira, cultivar BRS Nordestina. Verificou-se, com base nos resultados obtidos para a variável redução de crescimento, refletida pela altura e tamanho das plantas, efeito significativo por doses e estádios do desenvolvimento e a interação entre eles, em que a planta mais nova foi mais sensível ao produto. O herbicida que atua nas folhas e raízes é fitotóxico para a mamoneira, cultivar BRS Nordestina, mesmo na menor dose testada.The castor been (Ricinus communis L. is a rustic plant, heliophile, resistant to drought, belonging to the family of Euforbiace. It is characterized by being sensitive to several herbicides and the competition imposed by harmful plants. This work had as objective to study the influence of different doses of the herbicide trifloxysulfuron-sodium in different states of development of the castor been, cultivar BRS Nordestina. The experiment was conducted during 2006, in a greenhouse of EMBRAPA - Cotton at Campina

  12. Deficiências de macronutrientes no estado nutricional da mamoneira cultivar Iris Deficiencies of macronutrients on nutritional status of castor bean cultivar Iris

    Directory of Open Access Journals (Sweden)

    José Lavres Junior

    2005-02-01

    Full Text Available Os objetivos deste trabalho foram avaliar o efeito da deficiência dos macronutrientes no crescimento e estado nutricional da mamoneira (Ricinus communis L. e a obtenção do quadro sintomatológico das deficiências de N, P, K, Ca, Mg e S. Cultivou-se Ricinus communis L. cultivar Iris em solução nutritiva, tendo como tratamentos soluções completa e deficientes em N, P, K, Ca, Mg e S. Foram determinadas a concentração indireta de clorofila, a atividade da redutase do nitrato, os teores solúveis de N (NO3-, P (H2PO4- e K+ e realizados testes rápidos para N, P e K. As deficiências de N, Ca, S e Mg foram as que mais restringiram a produção de massa de matéria seca, na ordem decrescente: N>Ca>S>Mg>K>P. Os maiores acúmulos de macronutrientes, no tratamento completo, foram observados nas raízes e no limbo das folhas inferiores. As concentrações críticas para N e Ca, ambas no limbo das folhas superiores e, Mg, no pecíolo das inferiores foram, respectivamente, 46,7, 13,8 e 6,5 g kg-1. As deficiências influenciaram as leituras do clorofilômetro. A atividade da redutase do nitrato guardou relação direta com a determinação da clorofila. Os teores de N (NO3-, P (H2PO4- e K+ foram menores nas folhas deficientes em N, P e K, respectivamente, o mesmo acontecendo quando avaliadas pela análise de toque.The objectives of this work were to evaluate the effect of macronutrient deficiencies on growth and on nutritional status of castor beans (Ricinus communis L., and to obtain the symptoms of the lack of N, P, K, Ca, Mg and S. Nutrient solutions containing all macronutrients and those from which one of these elements was omitted were the treatments used. The following determinations were made: chlorophyll (indirectly, nitrate reductase activity, NO3--N, H2PO4--P and K+, both on soluble fractions, and by spot tests. Deficiencies of N, Ca, S and Mg were the most limiting for dry matter production, followed in decreasing order by those of K and

  13. Substratos para produção de mudas de mamoneira compostos por misturas de cinco fontes de matéria orgânica Substrates for castor seedlings production composed by blends of five organic materials

    Directory of Open Access Journals (Sweden)

    Rosiane de Lourdes Silva de Lima

    2006-06-01

    Full Text Available O plantio de mamona (Ricinus communis L. através de mudas pode ser uma alternativa para um melhor aproveitamento da curta estação chuvosa do semi-árido brasileiro, porém ainda não se dispõe de informações básicas para o emprego desta técnica. Na formulação de substratos para produção de mudas de mamona, as características físicas, principalmente a aeração, são fatores de grande importância. O presente estudo objetivou avaliar a composição de substratos utilizando misturas de solo, esterco bovino, casca de amendoim, mucilagem de sisal, bagaço de cana e cama de frango. Utilizou-se delineamento em blocos casualizados com 12 tratamentos e quatro repetições. Sementes da cultivar BRS Nordestina foram semeadas em sacos plásticos de 17 x 28cm, contendo misturas dos materiais a serem testados. Valores de altura, área foliar, número de folhas e diâmetro caulinar foram registrados semanalmente entre 15 e 43 dias após a emergência. Na última coleta também se registraram a massa seca da parte aérea e das raízes. O substrato composto por solo + casca de amendoim + cama de frango + mucilagem de sisal propiciou o melhor crescimento das mudas. A cama de frango contribuiu para o enriquecimento químico do substrato, enquanto a casca de amendoim e a mucilagem de sisal contribuíram para adequar as características físicas de aeração e retenção de água.Planting castor (Ricinus communis L. by seedlings can be an alternative for a better use of the short rainy season at brazilian semi-arid region, however there has been a lack of information necessary for this technique adoption. Physics characteristics, mainly aeration, are very important in a substrate for castor seedlings production. A trial was run in a randomized block design with 12 treatments and 4 replications in order to evaluate substrates for castor seedlings production. Treatments were blends of sand, bovine manure, peanut hulls, agave mucilage, sugarcane bagasse

  14. Características agronômicas de cultivares de mamona em função do local de cultivo e da época de semeadura no Rio Grande do Sul Characteristics of castor bean cultivars according to the environmental crop and sowing season in Rio Grande do Sul State, Brazil

    Directory of Open Access Journals (Sweden)

    Jacson Zuchi

    2010-03-01

    Full Text Available A mamona (Ricinus communis L. é uma planta oleaginosa anual e, ocasionalmente, bienal em regiões tropicais, com ciclo médio de 150 dias para a maioria das cultivares anuais e de 120 a 130 dias para cultivares anuais precoces. O objetivo deste trabalho foi avaliar características agronômicas de cultivares das mamonas 'Al Guarany 2002', 'IAC 80', 'IAC 226' e 'BRS 188 Paraguaçu'em função do ambiente de cultivo e da época de semeadura. As cultivares foram semeadas entre o primeiro e o quinto dia dos meses de novembro e dezembro, na Embrapa Clima Temperado, em Pelotas, Rio Grande do Sul. Cada época teve 12 unidades experimentais em três blocos casualizados. A emergência, a altura de planta e de inserção do primeiro cacho, o período de florescimento e colheita e o ataque de pragas e doenças foram avaliados e analisados com o programa WinStat Versão 2.0. O comportamento entre as cultivares diferiu entre locais de cultivo e época de semeadura. A inserção do cacho foi mais alta, e as florações e colheitas foram mais tardias em plantas da segunda época de semeadura. Danos por pragas e doenças e os descritores morfológicos da planta de mamona apresentaram diferenças entre os locais de cultivo.Castor bean (Ricinus communis L. is an oleaginous plant with annual cycle and occasionally biennial cycle in tropical areas, with mean cycle of 150 days for the majority of annual cultivars and 120 to 130 days for annual early cultivars. The objective of this study was to evaluate the agronomic characteristics of castor cultivars according to environmental crop and sowing season. The experiment was conduced at Embrapa Clima Temperado - Pelotas/RS, in two places. The castor cultivars used in this research were 'Al Guarany 2002', 'IAC 80', 'IAC 226' and 'BRS 188 Paraguaçu', which were sown in two sowing times: the first was in early November (between 1st and 5st and the second was in early December (between 1st and 5st. Each sowing season was

  15. Simulación de los cambios de carbono orgánico del suelo en sistema de cultivo con higuerilla por el modelo RothC Simulation of soil organic carbon changes in crop systems with castor bean using the RothC model

    Directory of Open Access Journals (Sweden)

    Lucila González Molina

    2012-11-01

    Full Text Available El objetivo del presente trabajo fue la simulación de los cambios del carbono orgánico del suelo (COS, por el modelo RothC, en razón del cambio de uso de suelo del sistema tradicional - asociación maíz-calabaza (TMC - a sistemas con higuerilla (Ricinus communis: multiestratos (MUL, callejones (CALL y monocultivo de higuerilla (HIG. Las simulaciones del COS se hicieron para las profundidades de suelo 0-20 y 0-40 cm, para el periodo de 1980-2040, considerándose como línea base al sistema TMC. Las tasas de cambio de COS estimadas con el RothC, en ambas profundidades de suelo, estuvieron en 0,5-1,2, 0,4-0,8, 0,3-0,5 y 0,04-0,1 Mg ha-1 de C por año en los sistemas HIG, MUL, CALL y TMC, respectivamente, y fueron consistentes con las reportadas en la literatura. El desempeño del RothC tuvo 89% de eficiencia (EF, con R²=0,9, lo que muestra que este modelo puede usarse con información temporal del COS escasa, información de la historia de uso de suelo y mediciones de la entrada de residuos vegetales aéreos y subterráneos en el suelo.The objective of this work was to simulate, by the RothC model, the changes in soil organic carbon (SOC caused by changes of land use - from the traditional maize-squash (TMC association to systems with castor bean (Ricinus communis: multilayer (MUL, alleys (CALL and monoculture (HIG. SOC simulations were performed for 0-20 and 0-40 cm soil depths, for the period 1980-2040, considering the TMC system as the base line. SOC change rates estimated with RothC, for both soil depths, were 0.5-1.2, 0.4-0.8, 0.3-0.5 and 0.04-0.1 Mg ha-1 C per year in the HIG, MUL, CALL and TMC systems, respectively, and were consistent with those reported in the literature. RothC perfomance had 89% efficiency (EF and R² = 0.9, which shows that this model can be used with scarce SOC temporal information, information on the history of land use, and with input measurements of aerial and underground plant residues in the soil.

  16. The CASTOR initiative

    Energy Technology Data Exchange (ETDEWEB)

    Le Thiez, Pierre [GEOGREEN (France)

    2008-07-15

    In this paper it is spoken over the CASTOR project, which has 31 partners of 12 European countries. Also it is spoken on the strategy for the CO{sub 2} reduction in Europe; what on the capture and post-combustion has been done, and what as far as geologic CO{sub 2} storage has been accomplished. [Spanish] En esta ponencia se habla sobre el proyecto Castor, el cual cuenta con 31 socios de 12 paises europeos. Tambien se habla sobre la estrategia para la reduccion de CO{sub 2} en Europa; lo que se ha hecho en cuanto a captura post-combustion y lo que se ha hecho para el almacenamiento geologico de CO{sub 2}.

  17. ECRH on CASTOR

    Czech Academy of Sciences Publication Activity Database

    Preinhaelter, Josef; Žáček, František; Irzak, M. A.; Vahala, L.; Vahala, G.

    2000-01-01

    Roč. 50, S 3 (2000), s. 51-56. ISSN 0011-4626. [Symposium on Plasma Physics and Technology/19th./. Prague, 06.06.2000-09.06.2000] R&D Projects: GA ČR GA202/00/1215; GA ČR GA202/97/0778 Institutional research plan: CEZ:AV0Z2043910 Keywords : plasma * tokamak * CASTOR Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 0.298, year: 2000

  18. Volume de recipientes e composição de substratos para produção de mudas de mamoneira Recipients volume and substrate composition for castor seedlings production

    Directory of Open Access Journals (Sweden)

    Rosiane de Lourdes Silva de Lima

    2006-06-01

    Full Text Available A mamoneira (Ricinus communis L.é uma oleaginosa bem adaptada ao cultivo na região semi-árida por sua rusticidade e resistência ao estresse hídrico. Seu plantio é tradicionalmente feito por sementes, mas o uso de mudas pode se tornar atraente como estratégia para melhor aproveitamento da curta estação chuvosa. Para adoção desta tecnologia, a definição de aspectos técnicos como volume de recipientes, composição do substrato e período de permanência da muda no viveiro são fundamentais para o êxito da técnica. Conduziu-se experimento em casa-de-vegetação da Embrapa Algodão em Campina Grande, com sementes da cultivar de mamona de porte médio BRS Nordestina, em delineamento de blocos casualizados com 4 repetições e 25 tratamentos em distribuição fatorial 5², sendo os fatores cinco volumes de recipientes e cinco composições de substratos. Entre 15 e 43 dias após a emergência (DAE foram feitas cinco coletas destrutivas semanais para obtenção de dados de altura, diâmetro caulinar, área foliar, número de folhas e matéria seca da parte aérea e radicular. Com os dados obtidos calculou-se o tamanho da folha. Detectaram-se efeitos significativos dos tratamentos em todas as variáveis estudadas. O crescimento das mudas estabilizou-se aproximadamente aos 36 DAE, independente do volume do recipiente. Os substratos compostos por mistura de areia com esterco bovino ou casca de amendoim propiciaram o melhor crescimento das mudas, enquanto aqueles contendo bagaço de cana ou mucilagem de sisal foram os piores. Recipientes de 2 L de volume foram os mais adequados para a produção de mudas de mamoneira.Castor (Ricinus communis L. is an oilseed crop well adapted for growing at semi-arid region for its rusticity and resistance to water deficit. It is usually planted by seeds, but planting by seedling can become attractive as a strategy for better use of the short rainy season. Before the adoption of this technology some aspects

  19. Biotechnology for Castor oil Production

    Science.gov (United States)

    We conducted a series of seed development studies in castor and L. fendleri, including seed morphogenesis, oil and storage protein accumulation and lipid gene expression. In castor, the entire course of seed development can be divided into eight stages and each stage can be distinguished by seed co...

  20. Prospective study for the production of oleochemicals derivates from castor oil in Colombia

    Directory of Open Access Journals (Sweden)

    Margarita Guerrero

    2010-04-01

    Full Text Available There are many ways get closet to the future, being the prospective the one that conceives the future, not like an unique reality but like a multiple one, obtained as a result of the identification of the human beign future actions. For all this, the human being takes knowledge, the yearings and the fears that he sees for the actions he will undertake. Using the prospective, this article outlines the dynamics that will have the oleochemical castor oil sector, because Colombia has resources to develop Ricinus comunnis cultivation and industrial uses of castor oil and its derivates. The study establishes the keys that define the current and future behaviour of the system, the position and the power of each one of the involved actors will have, and the determination of the scenarios (future representations with more probability to occur, as well as the definition of the scenario wanted and the strategies that will allow to reach it.

  1. DNA ANALYSIS OF RICIN USING RAPD TECHNIQUE

    OpenAIRE

    Martin Vivodík; Želmíra Balážová; Zdenka Gálová

    2014-01-01

    Castor (Ricinus communis L.) is an important plant for production of industrial oil. The systematic evaluation of the molecular diversity encompassed in castor inbreds or parental lines offers an efficient means of exploiting the heterosis in castor as well as for management of biodiversity. The aim of this work was to detect genetic variability among the set of 30 castor genotypes using 5 RAPD markers. Amplification of genomic DNA of 30 genotypes, using RAPD analysis, yielded 35 fragments, w...

  2. Neuroglial response to neuron injury. A study using intraneural injection of ricinus communis agglutinin-60.

    OpenAIRE

    Ling, E A; Wen, C Y; J.Y. Shieh; Yick, T Y; Leong, S K

    1989-01-01

    The present study has shown the selective destruction of large ventral horn neurons in the lumbosacral cord segments following a single injection of RCA-60 into the sciatic nerve. The neurons appeared to undergo structural alteration beginning 3 days after the RCA application. In the postoperative period extending from 1 to 60 days, degeneration of neurons was progressive and irreversible and this elicited a rapid increase in the number of microglial cells. They were most numerous in the 7 da...

  3. Neuroglial response to neuron injury. A study using intraneural injection of ricinus communis agglutinin-60.

    Science.gov (United States)

    Ling, E A; Wen, C Y; Shieh, J Y; Yick, T Y; Leong, S K

    1989-06-01

    The present study has shown the selective destruction of large ventral horn neurons in the lumbosacral cord segments following a single injection of RCA-60 into the sciatic nerve. The neurons appeared to undergo structural alteration beginning 3 days after the RCA application. In the postoperative period extending from 1 to 60 days, degeneration of neurons was progressive and irreversible and this elicited a rapid increase in the number of microglial cells. They were most numerous in the 7 days postoperative animals. The massive microglial cells penetrated the neuropil and appeared to strip off the axon terminals from the postsynaptic somata. Occasional axon terminals were phagocytosed by microglia. The numerous microglial cells often formed a multilayered 'barrier' encircling the somata of the RCA-poisoned neurons which eventually became totally disorganised. It is postulated that in the course of neuronal degeneration induced by RCA, microglial cells serve to prevent the leakage or diffusion of the toxic lectin from the neuronal somata into the neighbouring neuropil. They also function as scavenger cells in the removal of degenerating myelinated axons in the longer surviving rats. Oligodendrocytes do not appear to react actively to the degeneration process. However, astrocytes showed a significant increase in the 7 and 15 day postoperative rats and this coincided with the presence of mitotic astrocytes in the same period. PMID:2606792

  4. SELEÇÃO AGRONÔMICA DE ACESSOS E CULTIVARES DE MAMONEIRA (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Helen Cristina de Arruda Rodrigues

    2007-06-01

    Full Text Available The objective of this work was to evaluate agronomic and to characterize morfologic, 23 genetic materials collected with agricultural producers of diverse and regions two to cultivate, for comparative effect, ` Guarani ' and ` IAC 80 '. The experiment was established in the Department of Agriculture of the Federal University of Lavras, Lavras - MG where 23 accesses had been characterized morphologic and agronomic in accordance with the describers considered for the Agronomic Institute of Campinas. The identification of the adapted accesses more was made by means of evaluations, during one year, of the agronomic characteristics: evolution cycle, height of plant; diameter of main connecting rod; height until the insertion of first racimo; number of stem until first racimo; relation weight of first racimo and all up weight; weight of first racimo and total weight, in a competition assay. In accordance with the analysis of variance, did not have significant difference between the treatments.

  5. Drug: D06462 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available s in Japan [BR:br08301] 2 Agents affecting individual organs 23 Digestive organ agents 235 Purgatives... FOR CONSTIPATION A06AB Contact laxatives A06AB05 Castor oil D06462 Castor oil (J...65], 9,10-Dihtdroxystearic acid Ricinus communis L. [TAX:3988] Laxative Same as: E00049 Therapeutic category

  6. 21 CFR 172.876 - Castor oil.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Castor oil. 172.876 Section 172.876 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... Multipurpose Additives § 172.876 Castor oil. The food additive castor oil may be safely used in accordance...

  7. Evaluation of phytoextracting cadmium and lead by sunflower, ricinus, alfalfa and mustard in hydroponic culture

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Soil contaminated with heavy metals cadmium (Cd) and lead (Pb) is hard to be remediated. Phytoremediation may be a feasible method to remove toxic metals from soil, but there are few suitable plants which can hyperaccumulate metals. In this study, Cd and Pb accumulation by four plants including sunflower (Helianthus annuus L.), mustard (Brassica juncea L.), alfalfa (Medicago sativa L.), ricinus (Ricinus communis L.) in hydroponic cultures was compared. Results showed that these plants could phytoextract heavy metals, the ability of accumulation differed with species, concentrations and categories of heavy metals. Values of BCF (bioconcentration factor) and TF (translocation factor) indicated that four species had dissimilar abilities of phytoextraction and transportation of heavy metals. Changes on the biomass of plants, pH and Eh at different treatments revealed that these four plants had distinct responses to Cd and Pb in cultures. Measurements should be taken to improve the phytoremediation of sites contaminated with heavy metals, such as pH and Eh regulations, and so forth.

  8. Replacement of soybean meal by treated castor meal in supplements for grazing heifer during the dry-rainy season period Substituição do farelo de soja por farelo de mamona tratado em suplementos para novilhas em pastejo no período de transição seca-águas

    Directory of Open Access Journals (Sweden)

    L.V. Barros

    2011-04-01

    Full Text Available The objective of this work was to evaluate the effect of multiple supplement with different levels of castor meal (Ricinus communis L. treated with calcium oxide on intake, on the total apparent digestibility of dietary components, on the efficiency of microbial synthesis and on the performance of beef heifers grazing Brachiaria decumbens during the dry-rainy transition period. The experimental area was composed of five 2.5-ha paddocks with availability of potentially digestible dry matter of 2,858.4 kg/ha. It was used 25 Nellore heifers and 10 crossbred with predominance of Zebu breed heifers at 13 months of age and body weight of 210 ± 0.8 kg in a completely randomized experimental design. Supplements contained approximately 25% of crude protein (CP and they were formulated with 0; 33; 67 and 100% of castor meal replacing soybean meal. Daily weight gain was 366.1 g for animals in the control group and 439.7; 478.9; 556.3; and 493.9, respectively for those fed supplements with 100% of soybean meal and 33, 67 and 100% castor meal. There was no effect of treated castor meal levels on daily weight gain of the animals, which was higher in those animals fed supplements. Levels of castor meal had decreasing linear effect on intakes of dry matter (DM, organic matter (OM, ether extract (EE, digested dry matter and digestible neutral detergent fiver and on the intake of total digestible nutrients. Coefficients of apparent digestibility of DM, OM, CP, EE and non-fibrous carbohydrates were greater for animals under supplementation. Microbial efficiency, expressed in g of crude protein per kg of consumed TDN, did not differ among groups. Replacement of soybean meal by castor meal treated with calcium oxide does not harm animal performance.Objetivou-se avaliar o efeito de suplementos múltiplos com diferentes níveis de farelo de mamona (Ricinus communis L. tratado com óxido de cálcio sobre o consumo, a digestibilidade aparente total de componentes da

  9. Divergência genética entre acessos e cultivares de mamoneira por meio de estatística multivariada Genetic divergence on castor bean accesses and cultivars through multivariate analysis

    Directory of Open Access Journals (Sweden)

    Mauro Nóbrega da Costa

    2006-11-01

    Full Text Available O objetivo deste trabalho foi avaliar a divergência genética entre acessos e cultivares de mamoneira (Ricinus communis L. e utilizá-la como critério na escolha de genitores que viabilizem, a partir de hibridações, a formação de populações segregantes. Os tratamentos foram representados pelos acessos BRA 4871, BRA 2968, BRA 5550 e BRA 7722 Papo-de-gia, e as cultivares BRS 188 Paraguaçu, BRS 149 Nordestina, IAC-80, Mirante-10 e Pernambucana Melhorada. As características analisadas foram: início do florescimento (FR, número de racemos por planta (NRP, comprimento efetivo do racemo primário (CR, altura de planta (AP, potencial produtivo (PP e teor de óleo nas sementes (TO. A divergência genética foi estimada por meio de estatística multivariada, com base em variáveis canônicas e análise de agrupamento, tendo-se empregado a distância euclidiana média. Houve a formação de dois grupos: o grupo I formado por oito genótipos e o grupo II por apenas um genótipo, a cultivar Mirante-10. Apesar de a cultivar Mirante-10 ter sido a mais divergente, não deve ser recomendada para hibridação, por sua baixa média de desempenho. As demais cultivares também apresentam restrições para hibridação, por serem bastante similares. As variáveis que mais contribuíram para a divergência genética foram FR, AP, TO e CR.This work aimed to evaluate genetic divergence among castor bean (Ricinus communis L. cultivars, in order to enable the choice of parents which make the formation of segregating populations possible. Accesses BRA 4871, BRA 2968, BRA 5550 and BRA 7722 Papo-de-gia, and cultivars BRS 188 Paraguaçu, BRS 149 Nordestina, IAC-80, Mirante-10 and Pernambucana Melhorada were evaluated. Characteristics analyzed were: days to flowering, number of racemes per plant, length of pistillate region of main raceme, plant height, potential yield, and seed oil content. The genetic divergence among accesses and cultivars was studied by

  10. LHCD experiments on tokamak CASTOR

    International Nuclear Information System (INIS)

    A short survey is given of the experimental activities at the small Prague tokamak CASTOR. They concern primarily the LH current drive using multijunction waveguide grills as launching antennae. During two last years the, efforts were focused on a study of the electrostatic and magnetic fluctuations under conditions of combined inductive/LHCD regimes and of the relation of the level of these fluctuations to the anomalous particles transport in tokamak CASTOR. Results of the study are discussed in some detail. (author). 24 figs., 51 refs

  11. CASTOR Calorimeter Installation Review at CMS

    CERN Multimedia

    CERN Video Productions

    2011-01-01

    This test is a part of CASTOR EDR process. The CASTOR phys-tech review held on 14 Jan 2011 and the subsequent EDR held on 17 Jun 2011, the CMS Management Board has endorsed a strategy in which CASTOR is removed during the 2011 Year-End Technical Stop, but is then refurbished, replacing a substantial fraction of the phototubes, so that it is ready for re-installation in the Technical Stop just before 2012 heavy-ion operation.

  12. Castor Oil-Based Biodegradable Polyesters.

    Science.gov (United States)

    Kunduru, Konda Reddy; Basu, Arijit; Haim Zada, Moran; Domb, Abraham J

    2015-09-14

    This Review compiles the synthesis, physical properties, and biomedical applications for the polyesters based on castor oil and ricinoleic acid. Castor oil has been known for its medicinal value since ancient times. It contains ∼90% ricinoleic acid, which enables direct chemical transformation into polyesters without interference of other fatty acids. The presence of ricinoleic acid (hydroxyl containing fatty acid) enables synthesis of various polyester/anhydrides. In addition, castor oil contains a cis-double bond that can be hydrogenated, oxidized, halogenated, and polymerized. Castor oil is obtained pure in large quantities from natural sources; it is safe and biocompatible. PMID:26301922

  13. Nível tecnológico e balanço econômico de produção de mamona para obtenção do biodiesel no estado do Ceará

    OpenAIRE

    Khan, Ahmad Saeed; Braga, Francisco Laercio Pereira; Mayorga, Ruben Dario

    2008-01-01

    In order to determine technological level and economic balance of castor seed prodution (Ricinus communis) in the State of Ceará, one of the main producers of oil seed of Northeast of Brazil, the present research was coducted to verify economic feasibility and technological level of castor seed production for obtaining biodiesel. The data were collected in Boa Viagem, Tauá and Pedra Branca municipalities. For profit analysis, income and production cost per hectare of castor seed production in...

  14. Transmission of Bartonella henselae by Ixodes ricinus

    OpenAIRE

    Cotté, Violaine; Bonnet, Sarah; Le Rhun, Danielle; Le Naour, Evelyne; Chauvin, Alain; Boulouis, Henri-Jean; Lecuelle, Benoit; Lilin, Thomas; Vayssier-Taussat, Muriel

    2008-01-01

    Bartonella spp. are facultative intracellular bacteria associated with several emerging diseases in humans and animals. B. henselae causes cat-scratch disease and is increasingly associated with several other syndromes, particularly ocular infections and endocarditis. Cats are the main reservoir for B. henselae and the bacteria are transmitted to cats by cat fleas. However, new potential vectors are suspected of transmitting B. henselae, in particular, Ixodes ricinus, the most abundant ixodid...

  15. Weed management strategies for castor bean crops

    Directory of Open Access Journals (Sweden)

    Augusto Guerreiro Fontoura Costa

    2014-04-01

    Full Text Available Castor bean crops are agriculturally relevant due to the quality and versatility of their oil, both for the chemical industry and for biodiesel production. Proper weed management is important for both the cultivation and the yield of castor bean crops; therefore, the intention of the present work is to review pertinent information regarding weed management, including the studies regarding weed interference periods, chemical controls for use in different crop production systems and herbicide selectivity, for castor bean crops. Weed science research for castor bean crops is scarce. One of the main weed management challenges for castor bean crops is the absence of herbicides registered with the Ministry of Agriculture, Livestock and Food Supply (MALFS. Research for viable herbicides for weed control in castor bean crops should be directed by research and/or rural extension institutions, associations and farmers cooperatives, as well as by manufactures, for the registration of these selective herbicides, which would be primarily used to control eudicotyledons in castor bean crops. New studies involving the integration of weed control methods in castor bean also may increase the efficiency of weed management, for both small farmers using traditional crop methods in the Brazilian Northeast region, as well as for areas with the potential for large scale production, using conservation tillage systems, such as the no-tillage crop production system.

  16. Synthesis of novel castor oil phosphonates

    Science.gov (United States)

    Castor oil has served as a versatile hydroxy fatty acid (HFA); its principle component, ricinoleic acid, can be isolated from castor oil and has been modified extensively for a number of applications. Additionally, phosphonates and their corresponding phosphonic acids are a functional moiety that ha...

  17. Entomopathogenic fungi associated with Ixodes ricinus ticks

    DEFF Research Database (Denmark)

    Kalsbeek, Vibeke; Frandsen, F.; Steenberg, Tove

    1995-01-01

    The objective of this study was to demonstrate the occurrence of entomopathogenic fungi on Ixodes ricinus ticks in relation to the tick stage, engorgement and season. Ticks were collected from the vegetation, from small rodents and from deer. All entomopathogenic fungi found belonged...... infected with fungi. Thirty-three out of 149 engorged females were infected, whereas males and engorged larvae were not infected. Throughout the season, a significantly higher proportion of ticks collected in autumn were infected. Entomopathogenic fungi may have a significant impact on the size of the I...

  18. Thermoanalytical characterization of castor oil biodiesel

    Energy Technology Data Exchange (ETDEWEB)

    Conceicao, Marta M.; Fernandes, Valter J. [Universidade Federal do Rio Grande do Norte, Departamento de Quimica, Laboratorio de Combustiveis, Natal, RN, Lagoa Nova, CEP 59072970 (Brazil); Candeia, Roberlucia A.; Bezerra, Aline F.; Souza, Antonio G. [Universidade Federal da Paraiba, Departamento Quimica, Joao Pessoa, PB (Brazil); Silva, Fernando C. [Universidade Federal do Maranhao, Sao Luis, Maranhao (Brazil)

    2007-06-15

    The castor oil seed has 47-49% of oil. Biodiesel obtained from castor oil has a lower cost compared to the ones obtained from other oils, as due its solvability in alcohol transesterification occurs without heating. The use of biodiesel will allow a reduction on the consumption of petroleum-derived fuels minimizing the harmful effects on the environment. This work wants to provide a thermoanalytical and physical-chemistry characterization of castor oil and biodiesel. Biodiesel was obtained with methyl alcohol and characterized through several techniques. Gas chromatography indicated methyl ester content of 97.7%. The volatilization of biodiesel starts and finishes under inferior temperatures than the beginning and final volatilization temperatures of castor oil. Biodiesel data are very close to the volatilization temperatures of conventional diesel. (author)

  19. Weed management strategies for castor bean crops

    OpenAIRE

    Augusto Guerreiro Fontoura Costa; Valdinei Sofiatti; Cleber Daniel de Góes Maciel; Juliana Parisotto Poletine; João Igor de Sousa

    2014-01-01

    Castor bean crops are agriculturally relevant due to the quality and versatility of their oil, both for the chemical industry and for biodiesel production. Proper weed management is important for both the cultivation and the yield of castor bean crops; therefore, the intention of the present work is to review pertinent information regarding weed management, including the studies regarding weed interference periods, chemical controls for use in different crop production systems and herbicide s...

  20. Studies with Myrtus communis L.: Anticancer properties.

    Science.gov (United States)

    Ogur, Recai

    2014-01-01

    Myrtus communis (MC) L. is a well-known Mediterranean plant with important cultural significance in this region. In ancient times, MC was accepted as a symbol of immortality. Maybe due to this belief, it is used during cemetery visits in some regions. Although it is a well-known plant in cosmetics, and there is a lot of studies about its different medical properties, anticancer studies performed using its different extracts or oils are not so much, but increasing. We collected these anticancer property-related studies in this review. PMID:26401362

  1. Antiviral activity of constituents of Tamus communis.

    Science.gov (United States)

    Aquino, R; Conti, C; De Simone, F; Orsi, N; Pizza, C; Stein, M L

    1991-10-01

    The antiviral activity of the phenanthrene derivatives 1-6, of the spyrostane triglycosides dioscin (7) and gracillin (8), of the furostanol tetraglycosides methylprotodioscin (9), its (25S) epimer methylprotoneodioscin (10), and methylprotogracillin 11, have been tested towards two RNA viruses: vesicular stomatitis virus and human rhinovirus type 1B. All these products were extracted from the rizomes of Tamus communis L; compound 11 was isolated also from Asparagus cochinchinesis, together with pseudoprotodioscin (12), a 20 (22)-unsaturated furostanoside, which was also investigated for antiviral activity. The results were of some interest mainly for the phenanthrene derivatives. PMID:1667189

  2. 不同品种蓖麻对镉的响应及修复能力评价%Evaluation of Cadmium Tolerance and Cadmium-phytoextraction Ability of 30 Castor Bean Cultivars

    Institute of Scientific and Technical Information of China (English)

    张晗芝; 郭庆军; 杨俊兴; 陈同斌; 王坚; 王鑫; 陈刚; 邵春岩

    2016-01-01

    Castor bean (Ricinus communis L.), a valuable renewable resource, is cultivated as a resource for bioenergy production, and also for bioremediation. In this study, we compare the growth of 30 castor bean cultivars under 2 mg·kg-1 Cd and 5 mg·kg-1 Cd conditions in a pot experiment in the greenhouse (5~32℃). We evaluate Cd accumulation in different parts of the plants, and compare the abilities of the cultivars to extract Cd from the soil. The 30 cultivars show different degrees of Cd tolerance, as indicated by the aboveground biomass response to Cd stress index (> 0 with 10 cultivars, < 0 with 20 cultivars). Under 2 mg·kg-1 Cd conditions, the range of Cd concentrations is 0.600~1.670 mg·kg-1 in the stems, 0.310~1.970 mg·kg-1 in the leaves and 0.130~0.909 mg·kg-1 in the fruit. The average Cd concentrations in stems, leaves and fruit is 1.030, 0.831 and 0.362 mg·kg-1, respectively. Under 5 mg·kg-1 Cd conditions, the range of Cd concentrations is 1.012~4.032 mg·kg-1 in the stems, 0.698~3.514 mg·kg-1 in the leaves and 0.227~1.525 mg·kg-1 in the fruit. The average Cd concentrations in stems, leaves and fruit is 1.964, 1.583 and 0.694 mg·kg-1, respectively. Four cultivars are high-Cd accumulators, and 25 cultivars are low-Cd accumulators. The cultivars also show a range of abilities to extract Cd from soil (26.3~65.7μg·pot-1 under 2 mg·kg-1 Cd and 37.0~121.6μg·pot-1 under 5 mg·kg-1 Cd). Cd concentrations and extraction capability (EA) in aboveground organs are cultivar-dependent, and less affected by the Cd concentration in the soil. On the basis of the Cd concentrations and enrichment factors of the aerial part, castor is not a Cd hyperaccumulator. Therefore, the relative high tolerance cultivars of castor can address the Cd contaminated farmland for phytostabilization and high seed-oil production with a healthy pattern.%蓖麻(Ricinus communis L.)是一种有价值的能源作物,可用于修复镉污染农田同时生产生物能源。

  3. Modified Castor Oil as an Epoxy Resin Curing Agent

    OpenAIRE

    Patel, B. P.; H. S. Patel; Patel, S R

    2004-01-01

    A castor oil, an agricultural product, is an unsaturated material. Hence the castor oil is brominated by bromine liquid. The brominated castor oil (BCO) was then reacted with excess of aliphatic diamines viz; ethylene diamine, 1,3-propane diamine and 1,6-hexane diamine. The resultant amino functionalized castor oil (ACO) samples were then characterized by elemental analysis, IR spectral study and number of amino groups. All the three ACO samples were then employed for the curing of commercial...

  4. 75 FR 44917 - Castor Oil, Ethoxylated, Dioleate; Tolerance Exemption

    Science.gov (United States)

    2010-07-30

    ... AGENCY 40 CFR Part 180 Castor Oil, Ethoxylated, Dioleate; Tolerance Exemption AGENCY: Environmental... requirement of a tolerance for residues of castor oil, ethoxylated, dioleate; when used as an inert ingredient... permissible level for residues of castor oil, ethoxylated, dioleate on food or feed commodities. DATES:...

  5. Descriptores botánicos para caracterizar germoplasmas de Ricinus communis de diferentes zonas de Costa Rica

    Directory of Open Access Journals (Sweden)

    Paola Solera-Steller

    2015-03-01

    Los resultados mostraron valores significativos para la longitud del racimo y el número de frutos por racimo, la razón largo/ancho del fruto, peso del fruto, la razón del largo/ancho de la semilla y el peso de la semilla, con correlaciones superiores a un 45%. Sin embargo, el ACP mostró que existe una alta variabilidad entre los datos, algo muy común entre individuos silvestres, debido principalmente a su forma de dispersión y a la gran cantidad de zonas de vida muestreadas. Para la CJA, se pudieron observar tres grupos ordenados principalmente por las correlaciones entre el tamaño del racimo y el número de frutos, la razón largo/ancho y el peso del fruto y la razón largo/ancho y peso de la semilla, los cuales pueden usarse como indicadores para la caracterización morfológica de la higuerilla proveniente de todo el país.

  6. Phloem flow and sugar transport in Ricinus communis L. is inhibited under anoxic conditions of shoot or roots

    NARCIS (Netherlands)

    Peuke, A.D.; Gessler, A.; Trumbore, S.; Windt, C.W.; Homan, N.; Gerkema, E.; As, van H.

    2015-01-01

    Anoxic conditions should hamper the transport of sugar in the phloem, as this is an active process. The canopy is a carbohydrate source and the roots are carbohydrate sinks.By fumigating the shoot with N2 or flooding the rhizosphere, anoxic conditions in the source or sink, respectively, were induce

  7. Phloem sap proteins from Cucurbita maxima and Ricinus communis have the capacity to traffic cell to cell through plasmodesmata

    OpenAIRE

    Balachandran, Suchandra; Xiang, Yu; Schobert, Christian; Thompson, Gary A.; Lucas, William J.

    1997-01-01

    In angiosperms, the functional enucleate sieve tube system of the phloem appears to be maintained by the surrounding companion cells. In this study, we tested the hypothesis that polypeptides present within the phloem sap traffic cell to cell from the companion cells, where they are synthesized, into the sieve tube via plasmodesmata. Coinjection of fluorescently labeled dextrans along with size-fractionated Cucurbita maxima phloem proteins, ranging in size from 10 to 200 kDa, as well as injec...

  8. Electrochemiluminescence immunosorbent assay of ricin in ground beef: Biotinylated capture antibodies and matrix effects

    Science.gov (United States)

    Ricin is a highly toxic protein present in the seeds of castor (Ricinus communis), grown principally as a source of high quality industrial lubricant and as an ornamental. Because of the past use of ricin for intentional poisoning, there is a need for analytical methodology to detect ricin in food m...

  9. MRI in soils: determination of water concent changes due to root water uptake by means of a multi-slice-multi-echo sequence (MSME)

    NARCIS (Netherlands)

    Pohlmeier, A.; Vergeldt, F.; Gerkema, E.; As, van H.; Dusschoten, van D.; Vereecken, H.

    2010-01-01

    Root water uptake by ricinus communis (castor bean) in fine sand was investigated using MRI with multiecho sampling. Before starting the experiments the plants germinated and grew for 3 weeks in a cylindrical container with a diameter of 9 cm. Immediately before the MRI experiments started, the cont

  10. Review of the traditional uses, phytochemistry, pharmacology and toxicology of giant fennel (Ferula communis L. subsp. communis

    Directory of Open Access Journals (Sweden)

    Maryam Akaberi

    2015-11-01

    Full Text Available Ferula communis L., subsp. communis, namely giant fennel, has extensively been used in traditional medicine for a wide range of ailments. Fresh plant materials, crude extracts and isolated components of F. communis showed a wide spectrum of in vitro and in vivo pharmacological properties including antidiabetic, antimicrobial, antiproliferative, and cytotoxic activities. The present paper, reviews the traditional uses, botany, phytochemistry, pharmacology and toxicology of F. communis in order to reveal its therapeutic potential and future research opportunities. A bibliographic literature search was conducted in different scientific databases and search engines including Scopus, Cochrane Library, Embase, Google Scholar, Pubmed, SciFinder, and Web of science. Phytochemical studies have led to the isolation of different compounds such as sesquiterpenes from F. communis. This plant has two different chemotypes, the poisonous and non-poisonous chemotypes. Each chemotype is endowed with various constituents and different activities. The poisonous chemotype exhibits anticoagulant and cytotoxic activities with sesquiterpene coumarins as major constituents, while the non-poisonous one exhibits estrogenic and cytotoxic effects with daucane sesquiterpene esters as the main compounds. In addition, although various pharmacological properties have been reported for F. communis, anti-microbial activities of the plant have been investigated in most studies. Studies revealed that F. communis exhibits different biological activities, and contains various bioactive compounds. Although, antibacterial and cytotoxic activities are the two main pharmacological effects of this plant, further studies should focus on the mechanisms underlying these actions, as well as on those biological activities that have been reported traditionally.

  11. Tape write-efficiency improvements in CASTOR

    International Nuclear Information System (INIS)

    The CERN Advanced STORage manager (CASTOR) is used to archive to tape the physics data of past and present physics experiments. For reasons of physical storage space, all of the tape resident data in CASTOR are repacked onto higher density tapes approximately every two years. Improving the performance of writing files smaller than 2GB to tape is essential in order to keep the time needed to repack all of the tape resident data within a period of no more than 1 year. This paper reports on the solution to writing efficiently to tape that is currently in its early deployment phases at CERN.

  12. Tough Blends of Polylactide and Castor Oil

    Energy Technology Data Exchange (ETDEWEB)

    Robertson, Megan L.; Paxton, Jessica M.; Hillmyer, Marc A. (UMM)

    2012-10-10

    Poly(l-lactide) (PLLA) is a renewable resource polymer derived from plant sugars with several commercial applications. Broader implementation of the material is limited due to its inherent brittleness. We show that the addition of 5 wt % castor oil to PLLA significantly enhances the overall tensile toughness with minimal reductions in the modulus and no plasticization of the PLLA matrix. In addition, we used poly(ricinoleic acid)-PLLA diblock copolymers, synthesized entirely from renewable resources, as compatibilizers for the PLLA/castor oil blends. Ricinoleic acid, the majority fatty acid comprising castor oil, was polymerized through a lipase-catalyzed condensation reaction. The resulting polymers contained a hydroxyl end-group that was subsequently used to initiate the ring-opening polymerization of L-lactide. The binary PLLA/castor oil blend exhibited a tensile toughness seven times greater than neat PLLA. The addition of block copolymer allowed for control over the morphology of the blends, and even further improvement in the tensile toughness was realized - an order of magnitude larger than that of neat PLLA.

  13. Phenylpropanoid esters of lesquerella and castor oil

    Science.gov (United States)

    Lesquerella (LO) and castor oil (CO) were esterified at the secondary hydroxyl groups of their 14-hydroxyeicos-cis-11-enoic fatty acids and 12-hydroxyoctadec-cis-9-enoic fatty acids, respectively, with 4-acetoxy-3-methoxycinnamic acid (acetoxyferulic acid). The unconventional esterifications were co...

  14. The Castor Plant: Technology and Biotechnology

    Science.gov (United States)

    Production of hydroxy fatty acids in plants is of current interest principally due to the novel properties, physical and chemical, that are characteristic of hydroxy fatty acids. Castor oil is currently the only major source of hydroxy fatty acids. It has a long history in medicinal applications, se...

  15. PHYSIOLOGIC AND SANITARY QUALITY OF CASTOR BEAN SEEDS UNDER DIFFERENT CHEMICAL TREATMENTS QUALIDADE FISIOLÓGICA E SANITÁRIA DE SEMENTES DE MAMONA SUBMETIDAS A DIFERENTES TRATAMENTOS QUÍMICOS

    Directory of Open Access Journals (Sweden)

    Manoel Murilo Macedo Barbosa

    2009-12-01

    ="en-US" align="JUSTIFY">KEY-WORDS: Ricinus communis L.; seeds pathogens; carbendazim; carboxim; thiram.

    O tratamento de sementes com fungicidas tornou-se medida indispensável no controle de patógenos. Entretanto, a eficácia de muitos produtos ainda não é bem conhecida para algumas culturas. Este trabalho teve por objetivo avaliar o efeito de diferentes doses dos fungicidas carbendazim e carboxim + thiram no controle de patógenos e sua interferência sobre a qualidade fisiológica em sementes de mamona. O ensaio foi constituído dos seguintes tratamentos (gramas do ingrediente ativo por 100 kg de sementes: carbendazim (15, 30 e 60, carboxim + thiram (25 + 25, 50 + 50, 100 + 100, formoldeído 0,15% (v/v e testemunha (água destilada. A qualidade fisiológica das sementes foi determinada pela germinação, primeira contagem, emergência a campo, índice de velocidade de emergência (IVE, número de folhas, comprimento, massa verde e seca da parte aérea e condutividade elétrica. Não houve diferenças estatísticas entre os tratamentos, nas avaliações de germinação, IVE, número de folhas, comprimento, massa verde e seca da parte aérea. O tratamento com formoldeído, se comparado aos demais, proporcionou menores médias (p < 0,05 para a primeira contagem e emergência a campo. Sementes tratadas com fungicidas apresentaram maior condutividade elétrica. Os fungos identificados foram Cladosporium spp.; Bipolaris spp.;

  16. Castor Bean Organelle Genome Sequencing and Worldwide Genetic Diversity Analysis

    OpenAIRE

    Rivarola, Maximo; Foster, Jeffrey T.; Chan, Agnes P.; Williams, Amber L.; Rice, Danny W; Liu, Xinyue; Melake-Berhan, Admasu; Huot Creasy, Heather; Puiu, Daniela; Rosovitz, M. J.; Khouri, Hoda M.; Beckstrom-Sternberg, Stephen M.; Allan, Gerard J; Keim, Paul; Ravel, Jacques

    2011-01-01

    Castor bean is an important oil-producing plant in the Euphorbiaceae family. Its high-quality oil contains up to 90% of the unusual fatty acid ricinoleate, which has many industrial and medical applications. Castor bean seeds also contain ricin, a highly toxic Type 2 ribosome-inactivating protein, which has gained relevance in recent years due to biosafety concerns. In order to gain knowledge on global genetic diversity in castor bean and to ultimately help the development of breeding and for...

  17. Anthrasteroid hydrocarbons of the sheep tick Ixodes ricinus

    Czech Academy of Sciences Publication Activity Database

    Zahradníčková, Helena; Kalinová, Blanka; Šaman, David; Cvačka, Josef; Svatoš, Aleš; Bouman, Edwin Arien Poul; Šimek, Petr

    Barcelona: University of Barcelona, 2006. s. 127. [Annual Meeting International Society of Chemical Ecology. 15.07.2006-19.07.2006, Barcelona] Institutional research plan: CEZ:AV0Z40550506; CEZ:AV0Z50070508 Keywords : anthrasteroid hydrocarbon * Ixodes ricinus Subject RIV: CC - Organic Chemistry

  18. Polydimethylsiloxane and Castor Oil Comodified Waterborne Polyurethane

    OpenAIRE

    Xuan Ji; Yanming Zhou; Baoling Zhang; Caiying Hou; Guozhang Ma

    2013-01-01

    In view of both improving properties of waterborne polyurethane (WPU) and sufficient utilization of renewable resources, a series of polydimethylsiloxane (PDMS) and castor oil (C.O.) comodified anionic WPUs with internal cross-linking was prepared through a prepolymer mixing process. The chemical structure of synthesized polymers was characterized by Fourier transforms infrared spectroscopy (FT-IR). In comparison with traditional linear WPU synthesized from petroleum-based polyols, these nove...

  19. Compression tests of castor oil biopolymer

    OpenAIRE

    Amauri Bravo Ferneda; Romeu Rony Cavalcante da Costa; Volnei Tita; Sérgio Persival Baroncini Proença; Jonas de Carvalho; Benedito de Moraes Purquerio

    2006-01-01

    Many methods have been developed to test and evaluate the mechanical properties of the biopolymer from castor oil employed in implants and osteo-repositions, among other things. Most of the methods are performed under quasi-static and cyclic loads (creep and relaxation tests) and under high strain rate, uniaxial compression conditions. This paper presents and discusses the development and applicability of a simple load-application apparatus, devised to reduce shear and barrelling effects on s...

  20. Dicty_cDB: Contig-U00081-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Castor bean cDNA library from leaves, 1... 54 0.006 2 ( EE260272 ) RFABO81TH Castor bean cDNA library from flowers...y from leaves, 1... 54 0.006 2 ( EE258316 ) RFAB030TH Castor bean cDNA library from flowers,8... 54 0.006 2 ...( EE255054 ) RFAA310TH Castor bean cDNA library from flowers,8... 54 0.007 2 ( EG658271 ) RCLER38TP Castor b... D21162 ) Ricinus communis cat2 gene for catalase CAT2, compl... 54 0.015 1 ( EE259933 ) RFAB661TH Castor bean cDNA library from flow...ers,8... 54 0.015 1 ( EE254561 ) RBAA346TO RBAA-Castor bean cDNA library from leav.

  1. Synthesis of branched naphthoquinones from castor oil

    Directory of Open Access Journals (Sweden)

    Adriano Olímpio da Silva

    2012-06-01

    Full Text Available The naphthoquinones are cyclic aromatic α,β-dienonas with a basic framework derived from naphthalene. They are also found in many higher plants, algae, fungi and as the product of the  metabolism  of some  bacteria  having large biologica activity described in the literature such as antibacterial, anti-inflammatory, antitumor, anticancer and trypanocidal [1-3]. Castor oil is an abundant raw material in Brazil of great versatility and, it is present in biodiesel production, surfactants, cosmetics and others. Considering the importance of naphthoquinones and, the availability of the ricinoleic acid from castor oil, the aim of this study was the preparation of new branched naphthoquinones in order to test their trypanocidal activity. Castor oil was submitted to saponification with sodium hydroxide, ethanol and water under reflux for 6 h. We then carried out an acid hydrolysis with hydrochloric acid and the formed ricinoleic acid was extracted with ethyl acetate. Following, through Kochi-Anderson addition reaction it was performed the alkylation of a naphthoquinone 1 and 2, using ammonium persulfate, silver nitrate, acetonitrile and water, under heating at 70-80 ° C during 3 h, to give the branched naphthoquinones 4 and 5 (scheme 1. The naphthoquinone 3 will be similarly submitted to this procedure. The naphthoquinones 4 and 5 were purified by column chromatography on sílica gel using hexane as the eluent. The compounds were characterized by mass spectrometry and 1H and 13CNMR spectroscopy.

  2. LHCb: CASTORFS - A Filesystem to Access CASTOR

    CERN Multimedia

    Mazurov, A

    2009-01-01

    CASTOR provides a powerful and rich interface for managing files and pools of files backed by tape-storage. The API is modelled very closely on that of a POSIX filesystem, where part of the actual I/O part is handled by the rfio library. While the API is very close to POSIX it is still separated, which unfortunately makes it impossible to use standard tools and scripts straight away. This is particularly inconvenient when applications are written in languages other than C/C++ such as is frequently the case in web-apps. Here up to now the only the recourse was to use command-line utilities and parse their output, which is clearly a kludge. We have implemented a complete POSIX filesystem to access CASTOR using FUSE (Filesystem in Userspace) and have successfully tested and used this on SLC4 and SLC5 (both in 32 and 64 bit). We call it CastorFS. In this paper we will present its architecture and implementation, with emphasis on performance and caching aspects.

  3. Agronomically valuable mutant lines of castor

    International Nuclear Information System (INIS)

    Dry seeds of four castor varieties (VNIIMK 165-improved, VNIIMK 18, Chervonnaya and Antika) were treated with six chemical mutagens, N-nitroso-N-methyl urea (NMU), N-nitroso-N-ethyl urea (NEU), dimethyl sulphate (DMS), diethyl sulphate (DES), ethylenimine (EI) and 1,4-bis-diazoacetyl-butane (DAB) in various doses during 18 hours. About 40,000 plants were studied in M2 and 80 types of mutations were found, including a number of valuable mutants: short-stemmed, semi-dwarf, dwarf, early maturing, with female and interspersed types of racemes, highly productive etc. Based on trials in M3-M4, on small plots with two or three replications, the superior mutant lines were identified. The best mutants are presented in the table. Early maturation is very important for growing castor in the USSR, as it is the predecessor of winter wheat in crop rotation. The mutants M2-323 and Ml-83 are of great value as they show early maturation and high yield. Their productivity is mainly conditioned by a high percentage of interspersed plants. The reduction of plant height is of great importance for the successful combine harvesting of castor. Mutant lines M2-119 and Ml-284 characterised by low plant height and high yield are very interesting in this respect. The obtained initial material will be used in further breeding work

  4. Simulación de los cambios de carbono orgánico del suelo en sistema de cultivo con higuerilla por el modelo RothC Simulation of soil organic carbon changes in crop systems with castor bean using the RothC model

    OpenAIRE

    Lucila González Molina; Esaú del C. Moreno Pérez; Laksmi Reddiar Krishnamurty; Aurelio Baéz Pérez; Acosta Mireles Miguel

    2012-01-01

    El objetivo del presente trabajo fue la simulación de los cambios del carbono orgánico del suelo (COS), por el modelo RothC, en razón del cambio de uso de suelo del sistema tradicional - asociación maíz-calabaza (TMC) - a sistemas con higuerilla (Ricinus communis): multiestratos (MUL), callejones (CALL) y monocultivo de higuerilla (HIG). Las simulaciones del COS se hicieron para las profundidades de suelo 0-20 y 0-40 cm, para el periodo de 1980-2040, considerándose como línea base al sistema ...

  5. Babesia Species Occurring in Austrian Ixodes ricinus Ticks▿

    OpenAIRE

    Blaschitz, Marion; Narodoslavsky-Gföller, Melanie; Kanzler, Michaela; Stanek, Gerold; Walochnik, Julia

    2008-01-01

    Babesiosis is a tick-transmitted disease of veterinary and medical importance. The first Austrian case of human babesiosis was recently recorded. In the current study, ticks at all life cycle stages (instars), including 853 Ixodes ricinus and 11 Haemaphysalis concinna ticks, from sampling sites throughout Austria were examined for the presence of Babesia spp. by using 18S rRNA gene PCR and sequencing, and the overall mean infection rate was 51.04%. The infection rates for sampling sites were ...

  6. Longitudinal surveillance of the tick Ixodes ricinus for borreliae

    Czech Academy of Sciences Publication Activity Database

    Hubálek, Zdeněk; Halouzka, Jiří; Juřicová, Zina

    2003-01-01

    Roč. 17, č. 1 (2003), s. 46-51. ISSN 0269-283X R&D Projects: GA ČR GA206/00/1204; GA AV ČR IBS6093007 Institutional research plan: CEZ:AV0Z6093917 Keywords : Borrelia burgdorferi * Ixodes ricinus * Lyme disease Subject RIV: FN - Epidemiology, Contagious Disease s ; Clinical Immunology Impact factor: 1.040, year: 2003

  7. Borreliae in Ixodes ricinus ticks feeding on humans

    Czech Academy of Sciences Publication Activity Database

    Hubálek, Zdeněk; Halouzka, Jiří; Juřicová, Zina

    2004-01-01

    Roč. 18, č. 3 (2004), s. 228-231. ISSN 0269-283X R&D Projects: GA ČR GA206/03/0726; GA AV ČR IBS6093007 Institutional research plan: CEZ:AV0Z6093917 Keywords : Borrelia burgdorferi * Ixodes ricinus * Lyme disease Subject RIV: FN - Epidemiology, Contagious Disease s ; Clinical Immunology Impact factor: 1.405, year: 2004

  8. Ixodes ricinus defensins attack distantly-related pathogens

    Czech Academy of Sciences Publication Activity Database

    Tonk, M.; Cabezas-Cruz, A.; Valdés, James J.; Rego, Ryan O. M.; Grubhoffer, Libor; Estrada--Pena, A.; Vilcinskas, A.; Kotsyfakis, Michalis; Rahnamaeian, M.

    2015-01-01

    Roč. 53, č. 2 (2015), s. 358-365. ISSN 0145-305X R&D Projects: GA MŠk(CZ) EE2.3.30.0032; GA ČR GAP502/12/2409 EU Projects: European Commission(XE) 278976 Institutional support: RVO:60077344 Keywords : Antimicrobial peptide * Defensin * Ixodes ricinus * Listeria monocytogenes * Staphylococcus aureus * Staphylococcus epidermidis * Escherichia coli * Pseudomonas aeruginosa * Fusarium spp Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.815, year: 2014

  9. CASTOR detector. Model, objectives and simulated performance

    International Nuclear Information System (INIS)

    It is presented a phenomenological model describing the formation and evolution of a Centauro fireball in the baryon-rich region in nucleus-nucleus interactions in the upper atmosphere and at the LHC. The small particle multiplicity and imbalance of electromagnetic and hadronic content characterizing a Centauro event and also the strongly penetrating particles (assumed to be strangelets) frequently accompanying them can be naturally explained. It is described the CASTOR calorimeter, a sub detector of the ALICE experiment dedicated to the search for Centauro in the very forward, baryon-rich region of central Pb+Pb collisions at the LHC. The basic characteristics and simulated performance of the calorimeter are presented

  10. Optimization and Characterization of Castor Seed Oil

    OpenAIRE

    Bagali S. SHRIDHAR; K. V. BEENA; M. V. ANITA; K. B. PARAMJEET

    2010-01-01

    The response surface methodology (RSM) was employed to optimize the dilution level and agitation time for castor oil extraction. The % recovery of oil was investigated with respect to two variable including dilution level (X1) and agitation time (X2). As a result, a polynomial regression model equation was fitted as follows: Y1 = 47.50 + 7.41 x1 + 2.08 x2 + 0.63 x1 x2 -16.62 x12 - 2.87 x2. The optimal dilution level and agitation time were found to be 7.3 and 2.38 hr respectively. The maximum...

  11. Production of Detergent from Castor Oil

    OpenAIRE

    Abubakar Garba ISAH

    2006-01-01

    This research work was carried out with the objective of extraction of oil from castor seeds and its utilization to produce a synthetic detergent. Solvent extraction method was employed in extracting the oil and the total percent oil yield was found to be 23.8%. The experimentally determined saponification value of the oil was 183.7275mgKOH/g of oil. The detergent efficiency, determined as a measure of the foamability of the detergent was found to be 2.6cm. The pH tests revealed mildly basic ...

  12. Castor transport and storage casks for VVER and RBMK fuel assemblies

    Energy Technology Data Exchange (ETDEWEB)

    Gartz, R.; Gobler, A.; John, R.; Diersch, R. [GNB Gesellschaft fur Nuklear-Behalter mbH, Essen (Germany); Nemec, P. [Skoda Nuclear Machinery Plzen (Czech Republic)

    1998-12-31

    CASTOR casks have been successfully developed, manufactured and delivered for Russian type reactor fuel assemblies. These casks fulfill both the requirements for type B packages according to IAEA regulations and the requirements covering different accident situations to be assumed at the storage site. In the following, the CASTOR casks CASTOR 440/84, CASTOR RBMK and CASTOR VVER 1000 are described, the nuclear content is characterized and an overview about the status of licensing, manufacturing and delivery is given. (authors) 3 refs.

  13. Protein (Viridiplantae): 255582327 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available :3875 3988:3875 lipid binding protein, putative Ricinus communis MKMESTKILALLFICMFFTSSAATAVNPDCGACGHHKPPKHGGHKGGGGGLLPPIVKPPINLPPVI...PPVVKPPINLPPVIPPVVKPPINLPPVIPPVVKPPINLPPVIPPVVKPPINLPPVIPPVIKPPINLPPVTVPPVI

  14. Protein (Viridiplantae): 255577163 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available :6554 3988:6554 hypothetical protein RCOM_0753050 Ricinus communis MQLGNAFIAILLILILFCISIDFSVASAGLKQNFTIVISQSPWLKNVTENLPHP...VSPFNCGSCGNKCPWGVLCVYGMCGYAEPWPPWPHPHPHPHPHPHPHPHPHPHPHPHPHPHPHPPPKPPKPWPHRPPQSPPKPIKPWPHHPPKADHEPSQSAMGPSY ...

  15. Role of tachykinins in castor oil diarrhoea in rats

    OpenAIRE

    Croci, Tiziano; Landi, Marco; Emonds-Alt, Xavier; Le Fur, Gérard; Maffrand, Jean-Pierre; Manara, Luciano

    1997-01-01

    We set out to ascertain the role of tachykinins, neurokinin A and substance P, in castor oil-induced diarrhoea in rats as disclosed by the inhibitory effect of the non-peptide NK1- and NK2-receptor antagonists, SR 140333 and SR 48968, respectively.SR 48968 (0.02 to 20 μg kg−1, s.c. or p.o.), and the opioid receptor agonist loperamide (1–10 mg kg−1, p.o.), dose-dependently prevented castor oil effects: % inhibition vs castor oil, diarrhoea 0 to 100, increase in faecal mass 7 to 90 and water co...

  16. High Prevalence of Granulocytic Ehrlichiae and Borrelia burgdorferi Sensu Lato in Ixodes ricinus Ticks from Bulgaria

    OpenAIRE

    Christova, Iva; Schouls, Leo; van de Pol, Ingrid; Park, Jinho; Panayotov, Stefan; Lefterova, Viktoria; Kantardjiev, Todor; Dumler, J. Stephen

    2001-01-01

    Bulgarian Ixodes ricinus ticks were examined for Ehrlichia and Borrelia coinfection: 34 and 32% of adult ticks and at least 2 and 10% of nymphs were positive for these infections, respectively. Coinfections and dual or triple Borrelia infections were frequent, although Ehrlichia phagocytophila heterogeneity was minimal. Multiple tick-borne bacteria coexist in I. ricinus ticks in southeastern Europe.

  17. Blood feeding on large grazers affects the transmission of Borrelia burgdorferi sensu lato by Ixodes ricinus

    NARCIS (Netherlands)

    Pacilly, F.C.A.; Benning, M.E.; Jacobs, F.; Leidekker, J.; Sprong, H.; Wieren, van S.E.; Takken, W.

    2014-01-01

    The presence of Ixodes ricinus and their associated Borrelia infections on large grazers was investigated. Carcases of freshly shot red deer, mouflon and wild boar were examined for the presence of any stage of I. ricinus. Questing ticks were collected from locations where red deer and wild boar are

  18. Ethnomedicinal and Phytochemical Prospectives of Pyrus Communis Linn.

    Directory of Open Access Journals (Sweden)

    Vikrant Arya

    2012-07-01

    Full Text Available Ethnomedicinal implies the usage of medicinal plants used by a group of people on account of their traditional knowledge and phytochemical means the individual chemical that plant contains. This review involves the ethnomedicinal and phytochemical prospectives of Pyrus communis Linn. In the “The Indian Materia Medica”, the common pear or gabbu gosha is considered as ‘Amritphala’ because of its immense potenial in human health care system.Various phenolic glucoside compounds have been isolated and identified from Pyrus communis Linn. e.g. arbutin, quercitin, kaempferol, fredielin, sterols, isoquercitrin, ursolic acid,sorbitol,astragalin, phloridzin and various tannins responsible for different activities viz. in urinary therapeutics,as skin whitenining agent, anti-inflammatory, antioxidant, antibacterial, analgesic, astringent, spasmolytic. Also used in diabetes because of low sucrose content.

  19. A systems level analysis reveals transcriptomic and proteomic complexity in Ixodes ricinus midgut and salivary glands during early attachment and feeding.

    Science.gov (United States)

    Schwarz, Alexandra; Tenzer, Stefan; Hackenberg, Michael; Erhart, Jan; Gerhold-Ay, Aslihan; Mazur, Johanna; Kuharev, Jörg; Ribeiro, José M C; Kotsyfakis, Michail

    2014-10-01

    Although pathogens are usually transmitted within the first 24-48 h of attachment of the castor bean tick Ixodes ricinus, little is known about the tick's biological responses at these earliest phases of attachment. Tick midgut and salivary glands are the main tissues involved in tick blood feeding and pathogen transmission but the limited genomic information for I. ricinus delays the application of high-throughput methods to study their physiology. We took advantage of the latest advances in the fields of Next Generation RNA-Sequencing and Label-free Quantitative Proteomics to deliver an unprecedented, quantitative description of the gene expression dynamics in the midgut and salivary glands of this disease vector upon attachment to the vertebrate host. A total of 373 of 1510 identified proteins had higher expression in the salivary glands, but only 110 had correspondingly high transcript levels in the same tissue. Furthermore, there was midgut-specific expression of 217 genes at both the transcriptome and proteome level. Tissue-dependent transcript, but not protein, accumulation was revealed for 552 of 885 genes. Moreover, we discovered the enrichment of tick salivary glands in proteins involved in gene transcription and translation, which agrees with the secretory role of this tissue; this finding also agrees with our finding of lower tick t-RNA representation in the salivary glands when compared with the midgut. The midgut, in turn, is enriched in metabolic components and proteins that support its mechanical integrity in order to accommodate and metabolize the ingested blood. Beyond understanding the physiological events that support hematophagy by arthropod ectoparasites, we discovered more than 1500 proteins located at the interface between ticks, the vertebrate host, and the tick-borne pathogens. Thus, our work significantly improves the knowledge of the genetics underlying the transmission lifecycle of this tick species, which is an essential step for

  20. Antihepatoma Activity of Artocarpus communis Is Higher in Fractions with High Artocarpin Content

    Directory of Open Access Journals (Sweden)

    Cheng-Wei Tzeng

    2014-01-01

    Full Text Available Extracts from natural plants have been used in traditional medicine for many centuries worldwide. Artocarpus communis is one such plant that has been used to treat liver cirrhosis, hypertension, and diabetes. To our knowledge, this study is the first to investigate the antihepatoma activity of A. communis toward HepG2 and PLC/PRF/5 cells and the first to explore the relationship between antihepatoma activity and the active compound artocarpin content in different fractions of A. communis. A. communis methanol extract and fractions induced dose-dependent reduction of tumor cell viability. DNA laddering analysis revealed that A. communis extract and fractions did not induce apoptosis in HepG2 and PLC/PRF/5 cells. Instead, acridine orange staining revealed that A. communis triggered autophagic cell death in a dose-dependent manner. The antihepatoma activity of A. communis is attributable to artocarpin. The fractions with the highest artocarpin content were also the fractions with the highest antihepatoma activity in the following order: dichloromethane fraction > methanol extract > ethyl acetate fraction > n-butanol fraction > n-hexane fraction. Taken together, A. communis showed antihepatoma activity through autophagic cell death. The effect was related to artocarpin content. Artocarpin could be considered an indicator of the anticancer potential of A. communis extract.

  1. Extraction and Characterization of Drilling Fluid from Castor Oil

    OpenAIRE

    Manase Auta

    2013-01-01

    Drilling fluid is an essential component in drilling operations. It is used to prevent blowouts by creating adequate hydrostatic pressure, lubricating the walls of a well and the drill string, flushing to the surface of cuttings, and keeping the drill bit clean and cool. Extraction, characterization and formation of drilling fluid from castor seed oil were investigated. The castor seeds used were obtained from a local market and the extraction of the oil was done mechanically. The extracted o...

  2. Laser-fabricated castor oil-capped silver nanoparticles

    OpenAIRE

    Zamiri, Reza; Zakaria, Azmi; Abbastabar, Hossein; Darroudi, Majid; Husin, Mohd Shahril; Mahdi, Mohd. Adzir

    2011-01-01

    Silver nanoparticles were fabricated by ablation of a pure silver plate immersed in castor oil. A Nd:YAG-pulsed Q-switch laser with 1064-nm wavelength and 10-Hz frequency was used to ablate the plate for 10 minutes. The sample was characterized by ultraviolet-visible, atomic absorption, Fourier transform-infrared spectroscopies, and transmission electron microscopy. The results of the fabricated sample showed that the nanoparticles in castor oil were about 5-nm in diameter, well dispersed, an...

  3. Ixodes ricinus defensins attack distantly-related pathogens.

    Science.gov (United States)

    Tonk, Miray; Cabezas-Cruz, Alejandro; Valdés, James J; Rego, Ryan O M; Grubhoffer, Libor; Estrada-Peña, Agustín; Vilcinskas, Andreas; Kotsyfakis, Michalis; Rahnamaeian, Mohammad

    2015-12-01

    Antimicrobial peptides are ubiquitous components of eukaryotic innate immunity. Defensins are a well-known family of antimicrobial peptides, widely distributed in ticks, insects, plants and mammals, showing activity against bacteria, viruses, fungi, yeast and protozoan parasites. Ixodes ricinus is the most common tick species in Europe and is a vector of pathogens affecting human and animal health. Recently, six defensins (including two isoforms) were identified in I. ricinus. We investigated the evolution of the antimicrobial activity of I. ricinus defensins. Among the five unique defensins, only DefMT3, DefMT5 and DefMT6 showed in vitro antimicrobial activity. Each defensin was active against rather distantly-related bacteria (P < 0.05), significantly among Gram-negative species (P < 0.0001). These three defensins represent different clades within the family of tick defensins, suggesting that the last common ancestor of tick defensins may have had comparable antimicrobial activity. Differences in electrostatic potential, and amino acid substitutions in the β-hairpin and the loop bridging the α-helix and β-sheet may affect the antimicrobial activity in DefMT2 and DefMT7, which needs to be addressed. Additionally, the antimicrobial activity of the γ-core motif of selected defensins (DefMT3, DefMT6, and DefMT7) was also tested. Interestingly, compared to full length peptides, the γ-core motifs of these defensins were effective against less species of bacteria. However, the antifungal activity of the γ-core was higher than full peptides. Our results broaden the scope of research in the field of antimicrobial peptides highlighting the overlooked ability of arthropod defensins to act against distantly-related microorganisms. PMID:26255244

  4. Determination of Novel Borrelia Genospecies in Swedish Ixodes ricinus Ticks

    OpenAIRE

    2002-01-01

    A total of 301 adult questing Ixodes ricinus ticks were collected at 15 different locations along the south and east coasts of Sweden to determine the Borrelia genospecies diversity. Thirty-two ticks (11%) were found to be positive by nested PCR with Borrelia burgdorferi sensu lato-specific primers. Species determination was based on partial sequencing of the 16S rRNA gene and the flagellin gene. Five different Borrelia species were found. The nucleotide sequence of the Borrelia DNA found in ...

  5. Diversity of Babesia Infecting European Sheep Ticks (Ixodes ricinus)

    OpenAIRE

    Duh, Darja; Petrovec, Miroslav; Avsic-Zupanc, Tatjana

    2001-01-01

    Questing Ixodes ricinus (Acari: Ixodidae) adult and nymphal ticks collected in various parts of Slovenia were tested for the presence of babesial parasites with a PCR assay based on the nuclear small subunit rRNA gene (nss-ribosomal DNA [rDNA]). Thirteen of 135 ticks were found to contain babesial DNA. Sequence determination and analysis of amplified portions of nss-rDNA revealed their identity with Babesia microti and a high degree of homology with Babesia odocoilei and Babesia divergens. Th...

  6. Morphological features of Ixodes persulcatus and I. ricinus hybrids: nymphs and adults.

    Science.gov (United States)

    Bugmyrin, Sergey V; Belova, Oxana A; Bespyatova, Liubov A; Ieshko, Eugeniy P; Karganova, Galina G

    2016-07-01

    Our aim was to reveal morphological features of first-generation Ixodes persulcatus and I. ricinus hybrids (nymphs and adults) obtained under laboratory conditions for further study of natural populations of these species in sympatry foci. In 65 nymphs of three groups I. ricinus (23 specimens), I. persulcatus (21 specimens), and hybrids (21 specimens), 16 parameters were evaluated (length/width of the scutum and capitulum, length of the hypostome, palp, tarsus I, coxa I, sternal setae, and various scutal and alloscutal setae) and discrimination analysis was performed allowing differentiation of hybrid nymphs from original species. General effectiveness of classification of I. ricinus, I. persulcatus, and hybrids was >95 %. Discriminant functions are presented allowing classification of I. persulcatus, I. ricinus, and hybrid nymphs. For description of morphology, 27 adult hybrids (13 males and 14 females) were examined under a stereo microscope at 14-28× (without preparation of permanent mounts). The following morphological distinctions of hybrids from original species were described: posterior marginal groove is not clear (as in I. ricinus) and absence of syncoxa on coxa I (as in I persulcatus). In hybrid males, simultaneous absence of syncoxa on coxa I (as in I. persulcatus) and a long internal spur on coxa I (as in I. ricinus) can be used as a diagnostic feature. Based on the detected characteristics, 10 of 157 ticks collected in Karelia in I. ricinus and I. persulcatus sympatry area were classified as hybrids. PMID:26984610

  7. Infection of Ixodes ricinus (Acari: Ixodidae) by Borrelia burgdorferi sensu lato in North Africa

    Science.gov (United States)

    Zhioua, E.; Bouattour, A.; Hu, C.M.; Gharbi, M.; Aeschliman, A.; Ginsberg, H.S.; Gern, L.

    1999-01-01

    Free-living adult Ixodes ricinus L. were collected in Amdoun, situated in the Kroumiry mountains in northwestern Tunisia (North Africa). Using direct fluorescence antibody assay, the infection rate of field-collected I. ricinus by Borrelia burgdorferi sensu lato was 30.5% (n = 72). No difference in infection rate was observed between male and female ticks. Spirochetes that had been isolated from I. ricinus from Ain Drahim (Kroumiry Mountains) in 1988 were identified as Borrelia lusitaniae (formerly genospecies PotiB2). This is the first identification of a genospecies of Borrelia burgdorferi sensu lato from the continent of Africa.

  8. 蓖麻质膜水通道蛋白PIP1.3在仓鼠卵巢细胞中的转运功能%Castor Plasma Membrane Aquaporin (PIP1.3) in Vitro Transprot in Chinese Hamster Ovary

    Institute of Scientific and Technical Information of China (English)

    董乐; 戴聪杰; 王芳; 王云; 朱国立; 谢小宾; 许珊珊; 刘灿阳; 林婷

    2014-01-01

    为研究蓖麻质膜水通道蛋白PIP1.3的转运功能,采用RT-PCR技术扩增基因PIP1.3的全长编码区cDNA序列(861 bp),将该序列亚克隆至真核表达载体pcDNA3.1/Myc-His A,酶切、测序分析表明,重组质粒pcDNA3.1PIP1.3-Myc-His阅读框架正确。将pcDNA3.1PIP1.3-Myc-His和连接氯离子敏感性绿色荧光蛋白突变体(EYFP-H148Q-V163S)的pcDNA3.1Hygro-EY-FP-H148Q-V163S重组质粒稳定共转染至中国仓鼠卵巢(Chinese hamster ovary, CHO)细胞中, RT-PCR和Western blot分析表明, PIP1.3的mRNA和蛋白质在选定CHO细胞克隆中高表达。分别通过荧光法和同位素标记的14C-甘油摄入实验测定该CHO细胞对水分和甘油的通透性,结果表明,该CHO细胞表达的PIP1.3对水分子的转运能力很低,但能选择性转运甘油。%The encoding sequence of plasma membrane aquaporin gene (PIP1.3) in castor (Ricinus communis L.) was ampliifed with RT-PCR and inserted into pcDNA3.1/Myc-His A vector, double enzyme digestion analy-sis and DNA sequencing confirmed that recombination plasmid was successfully constructed. pcD-NA3.1PIP1.3-Myc-His and pcDNA3.1Hygro-EYFP-H148Q-V163S plasmids linking Cl--sensitive EYFP mutant (EYFP-H148Q-V163S) were transfected in CHO cells. The stable transfection of CHO cells was analysis with RT-PCR and Western blot. The results showed that PIP1.3 mRNA and protein were overexpressed in cell line screened. Permeabilities of PIP1.3 expressing CHO cells for water and glycerol were measured respectively by lfuorescence method and carbon labeling experiment. The results showed that permeability of PIP1.3 express-ing CHO cells for water was low, but high for glycerol.

  9. Castor oil induces laxation and uterus contraction via ricinoleic acid activating prostaglandin EP3 receptors

    OpenAIRE

    Tunaru, Sorin; Althoff, Till F.; Nüsing, Rolf M.; Diener, Martin; Offermanns, Stefan

    2012-01-01

    Castor oil is one of the oldest drugs. When given orally, it has a laxative effect and induces labor in pregnant females. The effects of castor oil are mediated by ricinoleic acid, a hydroxylated fatty acid released from castor oil by intestinal lipases. Despite the wide-spread use of castor oil in conventional and folk medicine, the molecular mechanism by which ricinoleic acid acts remains unknown. Here we show that the EP3 prostanoid receptor is specifically activated by ricinoleic acid and...

  10. Large animal hepatotoxic and nephrotoxic plants.

    Science.gov (United States)

    Oladosu, L A; Case, A A

    1979-10-01

    The hepatotoxic and nephrotoxic plants of large domestic animals have been reviewed. The most important ones are those widely distributed as weeds over pastures, negelcted forests and grasslands, those used as ornamentals, the nitrate concentrating forage crops, and the cyanophoric plants. Crotolaria spp, the ragwort (Senecia jacobaea), the lantana spp. and heliotopum are common hepatoxic plants. Amaranthus retroflexus, Datura stramonium, Solanum rostratum, and the castor oil plant (Ricinus communis) are nephrotoxic plants. PMID:516370

  11. Growth, development, reproductive competence and adult behaviour of Spodoptera litura (Lepidoptera: Noctuidae) reared on different diets

    International Nuclear Information System (INIS)

    Spodoptera litura was reared on natural food (castor leaves, Ricinus communis) and on a several semi-synthetic diets using quasi mass rearing techniques. The effect of the different diets and rearing regimes on S. litura growth, development, reproductive competence and adult behaviour was measured. Spodoptera litura reared from a modified chickpea-based diet provided the greatest growth index and index of adequacy. These studies were conducted as a prerequisite for the evaluation of F1 sterility technique. (author)

  12. Genetic and chemical evaluation of the U.S. castor germplasm collection for biodiesel production

    Science.gov (United States)

    Castor has multiple industrial applications including potential as a feedstock for biodiesel production. The oil content and fatty acid composition in castor seed are important factors to determine the price for production and affect the key fuel properties of biodiesel. The entire U.S. castor germp...

  13. Analysis of acylglycerols containing mono- and dihydroxy fatty acids in castor oil by HPLC and MS

    Science.gov (United States)

    Ricinoleate, a monohydroxy fatty acid, has many industrial uses such as the manufacture of aviation lubricant, plastic, paint and cosmetics. Ricinoleate occurs as acylglycerols (AG) in castor oil, and about 70% of castor oil is triricinolein. Castor oil is the only commercial source of ricinoleate. ...

  14. Regiospecific Quantification of Triacylglycerols Containing Ricinoleate and Dihydroxy Fatty Acids in Castor Oil by Mass Spectrometry

    Science.gov (United States)

    Ricinoleate, a monohydroxy fatty acid, has many industrial uses such as the manufacture of aviation lubricant, plastic, paint and cosmetics. Ricinoleate occurs as acylglycerols (AG) in castor oil, and about 70% of castor oil is triricinolein. Castor oil is the only commercial source of ricinoleate. ...

  15. Castor oil biodiesel as an alternative fuel for diesel engines

    International Nuclear Information System (INIS)

    In this paper, a study related to the production and use of castor oil biodiesel is presented. The maximum methyl esters yield of the castor oil transesterification reaction is obtained under the following conditions: ambient temperature, a molar ratio of methanol to vegetable oil equal to 9 and a catalyst percentage equal to 0.8%. The castor oil biodiesel can be blended with petroleum diesel as far as 15% in such way that the resulting blend complies with national and international technical standards for diesel fuels. Its high viscosity becomes the main difficulty for using castor oil biodiesel in engines. However this biofuel exhibits excellent cold flow properties (low values of cloud and pour points). The motor tests using castor oil biodiesel petroleum diesel blends, for the biodiesel proportion tested; show that a biodiesel percentage increase leads to an increase in the specific fuel consumption, a decrease in the fuel air ratio, a slight decrease in smoke opacity, while the fuel conversion efficiency and the CO and CO2 emissions practically remain constants

  16. The 'Castor' incidence: Statements and opinions

    International Nuclear Information System (INIS)

    Incidents like the recently unveiled, highly publicised 'Castor' incident involving real or alleged radiation hazards to the population as a consequence of nuclear activities in the broader sense, are an acute challenge to the editors of this journal, who of course are expected to promptly react and contribute information and opinions to the public debate. The editorial staff, however, is subject to restraints in such a situation as regards retrieval and scanning of reliable information. Such restraints are due not only to manpower resources, but also involve time delay aspects - who can know in advance, at the time of writing an article for a quarterly scientific journal, how the topical debate will have proceeded at the time the issue in the making will appear? The editors tried to obtain from colleagues in France and Germany their views and opinions as well as competent information, but for reasons to be respected, we have not been successful. So we decided to compile the background information and history of events published in this issue, based on information available from reliable sources, hoping that the survey will contribute to presenting a true picture of the situation. (orig./CB)

  17. Seasonal distribution of Borreliae in Ixodes ricinus ticks in the Belgrade region

    Directory of Open Access Journals (Sweden)

    Milutinović Marija

    2006-01-01

    Full Text Available Green areas at four localities in the Belgrade region (Ada Ciganlija, Košutnjak, Miljakovac forest, and Mt. Avala were investigated in 2004. The aim of the research was to clarify the faunistic composition, relative abundance, and population dynamics of ticks, as well as the seasonal distribution of Borrelia burgdorferi sensu lato (sl in Ixodes ricinus. Two species of ticks were detected: Ixodes ricinus and Dermacentor reticulates. Relative abundance analysis revealed that the species Ixodes ricinus was predominant (97.41 %. Out of 942 Ixodes ricinus ticks, 188 (19.96 % were infected with Borrelia burgdorferi sl. The infection rate of adults by localities ranged from 19.16% to 30.99% (Mt. Avala and Ada Ciganlija, respectively.

  18. Prevalence and diversity of Babesia spp. in questing Ixodes ricinus ticks from Norway

    OpenAIRE

    Øines Øivind; Radzijevskaja Jana; Paulauskas Algimantas; Rosef Olav

    2012-01-01

    Abstract Background Ixodes ricinus ticks transmit Babesia species to vertebrate hosts. Using molecular tools we were able to detect the presence of this piroplasmid in its vector. The aims of this study were to investigate the prevalence and identity of Babesia species in questing ticks collected in various areas of Norway. Methods DNA from questing l. ricinus ticks were examined with a realtime PCR for the presence of Babesia. Positive samples of tick DNA were identified to species using PCR...

  19. Vaccination against Bm86 Homologues in Rabbits Does Not Impair Ixodes ricinus Feeding or Oviposition.

    Science.gov (United States)

    Coumou, Jeroen; Wagemakers, Alex; Trentelman, Jos J; Nijhof, Ard M; Hovius, Joppe W

    2014-01-01

    Human tick-borne diseases that are transmitted by Ixodes ricinus, such as Lyme borreliosis and tick borne encephalitis, are on the rise in Europe. Diminishing I. ricinus populations in nature can reduce tick exposure to humans, and one way to do so is by developing an anti-vector vaccine against tick antigens. Currently, there is only one anti-vector vaccine available against ticks, which is a veterinary vaccine based on the tick antigen Bm86 in the gut of Rhipicephalus microplus. Bm86 vaccine formulations cause a reduction in the number of Rhipicephalus microplus ticks that successfully feed, i.e. lower engorgement weights and a decrease in the number of oviposited eggs. Furthermore, Bm86 vaccines reduce transmission of bovine Babesia spp. Previously two conserved Bm86 homologues in I. ricinus ticks, designated as Ir86-1 and Ir86-2, were described. Here we investigated the effect of a vaccine against recombinant Ir86-1, Ir86-2 or a combination of both on Ixodes ricinus feeding. Recombinant Ixodes ricinus Bm86 homologues were expressed in a Drosophila expression system and rabbits were immunized with rIr86-1, rIr86-2, a combination of both or ovalbumin as a control. Each animal was infested with 50 female adults and 50 male adults Ixodes ricinus and tick mortality, engorgement weights and egg mass were analyzed. Although serum IgG titers against rIr86 proteins were elicited, no effect was found on tick feeding between the rIr86 vaccinated animals and ovalbumin vaccinated animals. We conclude that vaccination against Bm86 homologues in Ixodes ricinus is not an effective approach to control Ixodes ricinus populations, despite the clear effects of Bm86 vaccination against Rhipicephalus microplus. PMID:25919587

  20. Vaccination against Bm86 Homologues in Rabbits Does Not Impair Ixodes ricinus Feeding or Oviposition.

    Directory of Open Access Journals (Sweden)

    Jeroen Coumou

    Full Text Available Human tick-borne diseases that are transmitted by Ixodes ricinus, such as Lyme borreliosis and tick borne encephalitis, are on the rise in Europe. Diminishing I. ricinus populations in nature can reduce tick exposure to humans, and one way to do so is by developing an anti-vector vaccine against tick antigens. Currently, there is only one anti-vector vaccine available against ticks, which is a veterinary vaccine based on the tick antigen Bm86 in the gut of Rhipicephalus microplus. Bm86 vaccine formulations cause a reduction in the number of Rhipicephalus microplus ticks that successfully feed, i.e. lower engorgement weights and a decrease in the number of oviposited eggs. Furthermore, Bm86 vaccines reduce transmission of bovine Babesia spp. Previously two conserved Bm86 homologues in I. ricinus ticks, designated as Ir86-1 and Ir86-2, were described. Here we investigated the effect of a vaccine against recombinant Ir86-1, Ir86-2 or a combination of both on Ixodes ricinus feeding. Recombinant Ixodes ricinus Bm86 homologues were expressed in a Drosophila expression system and rabbits were immunized with rIr86-1, rIr86-2, a combination of both or ovalbumin as a control. Each animal was infested with 50 female adults and 50 male adults Ixodes ricinus and tick mortality, engorgement weights and egg mass were analyzed. Although serum IgG titers against rIr86 proteins were elicited, no effect was found on tick feeding between the rIr86 vaccinated animals and ovalbumin vaccinated animals. We conclude that vaccination against Bm86 homologues in Ixodes ricinus is not an effective approach to control Ixodes ricinus populations, despite the clear effects of Bm86 vaccination against Rhipicephalus microplus.

  1. Experimental in vitro transmission of Babesia sp. (EU1) by Ixodes ricinus

    OpenAIRE

    Bonnet, Sarah; Brisseau, Nadine; Hermouet, Axelle; Jouglin, Maggy; Chauvin, Alain

    2009-01-01

    Babesia sp. (EU1), first characterized in 2003, has been implicated in human cases of babesiosis in Italy, Austria and Germany. It has been identified in roe deer and in its suspected tick vector, Ixodes ricinus, in several European countries. The aim of the present study was to validate the competence of I. ricinus as a vector of Babesia sp. (EU1) via experimental infections. For this purpose, a parasite strain isolated from roe deer was cloned in sheep erythrocytes. After experimental infec...

  2. Heterogeneous catalysis afford biodiesel of babassu, castor oil and blends

    International Nuclear Information System (INIS)

    This work describes the preparation of babassu, castor oil biodiesel and mixtures in various proportions of these oils, using alkaline compounds of strontium (SrCO3 + SrO + Sr (OH)2) as heterogeneous catalysts. The mixture of oils of these oleaginous sources was used in the production of biodiesel with quality parameters that meet current legislation. The catalyst was characterized by X-ray diffractometry (XDR), physisorption of gas (BET method), scanning electron microscopy (SEM), energy dispersive spectroscopy (EDX) and Fourier transform infrared spectroscopy (FTIR). The viscometric technique was used to monitor the optimization.The transesterification reactions performed using strontium compounds reached conversion rates of 97.2% babassu biodiesel (BB), 96.4% castor oil biodiesel (COB) and 95.3% Babassu/Castor Oil Biodiesel 4:1 (BBCO41). (author)

  3. Experimental Study of Castor Oil Based Lubricant for Automotive Applications

    Directory of Open Access Journals (Sweden)

    Amit Suhane,

    2014-01-01

    Full Text Available Vegetable oils due to their better natural propertiescan be used as an alternative to reduce the dependency on the conventional lubricants. With the depletion of conventional resources at faster pace, need of hour is to approach the safer alternatives for ensuring the availability of such resources for longer periods with lesser harm to the mankind and sorroundings.This workevaluates the prospects of Castor oil based lubricant for automotive applications in contrast to the available commercial servo gear oil. Experimentation has been performed on four ball tester set up.Material used is carbon steel balls. Refined castor and mahua oils are blended in fixed ratios and subjected to friction and wear tests. Experimentation reveals that castor mahua oil blend possess immense potential in contrast to servo gear oil due to good wear reducing traits apart from environmental benefits.

  4. Heterogeneous catalysis afford biodiesel of babassu, castor oil and blends

    Energy Technology Data Exchange (ETDEWEB)

    Carvalho, Lee M.G. de; Abreu, Wiury C. de; Silva, Maria das Gracas de O. e; Matos, Jose Milton E. de; Moura, Carla V.R. de; Moura, Edmilson M. de, E-mail: mmoura@ufpi.edu.br [Universidade Federal do Piaui (UFPI), Teresina, PI (Brazil). Departamento de Quimica; Lima, Jose Renato de O.; Oliveira, Jose Eduardo de [Universidade Estadual Paulista Julio de Mesquita Filho (UNESP/IQ/CEMPEQC), Araraquara, SP (Brazil). Instituto de Quimica. Centro de Monitoramento e Pesquisa da Qualidade de Combustiveis, Biocombustiveis, Petroleo e Derivados

    2013-04-15

    This work describes the preparation of babassu, castor oil biodiesel and mixtures in various proportions of these oils, using alkaline compounds of strontium (SrCO{sub 3} + SrO + Sr (OH){sub 2}) as heterogeneous catalysts. The mixture of oils of these oleaginous sources was used in the production of biodiesel with quality parameters that meet current legislation. The catalyst was characterized by X-ray diffractometry (XDR), physisorption of gas (BET method), scanning electron microscopy (SEM), energy dispersive spectroscopy (EDX) and Fourier transform infrared spectroscopy (FTIR). The viscometric technique was used to monitor the optimization.The transesterification reactions performed using strontium compounds reached conversion rates of 97.2% babassu biodiesel (BB), 96.4% castor oil biodiesel (COB) and 95.3% Babassu/Castor Oil Biodiesel 4:1 (BBCO41). (author)

  5. Mixed Field Modification of Thermally Cured Castor Oil Based Polyurethanes

    International Nuclear Information System (INIS)

    Thermally cured polyurethanes were prepared from castor oil and hexamethylene diisocyanatee (HMDI). Due to the long aliphatic chain of the castor oil component of polyurethane, thermal curing of castor oil based polyurethane (COPU) is limited by increasing polymer viscosity. To enhance further crosslinking, COPUs were subjected to a range of accumulated doses (0.0-3.0 MGy) produced by the mixed ionizing field of the SLOWPOKE-2 research reactor. The physico-mechanical properties of COPU, unirradiated and irradiated, were characterized by mechanical tests. Increased bond formation resulting from radiation-induced crosslinking was confirmed by favorable increases in mechanical properties and by solid-state 13C-NMR and FTIR spectra

  6. Mixed field radiation modification of polyurethanes based on castor oil

    International Nuclear Information System (INIS)

    Polyurethane is among the polymers and polymer-based composite materials being investigated at the Royal Military College of Canada for the fabrication of leak-tight containers for the long-term disposal of radioactive waste. Due to the long aliphatic chain of the castor oil component of polyurethane, thermal curing of castor oil based polyurethane (COPU) is limited by increasing polymer viscosity. To enhance further crosslinking, COPUs were subjected to a range of doses (0.0 - 3.0 MGy) produced by the mixed ionizing radiation field of a SLOWPOKE-2 research nuclear reactor. The tensile mechanical properties of castor oil based polyurethanes (COPU), unirradiated and irradiated, were characterized by mechanical tensile tests. Increases in mechanical strength due to radiation-induced crosslinking and limitations of thermal curing were confirmed by tensile tests and changing 13C-NMR and FTIR spectra. (author)

  7. CASTOR: Cathode/Anode Satellite Thruster for Orbital Repositioning

    Science.gov (United States)

    Mruphy, Gloria A.

    2010-01-01

    The purpose of CASTOR (Cathode/Anode Satellite Thruster for Orbital Repositioning) satellite is to demonstrate in Low Earth Orbit (LEO) a nanosatellite that uses a Divergent Cusped Field Thruster (DCFT) to perform orbital maneuvers representative of an orbital transfer vehicle. Powered by semi-deployable solar arrays generating 165W of power, CASTOR will achieve nearly 1 km/s of velocity increment over one year. As a technology demonstration mission, success of CASTOR in LEO will pave the way for a low cost, high delta-V orbital transfer capability for small military and civilian payloads in support of Air Force and NASA missions. The educational objective is to engage graduate and undergraduate students in critical roles in the design, development, test, carrier integration and on-orbit operations of CASTOR as a supplement to their curricular activities. This program is laying the foundation for a long-term satellite construction program at MIT. The satellite is being designed as a part of AFRL's University Nanosatellite Program, which provides the funding and a framework in which student satellite teams compete for a launch to orbit. To this end, the satellite must fit within an envelope of 50cmx50cmx60cm, have a mass of less than 50kg, and meet stringent structural and other requirements. In this framework, the CASTOR team successfully completed PDR in August 2009 and CDR in April 2010 and will compete at FCR (Flight Competition Review) in January 2011. The complexity of the project requires implementation of many systems engineering techniques which allow for development of CASTOR from conception through FCR and encompass the full design, fabrication, and testing process.

  8. The use of castor oil on cervical ripening in pregnancies

    OpenAIRE

    Saadat, Z; M. Abedzadeh; F. Saberi

    2008-01-01

    AbstractBackground and Purpose: The role of castor oil on cervical ripening is poorly understood and data in examining its efficacy within clinical trial are limited. This study was performed to evaluate the effect of utilizing castor oil on cervical ripening in pregnancies after 40 weeks.Materials and Methods: A randomized clinical trial study was performed on 200 pregnant women after 40 weeks in Shabikhany Hospital, in the City of Kashan, in 2004 to 2006. Women were divided to two groups (1...

  9. Large nonlocal nonlinear optical response of castor oil

    Science.gov (United States)

    Souza, Rogério F.; Alencar, Márcio A. R. C.; Meneghetti, Mario R.; Hickmann, Jandir M.

    2009-09-01

    The nonlocal nonlinearity of castor oil was investigated using the Z-scan technique in the CW regime at 514 nm and in femtosecond regime at 810 nm. Large negative nonlinear refractive indexes of thermal origin, thermo-optical coefficients and degree of nonlocality were obtained for both laser excitation wavelengths. The results indicate that the electronic part of the nonlinear refractive index and nonlinear absorption were negligible. Our results suggest that castor oil is promising candidate as a nonlinear medium for several nonlocal optical applications, such as in spatial soliton propagation, as well as a dispersant agent in the measurement of absorptive properties of nanoparticles.

  10. Synthesis of carbon nanotubes using natural carbon precursor: Castor oil

    Science.gov (United States)

    Raziah, A. Z.; Junizah, A. R.; Saifuddin, N.

    2012-09-01

    Castor oil has long been an article of commerce due to its versatility as it is widely used as a starting material for many industrial chemical products because of its unique structure. In this study, carbon nanotubes has been synthesized by thermal decomposition of castor oil in nitrogen atmosphere at 300-400δC using custom-made microwave processing unit. The precursor material was catalyzed by iron clusters originating from the addition of ferrocene. The morphology and characterization of the CNTs were studied and discussed by transmission electron microscopy (TEM).

  11. In vitro antibacterial activity of leaf extracts of Zehneria scabra and Ricinus communis against Escherichia coli and methicillin resistance Staphylococcus aureus

    Directory of Open Access Journals (Sweden)

    Bereket Abew

    2014-10-01

    Conclusions: The potency of plant extracts against test organisms were depend on different organic solvents used. Clinical isolate of bacterial pathogens showed less zones of diameter compared to the standard strains. Gram-positive had wide inhibition zones than Gram-negative bacteria. Further studies should be carried out to isolate the pure compounds and standardization of the methods of plant extracts for an in vitro testing.

  12. Qualitative histologic evaluation of the tissue reaction to the polyurethane resin (ricinus communis - based biopolymer implantation assessed by light and scanning electron microscopy

    Directory of Open Access Journals (Sweden)

    Gustavo Campos Belmonte

    2013-01-01

    Full Text Available The tissue reaction of bone tissue accessed by light microscopy and scanning electron microscopy (SEM images after polyurethane resin implantation is presented in this study. Twenty four male rabbits were used, divided into two groups of 12 animals each (experimental group and control group in which full-thickness cranial defect was surgically created. At 30 and 90 days post operation 6 animals of each group were euthanized and bone samples were removed for analysis. The microscopic results indicated no inflammatory foreign body reaction, a perfect union between the polymer and surgical bone bed surface, lack of bone resorption and presence of a thin layer of osteogenic material covering the polymer surface in contact with the surgical bone bed. The SEM images demonstrate the porosity of the resin, with diameters from 120 to 500 µm. This important feature of this polymer is associated with its osteoconductivity, allowing the bone growth inside it, improving the integration between the material and bone tissue. These results confirm that polyurethane resin derived from Ricinuscommunis is an excellent bone substitute for use in repair surgery for great bone losses.

  13. COMPETITIVIDAD DE LA HIGUERILLA (Ricinus communis) PARA BIOCOMBUSTIBLE EN RELACIÓN A LOS CULTIVOS ACTUALES EN EL EDO. DE OAXACA, MÉXICO

    OpenAIRE

    Rodriguez Hernandez, Rafael; Zamarripa Colmenero, Alfredo

    2013-01-01

    Ante el problema actual del calentamiento global por las altas emisiones de CO a la atmósfera, 2 así como la escasez y encarecimiento de los energéticos fósiles como el petróleo, carbón y gas, ha cobrado importancia la búsqueda y aprovechamiento de fuentes alternas de combustibles. Las principales especies vegetales que pueden proveer de biocarburantes son la caña de azúcar, sorgo, maíz, entre otros para etanol; soya girasol y cacahuate, entre otros para biodiesel; sin embargo la utilizació...

  14. Ultrastructural changes of the nodose ganglion cells following an intraneural injection of Ricinus communis agglutinin-60 into the vagus nerve in hamsters.

    OpenAIRE

    Ling, E A; Wen, C Y; Shieh, J Y; Yick, T Y; Wong, W C

    1991-01-01

    Virtually all the ganglion cells in the nodose ganglion in hamsters underwent rapid degeneration following an intraneural injection of RCA-60 into the vagus nerve in the cervical region. The earliest signs of neuronal degeneration were evident in animals which survived 5 days after the ricin application. A remarkable feature was the appearance of a variable number of granular dense bodies measuring 1-4 microns in diameter in the cytoplasm. They were composed of closely stacked cisternae which...

  15. Potencial do uso da torta de mamona (Ricinus communis L.) como matriz para produção de compósitos e nanocompósitos

    OpenAIRE

    Kumode, Marina Mieko Nishidate

    2013-01-01

    Resumo: Durante as últimas décadas, tem aumentado os problemas ambientais causados pelo grande consumo de petróleo, um produto não-renovável, base de materiais plásticos e isso têm despertado interesse na comunidade científica na busca de novos materiais. Esses materiais devem ter as características de renovabilidade, fácil biodegradabilidade, com propriedades específicas comparáveis e, claro, de baixo custo e que causem menor impacto ambiental. O desenvolvimento destes novos materiais é poss...

  16. Influence of metal resistant-plant growth-promoting bacteria on the growth of Ricinus communis in soil contaminated with heavy metals

    OpenAIRE

    Rajkumar, Mani; Freitas, Helena

    2008-01-01

    The metal resistant-plant growth-promoting bacterial (PGPB) strains PsM6 and PjM15 isolated from a serpentine soil were characterized as Pseudomonas sp. and Pseudomonas jessenii, respectively, on the basis of their morphological, physiological, biochemical characteristics and 16S rDNA sequences. Assessment of plant growth-promoting parameters revealed the intrinsic ability of the strains for the utilization of 1-aminocyclopropane-1-carboxylic acid as the sole N source, solubilization of insol...

  17. HYDRA and COBRA-SFS temperature calculations for CASTOR-IC, REA-2023, CASTOR-V/21, and TN-24P

    International Nuclear Information System (INIS)

    The COBRA-SFS and HYDRA thermal analysis computer codes were used to perform ''pretest'' or ''prelook'' calculations on the CASTOR-1C, REA-2023, CASTOR-V/21 and TN-24P spent fuel storage casks. HYDRA results were compared to 24 different test runs, while COBRA-SFS results were compared to 25 runs. These comparisons included tests with three different fill media, vacuum (low-pressure nitrogen), helium, and nitrogen, in both horizontal and vertical casks. The mean difference in peak clad temperature for of all comparisons was +100C for HYDRA and +30C for COBRA-SFS. Their respective standard deviations were +-100C and +-110C. These comparisons have demonstrated that even with the limited amount of experience in modeling the thermal characteristics of casks, both codes do an excellent job of predicting peak clad temperatures for a wide variety of cask configurations

  18. GNS Castor V/21 Headspace Gas Sampling 2014

    Energy Technology Data Exchange (ETDEWEB)

    Winston, Philip Lon [Idaho National Laboratory

    2016-01-01

    Prior to performing an internal visual inspection, samples of the headspace gas of the GNS Castor V/21 cask were taken on June 12, 2014. These samples were taken in support of the CREIPI/Japanese nuclear industry effort to validate fuel integrity without visual inspection by measuring the 85Kr content of the cask headspace

  19. Detoxification of castor meal through reactive seed crushing

    Science.gov (United States)

    Non-edible oil crops, such as castor or jatropha, contain several toxic components. Post-harvest treatments should be used to reduce the risks associated with the possible dispersion of toxic compounds in the environment. A new processing technology named Reactive Seed Crushing was developed, which ...

  20. GNS Castor V/21 Headspace Gas Sampling 2014

    Energy Technology Data Exchange (ETDEWEB)

    Winston, Philip Lon [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2016-01-01

    Prior to performing an internal visual inspection, samples of the headspace gas of the GNS Castor V/21 cask were taken on June 12, 2014. These samples were taken in support of the CREIPI/Japanese nuclear industry effort to validate fuel integrity without visual inspection by measuring the 85Kr content of the cask headspace

  1. Measurements with an emissive probe in the CASTOR tokamak

    Czech Academy of Sciences Publication Activity Database

    Schrittwieser, R.; Adámek, Jiří; Balan, P.; Hron, Martin; Ionita, C.; Jakubka, Karel; Kryška, Ladislav; Martines, E.; Stöckel, Jan; Tichý, M.; Van Oost, G.

    2002-01-01

    Roč. 44, č. 5 (2002), s. 567-578. ISSN 0741-3335 R&D Projects: GA ČR GA202/00/1217 Institutional research plan: CEZ:AV0Z2043910 Keywords : CASTOR tokamak, plasma Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.121, year: 2002

  2. 21 CFR 178.3280 - Castor oil, hydrogenated.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Castor oil, hydrogenated. 178.3280 Section 178.3280 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION (CONTINUED) INDIRECT FOOD ADDITIVES: ADJUVANTS, PRODUCTION AIDS, AND SANITIZERS Certain Adjuvants and Production Aids...

  3. Develop a New Lesquerella fendleri Crop for Castor Oil Production

    Science.gov (United States)

    Seed oil of Lesquerella fendleri contains a valuable hydroxy fatty acid (HFA), lesquerolic acid (20:1OH). The conventional source of HFA is ricinoleic acid (18:1OH) from castor seeds. Ricinoleic acid and its derivatives are used as raw materials for numerous industrial products, such as lubricants, ...

  4. Ixodes ricinus and Its Endosymbiont Midichloria mitochondrii: A Comparative Proteomic Analysis of Salivary Glands and Ovaries.

    Science.gov (United States)

    Di Venere, Monica; Fumagalli, Marco; Cafiso, Alessandra; De Marco, Leone; Epis, Sara; Plantard, Olivier; Bardoni, Anna; Salvini, Roberta; Viglio, Simona; Bazzocchi, Chiara; Iadarola, Paolo; Sassera, Davide

    2015-01-01

    Hard ticks are hematophagous arthropods that act as vectors of numerous pathogenic microorganisms of high relevance in human and veterinary medicine. Ixodes ricinus is one of the most important tick species in Europe, due to its role of vector of pathogenic bacteria such as Borrelia burgdorferi and Anaplasma phagocytophilum, of viruses such as tick borne encephalitis virus and of protozoans as Babesia spp. In addition to these pathogens, I. ricinus harbors a symbiotic bacterium, Midichloria mitochondrii. This is the dominant bacteria associated to I. ricinus, but its biological role is not yet understood. Most M. mitochondrii symbionts are localized in the tick ovaries, and they are transmitted to the progeny. M. mitochondrii bacteria have however also been detected in the salivary glands and saliva of I. ricinus, as well as in the blood of vertebrate hosts of the tick, prompting the hypothesis of an infectious role of this bacterium. To investigate, from a proteomic point of view, the tick I. ricinus and its symbiont, we generated the protein profile of the ovary tissue (OT) and of salivary glands (SG) of adult females of this tick species. To compare the OT and SG profiles, 2-DE profiling followed by LC-MS/MS protein identification were performed. We detected 21 spots showing significant differences in the relative abundance between the OT and SG, ten of which showed 4- to 18-fold increase/decrease in density. This work allowed to establish a method to characterize the proteome of I. ricinus, and to detect multiple proteins that exhibit a differential expression profile in OT and SG. Additionally, we were able to use an immunoproteomic approach to detect a protein from the symbiont. Finally, the method here developed will pave the way for future studies on the proteomics of I. ricinus, with the goals of better understanding the biology of this vector and of its symbiont M. mitochondrii. PMID:26398775

  5. Eficiência dos óleos de nim e mamona contra cupins xilófagos em ensaio de alimentação forçada

    OpenAIRE

    Juarez Benigno Paes; Ademilson Daniel de Souza; Carlos Roberto de Lima; Pedro Nicó de Medeiros Neto

    2010-01-01

    The research aimed to evaluate the efficiency of neem (Azadirachta indica) and castor oil plant (Ricinus communis) oils to improvement of Ceiba pentandra wood resistance to Nasutitermes corniger xilophogous termite und forced food assay. The neem and castor oil plant oils were extracted with absolute ethyl alcohol and employees in the preparation of oil solutions. Wood samples with dimensions of 2.0 x 2.54 x 0.64 cm (radial x longitudinal x tangential) were treated to reach a nominal retentio...

  6. Antileishmanial and Cytotoxic Effects of Essential Oil and Methanolic Extract of Myrtus communis L.

    OpenAIRE

    MAHMOUDVAND, Hossein; Ezzatkhah, Fatemeh; Sharififar, Fariba; SHARIFI, Iraj; Dezaki, Ebrahim Saedi

    2015-01-01

    Plants used for traditional medicine contain a wide range of substances that can be used to treat various diseases such as infectious diseases. The present study was designed to evaluate the antileishmanial effects of the essential oil and methanolic extract of Myrtus communis against Leishmania tropica on an in vitro model. Antileishmanial effects of essential oil and methanolic extract of M. communis on promastigote forms and their cytotoxic activities against J774 cells were evaluated usin...

  7. Topology of the polypeptide chain in the complex of agglutinin from castor bean seeds with β-D-galactose in the crystalline state

    International Nuclear Information System (INIS)

    The three-dimensional structure of the complex of agglutinin from Ricinus communis with β-D-galactose was established and refined at 2.5 A resolution by X-ray structure analysis. Biocrystals were obtained using dialysis through a semipermeable membrane. X-ray intensity data (Rmerge = 4.6%) were collected from one crystal at 100 K using synchrotron radiation at the DESY outstation [European Molecular Biology Laboratory (EMBL), Hamburg, Germany]. The initial phases were calculated by the molecular replacement method. The atoms of both protein and sugar molecules were localized. Unlike ricin, the ricinlike heterodimer RcA contains only one galactose-binding center in the region of the Asn46-Gly25-Trp37-Lys40 site in the first domain of the B subunit, whereas the second galactose-binding site of the B subunit is lost. One functionally important water molecule, which is bound to the residues Tyr123-Glu176-Arg179-Glu207, was revealed in the region of the active center in the A subunit

  8. Leaf mineral concentrations of Erica arborea, Juniperus communis and Myrtus communis growing in the proximity of a natural CO2 spring

    OpenAIRE

    Peñuelas, Josep

    2001-01-01

    Leaf mineral concentrations of co-occurring Erica arborea, Juniperus communis and Myrtus communis were measured at bimonthly intervals throughout a year in a natural CO2 spring and in a nearby control site with similar soil chemistry in a Mediterranean environment. There were different responses to the elevated [CO2] (c. 700 μL L−1) of the spring site plants depending on the element and the species. In the CO2 spring site K, Ca, Mg, Mn, Al, Fe, and Ti leaf concentrations and the ratio C/N sho...

  9. Edge plasma studies on the CASTOR tokamak

    International Nuclear Information System (INIS)

    This paper will present an overview of recent edge plasma experiments on the CASTOR tokamak (R = 0.4 m, a = 0.085 m, BT = 1.3 T, Ip ∼ 10 kA, ne ∼ 2 x 1019 m-3). A poloidal array of 96 Langmuir probes, 16 magnetic coils, and 16 Hall sensors surrounding the full poloidal circumference monitors poloidal profiles of electric field, density, and magnetic field with high temporal resolution. A radial array of Langmuir probes measures the radial profiles of floating potential, poloidal electric field, and ion saturation current. A Gundestrup probe measures the parallel and perpendicular flows, a segmented tunnel probe measures the electron and ion temperatures. All data are acquired with 1 MHz sampling rate. First, an overview of the edge turbulence measurements will be given. Correlation analysis of the poloidal structure of the edge turbulence indicates that the behaviour of the scrape-off layer (SOL) turbulence is strongly linked to the magnetic field configuration in this region. The fluctuation measurements can be interpreted in a straightforward way assuming a single long structure, aligned with the magnetic field lines, which intersects a given poloidal cross section several times, giving rise to an apparent m = q mode. Next, behaviour of the plasma is presented for biasing experiments performed using a graphite electrode, immersed into the SOL and edge plasma, respectively. In the SOL, the measurements have shown presence of a region with long connection length (several toroidal turns), in which a biased flux tube is created. Thus, not only the radial field, but also a rather strong poloidal electric field is formed at the magnetic surface associated with the biased electrode. This poloidal field changes its sign periodically along the poloidal circumference and, as a consequence of the Epol x BT drift, the density is also poloidally modulated. The overall result is a creation of a pattern of particle flux with a strong poloidal modulation, which can be seen

  10. Preparation and research on properties of castor oil as a diesel fuel additive

    OpenAIRE

    Nurbakhit Imankulov

    2012-01-01

    The research shows an opportunity of preparing biodiesel fuel on the basis of local diesel fuel and the bioadditive - castor oil. Limiting optimum concentration of introduction of the bioadditive equal was established as 5% mass ratio. The castor oil released from seeds of Palma Christi grown on experimental field. All physical and chemical characteristics of the oil including IR-spectra were determined. Operating conditions of castor oil introduction (temperature, solubility, concentra-tion,...

  11. Molecular evidence for bacterial pathogens in Ixodes ricinus ticks infesting Shetland ponies.

    Science.gov (United States)

    Skotarczak, Bogumiła; Wodecka, Beata; Rymaszewska, Anna; Adamska, Małgorzata

    2016-06-01

    Ixodes ricinus has the potential to transmit zoonotic pathogens to humans and domestic animals. The feeding I. ricinus (n = 1737) collected from 49 Shetland ponies and questing ones from vegetation (n = 371) were tested for the presence and differentiation of the bacterial species. DNA of I. ricinus ticks was examined with PCR and sequencing analysis to identify species of Borrelia burgdorferi sensu lato (Bbsl), Anaplasma phagocytophilum and Rickettsia spp. Altogether, 24.3 % I. ricinus of the infested horses and 12.4 % ticks from vegetation carried at least one pathogen species. Horse-feeding ticks (19.2 %) were significantly more frequently infected with Borrelia spp. than questing ticks (4.8 %). Among Bbsl species, in I. ricinus infesting ponies, B. garinii, B. afzelii, B. burgdorferi sensu stricto, B. valaisiana and B. lusitanie and one species, B. miyamotoi related to relapsing fever group, were detected. The 73 flaB gene sequences of Borrelia obtained from feeding I. ricinus have been deposited in GenBank. Among Rickettsia species, two were identified: R. helvetica which was dominant and R. monacensis. Infections with more than one pathogenic species, involving mostly Bbsl and R. helvetica were detected in 6.3 % of infected ticks collected from horses. Shetland ponies may play an important role in the epidemiological cycle of Bbsl and probably could contribute to the natural cycle of A. phagocytophilum and R. helvetica as host for infected ticks. The awareness about these infectious agents in ticks from ponies might be an important criterion for the risk assessment of human diseases, especially as these animals are maintained for recreational purposes. PMID:26920921

  12. The toxic effect of permethrin and cypermethrin on engorged Ixodes ricinus females

    Directory of Open Access Journals (Sweden)

    Alicja Buczek

    2014-06-01

    Full Text Available introduction. [i]Ixodes ricinus[/i] tick is of great medical and veterinary importance and has a wide range of geographical distribution. The study presents the effect of permethrin (Per and cypermethrin (CM on engorged[i] I. ricinus[/i] females. materials and method. The effect of perythroids studied on engorged I. ricinus females was assessed on the basis of the pre-oviposition and oviposition period. Remote effects of Per and CM application were assessed by investigation of the length and course of embryonic development and larval hatching from eggs laid by pyrethroid-treated females. Per (Copex WP was used at doses of 0.78125–25.0 µg/1 specimen, and CM (Kordon 10WP was applied at 0.3125–10.0 µg/1 specimen. Immediately after the feeding period, I. ricinus females were sprayed with 20 µl of a pyrethroid solution and kept at 28 °C and 75%RH. results. The experiments demonstrated that CM exerted a stronger toxic effect on [i]I. ricinus[/i] females than Per. The lowest doses of CM doubled the length of the pre-oviposition period while its highest doses prolonged the period nearly three times compared with the control. The pyrethroids applied reduced the number and weight of eggs and changed the parameters of the oviposition process. Application of the tested pyrethroid doses led to disturbances in the embryonic development of[i] I. ricinus[/i], i.e. the development was prolonged, few normal larvae hatched, numerous eggs and embryos at various developmental stages died, and larval hatch was inhibited. conclusions. Knowledge about the sensitivity of engorged females to different doses of the tested pyrethroids and the remote effects of their action can be used in practice for tick control among livestock animals, and the reduction of tick population abundance in the environment.

  13. Mitogenomes reveal diversity of the European Lyme borreliosis vector Ixodes ricinus in Italy.

    Science.gov (United States)

    Carpi, Giovanna; Kitchen, Andrew; Kim, Hie Lim; Ratan, Aakrosh; Drautz-Moses, Daniela I; McGraw, John J; Kazimirova, Maria; Rizzoli, Annapaola; Schuster, Stephan C

    2016-08-01

    In Europe, the Ixodes ricinus tick is the most important vector of the etiological agents of Lyme borreliosis and several other emerging tick-borne diseases. Because tick-borne pathogens are dependent on their vectors for transmission, understanding the vector population structure is crucial to inform public health research of pathogen dynamics and spread. However, the population structure and dynamics of this important vector species are not well understood as most genetic studies utilize short mitochondrial and nuclear sequences with little diversity. Herein we obtained and analyzed complete mitochondrial genome (hereafter "mitogenome") sequences to better understand the genetic diversity and the population structure of I. ricinus from two long-standing tick-borne disease foci in northern Italy. Complete mitogenomes of 23 I. ricinus ticks were sequenced at high coverage. Out of 23 mitogenome sequences we identified 17 unique haplotypes composed of 244 segregating sites. Phylogenetic reconstruction using 18 complete mitogenome sequences revealed the coexistence of four highly divergent I. ricinus maternal lineages despite the narrow spatial scale over which these samples were obtained (100km). Notably, the estimated coalescence time of the 18 mitogenome haplotypes is ∼427 thousand years ago (95% HPD 330, 540). This divergence between I. ricinus lineages is consistent with the mitochondrial diversity of other arthropod vector species and indicates that long-term I. ricinus populations may have been less structured and larger than previously thought. Thus, this study suggests that a rapid and accurate retrieval of full mitochondrial genomes from this disease vector enables fine-resolution studies of tick intraspecies genetic relationships, population differentiation, and demographic history. PMID:27165938

  14. Impacto del castor (Castor canadensis, Rodentia) en bosques de lenga (Nothofagus pumilio) de Tierra del Fuego, Chile Impact of american beaver (Castor canadensis, Rodentia) in lenga (Nothofagus pumilio) forests of Tierra del Fuego, Chile

    OpenAIRE

    Aida Baldini U; Juan Oltremari A; Mauricio Ramírez

    2008-01-01

    Castor canadensis es un roedor de Norteamérica introducido a la porción argentina de Tierra del Fuego en el año 1946, invadiendo territorios chilenos del mismo sector. En esta zona los castores construyen diques y se alimentan de material arbóreo extraído principalmente de Nothofagus pumilio. En el estudio se intentó probar que los castores provocan daño en la biomasa y volumen de los bosques de N. pumilio. Los objetivos del estudio fueron identificar los tipos de daños y cuantificar las pérd...

  15. Vaccination against Bm86 Homologues in Rabbits Does Not Impair Ixodes ricinus Feeding or Oviposition

    OpenAIRE

    Jeroen Coumou; Alex Wagemakers; Trentelman, Jos J.; Nijhof, Ard M; Hovius, Joppe W.

    2015-01-01

    Human tick-borne diseases that are transmitted by Ixodes ricinus, such as Lyme borreliosis and tick borne encephalitis, are on the rise in Europe. Diminishing I. ricinus populations in nature can reduce tick exposure to humans, and one way to do so is by developing an anti-vector vaccine against tick antigens. Currently, there is only one anti-vector vaccine available against ticks, which is a veterinary vaccine based on the tick antigen Bm86 in the gut of Rhipicephalus microplus. Bm86 vaccin...

  16. Extraction, Characterization and Modification of Castor Seed Oil

    Directory of Open Access Journals (Sweden)

    A. D. MOHAMMED

    2006-01-01

    Full Text Available This paper carried out experimental study, through extraction and characterization of both crude and refined castor oil. Normal hexane was used as solvent for the extraction process. The oil produced was refined through degumming, neutralization and bleaching process using local adsorbent (activated clay. The characterization analysis revealed that tested parameters, which include specific gravity, refractive index, acid value, saponification value and iodine value for both crude and refined castor oil produced, were within the ASTM standard specifications. In fact the iodine value obtained (84.8 for the refined oil indicates that the oil could certainly be used as lubricant, hydraulic break fluid and protecting coatings. The oil was modified via sulphation method to produce Turkey – red oil that was tested on wooden material, paper and cloth. The test revealed that the Turkey – red oil produced is suitable to be used as a good dying agent and polish.

  17. ToF-SIMS PCA analysis of Myrtus communis L.

    Science.gov (United States)

    Piras, F. M.; Dettori, M. F.; Magnani, A.

    2009-06-01

    Nowadays there is a growing interest of researchers for the application of sophisticated analytical techniques in conjunction with statistical data analysis methods to the characterization of natural products to assure their authenticity and quality, and for the possibility of direct analysis of food to obtain maximum information. In this work, time-of-flight secondary ion mass spectrometry (ToF-SIMS) in conjunction with principal components analysis (PCA) are applied to study the chemical composition and variability of Sardinian myrtle ( Myrtus communis L.) through the analysis of both berries alcoholic extracts and berries epicarp. ToF-SIMS spectra of berries epicarp show that the epicuticular waxes consist mainly of carboxylic acids with chain length ranging from C20 to C30, or identical species formed from fragmentation of long-chain esters. PCA of ToF-SIMS data from myrtle berries epicarp distinguishes two groups characterized by a different surface concentration of triacontanoic acid. Variability in antocyanins, flavonols, α-tocopherol, and myrtucommulone contents is showed by ToF-SIMS PCA analysis of myrtle berries alcoholic extracts.

  18. Numerical fracture analysis for the structural design of CASTOR casks

    International Nuclear Information System (INIS)

    The numerical implementation of the dynamic J-Integral is presented as one method to compute the dynamic stress intensity factor (DSIF). The applicability of the computational method is demonstrated by a finite element simulation of a free drop test of a ductile cast iron CASTOR cask with a pre-crack. The results of the simulation are contrasted with the data from the real experiment. (author)

  19. Rheological behavior of castor oil mixed with different pyromellitic esters

    OpenAIRE

    Boran Sorina; Tamas Andra

    2014-01-01

    The paper presents the rheological behavior study of castor oil mixed with different pyromellitic esters. The pyromellitic tetraesters used were obtained through the esterification of pyromellitic anhydride with a special alcohol of a complex alkyl-aryl structure (2-phenoxy-ethanol) in conjunction with a linear aliphatic alcohol with variable length (n-butanol, n-decanol). The influence of pyromellitic esters’ structure and concentration was determined, as ...

  20. Results on CASTOR Performance during LHC Run 2

    CERN Document Server

    CMS Collaboration

    2016-01-01

    The intercalibration of the gains of the fine mesh PMT's using beam-halo muons is discussed, this in combination with results of a study on the noise and baseline. Two methods on obtaining gain correction factors for reweighing the gains between different high voltage settings are compared. Results on the efficiency of a CASTOR jet trigger are compared for LHC Run 2 collision data and Monte Carlo event generator predictions.

  1. Characterization of Novel Castor Oil-Based Polyurethane Polymer Electrolytes

    OpenAIRE

    Salmiah Ibrahim; Azizan Ahmad; Nor Sabirin Mohamed

    2015-01-01

    Castor oil-based polyurethane as a renewable resource polymer has been synthesized for application as a host in polymer electrolyte for electrochemical devices. The polyurethane was added with LiI and NaI in different wt% to form a film of polymer electrolytes. The films were characterized by using attenuated total reflectance-Fourier transform infrared spectroscopy, dynamic mechanical analysis, electrochemical impedance spectroscopy, linear sweep voltammetry and transference number measurem...

  2. Experimental Study of Castor Oil Based Lubricant for Automotive Applications

    OpenAIRE

    Amit Suhane; R.M.Sarviya

    2014-01-01

    Vegetable oils due to their better natural propertiescan be used as an alternative to reduce the dependency on the conventional lubricants. With the depletion of conventional resources at faster pace, need of hour is to approach the safer alternatives for ensuring the availability of such resources for longer periods with lesser harm to the mankind and sorroundings.This workevaluates the prospects of Castor oil based lubricant for automotive applications in contrast to the ava...

  3. 75 FR 40751 - Castor Oil, Ethoxylated, Oleate; Tolerance Exemption

    Science.gov (United States)

    2010-07-14

    ...This regulation establishes an exemption from the requirement of a tolerance for residues of castor oil, ethoxylated, oleate (CAS Reg. No. 220037-02-5) with a minimum number average molecular weight (in amu) of 1,600 when used as an inert ingredient in a pesticide chemical formulation under 40 CFR 180.960. SciReg. Inc. on behalf of Rhodia, Inc, submitted a petition to EPA under the Federal......

  4. Extraction, Characterization and Modification of Castor Seed Oil

    OpenAIRE

    A. D. MOHAMMED; A. JIMOH; U. G. AKPAN

    2006-01-01

    This paper carried out experimental study, through extraction and characterization of both crude and refined castor oil. Normal hexane was used as solvent for the extraction process. The oil produced was refined through degumming, neutralization and bleaching process using local adsorbent (activated clay). The characterization analysis revealed that tested parameters, which include specific gravity, refractive index, acid value, saponification value and iodine value for both crude and refined...

  5. Low-modulus PMMA bone cement modified with castor oil

    OpenAIRE

    López, Alejandro; Hoess, Andreas; Thersleff, Thomas; Ott, Marjam; Engqvist, Håkan; Persson, Cecilia

    2011-01-01

    Some of the current clinical and biomechanical data suggest that vertebroplasty causes the development of adjacent vertebral fractures shortly after augmentation. These findings have been attributed to high injection volumes as well as high Young’s moduli of PMMA bone cements compared to that of the osteoporotic cancellous bone. The aim of this study was to evaluate the use of castor oil as a plasticizer for PMMA bone cements. The Young’s modulus, yield strength, maximum polymerization temper...

  6. Encounters between Otters (Lontra canadensis) and American Beavers (Castor canadensis)

    OpenAIRE

    Bob Arnebeck

    2004-01-01

    Six encounters between otters (Lontra canadensis) and American beavers (Castor canadensis) were observed between 1997 and 2003 at Wellesley Island State Park, New York. Contrary to the observer’s expectations, in each case the beaver moved aggressively toward the otter or otters, and the otters retreated. The author offers detailed accounts of each of the interactions, which may offer some insight into the relationship between otters and beavers. In half of the encounters, the beaver appeared...

  7. Extraction and Characterization of Drilling Fluid from Castor Oil

    Directory of Open Access Journals (Sweden)

    Manase Auta

    2013-06-01

    Full Text Available Drilling fluid is an essential component in drilling operations. It is used to prevent blowouts by creating adequate hydrostatic pressure, lubricating the walls of a well and the drill string, flushing to the surface of cuttings, and keeping the drill bit clean and cool. Extraction, characterization and formation of drilling fluid from castor seed oil were investigated. The castor seeds used were obtained from a local market and the extraction of the oil was done mechanically. The extracted oil characteristics such as specific gravity, pH, acid value, iodine value, saponification value, refractive index and viscosity were within the standard range before before formulating it to drilling fluid by the addition of additives. The result of the formulation obtained showed that the formulated drilling fluid had an electrical stability of 222 V, High Pressure/High Temperature of 8.8, mass funnel viscosity at 30 and 50 oC were 26.5 and 25 s, respectively; chemical alkalinity was 0.3 and excess lime of 0.39 Ib/bbI. The findings in this research have shown that formulated drilling fluid from castor seed oil is safe as drilling fluid and has characteristics close to that of the standard drilling mud equivalent circulating density 99. The formulated drilling fluid can adequately serve as an alternative to the commercial products.

  8. Measurement of quadratic electrogyration effect in castor oil

    Science.gov (United States)

    Izdebski, Marek; Ledzion, Rafał; Górski, Piotr

    2015-07-01

    This work presents a detailed analysis of electrogyration measurement in liquids with the usage of an optical polarimetric technique. Theoretical analysis of the optical response to an applied electric field is illustrated by experimental data for castor oil which exhibits natural optical activity, quadratic electro-optic effect and quadratic electrogyration effect. Moreover, the experimental data show that interaction of the oil with a pair of flat electrodes induces a significant dichroism and natural linear birefringence. The combination of these effects occurring at the same time complicates the procedure of measurements. It has been found that a single measurement is insufficient to separate the contribution of the electrogyration effect, but it is possible on the basis of several measurements performed with various orientations of the polarizer and the analyser. The obtained average values of the quadratic electrogyration coefficient β13 in castor oil at room temperature are from - 0.92 ×10-22 to - 1.44 ×10-22m2V-2 depending on the origin of the oil. Although this study is focused on measurements in castor oil, the presented analysis is much more general.

  9. The experiences from interim spent fuel storage operation with CASTOR 440/84 CASKS in NPP Dukovany

    International Nuclear Information System (INIS)

    In this lecture are presented: principles of the CASTOR 440/84 design; design development works; commissioning of interim spent fuel storage facility; international transports of spent fuel utilising CASTOR 440/84 casks

  10. Demodex castoris sp. nov. (Acari: Demodecidae) parasitizing Castor fiber (Rodentia), and other parasitic arthropods associated with Castor spp.

    Science.gov (United States)

    Izdebska, Joanna N; Fryderyk, Sławomira; Rolbiecki, Leszek

    2016-02-11

    A new species of demodecid mite, Demodex castoris sp. nov. (Acari: Prostigmata: Demodecidae), is described based on adult stages from the skin of the nasal region of the Eurasian beaver Castor fiber Linnaeus, 1758, collected in Poland. This is the first detection of a representative demodecid mite in rodents of the suborder Castorimorpha and also represents the first detection of a skin mite in Eurasian beavers. The new species is a small skin mite (average 173 µm in length) characterized by sexual dimorphism related to body proportions. D. castoris sp. nov. was observed in 4 out of 6 beavers examined (66.6%), with a mean intensity of 10.8 and an intensity range of 2-23 ind. host(-1). This paper also contains a checklist of parasitic arthropods known from Castor spp. PMID:26865230

  11. Antileishmanial and cytotoxic effects of essential oil and methanolic extract of Myrtus communis L.

    Science.gov (United States)

    Mahmoudvand, Hossein; Ezzatkhah, Fatemeh; Sharififar, Fariba; Sharifi, Iraj; Dezaki, Ebrahim Saedi

    2015-02-01

    Plants used for traditional medicine contain a wide range of substances that can be used to treat various diseases such as infectious diseases. The present study was designed to evaluate the antileishmanial effects of the essential oil and methanolic extract of Myrtus communis against Leishmania tropica on an in vitro model. Antileishmanial effects of essential oil and methanolic extract of M. communis on promastigote forms and their cytotoxic activities against J774 cells were evaluated using MTT assay for 72 hr. In addition, their leishmanicidal activity against amastigote forms was determined in a macrophage model, for 72 hr. Findings showed that the main components of essential oil were α-pinene (24.7%), 1,8-cineole (19.6%), and linalool (12.6%). Findings demonstrated that M. communis, particularly its essential oil, significantly (PJ774 cells. However, essential oil indicated a more cytotoxic effect as compared with the methanolic extract of M. communis. The findings of the present study demonstrated that M. communis might be a natural source for production of a new leishmanicidal agent. PMID:25748705

  12. The use of castor oil on cervical ripening in pregnancies

    Directory of Open Access Journals (Sweden)

    Z. Saadat

    2008-01-01

    Full Text Available AbstractBackground and Purpose: The role of castor oil on cervical ripening is poorly understood and data in examining its efficacy within clinical trial are limited. This study was performed to evaluate the effect of utilizing castor oil on cervical ripening in pregnancies after 40 weeks.Materials and Methods: A randomized clinical trial study was performed on 200 pregnant women after 40 weeks in Shabikhany Hospital, in the City of Kashan, in 2004 to 2006. Women were divided to two groups (100 women in case group and 100 women in control group. Case group took 60 ml castor oil, while the control group omitted treatment. Comparison was then compared between the two groups for demographic characteristics: increase of Bishop Score, means of Bishop Score at entrance to study and 24 hours after entrance to study, onset of labor within 24 hours, method and time of delivery and newborns Apgar score by X2, followed by Fisher’s exact test, and paired-samples T and T-tests.Results: Results showed that there were no significant differences in mother’s age, education, nationality, gravidity, gestational age, parity between two groups. Paired-sample T test showed significant difference between means of Bishop Score at entrance of study and 24 hours after entrance of study in case and control groups(p=0.00. Furthermore, the mean increase of Bishop score in the case group was 4.5±3.63 versus 0.67±1.25 in the control group during the 24 hour period. During 24 hours after entrance to study, uterine contraction occurred in 70% women in case and 12% women in control groups. Statistical test showed significant difference between the two groups and an increase of Bishop Score at the onset of uterine contractions (P<0.001. There were no significant differences in method of delivery and Apgar score in their newborns between the two groups.Conclusion: The results of this study showed that use of castor oil may lead to cervical ripening in pregnant women after 40

  13. Study of the Castor Oil Plant Pie in the Planting of the Castor Beans with Different Global Density of the Soil

    OpenAIRE

    Fabiana Xavier Costa; Edivan Silva Nunes Júnior; José Sebastião de Melo Filho

    2010-01-01

    It was aimed at with this work to evaluate the chlorophyll tenor in the leaves, of potassium in the pecíolos of the castor beans, the physical analysis of the soil and the tenors of the present macronutrientes in the leaves of the castor beans cultivated with growing doses of castor oil plant pie and degrees different from density of the soil. The experiment had beginning in the period of May 02, 2006 and he/she extended to September 02, 2006, in house-of-vegetation, without atmosphere contro...

  14. Surface Coating Studies of Polyurethane Derived from [(Alkyd)-(Epoxy Resin Treated Castor Oil)] Using Isophorene Diisocynate - II

    OpenAIRE

    Dinesh. P. Patel; Kiran Nimavat; Kartik Vyas

    2012-01-01

    Castor oil (C) was reacted with profitable epoxy resin (E) (diglycidylether of bisphenol-A, DGEBF) at a range of mole ratios. The consequential products (Castor oil- Epoxy resin) were nominated as CEs. Isocyanate terminated castor oil Polyurethane (ICOPU) was prepared by reaction of castor oil and various proportion of Isophoren diisocyanate. A commercial alkyd resin was blended with various proportions of CEs and ICOPU. A unique solvent system, which shows a one – phase clear solution and a ...

  15. HYDRA and COBRA-SFS temperature calculations for CASTOR-IC, REA-2023, CASTOR-V/21, and TN-24P

    Energy Technology Data Exchange (ETDEWEB)

    Wheeler, C.L.; McCann, R.A.; Michener, T.E.; Lombardo, N.J.; Rector, D.R.

    1986-03-01

    The COBRA-SFS and HYDRA thermal analysis computer codes were used to perform ''pretest'' or ''prelook'' calculations on the CASTOR-1C, REA-2023, CASTOR-V/21 and TN-24P spent fuel storage casks. HYDRA results were compared to 24 different test runs, while COBRA-SFS results were compared to 25 runs. These comparisons included tests with three different fill media, vacuum (low-pressure nitrogen), helium, and nitrogen, in both horizontal and vertical casks. The mean difference in peak clad temperature for of all comparisons was +10/sup 0/C for HYDRA and +3/sup 0/C for COBRA-SFS. Their respective standard deviations were +-10/sup 0/C and +-11/sup 0/C. These comparisons have demonstrated that even with the limited amount of experience in modeling the thermal characteristics of casks, both codes do an excellent job of predicting peak clad temperatures for a wide variety of cask configurations.

  16. Anti-tumour necrosis factor-alpha activity in Ixodes ricinus saliva

    Czech Academy of Sciences Publication Activity Database

    Koník, Peter; Slavíková, Veronika; Salát, Jiří; Řezníčková, Jana; Dvorožňáková, E.; Kopecký, Jan

    2006-01-01

    Roč. 28, č. 12 (2006), s. 649-656. ISSN 0141-9838 R&D Projects: GA ČR GA524/05/0811; GA MŠk(CZ) LC06009 Institutional research plan: CEZ:AV0Z60220518 Keywords : Ixodes ricinus * tick saliva * TNF Subject RIV: EC - Immunology Impact factor: 2.009, year: 2006

  17. SPME as tool to identify a trail pheromone in the sheep tick Ixodes ricinus

    Czech Academy of Sciences Publication Activity Database

    Bouman, Edwin Arien Poul; Zahradníčková, Helena; Zemek, Rostislav; Kalinová, Blanka; Dusbábek, František

    Neuchatel: Université de Neuchatel, 2005. s. 54-54. [International Conference on Ticks and Tick-Borne Pathogens /5./. 29.08.2005-02.09.2005, Neuchatel] Institutional research plan: CEZ:AV0Z50070508 Keywords : Ixodes ricinus * solid phase microextraction * contact pheromone Subject RIV: ED - Physiology

  18. Diversity of Ixodes ricinus tick-associated bacterial communities from different forests

    NARCIS (Netherlands)

    Overbeek, van L.S.; Gassner, F.; Lombaers-van der Plas, C.H.; Kastelein, P.; Nunes da Rocha, U.; Takken, W.

    2008-01-01

    Nymphal Ixodes ricinus ticks (n=180) were collected from three different areas in the Netherlands to investigate the effect of forest composition on tick-associated microbial communities. Sampled habitats differed in thickness of leaf litter and humus layers and vegetation associations and were loca

  19. Ixodes ricinus tick saliva modulates tick-borne encephalitis virus infection of dendritic cells

    Czech Academy of Sciences Publication Activity Database

    Fialová, Anna; Cimburek, Zdeněk; Iezzi, G.; Kopecký, Jan

    2010-01-01

    Roč. 12, č. 7 (2010), s. 580-585. ISSN 1286-4579 R&D Projects: GA AV ČR IAA600960811 Institutional research plan: CEZ:AV0Z60220518; CEZ:AV0Z50200510 Keywords : Tick-borne encephalitis virus * Dendritic cell * Tick saliva * Ixodes ricinus Subject RIV: EC - Immunology Impact factor: 2.726, year: 2010

  20. Occurrence of multiple infections with different Borrelia burgdorferi genospecies in Danish Ixodes ricinus nymphs

    DEFF Research Database (Denmark)

    Andersen, Jean Vennestrøm; Egholm, H.; Mikkelsen, Per Jensen

    2008-01-01

    The pathogen Borrelia burgdorferi causes Lyme Borreliosis in human and animals world-wide. In Europe the pathogen is transmitted to the host by the vector Ixodes ricinus. The nymph is the primary instar for transmission to humans. We here study the infection rate of five Borrelia genospecies: B...

  1. Prevalence and diversity of Babesia spp. in questing Ixodes ricinus ticks from Norway

    Directory of Open Access Journals (Sweden)

    Øines Øivind

    2012-08-01

    Full Text Available Abstract Background Ixodes ricinus ticks transmit Babesia species to vertebrate hosts. Using molecular tools we were able to detect the presence of this piroplasmid in its vector. The aims of this study were to investigate the prevalence and identity of Babesia species in questing ticks collected in various areas of Norway. Methods DNA from questing l. ricinus ticks were examined with a realtime PCR for the presence of Babesia. Positive samples of tick DNA were identified to species using PCR, and sequence analysis. Results From a total of 1908 questing l. ricinus ticks, 17 (0.9% indicated the presence of Babesia spp. after realtime-PCR screening. Ixodes ricinus harbouring Babesia spp. was detected in 9 out of 22 localities. Further molecular analyses of DNA from these positive ticks indicate the presence of Babesia venatorum, B. divergens, B. capreoli and a currently undescribed Babesia in Norwegian ticks. The most prevalent was B. venatorum found in 71% of the positive ticks. Conclusions A total of 17 out of 1908 (0.9% ticks were positive for Babesia. Our data confirm that there are several Babesia species in ticks in Norway. Babesia venatorum was the most prevalent. This species has a zoonotic potential and may cause human babesiosis following a tick bite.

  2. Babesia sp. EU1 from Roe Deer and Transmission within Ixodes ricinus

    OpenAIRE

    Bonnet, Sarah; Jouglin, Maggy; L’Hostis, Monique; Chauvin, Alain

    2007-01-01

    We report in vitro culture of zoonotic Babesia sp. EU1 from blood samples of roe deer in France. This study provides evidence of transovarial and transstadial transmission of the parasite within Ixodes ricinus, which suggests that this tick could be a vector and reservoir of EU1.

  3. Evaluation of oil content and fatty acid composition in the USDA castor germplasm collection for biodiesel production.

    Science.gov (United States)

    Castor has potential as a feedstock for biodiesel production. The oil content and fatty acid composition in castor seed are important factors to determine the price for production and affect the key fuel properties of biodiesel. There were 1033 available castor accessions collected or donated from 4...

  4. Mass spectrometry of the lithium adducts of diacylglycerols containing hydroxy FA in castor oil and two normal FA

    Science.gov (United States)

    Castor oil can be used in industry. The molecular species of triacylglycerols containing hydroxy fatty acids (FA) in castor oil have been identified. We report here the identification of twelve diacylglycerols (DAG) containing hydroxy FA in castor oil using positive ion electrospray ionization mass ...

  5. Identification of diacylglycerol and triacylglycerol containing 11,12,13-trihydroxy-9-14-octadecadienoic acids in castor oil

    Science.gov (United States)

    Castor oil has many industrial uses. Molecular species of acylglycerols containing monohydroxy, dihydroxy and trihydroxy fatty acids in castor oil have been reported. We report here the identification of acylglycerols containing triOH18:2 fatty acid in castor oil. The structure of this novel fa...

  6. Structure of the fruit peel of Pyrus communis L.

    Directory of Open Access Journals (Sweden)

    Agata Konarska

    2013-04-01

    Full Text Available The peel of fruits of Pyrus communisL. cv. ‘Klapsa’,harvested at commercial maturity in September 2011, was examined using bright-field and fluorescence microscopy as well as scanning electron and transmission microscopy. The fruit peel was found to be composed of an epidermis covered by a cuticle and several layers of hypodermis. SEM observations showed that in the cuticle there were numerous microcracks of various widths, running in different directions, as well as numerous oval- or star-shaped lenticels with a diameter of approximately 130-230 µm. The microcracks ran along the cell walls and the appearance of the widest ones resembled a zipped-up zip. Crystalline wax platelets with horizontal and, more rarely, vertical orientation in relation to the surface of the organ were visible on the surface of the cuticle. The largest number of vertical wax platelets was found inside the microcracks, whereas inside the lenticels mycelium hyphae and/or fungal spores were sometimes observed. In the cross-section through the surface layer covering the fruit of Pyrus, the cells of the single- and sometimes two-layered epidermis were found to have different shapes and sizes and to be covered with a cuticular epithelium characterized by a varying structure and a thickness of about 10 µm. The cuticle covered not only the external tangential walls, but also penetrated through the anticlinal walls significantly increasing their thickness and reducing the inner diameter of the cells. TEM observations showed that inside the epidermal cells, which exhibited varying degrees of vacuolation, there was parietal cytoplasm in which cell nuclei, plastids with starch grains, and numerous mitochondria could be observed. In the hypodermis, which was composed of 3 up to 5 layers of tangential collenchyma cells with thickened tangential walls, organelles were found similar to those described in the epidermis, whereas in the vacuoles there were visible fibrous deposits

  7. An innovative European integrated project: Castor-CO2 from capture to storage

    NARCIS (Netherlands)

    Thiez, P.L.; Mosditchian, G.; Torp, T.; Feron, P.; Ritsema, I.; Zweigel, P.; Lindeberg, E.

    2005-01-01

    This chapter gives an overview of the CASTOR (CO2, from Capture to Storage) R and D project, funded by the European Union (EU) under the 6th Framework Program. With a partnership involving Industry and Research organizations, CASTOR aims at developing new technologies for post-combustion capture and

  8. Analysis of germination of castor and peanuts seeds by 13C NMR

    International Nuclear Information System (INIS)

    Germination of castor and peanut seeds was followed by 13C NMR. Results are comparable to those observed for soybean seeds and reveal that this technique is generally applicable in cases in which a reasonable amount of soluble material is present during germination. Different pathways for oil degradation by castor and peanut seeds may be distinguished. (Author)

  9. Identification of acylglycerols containing dihydroxy fatty acids in castor oil by mass spectrometry

    Science.gov (United States)

    Ricinoleate, a monohydroxy fatty acid, in castor oil has many industrial uses. Dihydroxy fatty acids can also be used in industry. The C18 HPLC fractions of castor oil were used for mass spectrometry to identify the acylglycerols containing dihydroxy fatty acids. Four diacylglycerols identified were...

  10. 21 CFR 524.2620 - Liquid crystalline trypsin, Peru balsam, castor oil.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Liquid crystalline trypsin, Peru balsam, castor... NEW ANIMAL DRUGS § 524.2620 Liquid crystalline trypsin, Peru balsam, castor oil. (a)(1) Specifications... delivered to the wound site contains 0.12 milligram of crystalline trypsin, 87.0 milligrams of Peru...

  11. Different methods evaluation of antioxidant properties of Myrtus communis extract and its fractions

    Directory of Open Access Journals (Sweden)

    Soheila Moein

    2015-09-01

    Full Text Available Myrtus communis L. is a plant traditionally used as an antiseptic and disinfectant drug. In this research, the antioxidant activity of Myrtus communis was assayed by evaluating radical scavenging activity, reducing power, FRAP method and determination of phenolic compounds. The methanolic extract of leaves of Myrtus communis was fractionated by using petroleum ether, chloroform, ethyl acetate and buthanol. In reducing power, different concentrations of samples were mixed with phosphate buffer, ferrocyanate, TCA and ferric chloride. Different concentrations of samples were mixed with DPPH and after 30 min the absorbances were measured. For determination of phenolic content, 500 μl of sample was mixed with Folin-Ciocalteu and sodium carbonate. For determination of flavonoids, 500 μl of sample was mixed with 2 ml of distilled water, NaNO2 and NaOH. In reducing power method, chloroform fraction showed the highest reducing capacity. In the DPPH radical scavenging method, the highest antioxidant capacity was found in buthanol fraction (IC50=84.42±1.8 μg/ml. In FRAP method, the highest antioxidant capacity was found in crude extract (5.4±0.3 mg/ml and buthanol fractions (5.51±0.4 mg/ml, respectively. The highest amount of phenolic compounds was detected in ethyl acetate fraction of Myrtus communis (17.5±0.001 μg/g. The highest amount of flavonoids was found in crude extract of Myrtus communis (171.9±7.3 μg/ml. Overall, we can suggest that the leaves of Myrtus communis can be used as antioxidant and as a food additives to avoid oxidative degradation of foods.

  12. Hypnotic effect of the essential oil from the leaves of Myrtus communis on mice

    Directory of Open Access Journals (Sweden)

    Birhanie MW

    2016-08-01

    Full Text Available Muluken Walle Birhanie,1 Bizuayehu Walle,1 Kidist Rebba2 1Department of Physiology, 2Department of Nursing, College of Medicine and Health Sciences, Bahir Dar University, Bahir Dar, Ethiopia Background: Myrtus communis has been suggested as a sleep aid in unconventional medicine. Moreover, previous studies have also indicated its sedative- and hypnotic-like activity. In this study, the hypnotic effect of M. communis was investigated.Methods: Essential oil (EO of M. communis (600, 800, and 1,000 mg/kg was given orally to Swiss albino mice of both sex, and the hypnotic effect was evaluated. In addition, the EO of M. communis (500, 600, 800, and 1,000 mg/kg was administered orally to Swiss albino mice of both sex 60 minutes prior to pentobarbital injection (50 mg/kg. Latency to sleep and sleep duration were recorded. The effect of the EO on motor coordination and muscle relaxation was evaluated using chimney and traction tests, 60 and 90 minutes after administration of the respective doses of the EO, respectively.Results: There was no induction of hypnosis as the presence of the righting reflex was intact. However the EO prolonged pentobarbital-induced sleeping time and there was also 50% negative response on the chimney and traction test in a dose dependent manner.Conclusion: The EO of M. communis did not produce a hypnotic effect, but it potentiated a hypnotic effect with significant central nervous system depressant activity. Keywords: Myrtus communis, hypnotic, motor coordination, muscle relaxation, essential oil

  13. Metagenomic profile of the bacterial communities associated with Ixodes ricinus ticks.

    Directory of Open Access Journals (Sweden)

    Giovanna Carpi

    Full Text Available Assessment of the microbial diversity residing in arthropod vectors of medical importance is crucial for monitoring endemic infections, for surveillance of newly emerging zoonotic pathogens, and for unraveling the associated bacteria within its host. The tick Ixodes ricinus is recognized as the primary European vector of disease-causing bacteria in humans. Despite I. ricinus being of great public health relevance, its microbial communities remain largely unexplored to date. Here we evaluate the pathogen-load and the microbiome in single adult I. ricinus by using 454- and Illumina-based metagenomic approaches. Genomic DNA-derived sequences were taxonomically profiled using a computational approach based on the BWA algorithm, allowing for the identification of known tick-borne pathogens at the strain level and the putative tick core microbiome. Additionally, we assessed and compared the bacterial taxonomic profile in nymphal and adult I. ricinus pools collected from two distinct geographic regions in Northern Italy by means of V6-16S rRNA amplicon pyrosequencing and community based ecological analysis. A total of 108 genera belonging to representatives of all bacterial phyla were detected and a rapid qualitative assessment for pathogenic bacteria, such as Borrelia, Rickettsia and Candidatus Neoehrlichia, and for other bacteria with mutualistic relationship or undetermined function, such as Wolbachia and Rickettsiella, was possible. Interestingly, the ecological analysis revealed that the bacterial community structure differed between the examined geographic regions and tick life stages. This finding suggests that the environmental context (abiotic and biotic factors and host-selection behaviors affect their microbiome.Our data provide the most complete picture to date of the bacterial communities present within I. ricinus under natural conditions by using high-throughput sequencing technologies. This study further demonstrates a novel detection

  14. EVALUATION OF PHYSIOLOGY AND BIOCHEMISTRY THE CASTOR BEAN FUNCTION OF DOSES AND FERTILIZER IN SOIL

    Directory of Open Access Journals (Sweden)

    Fabiana Xavier Costa

    2011-04-01

    Full Text Available Aimed at with this work to investigate the physiology and biochemistry of the castor bean, after use of compost and organic castor bean. The trial began on October 3, 2005 ending on March 20, 2006, in green-house, controlled environment of the National Center of Cotton Research (CNPA / EMBRAPA, in Campina Grande , State of Paraiba. Was used to cultivate castor BRS Paraguaçu. We used a randomized block design with four replications, totaling 11 treatments, since they are derived from doses of castor-oil and organic compost (four doses of each and three witnesses, with further study of orthogonal contrasts . The castor bean showed effective results in the variables chlorophyll content (ppm in leaves and number of days to flowering of the first cluster (DIAFI. Compost organic waste not produced any significant result for both variables.

  15. Medicinal significance, pharmacological activities, and analytical aspects of ricinine: A concise report

    Directory of Open Access Journals (Sweden)

    Kanika Patel

    2016-08-01

    Full Text Available Ricinine (3-cyano-4-methoxy-N-methyl-2-pyridone is an alkaloid present in leaves and seeds of castor plant i.e. Ricinus communis. It can cause vomiting, convulsions, hypotension, liver and kidney damage and several other complications in human. Ricinine presents mainly in young plant and it is the only cyano-substituted pyridine compounds occurred naturally. Ricinine also found in some other plants such as Piper nigrum, Discocleidion rufescens, Aparisthmium cordatum and Nicotiana tabacum. Accidental and intended Ricinus communis intoxications in humans and animals have been known for centuries. In the present review, we summarize the information regarding its medicinal uses, pharmacological activities, analytical techniques and intended and unintended poisoning cases in humans and animals. This review will be beneficial for the researcher in the field of herbal medicine and other allied sciences.

  16. Characterization and Digestibility of Detoxified Castor Oil Meal for Japanese Quails

    Directory of Open Access Journals (Sweden)

    PA dos Santos

    2015-12-01

    Full Text Available ABSTRACT These experiments were performed to determine the chemical composition, coefficients of nutrient and energy metabolizability, amino acid composition, and cytotoxicity of different castor oil meals subjected to different detoxification processes and added to the diet of Japanese quails. In the trial, 180 46-d-old female Japanese quails were distributed according to a completely randomized design into five treatments and with replicates of six bird each. The treatments consisted of following detoxification methods of castor oil meal: Castor oil meal A (CMA - recovery in alcohol at 80 °C for 20 minutes and drying at 80 °C; castor oil meal B (CMB and C (CMC - recovery in alcohol at 80 °C for 6 minutes, neutralization with 5% NaOH, and drying under direct sunlight sun for two days (CMB or pelleted (CMC; castor oil meal D (CMD - recovery in alcohol at 110 °C for 15 minutes and drying at 110 °C. Castor oil meal was added replacing 20% of the reference diet. There was slight chemical composition variation (1.21% in crude protein, 6% in dry matter, 2.2% in ether extract and 64 kcal/kg in gross energy among the castor oil meals submitted to the different treatments. The castor oil meal submitted to treatment C showed the highest amino acid values. In the cytotoxicity test, treatment D presented lower ricin activity. Castor oil meals A, C, and D may be included in Japanese quail diets; however, castor oil meal D is recommended due to the simplicity its industrial process, its low toxicity, and metabolizability coefficients obtained.

  17. Protein (Viridiplantae): 255564343 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available VNGRARKFNRVFNAIESVEVLYSEGRKLHLQMEEKLSVLHGMLNREIDKPVEASLQDGSYAKHEGGRKRESRDEQERTIKIRSNVQNDGNAYGPASSSAMDLLGVPQECIKGL...EDFLINGRLMVHSDASIERLEGCDSRINIFLDGIYLNLSSNPASADQLVAGSIILASVCAAIDHIEFICEASYNLLQIRKYENDTILIILHVFAYLGG...CAIRTCMVRCSLDTERECLVQKIFHALKTEAKISPKEKACALFTLLLLNFSWCTLDKCGNFADKNFFLCLDSFACRINAVVCAVEARSLFAELCCCEELVGLI...8:7959 ATP binding protein, putative Ricinus communis MAADVPVKQLSLPVNPCCALWKEKCSKLEGGRKHLRQAVQILNEQVDKIQAENL...SDSFGFDLEKSERFEEIENGDYMKLLDLDNTADEECYRRAMEMPLSPTLPEIEISRIETFDVDNFRAFNFNGGLSNEKEVLVPSHRLDVAG

  18. Protein (Viridiplantae): 255562238 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available GNVGCGSIGGGATDLPKSYSVNSLRDVDDEEFKKLLRLLSEKGTETESYMQSSEQGDWRSCSRKASAMRRNYSVGVGKIGRIDEGRACSFREEEDDVNGNSYSRSRSHAVRRNVVYY ... ...880:2911 3987:2911 3988:2911 conserved hypothetical protein Ricinus communis MRSKPNKLSKLVQISKAPIRILCKARDFYVKGMLGFANS

  19. Protein (Viridiplantae): 255562723 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available :3079 3988:3079 conserved hypothetical protein Ricinus communis MIETSDANSAYSTQRGKSPLPCSQPRKKMRSDETGNTVATSNSETLSSKRKVNLNSYS...PEFKVRRVAAPSANSSFSDRSLPLINPIYLANGYLNLNQVIGRINVAMPRSNLSKCKDKQLSHERKAAGGQPSEGPPCLRIVSAAESAN...NFVSKHPFFRVVMRSTYLNDYVIVFRYIDSSKAKLEQKQGSSGTAHLQSSMMGSTSYAYCNSGHHYASTNKLCKKHMQHQNKNITLQFEGRTWSATFCSLTNRIRGGWKSFVRNNSLREGDVCVFELIDSRKALVKVSIFRSEN ...

  20. Isocyanate-functionalized castor oil as a novel bitumen modifier

    OpenAIRE

    Cuadri Vega, Antonio Abad; García Morales, Moisés; Navarro Domínguez, Francisco Javier; Partal López, Pedro

    2013-01-01

    The use of biomaterials from renewable sources in the synthesis of polyurethane-derived polymers is lately receiving great attention from social, environmental and economic standpoints. In this work, prepolymers having different -NCO/-OH ratio were synthesized, by reaction of 4,4´-diphenylmethane diisocyanate (MDI) with castor oil (CO), to be used as modifying agent of asphaltic bitumen. Reactions between MDI and CO, performed with -NCO/-OH molar ratios of 8:1 and 4:1, have led to suitable bi...

  1. Safety analysis report for packaging (onsite) Castor GSF cask

    International Nuclear Information System (INIS)

    The CASTOR GSF packaging was designed and fabricated to be a certified Type B(U) packaging and comply with the requirements of the International Atomic Energy Agency (IAEA) for transport of up to five sealed canisters of vitrified radioactive materials. This onsite Safety Analysis Report for Packaging (SARP) provides the analysis and evaluations necessary to demonstrate that the casks, with the canister payload, meet the intent of the Type B packaging regulations set forth in 10 CFR 71 and therefore meet the onsite transportation safety requirements of WHC-CM-2-14, Hazardous Material Packaging and Shipping

  2. Global energy balance and density limit on CASTOR tokamak

    International Nuclear Information System (INIS)

    Total radiative power losses were measured with a pyroelectric detector on the CASTOR tokamak in a broad range of plasma parameters. It was shown that while the most important channel of energy losses for the low density operation (average ne19 m-3) is thermal conductivity, the high density regimes are radiative dominant. Using a simple analytic energy balance model, the connection is discussed between such a high level of radiation and the shrinking of the current channel resulting in an enhanced MHD activity. (author)

  3. Example of industrial valorisation of derivative products of Castor oil

    Directory of Open Access Journals (Sweden)

    Borg Patrick

    2009-07-01

    Full Text Available Known since antiquity, Castor Oil has been first used in medicine. Now, even if it remains present in small quantities as an excipient in many pharmaceutical specialties, it finds a lot of applicationsin cosmetics, industrial applications and chemical industry. Castor Oil specificity comes from its high content of ricinoleic acid (up to 85% that combines a double bond and an hydroxyl function in the heart of a 18 carbons linear chain. This particular structure is the key of an unique chemistry developed by ARKEMA that gives by thermal cracking a wide range of compounds with either 7 or 11 carbon atoms. A whole range of innovative chemistries and end use products are generated from these base reaction products. They are used in every-day life, to improve our comfort and safety but also in very specific applications with very high technical requirements. Synthesized from undecylenic acid, 11-amino-undecanoic acid, 100% based on renewable resources, is the precursor to biobased polymers combining high performance and sustainability: Rilsan®, Rilsan Fine Powder®, Pebax Rnew®.

  4. Characterization of Novel Castor Oil-Based Polyurethane Polymer Electrolytes

    Directory of Open Access Journals (Sweden)

    Salmiah Ibrahim

    2015-04-01

    Full Text Available Castor oil-based polyurethane as a renewable resource polymer has been synthesized for application as a host in polymer electrolyte for electrochemical devices. The polyurethane was added with LiI and NaI in different wt% to form a film of polymer electrolytes. The films were characterized by using attenuated total reflectance-Fourier transform infrared spectroscopy, dynamic mechanical analysis, electrochemical impedance spectroscopy, linear sweep voltammetry and transference number measurement. The highest conductivity of 1.42 × 10−6 S cm−1 was achieved with the addition of 30 wt% LiI and 4.28 × 10−7 S·cm−1 upon addition of 30 wt% NaI at room temperature. The temperature dependence conductivity plot indicated that both systems obeyed Arrhenius law. The activation energy for the PU-LiI and PU-NaI systems were 0.13 and 0.22 eV. Glass transition temperature of the synthesized polyurethane decreased from −15.8 °C to ~ −26 to −28 °C upon salts addition. These characterizations exhibited the castor oil-based polyurethane polymer electrolytes have potential to be used as alternative membrane for electrochemical devices.

  5. Sanitary quality of castor bean seeds (cv. IAC-226

    Directory of Open Access Journals (Sweden)

    Andréia Márcia Santos de Souza David

    2014-09-01

    Full Text Available The objective of this work was to evaluate the fungicides efficacy on the castor seeds IAC-226 sanitary quality. The seeds were treated with two doses of the fungicides captan (250 and 300 g ai 100 kg-1 seed, thiophanate-methyl (100 and 150 g ai 100 kg-1 seed and thiabendazole (100 and 150 g kg ai 100 seeds. Seeds without fungicide treatment were the control. The seeds sanitary quality was evaluated by sanity test, using 10 replications of 20 seeds per treatment/lot, superficially sterilized (sodium hypochlorite and placed in plastic boxes (gerbox with filter paper and sterilized distilled water, under controlled temperature 25°C for 20 days. Seeds were examinated individually using a stereoscopic microscope and optical microscope. The results were expressed as percentage of infected seeds. The experimental design was completely randomized in a factorial arrangement (2 x 7, two lots and seven treatments, with ten repetitions. The fungicides captan, tiabendazol and tiofanato-metílico reduced the incidence of fungi, being recommended for the castor seeds IAC-226 treatment. There was a predominance of fungi Alternaria alternata, Aspergillus flavus, Aspergillus niger, Bipolar, Botrytis ricini, Curvularia sp., Penicillium sp. and Rhizopus sp.

  6. Diapause in ticks of the medically important Ixodes ricinus species complex.

    Science.gov (United States)

    Gray, Jeremy S; Kahl, Olaf; Lane, Robert S; Levin, Michael L; Tsao, Jean I

    2016-07-01

    Four members of the Ixodes ricinus species complex, Ixodes pacificus, Ixodes persulcatus, Ixodes ricinus and Ixodes scapularis, have, between them, a worldwide distribution within the northern hemisphere. They are responsible for the transmission of several animal and human pathogens, including the causal agents of Lyme borreliosis, tick-borne encephalitis, human granulocytic anaplasmosis and human babesiosis. Despite the importance of these ticks as vectors, the knowledge and understanding of the role that diapause plays in their complex life cycles are confused and incomplete. In view of the continuing geographic spread of these tick species, as well as the effects of climate change on vector-borne diseases, it is timely to encourage research on diapause phenomena to improve understanding of their biology and of pathogen transmission dynamics. In our review we seek to clarify thinking on the topic and to address gaps in our knowledge that require the attention of researchers. PMID:27263092

  7. Study on Emission and Performance of Diesel Engine Using Castor Biodiesel

    OpenAIRE

    2014-01-01

    This paper presents the result of investigations carried out in studying the emission and performance of diesel engine using the castor biodiesel and its blend with diesel from 0% to 40% by volume. The acid-based catalyzed transesterification system was used to produce castor biodiesel and the highest yield of 82.5% was obtained under the optimized condition. The FTIR spectrum of castor biodiesel indicates the presence of C=O and C–O functional groups, which is due to the ester compound in bi...

  8. EVALUATION OF PHYSIOLOGY AND BIOCHEMISTRY THE CASTOR BEAN FUNCTION OF DOSES AND FERTILIZER IN SOIL

    OpenAIRE

    Fabiana Xavier Costa

    2011-01-01

    Aimed at with this work to investigate the physiology and biochemistry of the castor bean, after use of compost and organic castor bean. The trial began on October 3, 2005 ending on March 20, 2006, in green-house, controlled environment of the National Center of Cotton Research (CNPA / EMBRAPA), in Campina Grande , State of Paraiba. Was used to cultivate castor BRS Paraguaçu. We used a randomized block design with four replications, totaling 11 treatments, since they are derived from doses of...

  9. Application of Factorial Design of Experiments for the Continuous Hydrogenation of Enriched Castor Oil Methyl Esters

    OpenAIRE

    Tulasi Sri Venkata Ramana Neeharika; Karna Narayana Prasanna Rani; Kasturi Venkata Sesha Adinarayana Rao; Thella Prathap Kumar; Rachapudi Badari Narayana Prasad

    2013-01-01

    Castor oil methyl esters contains nearly 90% ricinoleic acid (12-hydroxy-cis-9-octadecenoic acid). Hydrogen-ated castor oil methyl esters finds several applications in coating, lubricants formulations and pharmaceu-tical areas. The present study reports a fast, simple, efficient and continuous hydrogenation of enriched castor oil methyl ester (ECME) using 10% Pd/C catalyst at different pressures and temperatures. The range of process conditions for this study varied from 30-60 °C, 5-15 bar wi...

  10. Study on Emission and Performance of Diesel Engine Using Castor Biodiesel

    OpenAIRE

    Md. Saiful Islam; Abu Saleh Ahmed; Aminul Islam; Sidek Abdul Aziz; Low Chyi Xian; Moniruzzaman Mridha

    2014-01-01

    This paper presents the result of investigations carried out in studying the emission and performance of diesel engine using the castor biodiesel and its blend with diesel from 0% to 40% by volume. The acid-based catalyzed transesterification system was used to produce castor biodiesel and the highest yield of 82.5% was obtained under the optimized condition. The FTIR spectrum of castor biodiesel indicates the presence of C=O and C–O functional groups, which is due to the ester compound in...

  11. How ticks get under your skin: insertion mechanics of the feeding apparatus of Ixodes ricinus ticks

    OpenAIRE

    Richter, Dania; Matuschka, Franz-Rainer; Spielman, Andrew; Mahadevan, L.

    2013-01-01

    The tick Ixodes ricinus uses its mouthparts to penetrate the skin of its host and to remain attached for about a week, during which time Lyme disease spirochaetes may pass from the tick to the host. To understand how the tick achieves both tasks, penetration and attachment, with the same set of implements, we recorded the insertion events by cinematography, interpreted the mouthparts’ function by scanning electron microscopy and identified their points of articulation by confocal microscopy. ...

  12. Detection of Bartonella spp. in Ixodes ricinus ticks and Bartonella seroprevalence in human populations.

    Science.gov (United States)

    Müller, Andreas; Reiter, Michael; Schötta, Anna Margarita; Stockinger, Hannes; Stanek, Gerold

    2016-07-01

    Ticks are vectors for many bacterial, protozoan and viral pathogens and are potential vectors for Bartonella species. Hunters and foresters, therefore, may be regarded as high-risk groups for Bartonella infections. The aims of this study were (i) to identify Bartonella species in questing Ixodes ricinus ticks collected in all provinces of Austria, and (ii) to determine the prevalence of antibodies to Bartonella species in hunters and blood donors in eastern Austria. A total of 515 larval, nymphal and adult I. ricinus, collected throughout Austria in 2005, were selected from the tick library at the Institute for Hygiene and Applied Immunology of the Medical University of Vienna and screened in a specific real-time PCR that targeted a region of the ssrA gene of Bartonella species. The overall Bartonella infection rate was 2.1% (11/515) and the highest rate, 7.5% (4/53), was found in ticks from Vienna. This finding was confirmed by screening a further 60 I. ricinus collected from Vienna in 2013: of these, 6.7% (4/60) were positive for Bartonella spp. The rate of infection was always higher in adult ticks. Sequence analysis in the Bartonella-positive ticks identified several species, including B. henselae, B. doshiae and B. grahamii. To our knowledge this is the first time that these species have been identified in I. ricinus in Austria. Prevalence of IgG antibodies against B. henselae and B. quintana was determined in serum samples from hunters (100) and blood donors (100): in hunters 23% were positive for B. quintana and in 2 samples (2%), antibodies to both B. quintana and B. henselae were detected; in blood donors 22% were positive for B. quintana, 1% for B. henselae and 5% for both. These results indicate that exposure to ticks does not constitutes a relevant risk for Bartonella infection. PMID:26997137

  13. Identification and partial characterisation of new members of the Ixodes ricinus defensin family

    Czech Academy of Sciences Publication Activity Database

    Tonk, Miray; Cabezas Cruz, Alejandro; Valdés, James J.; Rego, Ryan O. M.; Rudenko, Natalia; Golovchenko, Maryna; Bell-Sakyi, L.; de la Fuente, J.; Grubhoffer, Libor

    2014-01-01

    Roč. 540, č. 2 (2014), s. 146-152. ISSN 0378-1119 R&D Projects: GA ČR(CZ) GAP302/11/1901; GA MŠk(CZ) EE2.3.30.0032 Institutional support: RVO:60077344 Keywords : antimicrobial peptide * defensin * Ixodes ricinus * tick * tick cell line Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.138, year: 2014

  14. Unbodied dehydrated castor oil from oil of castor beans cultivated in tropical and sub tropical zones of pakistan

    International Nuclear Information System (INIS)

    Commercially available castor oil was analysed for specific gravity at 25/25 degree C (0.959), acid value (0.5), iodine value (85), refractive index at 25 degree C (1.4769), viscosity at 25 degree C (6.8), and hydroxyl value (162). Fatty acid composition, including palmitic acid (I. 7%), stearic acid (1.39%), oleic acid (5.73%), linoleic acid (6.25%), and ricinoleic acid (84.2%) was estimated by means of GLC. Unbodied dehydrated castor oil (DCO- 15) 93% was prepared by using sodium bisulphate and sodium bisulphite and other reaction conditions. Unbodied DCO was analysed for iodine value (139), acid value (3.6), refractive index at 25 degree C (1.4820), specific gravity at 25/25 degree C and 30/30 degree C (0.9333 and 0.925) viscosity at 25 degree C and 30 degree C (200 cps and 1.85 poise), respectively. Fatty acid composition was also determined to ascertain the extent of dehydration due to the formation of conjugated linoleic acid (CLA, 36.9%) and non conjugated linoleic acid (NCLA, 46.8%). Ricinoleic acid was estimated as 3.83%. Unbodied DCO-15 was in good conformance with the standard specification of ASTM and other values cited in the literature. (author)

  15. Development of genomic resources for the tick Ixodes ricinus: isolation and characterization of single nucleotide polymorphisms.

    Science.gov (United States)

    Quillery, E; Quenez, O; Peterlongo, P; Plantard, O

    2014-03-01

    Assessing the genetic variability of the tick Ixodes ricinus-an important vector of pathogens in Europe-is an essential step for setting up antitick control methods. Here, we report the first identification of a set of SNPs isolated from the genome of I. ricinus, by applying a reduction in genomic complexity, pyrosequencing and new bioinformatics tools. Almost 1.4 million of reads (average length: 528 nt) were generated with a full Roche 454 GS FLX run on two reduced representation libraries of I. ricinus. A newly developed bioinformatics tool (DiscoSnp), which isolates SNPs without requiring any reference genome, was used to obtain 321 088 putative SNPs. Stringent selection criteria were applied in a bioinformatics pipeline to select 1768 SNPs for the development of specific primers. Among 384 randomly SNPs tested by Fluidigm genotyping technology on 464 individuals ticks, 368 SNPs loci (96%) exhibited the presence of the two expected alleles. Hardy-Weinberg equilibrium tests conducted on six natural populations of ticks have shown that from 26 to 46 of the 384 loci exhibited significant heterozygote deficiency. PMID:24119113

  16. Arsenophonus nasoniae and Rickettsiae Infection of Ixodes ricinus Due to Parasitic Wasp Ixodiphagus hookeri.

    Directory of Open Access Journals (Sweden)

    Monika Bohacsova

    Full Text Available Arsenophonus nasoniae, a male-killing endosymbiont of chalcid wasps, was recently detected in several hard tick species. Following the hypothesis that its presence in ticks may not be linked to the direct occurrence of bacteria in tick's organs, we identified A. nasoniae in wasps emerging from parasitised nymphs. We confirmed that 28.1% of Ixodiphagus hookeri wasps parasitizing Ixodes ricinus ticks were infected by A. nasoniae. Moreover, in examined I. ricinus nymphs, A. nasoniae was detected only in those, which were parasitized by the wasp. However, in part of the adult wasps as well as in some ticks that contained wasp's DNA, we did not confirm A. nasoniae. We also found, that in spite of reported male-killing, some newly emerged adult wasp males were also infected by A. nasoniae. Additionally, we amplified the DNA of Rickettsia helvetica and Rickettsia monacensis (known to be Ixodes ricinus-associated bacteria in adult parasitoid wasps. This may be related either with the digested bacterial DNA in wasp body lumen or with a role of wasps in circulation of rickettsiae among tick vectors.

  17. Vector competence of the tick Ixodes ricinus for transmission of Bartonella birtlesii.

    Directory of Open Access Journals (Sweden)

    Caroline Reis

    Full Text Available Bartonella spp. are facultative intracellular vector-borne bacteria associated with several emerging diseases in humans and animals all over the world. The potential for involvement of ticks in transmission of Bartonella spp. has been heartily debated for many years. However, most of the data supporting bartonellae transmission by ticks come from molecular and serological epidemiological surveys in humans and animals providing only indirect evidences without a direct proof of tick vector competence for transmission of bartonellae. We used a murine model to assess the vector competence of Ixodes ricinus for Bartonella birtlesii. Larval and nymphal I. ricinus were fed on a B. birtlesii-infected mouse. The nymphs successfully transmitted B. birtlesii to naïve mice as bacteria were recovered from both the mouse blood and liver at seven and 16 days after tick bites. The female adults successfully emitted the bacteria into uninfected blood after three or more days of tick attachment, when fed via membrane feeding system. Histochemical staining showed the presence of bacteria in salivary glands and muscle tissues of partially engorged adult ticks, which had molted from the infected nymphs. These results confirm the vector competence of I. ricinus for B. birtlesii and represent the first in vivo demonstration of a Bartonella sp. transmission by ticks. Consequently, bartonelloses should be now included in the differential diagnosis for patients exposed to tick bites.

  18. Prevalence and phylogenetic analysis of Babesia spp. in Ixodes ricinus and Ixodes persulcatus ticks in Latvia.

    Science.gov (United States)

    Capligina, Valentina; Berzina, Inese; Bormane, Antra; Salmane, Ineta; Vilks, Karlis; Kazarina, Alisa; Bandere, Dace; Baumanis, Viesturs; Ranka, Renate

    2016-03-01

    Babesia spp. are tick-borne protozoan parasites that have been reported in many European countries and are considered to be emerging pathogens. Several Babesia spp. have been identified in ticks in Latvia. Recently, canine babesiosis cases were diagnosed for the first time in Latvia; therefore, continued studies on the prevalence and occurrence of new species are warranted. In the present study, questing tick samples collected in 2005-2007 were screened for the presence of Babesia spp.; in total, 432 Ixodes ricinus and 693 Ixodes persulcatus ticks were analyzed. Babesia spp. were detected in 1.4% of the I. ricinus ticks and in 1.9% of I. persulcatus ticks. Sequencing revealed that ixodid ticks in Latvia contained Babesia microti, Babesia capreoli, and Babesia venatorum. Babesia microti was the most prevalent species, accounting for 58% of all positive samples; moreover, two distinct B. microti genotypes were identified. Phylogenetic analysis of the full-length 18S rRNA gene of two B. capreoli/B. divergens isolates indicated a closer relationship to the B. capreoli clade than B. divergens. This is the first report of B. venatorum in I. persulcatus ticks in Latvia. Our results suggest that both I. ricinus and I. persulcatus ticks play important roles in the epidemiology of these zoonotic pathogens in Latvia. PMID:26481239

  19. LDPE/PHB blends filled with castor oil cake

    Science.gov (United States)

    Burlein, Gustavo A.; Rocha, Marisa C. G.

    2015-05-01

    The response surface methodology (RSM) is a collection of mathematical techniques useful for developing, improving and optimizing process. In this study, RSM technique was applied to evaluate the effect of the components proportion on the mechanical properties of low density polyethylene (LDPE)/ poly (3-hydroxy-butyrate) (PHB) blends filled with castor oil cake (CC). The blends were prepared by melt mixing in a twin screw extruder. Low density polyethylene, poly (3-hydroxy-butyrate) and castor oil pressed cake were represented by the input variables designated as LDPE, PHB and CC, respectively. As it was desirable to consider the largest LDPE content in the ternary system, the components of the mixture were subjected to the following constraints: 0.7 ≤ LDPE ≤ 1.0, 0≤ PHB≤0.3 e 0 ≤ CC ≤0.3. The mechanical properties of the different mixtures were determined by conventional ASTM tests and were evaluated through analysis of variance performed by the Minitab software. Some polynomial equations were tested in order to describe the mechanical behavior of the samples. The quadratic model in pseudo components was selected for describing the tensile behavior because it was the most efficient from a statistical point of view (p-value ≤ 0.05; coefficient of determination (r2) close to 1 and variation inflation factor (VIF) values cake to LDPE. The morphological study of the materials obtained showed that LDPE/PHB blends are immiscible and form morphological structures with well distinguished phase boundaries between dispersed phase and matrix. Biodegradation was evaluated burying the samples in simulated soil for different periods of time. The LDPE/PHB/CC mixtures with higher content of PHB showed more pronounced degradation. Under the experimental conditions studied the LDPE/CC compositions presented no degradation. However, the loss of mass of the LDPE/PHB/CC mixtures was higher than the loss of mass of the corresponding LDPE/PHB binary blend. This result

  20. Performance of the CASTOR calorimeter at CMS during Run II of LHC

    CERN Document Server

    Van De Klundert, Merijn H F

    2016-01-01

    The detector has pseudorapidity borders at -5.2 and -6.6. An overview is presented on the various aspects of CASTOR's performance and their relations during LHC Run 2. The equalisation of CASTOR's channels is performed using beam-halo muons. Thereafter, CASTOR's pedestal spectrum is studied. It is shown that noise estimates which are extracted using a fit, give on average a 10\\% lower threshold than statistical estimates. Gain correction factors, which are needed for the intercalibration, are obtained using a statistical, in-situ applicable method. The results of this method are shown to be reasonably consistent with laboratory measurements. Penultimately the absolute calibration is discussed, with emphasis on the relation between the scale uncertainty and CASTOR's alignment. It is shown that the alignment's contribution to the systematic uncerta...

  1. Removal of Basic Dyes from Aqueous Solution by Chloroacetic Acid Modified Ferula Communis Based Adsorbent: Thermodynamic and Kinetic Studies

    OpenAIRE

    Salih, Shameran Jamal

    2014-01-01

    ABSTRACT: This research aimed to propose an alternative cheap and abundantly available adsorbent (Ferula communis) for the removal of basic dyes from aqueous solutions. Chloroacetic acid modified Ferula communis (MFC) shows a great potential for the removal of basic red 9 dyes (BR9) from aqueous solution with the effects of solution capacity under pH, temperature, contact time, adsorbent dosage, and initial dye concentration condition on BR9 removal were examined. The adsorption equilibrium d...

  2. Mechanical and thermal properties of castor oil polyurethane bone cement after gamma irradiation

    International Nuclear Information System (INIS)

    Polyurethanes from castor oil are being employed as bone cement in medical applications. In this work the thermal and mechanical properties of gamma irradiated polyurethanes derivative from castor oil were investigated by instrumented indentation, thermogravimetry and scanning electron microscopy. A slightly increase in hardness is observed only for doses as high as 100 kGy. Thermal analysis indicates stability at human body temperature. The glass transition temperature has small changes after gamma irradiation. (author)

  3. ISOLATED PROTEIN FROM CASTOR BEAN, PEANUT, SOY BEAN AND SAFFLOWER MEALS

    OpenAIRE

    B.Tavasolian; S.Nikpour; B.Makanvand

    1981-01-01

    Castor bean, peanut, Soy bean and safflower protein isolates were prepared. The amino acid content of each of the protein isolates was analysed and the essential amino acid contents were compared with the FAO human requirements. The results indicated that castor bean has the highest oil and the protein content of defatted meal. Safflower 3148 (Marand, Iran) has the highest amount of essential amino acids. Peanut (Gilan Iran) has the lowest content of essential amino acids, however, in compari...

  4. Use of castor oil-based polyurethane adhesive in the production of glued laminated timber beams

    OpenAIRE

    Maximiliano dos Anjos Azambuja; Antonio Alves Dias

    2006-01-01

    Researchers from the Polymer Technology and Analytical Chemistry (LQATP) group at the São Carlos Institute of Chemistry, University of São Paulo, developed a polyurethane adhesive based on castor oil. In addition to deriving it from a renewable source, this adhesive is nonaggressive to humans and the environment. The purpose of this study is to investigate the feasible use of polyurethane adhesive based on castor oil in the production of 12 beams of Glulam, using the species Pinus caribea hon...

  5. Comparison of lubricant properties of castor oil and commercial engine oil

    OpenAIRE

    Binfa Bongfa; Peter A. Atabor; Atuci Barnabas; M.O. Adeoti

    2015-01-01

    The tribological performance of crude Nigeria-based castor oil has been investigated and compared with that of a foreign, 20W-50 high quality crankcase oil, to see its suitability as base oil for lubricating oils in indigenous vehicle and power plants engines. The experiment was conducted using a four ball tester. The results showed that unrefined castor oil has superior friction reduction and load bearing capability in an unformulated form than the commercial oil; can compete favourably with...

  6. UV and gamma irradiation effects on surface properties of polyurethane derivate from castor oil

    OpenAIRE

    Elaine C. Azevedo; Eduardo M. Nascimento; Gilberto O. Chierice; Salvador Claro Neto; Carlos M. Lepienski

    2013-01-01

    Gamma and ultraviolet radiation effects on hardness, elastic modulus and viscoelastic properties of polyurethane derived from castor oil (PU) were investigated by nanoindentation tests. Modifications on surface morphology, induced by radiation, were observed by atomic force microscopy. The polyurethane derivate from castor oil shows good resistance to gamma radiation, with only small changes in hardness, elastic modulus, viscoelastic properties and contact angle. The hardness of PU increases ...

  7. First results from sin-cos reflectometer on CASTOR

    International Nuclear Information System (INIS)

    An analysis is given of the first experimental data from a sin-cos reflectometer used at the CASTOR tokamak for the measurement of density fluctuations. The reflectometer operates at frequencies of 8.5 GHz and 10.26 GHz. Discrete Fourier transformation, fast Fourier transformation and autocorrelation analysis were used to obtain frequency spectra of density fluctuations and the time evolution of the Δτ parameter. The character of the spectra is shown to depend on the frequency used. The content of higher frequencies in the spectrum increases for density fluctuations at the plasma periphery. The correlation of fluctuations increases for the fluctuation at layers near to the plasma centrum. (J.B.) 8 figs., 5 refs

  8. Electron cyclotron emission and absorption experiment on the CASTOR tokamak

    International Nuclear Information System (INIS)

    Electron cyclotron radiation and absorption measurements on the CASTOR tokamak are reported. Emission spectra were obtained using fast-scanning Fourier spectrometer and InSb detectors, operating in the spectral range 30 to 300 GHz and receiving two orthogonal polarization components simultaneously. In the high plasma loop voltage runaway electrons gave rise to an intense broad-band emission. Runaway particles can be removed by increasing the plasma density. The electron temperature profile was deduced from thermal emission and absorption around second cyclotron harmonics. From the second and third harmonics of the non-thermal emission the energy and number of non-thermal particles can be calculated. During the lower-hybrid-current-drive (LHCD) experiments, the presence of 60 keV electrons with density of 1.1016 m-3 was deduced from emission spectra. (author). 5 figs., 6 refs

  9. Castor and Pollux - shielded cells for studying fuel treatment processes

    International Nuclear Information System (INIS)

    CASTOR and POLLUX, two alpha, beta, gamma cells are described in the present paper. They are located in the CEN at Fontenay-aux-Roses (France). They are designed for improvement studies of the various aqueous separation processes used in irradiated fuels reprocessing plants. Located in the same air-tight steel encasement, they arc inter-connected by a pneumatic transfer. These two cells have a similar in-line conception and they include: a gamma shielding in lead of 10 cm of thickness; an inner air-tight box, made with stainless steel and plexiglas, is maintained in lowering in comparison to room pressure. Eleven Hobson model seven master-slave manipulators allow inner manipulations. Then the inner equipment is described briefly. (author)

  10. The Castor Moving Group The age of Fomalhaut and Vega

    CERN Document Server

    Barrado y Navascués, D

    1998-01-01

    We have recomputed the kinematic properties of several of dozens nearby stars, to try to verify if Castor has a cohort of stars sharing the same space motion and age. We used kinematics, the location of the stars in CM diagrams, their lithium abundances, and their activity, to establish that the moving group seems to be real and to reject several stars which were believed to be part of this group. Of the initial 26 stars, we show that probably only 16 stars are physically associated. The moving group contains several A spectral type stars. Among them, Vega and Fomalhaut, two of the prototypes of the beta Pic type stars. Since this association includes several late spectral type stars, we used their properties to estimate their age and, therefore, the age of the group and that of Vega and Fomalhaut. Our estimate for that age is 200$\\pm$100 Myr.

  11. Secure and documented screwing down of Castor containers

    International Nuclear Information System (INIS)

    The castor container is sealed using a multiple lid system comprising a primary lid and a secondary lid. The two lids are positioned one above the other and screwed securely to the body of the container. In addition, the tightness of the lids is guaranteed by a special metal seal. A further steel plate is screwed securely over the lids providing additional protection for the lids from moisture and various influences. The central element connecting the lids to the container comprises fixed threaded connections which must be accurately tightened with a torque of 900 Nm, 1500 Nm or more. The basic function of a threaded connection, in terms of a positive fit and detachable joint, is to join together two or more parts in such a way that they always behave as a single part whatever operational forces are present. This can only be achieved by means of an accurate and sufficient pre-tensioning force. This pretensioning force is transferred to the threaded connection with the help of a particular torque and presses the components together. This loading brought about by the pretensioning force is referred to as the prestress. In order to create a correct and high quality connection, this prestress must be arrived at in an optimum manner. The prestress must therefore be high enough to withstand the full loading for which the connection is designed. In addition the connection should not come loose unintentionally if it is exposed to externally acting forces. Since under no circumstances should threaded connections on a castor container fail, a suitable screwing process must guarantee that this does not happen. The securing of threaded joints can only be ensured by introducing and maintaining a constant and accurate prestress. VDI Guideline 2230, Part 1, mentions various threaded connection or tightening processes, including torque-controlled tightening, angle-controlled tightening and yield-controlled tightening. (orig.)

  12. Some properties of castor oil affecting its performance as a capacitor impregnant and their significance to future impregnant research

    International Nuclear Information System (INIS)

    For a considerable time castor oil and polychlorinated biphenyl (PCB) have been the principal impregnants used in energy-storage capacitors. Castor oil has proven to be better than PCB for pulsed applications. PCB's have come under attack as an environmental hazard, while castor oil is a vegetable product and its supply and quality are subject to fluctuation. These two facts make the development of new impregnants desirable. The properties of PCB as a capacitor impregnant are well known. This paper first compares a number of properties of castor oil and PCB's. A comparison is made between the lives of castor oil capacitors and comparable PCB energy-storage capacitors. Some of the physical and chemical properties of castor oil which make it a good pulse capacitor impregnant are examined. These properties can be used as a guide for future research on new pulse capacitor impregnants

  13. Expression of Castor LPAT2 Enhances Ricinoleic Acid Content at the sn-2 Position of Triacylglycerols in Lesquerella Seed

    OpenAIRE

    Grace Q. Chen; Harrie van Erp; Jose Martin-Moreno; Kumiko Johnson; Eva Morales; John Browse; Peter J. Eastmond; Jiann-Tsyh Lin

    2016-01-01

    Lesquerella is a potential industrial oilseed crop that makes hydroxy fatty acid (HFA). Unlike castor its seeds are not poisonous but accumulate lesquerolic acid mostly at the sn-1 and sn-3 positions of triacylglycerol (TAG), whereas castor contains ricinoleic acid (18:1OH) at all three positions. To investigate whether lesquerella can be engineered to accumulate HFAs in the sn-2 position, multiple transgenic lines were made that express castor lysophosphatidic acid acyltransferase 2 (RcLPAT2...

  14. Evaluation of the performance of a castor-oil based formulation in limiting pesticide residues in strawberry crops

    OpenAIRE

    Mário Sérgio Galhiane; Sandra Regina Rissato; Lucídio de Sousa Santos; Gilberto Orivaldo Chierice; Marcos Vinícius de Almeida; Terezinha Fumis; Inês Chechim; Aloísio Costa Sampaio

    2012-01-01

    A study was made to evaluate the effect of a castor oil-based detergent on strawberry crops treated with different classes of pesticides, namely deltamethrin, folpet, tebuconazole, abamectin and mancozeb, in a controlled environment. Experimental crops of greenhouse strawberries were cultivated in five different ways with control groups using pesticides and castor oil-based detergent. The results showed that the group 2, which was treated with castor oil-based detergent, presented the lowest ...

  15. Element repertoire: change and development with age in Whitethroat Sylvia communis song

    OpenAIRE

    Balsby, Thorsten Johannes Skovbjerg; Hansen, Poul

    2009-01-01

    Abstract Song repertoires are often important determining factors in sexual selection. In several species, older males have larger repertoires than 1-year-old males. The development of large song repertoires by an individual is, however, poorly understood. We studied song element repertoire changes in five individual male Whitethroats Sylvia communis sampled as 1- and 2-year olds. These males increased the size of their element repertoire between their first and second year, but so...

  16. Identification of critical amino acids in the IgE epitopes of Ric c 1 and Ric c 3 and the application of glutamic acid as an IgE blocker.

    Directory of Open Access Journals (Sweden)

    Natalia Deus-de-Oliveira

    Full Text Available BACKGROUND: The allergenicity of Ricinus communis L. (castor bean, Euphorbiaceae is associated with components of its seeds and pollen. Castor bean allergy has been described not only in laboratory workers, but also in personnel working in oil processing mills, fertilizer retail, the upholstery industry and other industrial fields. In the present study, we describe the critical amino acids in the IgE-binding epitopes in Ric c 1 and Ric c 3, two major allergens of R. communis. In addition, we also investigate the cross-reactivity between castor bean and some air and food allergen extracts commonly used in allergy diagnosis. METHODOLOGY/PRINCIPAL FINDINGS: The IgE reactivity of human sera from atopic patients was screened by immune-dot blot against castor bean allergens. Allergenic activity was evaluated in vitro using a rat mast cell activation assay and by ELISA. Cross-reactivity was observed between castor bean allergens and extracts from shrimp, fish, gluten, wheat, soybean, peanut, corn, house dust, tobacco and airborne fungal allergens. We observed that treatment of rat and human sera (from atopic patients with glutamic acid reduced the IgE-epitope interaction. CONCLUSIONS/SIGNIFICANCE: The identification of glutamic acid residues with critical roles in IgE-binding to Ric c 3 and Ric c 1 support the potential use of free amino acids in allergy treatment.

  17. Surface Coating Studies of Polyurethane Derived from [(Alkyd-(Epoxy Resin Treated Castor Oil] Using Isophorene Diisocynate - II

    Directory of Open Access Journals (Sweden)

    Dinesh. P. Patel

    2012-07-01

    Full Text Available Castor oil (C was reacted with profitable epoxy resin (E (diglycidylether of bisphenol-A, DGEBF at a range of mole ratios. The consequential products (Castor oil- Epoxy resin were nominated as CEs. Isocyanate terminated castor oil Polyurethane (ICOPU was prepared by reaction of castor oil and various proportion of Isophoren diisocyanate. A commercial alkyd resin was blended with various proportions of CEs and ICOPU. A unique solvent system, which shows a one – phase clear solution and a clear coat of binder system, was used. All the blends were applied on mild steel panels and characterized for drying time, adhesion, flexibility, hardness, impact resistance and chemical resistance properties.

  18. Antifungal and Herbicidal Effects of Fruit Essential Oils of Four Myrtus communis Genotypes.

    Science.gov (United States)

    Kordali, Saban; Usanmaz, Ayse; Cakir, Ahmet; Komaki, Amanmohammad; Ercisli, Sezai

    2016-01-01

    The chemical composition of the essential oils isolated by hydrodistillation from the fruits of four selected Myrtus communis L. genotypes from Turkey was characterized by GC-FID and GC/MS analyses. 1,8-Cineole (29.20-31.40%), linalool (15.67-19.13%), α-terpineol (8.40-18.43%), α-pinene (6.04-20.71%), and geranyl acetate (3.98-7.54%) were found to be the major constituents of the fruit essential oils of all M. communis genotypes investigated. The oils were characterized by high amounts of oxygenated monoterpenes, representing 73.02-83.83% of the total oil compositions. The results of the fungal growth inhibition assays showed that the oils inhibited the growth of 19 phytopathogenic fungi. However, their antifungal activity was generally lower than that of the commercial pesticide benomyl. The herbicidal effects of the oils on the seed germination and seedling growth of Amaranthus retroflexus L., Chenopodium album L., Cirsium arvense (L.) Scop., Lactuca serriola L., and Rumex crispus L. were also determined. The oils completely or partly inhibited the seed germinations and seedling growths of the plants. The findings of the present study suggest that the M. communis essential oils might have potential to be used as natural herbicides as well as fungicides. PMID:26765354

  19. Viability Prediction of Ricinus cummunis L. Seeds Using Multispectral Imaging

    DEFF Research Database (Denmark)

    Olesen, Merete Halkjær; Nikneshan, Pejman; Shrestha, Santosh; Tadayyon, Ali; Deleuran, Lise Christina; Boelt, Birte; Gislum, René

    2015-01-01

    The purpose of this study was to highlight the use of multispectral imaging in seed quality testing of castor seeds. Visually, 120 seeds were divided into three classes: yellow, grey and black seeds. Thereafter, images at 19 different wavelengths ranging from 375–970 nm were captured of all the...... seeds. Mean intensity for each single seed was extracted from the images, and a significant difference between the three colour classes was observed, with the best separation in the near-infrared wavelengths. A specified feature (RegionMSI mean) based on normalized canonical discriminant analysis, were......-germinated seeds. This validation of the model resulted in 96% correct classification of the seeds. The results illustrate how multispectral imaging technology can be employed for prediction of viable castor seeds, based on seed coat colour....

  20. Development and Leaf Consumption by Spodoptera cosmioides (Walker) (Lepidoptera: Noctuidae) Reared on Leaves of Agroenergy Crops.

    Science.gov (United States)

    Cabezas, M F; Nava, D E; Geissler, L O; Melo, M; Garcia, M S; Krüger, R

    2013-12-01

    Spodoptera cosmioides (Walker) (Lepidoptera: Noctuidae) is a polyphagous pest that threatens more than 24 species of crop plants including those used for biodiesel production such as Ricinus communis (castor bean), Jatropha curcas (Barbados nut), and Aleurites fordii (tung oil tree). The development and leaf consumption by S. cosmioides reared on leaves of these three species were studied under controlled laboratory conditions. The egg-to-adult development time of S. cosmioides was shortest when reared on castor bean leaves and longest when reared on tung oil tree leaves. Larvae reared on castor bean and Barbados nut leaves had seven instars, whereas those reared on tung oil tree leaves had eight. Females originating from larvae reared on castor bean and Barbados nut leaves showed greater fecundity than did females originating from larvae reared on tung oil tree leaves. Insects fed on castor bean leaves had shorter life spans than those fed on tung oil tree and Barbados nut leaves although the oviposition period did not differ significantly. The intrinsic and finite rates of increase were highest for females reared on castor bean leaves. Total leaf consumption was highest for larvae reared on tung oil tree leaves and lowest for those reared on Barbados nut leaves. We conclude that castor bean is a more appropriate host plant for the development of S. cosmioides than are Barbados nut and tung oil tree. PMID:27193276

  1. Effects of Process Parameters on the Yield of oil from Castor Seed

    Directory of Open Access Journals (Sweden)

    Mbah, G.O

    2016-08-01

    Full Text Available The physicochemical properties of castor seed oil were evaluated in this work using standard analytical technique. The results showed the percentage (% moisture, crude lipid, crude protein, ash and carbohydrate contents of the castor seed as 0.700, 48.800, 7.200, 10.600, 31.615 respectively. The oil from the castor seed was odourless and yellowish at room temperature (30℃. The treatment combinations used (leaching time, leaching temperature and solvent: solute ratio showed significant differences (p< 0.05 in yield of castor oil seed flour with % oil yield of 35.52 – 53.90%. Lipid indices of the castor seed oil indicated the acid value (AV as 1.100mg NaOH/g of oil, free fatty acid (FFA as 0.550%, saponification value (SV as 188.300mgkOH/g of oil, iodine value (IV as 74.700I2/g of oil, peroxide value as 1.500ml/g of oil, and viscosity as 0.008. A standard statistical package Minitab version 16.0 program was used in the regression analysis and analysis of variance (ANOVA. The statistical software mentioned above was also used to generate various plots such as single effect, interaction plot, contour plot and 3D surface plot. The response or yield of oil extracted from castor flour was used to develop a mathematical model that correlates the yield of oil. The optimum condition obtained to give the highest yield of castor oil extraction are leaching time of 2hrs, leaching temperature of 50℃ and solute: solvent ratio of 0.05g/ml.

  2. IrFC - An Ixodes ricinus injury-responsive molecule related to Limulus Factor C

    Czech Academy of Sciences Publication Activity Database

    Urbanová, Veronika; Hartmann, David; Grunclová, Lenka; Šíma, Radek; Flemming, Tina; Hajdušek, Ondřej; Kopáček, Petr

    2014-01-01

    Roč. 46, č. 2 (2014), s. 439-447. ISSN 0145-305X R&D Projects: GA ČR GAP506/10/2136; GA ČR GP13-27630P; GA ČR GP13-12816P; GA MŠk(CZ) EE2.3.30.0032 Institutional support: RVO:60077344 Keywords : Complement * Innate immunity * Limulus Clotting Factor C * Phagocytosis * RNA interference * Tick Ixodes ricinus Subject RIV: EC - Immunology Impact factor: 2.815, year: 2014

  3. Développement de Borrelia burgdorferi dans la tique Ixodes ricinus

    OpenAIRE

    Gern, Lise; Z. Zhu; Aeschlimann, André

    2011-01-01

    Nous avons étudié le développement de Borrelia burgdorferi dans son vecteur européen, la tique Ixodes ricinus, lors du repas sanguin. Nos résultats montrent que durant la phase de gorgement lente, les spirochètes présents dans l'intestin se multiplient. Chez certains individus, quelques spirochètes traversent la paroi intestinale et produisent une infection systémique de la tique. La présence de borrélies dans les conduits des glandes salivaires semblent prouver leur transmission via la saliv...

  4. Driving forces for changes in geographical distribution of Ixodes ricinus ticks in Europe

    DEFF Research Database (Denmark)

    Medlock, Jolyon M.; Hansford, Kayleigh M.; Bormane, Antra;

    2013-01-01

    Many factors are involved in determining the latitudinal and altitudinal spread of the important tick vector Ixodes ricinus (Acari: Ixodidae) in Europe, as well as in changes in the distribution within its prior endemic zones. This paper builds on published literature and unpublished expert opinion......, anthropogenically induced changes. These factors are strongly interlinked and often not well quantified. Although a change in climate plays an important role in certain geographic regions, for much of Europe it is non-climatic factors that are becoming increasingly important. How we manage habitats on a landscape...

  5. Functional characterization of two defensin isoforms of the hard tick Ixodes ricinus

    Czech Academy of Sciences Publication Activity Database

    Chrudimská, Tereza; Slaninová, Jiřina; Rudenko, Natalia; Růžek, Daniel; Grubhoffer, Libor

    2011-01-01

    Roč. 4, č. 1 (2011), e63. ISSN 1756-3305 R&D Projects: GA MŠk(CZ) LC06009; GA ČR GA206/09/1782; GA ČR GD206/09/H026; GA ČR(CZ) GAP302/11/1901 Institutional research plan: CEZ:AV0Z60220518; CEZ:AV0Z40550506 Keywords : defensin * antimicrobial compounds * Ixodes ricinus Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.937, year: 2011

  6. Soil amendment with chopped or ground dry leaves of six species of plants for the control of Meloidogyne javanica in tomato under greenhouse conditions Incorporação ao solo de folhas secas picadas ou moídas de seis espécies de plantas para o controle de Meloidogyne javanica em tomateiro em casa de vegetação

    OpenAIRE

    Everaldo Antônio Lopes; Silamar Ferraz; Paulo Afonso Ferreira; Leandro Grassi de Freitas; Rosangela Dallemole-Giaretta

    2011-01-01

    Greenhouse experiments were conducted to evaluate the effect of soil amendment with chopped (1cm²) or ground (1mm sieve) dry leaves of assa-peixe (Vernonia polyanthes), lemon-grass (Cymbopogon citratus), eucalyptus (Eucalyptus citriodora), castor (Ricinus communis), mango (Mangifera indica) or neem (Azadirachta indica) for the control Meloidogyne javanica. Into the soil (Yellow red oxisol) of each pot were added leaves (5g kg-1 of soil) and 5,000 eggs of the nematode. After seven days, one to...

  7. Attributes of the soil fertilized with sewage sludge and calcium and magnesium silicate

    OpenAIRE

    Geraldo R. Zuba Junio; Regynaldo A. Sampaio; Altina L. Nascimento; Luiz A. Fernandes; Natália N. de Lima; João P. Carneiro

    2015-01-01

    ABSTRACTThis study aimed to evaluate the chemical attributes of an Inceptisol cultivated with castor bean (Ricinus communis L.), variety ‘BRS Energia’, fertilized with sewage sludge compost and calcium (Ca) and magnesium (Mg) silicate. The experiment was conducted at the ICA/UFMG, in a randomized block design, using a 2 x 4 factorial scheme with three replicates, and the treatments consisted of two doses of Ca-Mg silicate (0 and 1 t ha-1) and four doses of sewage sludge compost (0, 23.81, 47....

  8. The Need for Continued Development of Ricin Countermeasures

    Directory of Open Access Journals (Sweden)

    Ronald B. Reisler

    2012-01-01

    Full Text Available Ricin toxin, an extremely potent and heat-stable toxin produced from the bean of the ubiquitous Ricinus communis (castor bean plant, has been categorized by the US Centers for Disease Control and Prevention (CDC as a category B biothreat agent that is moderately easy to disseminate. Ricin has the potential to be used as an agent of biological warfare and bioterrorism. Therefore, there is a critical need for continued development of ricin countermeasures. A safe and effective prophylactic vaccine against ricin that was FDA approved for “at risk” individuals would be an important first step in assuring the availability of medical countermeasures against ricin.

  9. Kombinasi Minyak Jagung (Oleum Maydis) Dan Minyak Jarak (Oleum Ricini) Sebagai Bahan Dasar Lipstik

    OpenAIRE

    Suriawati

    2015-01-01

    Seed Corn oil (Oleum maydis) was oil that obtained by extracting the corn seed. Corn oil was rich of colories, which was about 250 calories/100 grams, was a stable oil (resistant to rancidity) because of α-tocopherols are dissolved in oil, other than that corn oil contains essential fatty acids (Omega 3 and Omega 6), and vitamin E. Castor oil was a fatty oil that obtained from cold-pressed pleed seed of Ricinus communis L. Having a very high viscosity, it can delay the insoluble pigment m...

  10. Gravitropism in higher plant shoots. I - A role for ethylene

    Science.gov (United States)

    Wheeler, Raymond M.; Salisbury, Frank B.

    1981-01-01

    Two inhibitors of ethylene synthesis, Co(2+) and aminoethoxyvinylglycine (AVG), and two inhibitors of ethylene action, Ag(+) and CO2, are shown to delay the gravitropic response of cocklebur (Xanthium strumarium L.), tomato (Lycopersicon esculentum Mill.), and castor bean (Ricinus communis L.) stems. Gentle shaking on a mechanical shaker does not inhibit the gravitropic response, but vigorous hand shaking for 120 seconds delays the response somewhat. AVG and Ag(+) further delay the response of mechanically stimulated plants. AVG retards the storage of bending energy but not of stimulus. In gravitropism, graviperception may first stimulate ethylene evolution, which may then influence bending directly, or responses involving ethylene could be more indirect.

  11. Identification of diacylglycerol and triacylglycerols containing 11,12,13-trihydroxy-9,14-octadecadienoic acid in castor oil by mass spectrometry

    Science.gov (United States)

    Castor oil has many industrial uses. Molecular species of acylglycerols containing monohydroxy, dihydroxy and trihydroxy fatty acids in castor oil have been reported. The identification of acylglycerols containing a triOH18:2 fatty acid in castor oil is reported here. The structure of this novel fat...

  12. Contrasting patterns of genetic divergence in two sympatric pseudo-metallophytes: Rumex acetosa L. and Commelina communis L.

    Directory of Open Access Journals (Sweden)

    Ye M

    2012-06-01

    Full Text Available Abstract Background Patterns of genetic divergence between populations of facultative metallophytes have been investigated extensively. However, most previous investigations have focused on a single plant species making it unclear if genetic divergence shows common patterns or, conversely, is species-specific. The herbs Rumex acetosa L. and Commelina communis L. are two pseudo-metallophytes thriving in both normal and cupriferous soils along the middle and lower reaches of the Yangtze River in China. Their non-metallicolous and metallicolous populations are often sympatric thus providing an ideal opportunity for comparative estimation of genetic structures and divergence under the selective pressure derived from copper toxicity. Results In the present study, patterns of genetic divergence of R. acetosa and C. communis , including metal tolerance, genetic structure and genetic relationships between populations, were investigated and compared using hydroponic experiments, AFLP, ISSR and chloroplast genetic markers. Our results show a significant reduction in genetic diversity in metallicolous populations of C. communis but not in R. acetosa . Moreover, genetic differentiation is less in R. acetosa than in C. communis , the latter species also shows a clustering of its metallicolous populations. Conclusions We propose that the genetic divergences apparent in R. acetosa and C. communis , and the contrasting responses of the two species to copper contamination, might be attributed to the differences in their intrinsic physiological and ecological properties. No simple and generalised conclusions on genetic divergence in pseudo-metallophytes can thus be drawn.

  13. The castor oil production in Brazil and the biodiesel program (Probiodiesel); A producao de mamona no Brasil e o Probiodiesel

    Energy Technology Data Exchange (ETDEWEB)

    Almeida, Cezar Menezes; Almeida Neto, Jose Adolfo de; Pires, Monica de Moura [Universidade Estadual de Santa Cruz, Ilheus, BA (Brazil). Grupo Bioenergia e Meio Ambiente]. E-mails: biocomb@uesc.br; Rocha, Pauletti Karllien [Secretaria de Ciencia, Tecnologia e Inovacao do Estado da Bahia (SECTI), Salvador, BA (Brazil)]. E-mail: pauletti@secti.ba.gov.br

    2004-07-01

    The objective of this work is to present a prospective study of the national production of biodiesel and castor oil and to determine the level of the public investment necessary to attain the proposed production. For replacement of 2% of the diesel internal consumption, 786 millions of liters of biodiesel will be necessary, based on the consumption of 2003. From this amount 293 millions of liters (40%) will be derived from the castor oil. Considering the castor oil agricultural productivity of 1.8 t/ha and the 45% industrial income in oil, it will be necessary the planting of 360.000 ha and investment amount of R$ 370 million. An idleness of 71% of the castor oil crushing industry has been detected, but this sector works with profit as function of castor oil price. An deficit of 55% between the castor oil planting area and the necessary one for biodiesel production was identified, considering that all the castor oil will be exclusively used for this purpose. With the proposed goals and without the necessary allocation of public resources for castor oil production, probably it will not be possible to expect that 1/5 of the biodiesel national production can come from the domestic agricultural planting.

  14. Streamlining CASTOR to manage the LHC data torrent

    International Nuclear Information System (INIS)

    This contribution describes the evolution of the main CERN storage system, CASTOR, as it manages the bulk data stream of the LHC and other CERN experiments, achieving over 90 PB of stored data by the end of LHC Run 1. This evolution was marked by the introduction of policies to optimize the tape sub-system throughput, going towards a cold storage system where data placement is managed by the experiments' production managers. More efficient tape migrations and recalls have been implemented and deployed where bulk meta-data operations greatly reduce the overhead due to small files. A repack facility is now integrated in the system and it has been enhanced in order to automate the repacking of several tens of petabytes, required in 2014 in order to prepare for the next LHC run. Finally the scheduling system has been evolved to integrate the internal monitoring. To efficiently manage the service a solid monitoring infrastructure is required, able to analyze the logs produced by the different components (about 1 kHz of log messages). A new system has been developed and deployed, which uses a transport messaging layer provided by the CERN-IT Agile Infrastructure and exploits technologies including Hadoop and HBase. This enables efficient data mining by making use of MapReduce techniques, and real-time data aggregation and visualization. The outlook for the future is also presented. Directions and possible evolution will be discussed in view of the restart of data taking activities.

  15. Streamlining CASTOR to manage the LHC data torrent

    Science.gov (United States)

    Lo Presti, G.; Espinal Curull, X.; Cano, E.; Fiorini, B.; Ieri, A.; Murray, S.; Ponce, S.; Sindrilaru, E.

    2014-06-01

    This contribution describes the evolution of the main CERN storage system, CASTOR, as it manages the bulk data stream of the LHC and other CERN experiments, achieving over 90 PB of stored data by the end of LHC Run 1. This evolution was marked by the introduction of policies to optimize the tape sub-system throughput, going towards a cold storage system where data placement is managed by the experiments' production managers. More efficient tape migrations and recalls have been implemented and deployed where bulk meta-data operations greatly reduce the overhead due to small files. A repack facility is now integrated in the system and it has been enhanced in order to automate the repacking of several tens of petabytes, required in 2014 in order to prepare for the next LHC run. Finally the scheduling system has been evolved to integrate the internal monitoring. To efficiently manage the service a solid monitoring infrastructure is required, able to analyze the logs produced by the different components (about 1 kHz of log messages). A new system has been developed and deployed, which uses a transport messaging layer provided by the CERN-IT Agile Infrastructure and exploits technologies including Hadoop and HBase. This enables efficient data mining by making use of MapReduce techniques, and real-time data aggregation and visualization. The outlook for the future is also presented. Directions and possible evolution will be discussed in view of the restart of data taking activities.

  16. Crystallization and diffraction analysis of the serpin IRS-2 from the hard tick Ixodes ricinus

    International Nuclear Information System (INIS)

    Cleavage of the serpin IRS-2 from the hard tick I. ricinus by contaminating proteolytic activity mimicked the specific processing of the serpin by its target protease and resulted in a more stable form of the serpin which produced crystals that diffracted to 1.8 Å resolution. IRS-2 from the hard tick Ixodes ricinus belongs to the serpin family of protease inhibitors. It is produced in the salivary glands of the tick and its anti-inflammatory activity suggests that it plays a role in parasite–host interaction. Recombinant IRS-2 prepared by heterologous expression in a bacterial system was crystallized using the hanging-drop vapour-diffusion method. The crystals belonged to the primitive tetragonal space group P43 and diffracted to 1.8 Å resolution. Mass-spectrometric and electrophoretic analyses revealed that IRS-2 was cleaved by contaminating proteases during crystallization. This processing of IRS-2 mimicked the specific cleavage of the serpin by its target protease and resulted in a more stable form (the so-called relaxed conformation), which produced well diffracting crystals. Activity profiling with specific substrates and inhibitors demonstrated traces of serine and cysteine proteases in the protein stock solution

  17. Exon variability of gene encoding glycerol-3-phosphate dehydrogenase of Ixodes ricinus ticks*

    Directory of Open Access Journals (Sweden)

    Radulović Ž.

    2010-12-01

    Full Text Available We have previously found apparent differences in Gpdh allele frequences between borrelia infected and uninfected Ixodes ricinus as revealed by native gel electrophoresis of allozyme polymorphisms. The present study deals with the genetic basis of the observed allozyme polymorphism. Multiple sequence alignment of 36 Gpdh open reading frames identified a total of 40 polymorphic nucleotide sites. Of the 40 polymorphic nucleotide sites, 34 were silent (did not result in amino acid residue change, while six were active causing a change in the amino acid chain. All polymorphic amino acid sites were situated within the N-terminal NAD-binding domain, whereas the C-terminal substrate-binding domain was highly conserved. Analysis of the obtained Gpdh sequences and GPDH allozyme polymorphisms for individual ticks pointed to amino acid changes at positions 61 (glycine-to-glutamic acid, 64 (serineto- cysteine and 102 (glycine-to-arginine as a key for differential mobility of GPDH allozymes in an electric field. Our findings are discussed in the context of the molecular basis of I. ricinus host finding behavior.

  18. Fourier transform infrared spectroscopy of DNA from Borrelia burgdorferi sensu lato and Ixodes ricinus ticks

    Science.gov (United States)

    Muntean, Cristina M.; Stefan, Razvan; Bindea, Maria; Cozma, Vasile

    2013-06-01

    In this work we present a method for detection of motile and immotile Borrelia burgdorferi genomic DNA, in relation with infectious and noninfectious spirochetes. An FT-IR study of DNA isolated from B. burgdorferi sensu lato strains and from positive and negative Ixodes ricinus ticks, respectively, is reported. Motile bacterial cells from the species B. burgdorferi sensu stricto, Borrelia garinii and Borrelia afzelii were of interest. Also, FT-IR absorbance spectra of DNA from immotile spirochetes of B. burgdorferi sensu stricto, in the absence and presence of different antibiotics (doxycycline, erythromycin, gentamicin, penicillin V or phenoxymethylpenicillin, tetracycline, respectively) were investigated. FT-IR spectra, providing a high molecular structural information, have been analyzed in the wavenumber range 400-1800 cm-1. FT-IR signatures, spectroscopic band assignments and structural interpretations of these DNAs are reported. Spectral differences between FT-IR absorbances of DNAs from motile bacterial cells and immotile spirochetes, respectively, have been found. Particularly, alterations of the sugar-phosphate B-form chain in the case of DNA from Borrelia immotile cells, as compared with DNA from B. burgdorferi sensu lato motile cells have been observed. Based on this work, specific B. burgdorferi sensu lato and I. ricinus DNA-ligand interactions, respectively, might be further investigated using Fourier transform infrared spectroscopy.

  19. Histomorphological evaluation of Compound bone of Granulated Ricinus in bone regeneration in rabbits

    International Nuclear Information System (INIS)

    Histological evaluation is an effective method in the behavioral description of the qualitative and quantitative implanted materials. The research validated the performance of Compound bone of Granulated Ricinus on bone regeneration with the histomorphological analysis results. Were selected 30 rabbits, females, divided into 3 groups of 10 animals (G1, G2, G3) with a postoperative time of 45, 70 and 120 days respectively. Each animal is undergone 2 bone lesions in the ilium, one implemented in the material: Compound bone of Granulated Ricinus and the other for control. After the euthanasia, the iliac bone was removed, identified and subjected to histological procedure. The evaluation histological, histomorphological results were interpreted and described by quantitative and qualitative analysis based facts verified in the three experimental groups evaluating the rate of absorption of the material in the tissue regeneration, based on the neo-bone formation. The histomorphologic results classified as a material biocompatible and biologically active. Action in regeneration by bone resorption occurs slowly and gradually. Knowing the time and rate of absorption and neo-formation bone biomaterial, which can be determined in the bone segment applicable in the clinical surgical area.

  20. Exploring Diversity among Norwegian Borrelia Strains Originating from Ixodes ricinus Ticks

    Directory of Open Access Journals (Sweden)

    Ann-Kristin Tveten

    2014-01-01

    Full Text Available Characterisation of Borrelia strains from Ixodes ricinus ticks is important in the epidemiological surveillance of vector-borne pathogens. Multilocus sequences analysis (MLSA is a molecular genotyping tool with high discriminatory power that has been applied in evolutionary studies and for the characterisation of Borrelia genospecies. MLSA was used to study genetic variations in Borrelia strains isolated from I. ricinus ticks collected from the woodlands in Skodje. The results demonstrate that the 50 Borrelia strains were separated into 36 sequence types (STs that were not previously represented in the MLST database. A distance matrix neighbour-joining tree (bootstrapped 500 iterations showed four deeply branched clusters, and each deeply branched cluster represented one Borrelia genospecies. The mean pairwise genetic differences confirm the genospecies clustering. The combination of alleles separates the Borrelia strains from northwest Norway from the strains in the MLST database, thus identifying new STs. Although a highly divergent B. afzelii population could be expected, the heterogeneity among the B. garinii strains is more unusual. The present study indicates that the circulation of strains between migrating birds and stationary birds in this coastal region may play a role in the evolution of B. garinii strains.

  1. Identification of Borrelia burgdorferi genospecies isolated from Ixodes ricinus ticks in the South Moravian region of the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Bonczek, Ondřej; Žákovská, A.; Vargová, L.; Šerý, Omar

    2015-01-01

    Roč. 22, č. 4 (2015), s. 642-646. ISSN 1232-1966 Institutional support: RVO:67985904 Keywords : Borrelia burgdorferi s. I. * Borrelia spielmanii * Ixodes ricinus Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.126, year: 2014

  2. Functional analysis of fibrinogen-related proteins (FREPs, Ixoderins) of the tick Ixodes ricinus and their function in pathogen transmission

    OpenAIRE

    MONDEKOVÁ, Helena

    2015-01-01

    This study is focused on characterization of fibrinogen-related proteins (FREPs) from the tick Ixodes ricinus using molecular methods - PCR, cloning, qRT-PCR, RNA interference via dsRNA synthesis and injection, and also pathogen (Borrelia sp.) transmission on animal model.

  3. Study of the effect of \\kur{Borrelia burgdorferi} infection on the behaviour of Ixodes ricinus tick

    OpenAIRE

    HUSPEKOVÁ, Helena

    2014-01-01

    The main goal of this master thesis was to determine whether or not is the infection with Borrelia burgdorferi sensu lato responsible for changes in Ixodes ricinus tick behaviour. We tried to investigate if B. burgdorferi infection changes the time required for blood feeding, tick activity, phototaxis and amount of blood which is engorged by the tick.

  4. First evidence of Babesia venatorum and Babesia capreoli in questing Ixodes ricinus ticks in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Venclíková, Kristýna; Mendel, Jan; Betášová, Lenka; Hubálek, Zdeněk; Rudolf, Ivo

    2015-01-01

    Roč. 22, č. 2 (2015), s. 212-214. ISSN 1232-1966 EU Projects: European Commission(XE) 261504 - EDENEXT Institutional support: RVO:68081766 Keywords : Babesia sp. EU1 * Babesia venatorum * Babesia capreoli * Ixodes ricinus * ixodid ticks Subject RIV: EE - Microbiology, Virology Impact factor: 1.126, year: 2014

  5. Variations in Ixodes ricinus Density and Borrelia Infections Associated with Cattle Introduced into a Woodland in The Netherlands

    NARCIS (Netherlands)

    Gassner, F.; Verbaarschot, P.G.H.; Smallegange, R.C.; Spitzen, J.; Wieren, van S.E.; Takken, W.

    2008-01-01

    The effect of introduced large herbivores on the abundance of Ixodes ricinus ticks and their Borrelia infections was studied in a natural woodland in The Netherlands. Oak and pine plots, either ungrazed or grazed by cattle, were selected. Ticks were collected weekly by blanket dragging. Borrelia inf

  6. Rodent species as natural reservoirs of Borrelia burgdorferi sensu lato in different habitats of Ixodes ricinus in The Netherlands

    NARCIS (Netherlands)

    Gassner, F.; Takken, W.; Plas, C.; Kastelein, P.; Hoetmer, A.J.; Holdinga, M.; Overbeek, van L.S.

    2013-01-01

    Rodents are natural reservoirs for human pathogenic spirochaetes of the Borrelia burgdorferi complex [B. burgdorferi sensu lato (s.l.)], and the pathogens are transmitted by Ixodes ricinus ticks to humans in The Netherlands. B. burgdorferi s.l. infection prevalence in questing ticks, rodents, and ti

  7. ´Candidatus Midichloria mitochondrii´, an endosymbiont of the tick Ixodes ricinus with a unique intramitochondrial lifestyle

    Czech Academy of Sciences Publication Activity Database

    Sassera, D.; Beninati, T.; Bandi, C.; Bouman, Edwin Arien Poul; Sacchi, L.; Fabbi, M.; Lo, N.

    2006-01-01

    Roč. 56, č. 11 (2006), s. 2535-2540. ISSN 1466-5026 R&D Projects: GA ČR GA206/04/0751 Institutional research plan: CEZ:AV0Z60220518 Keywords : Ixodes ricinus * endosymbiont * intramitochondrial Subject RIV: EH - Ecology, Behaviour Impact factor: 2.662, year: 2006

  8. Impact of an exploding LPG rail tank car onto a CASTOR spent fuel cask

    International Nuclear Information System (INIS)

    On 27 April 1999 a fire test was performed with a 45 m3 rail tank car partially filled with 10 m3 pressurised liquid propane. A CASTOR THTR/AVR spent fuel transport cask was positioned beside the propane tank as to suffer maximum damage from any explosion. About 17 min after fire ignition the propane tank ruptured. This resulted in a BLEVE with an expanding fireball, heat radiation, explosion overpressure, and tank fragments projected towards the cask. This imposed severe mechanical and thermal impacts directly onto the CASTOR cask, moving it 17 m from its original position. This involved rotation of the cask with the lid end travelling 10 m before it crashed into the ground. Post-test investigations of the CASTOR cask demonstrated that no loss of leaktightness or containment and shielding integrity occurred. (author)

  9. Study on Emission and Performance of Diesel Engine Using Castor Biodiesel

    Directory of Open Access Journals (Sweden)

    Md. Saiful Islam

    2014-01-01

    performance of diesel engine using the castor biodiesel and its blend with diesel from 0% to 40% by volume. The acid-based catalyzed transesterification system was used to produce castor biodiesel and the highest yield of 82.5% was obtained under the optimized condition. The FTIR spectrum of castor biodiesel indicates the presence of C=O and C–O functional groups, which is due to the ester compound in biodiesel. The smoke emission test revealed that B40 (biodiesel blend with 40% biodiesel and 60% diesel had the least black smoke compared to the conventional diesel. Diesel engine performance test indicated that the specific fuel consumption of biodiesel blend was increased sufficiently when the blending ratio was optimized. Thus, the reduction in exhaust emissions and reduction in brake-specific fuel consumption made the blends of caster seed oil (B20 a suitable alternative fuel for diesel and could help in controlling air pollution.

  10. Production of Castor Culture in Depending to Fertilization With Bed Chicken

    Directory of Open Access Journals (Sweden)

    Maria Ednalva Cavalcanti de Oliveira

    2010-04-01

    Full Text Available Fertilization of crops with organic products, where the content organic matter in soil is low, it is viable alternatives for increasing crop productivity and improvement of the physical, chemical and biological conditions of soil. The experiment was conducted in a randomized block design with five treatments (0, 3, 6, 9, 12 and 15 t / ha of chicken bed and four replications. The chicken bed had a positive influence on the length of the bunch of castor, the number of fruit per bunch, the average weight of bunch, the 100 grain weight and grain yield. The highest yield of castor was 1131 kg ha-1, obtained with 11,53 t ha-1 of cattle manure. Addition of 11,53 t ha-1 of cattle manure increased the grain yield of castor at 580 kg ha-1, equivalent to 51,28% more.

  11. STUDY ON CASTOR OIL POLYURETHANE/POLY (METHYL METHACRYLATE) AB CROSSLINKED POLYMERS

    Institute of Scientific and Technical Information of China (English)

    DU Ying; HAN Xiaozu; LIU Wenzhong

    1991-01-01

    Castor oil polyurethane/poly(methyl methacrylate) AB crosslinked polymers (ABCP) were synthesized by free radical copolymerization of MMA and vinyl-terminated castor oil polyurethane which was obtained from isocyanate-terminated castor oil polyurethane and hydroxyethyl methacrylate.The mechanical properties, transition and relaxation, as well as compatibility and morphology of the ABCP were investigated by changing the component. The results show that the ABCP is a semicompatible system and the compatibility of the two components decreases with increasing content of the hard segment. The mechanical and damping properties of the ABCP are obviously superior to that of their homopolymers. The damping value is mainly controlled by crosslink density of the ABCP but the Tg value by component.

  12. Small x physics and multiple interactions with the forward calorimeter Castor in the CMS experiment

    Energy Technology Data Exchange (ETDEWEB)

    Knutsson, Albert; Behrens, Ulf; Borras, Kerstin; Campbell, Alan; Goettlicher, Peter; Jung, Hannes; Katkov, Igor; Rurikova, Zuzana [Deutsches Elektronen-Synchrotron, Hamburg (Germany)

    2008-07-01

    The Large Hadron Collider at CERN will give excellent possibilities to improve our understanding of QCD phenomena. The presentation concentrates on small x physics expected to be accessible with the forward calorimeter CASTOR in the CMS experiment. Studies of forward jet production, as well as studies on multiple interactions will be presented. This physics is studied in order to understand the dynamics of the strong force. The gained knowledge can be used to reduce the QCD background and to minimize uncertainties in more discovery oriented measurements. In the study of forward jets, sensitivity to parton dynamics beyond DGLAP are seen for 3-jet events with a forward jet in the CASTOR region and a di-jet pair in the main CMS detector. In the multiple interaction study it is shown that different scenarios can be distinguished by looking at the long range correlation between the energy deposit in CASTOR and the particle multiplicity in the main detector.

  13. Thermophysical properties of biodiesel and related systems: (Liquid + liquid) equilibrium data for castor oil biodiesel

    International Nuclear Information System (INIS)

    Highlights: ► (Liquid + liquid) equilibrium data for multicomponent castor oil FAME and FAEE castor oil. ► Tie-lines and solubility curves (binodal) by cloud-point method for FAME and FAEE systems. ► Experimental data correlated using the UNIQUAC model. -- Abstract: This work reports new liquid–liquid solubility values (binodal curves) as well as (liquid + liquid) equilibrium data for, ternary and quaternary systems containing fatty acid methyl esters (FAME) and fatty acid ethyl esters (FAEE) from castor oil, water, glycerol, methanol and anhydrous ethanol at T = (303.15, 318.15, and 333.15) K. Solubility curves (binodal) were also obtained by the cloud-point method for binary systems containing FAME, FAEE, water, or glycerol. All results obtained can be considered of good quality. The experimental values were correlated using the UNIQUAC model, whose results presented good performance and satisfactory fitting of equilibrium values

  14. Castor oil biodiesel: an economic evaluation; Biodiesel de mamona: uma avaliacao economica

    Energy Technology Data Exchange (ETDEWEB)

    Pires, Monica de Moura; Alves, Jaenes Miranda; Almeida Neto, Jose Adolfo de; Almeida, Cezar Menezes; Sousa, Geovania Silva de; Cruz, Rosenira Serpa da; Monteiro, Renata; Lopes, Beatriz Sampaio; Robra, Sabine [Universidade Estadual de Santa Cruz, Ilheus, BA (Brazil). Grupo Bioenergia e Meio Ambiente]. E-mails: mpires@uesc.br; jaenes@uesc.br; jalmeida@uesc.br; roserpa@uesc.br

    2004-07-01

    The production cost of castor oil biodiesel by methyl way and its economic viability, using as reference the production cost data of castor oil and the implantation of the pilot plant at UESC - state university of Santa Cruz, Bahia State, Brazil was determined. From this information, it was seen that the estimated price of castor oil biodiesel is close to the diesel price in the Itabuna market, Bahia state, Brazil. The indicators show economic viability of the mini-power plant installation. Such information are preliminary estimative for the market and can be modified as function of changes in the main factors used to have the production costs, as well as the sectorial policies that drives the activity as much in levels of raw material production as in biodiesel.

  15. Use of castor oil-based polyurethane adhesive in the production of glued laminated timber beams

    Directory of Open Access Journals (Sweden)

    Maximiliano dos Anjos Azambuja

    2006-09-01

    Full Text Available Researchers from the Polymer Technology and Analytical Chemistry (LQATP group at the São Carlos Institute of Chemistry, University of São Paulo, developed a polyurethane adhesive based on castor oil. In addition to deriving it from a renewable source, this adhesive is nonaggressive to humans and the environment. The purpose of this study is to investigate the feasible use of polyurethane adhesive based on castor oil in the production of 12 beams of Glulam, using the species Pinus caribea hondurensis and Eucaliptus grandis. The structural performance of the beams of Glulam was evaluated through static bending tests. The results obtained enabled to conclude good efficiency of the polyurethane adhesive based on castor oil, for use in Glulam.

  16. Measurements of essential oil extract and antioxidant in Syrian Myrtus communis L. leaves using photo chemiluminescence assay

    International Nuclear Information System (INIS)

    The essential oil extracts and antioxidant measurements of Syrian Myrtus communis L. leaves as hydrophilic and hydrophobic existence species have been carried out. The plant leaves as a source of antioxidants was tested by the influence of its aqueous and essential oil extracts on the yield of photo chemiluminescence, PCL solution applying very sensitive and reliable method. By means of a photo chemiluminescence assay, it was possible to assess the total antioxidants capacity of hydrophilic and hydrophobic species existence in Syrian Myrtus communis L. leaves. It has been found that, the integral antioxidant capacity measurements value of Syrian Myrtus communis L. leaves was found in Kurdaha site which has a value of 465.67 1.18 nmol TE/g DM (total Trolox equivalent /gram of Dry material) . The following three mainly chemical species were found in the essential oil extracts: -Pinene, Cineole and Limonene. (author)

  17. Factors related to RNA polymerase II transcription are localized in interchromatin granule clusters of Panorpa communis oocytes.

    Directory of Open Access Journals (Sweden)

    Vladimir Parfenov

    2009-05-01

    Full Text Available Diplotene oocyte nucleus of the scorpionfly Panorpa communis is transcriptionally silent and contains numerous nuclear bodies including interchromatin granule clusters (IGCs. The latter consist of the granules of 30-50 nm in diameter and contain IGC marker protein SC35 as well as RNA polymerase II. In this study, we also localized in P. communis oocyte IGCs the transcription coactivators CBP/p300, TATA-binding protein (TBP which is a component of the basal transcription factor TFIID and the basal transcription factor TFIIH. We belive that IGCs in transcriptionally inert P. communis oocytes are storage sites for the components of RNA polymerase II holoenzyme and other factors of RNA pol II transcription.

  18. Influence of growth retardants on the development of Gladiolus communis L. plants

    OpenAIRE

    Marcelo Ferraz de Campos; Clarice Backes; Jéssica Maria Coutinho Roters; Elizabeth Orika Ono; João Domingos Rodrigues

    2010-01-01

    Treatments involving plant growth retardants were studied in sword lily plants (Gladiolus communis L. spp.) to evaluate plant height, number of leaves and flower buds, stem diameter, and flower stalk length. The experimental design was a completely randomized layout, with four replicates and seven treatments (control; applications of mepiquat chloride at 200mg.L-1, 3 and 6 times; chlormequat chloride at 200mg.L-1, 3 and 6 times; and ethephon at 200mg.L-1, 3 and 6 times). Seven non-destructive...

  19. Gregarine Cephaloidophora communis mawrodiadi, 1908 in the barnacle Euraphia rhyzophorae, Oliveira, 1940 from Brazil

    Directory of Open Access Journals (Sweden)

    Lacombe Dyrce

    2002-01-01

    Full Text Available The gregarine Cephaloidophora communis was observed for the first time in Brazil in the barnacles Euraphia rhyzophorae collected in Angra dos Reis, Rio de Janeiro, Brazil, between 1990 and 1996. Histological studies showed growth phases of the parasite in specific parts of the digestive system. The intracellular forms occurred in the vacuoles of the intestinal cells. Syzygy was frequent, and the most common form following syzygy was cylindrical, with a single membrane. The cytoplasm of the gregarines was always irregular, dense, and occasionally presenting a dark stoch area.

  20. Synthesis and characterization of castor oil based polyurethane–polyacrylonitrile interpenetrating polymer networks

    Indian Academy of Sciences (India)

    P Mallu; Siddaramaiah; R Somashekar

    2000-10-01

    A series of interpenetrating polymer networks (IPNs) of castor oil based polyurethane/polyacrylonitrile (PU/PAN: 80/20, 60/40, 50/50, 40/60 and 20/80) were synthesized by condensation reaction of castor oil with methylene diisocyanate and acrylonitrile, employing benzoyl peroxide (BPO) and ethylene glycol dimethylacrylate (EGDM) as initiator and crosslinkers respectively. The physical, chemical, optical and some of the mechanical properties of PU/PAN were studied. Phase stabilization in IPNs was investigated by wide angle X-ray (WAXS) profile analysis. Variation of crystal size distribution was studied in these polymer networks.

  1. Inhibitors of nitric oxide synthetase prevent castor-oil-induced diarrhoea in the rat.

    OpenAIRE

    Mascolo, N; Izzo, A A; Barbato, F.; Capasso, F

    1993-01-01

    1. Castor oil (2 ml orally) produced copious diarrhoea in rats 3 h after its administration. 2. Pretreatment (intraperitoneal, i.p.) of rats with the NO synthesis inhibitors NG-nitro-L-arginine methyl ester (L-NAME, 1-25 mg kg-1) and NG-monomethyl-L-arginine (L-NMMA, 2.5-100 mg kg-1) inhibited or prevented castor-oil-induced diarrhoea. L-Arginine (150-600 mg kg-1, i.p.) administered to rats pretreated with L-NAME 10 mg kg-1, drastically reduced the antidiarrhoeal activity of L-NAME in a dose-...

  2. EVALUATION OF OIL CONTENT AND SEED WEIGHT IN CASTOR USING VARIOUS APPROACHES

    OpenAIRE

    Edinete Maria Oliveira

    2011-01-01

    The objective with this work to analyze the oil tenor and weight of several accesses of castor oil plant seeds for ends of genetic improvement, planted in different years. The analyses were accomplished at Embrapa Algodão Laboratory Multidisciplinary in Campina Grande -PB. 143 samples of castor oil plant seeds were used, coming of the city of Lagoa Seca - PB in 1998, 1999 and 2000, planted according to design random blocks. Initially the seeds were removed of the cold camera and made sampling...

  3. Nitrosomonas communis strain YNSRA, an ammonia-oxidizing bacterium, isolated from the reed rhizoplane in an aquaponics plant.

    Science.gov (United States)

    Tokuyama, Tatsuaki; Mine, Atsusi; Kamiyama, Kaoru; Yabe, Ryuichi; Satoh, Kazuo; Matsumoto, Hirotoshi; Takahashi, Reiji; Itonaga, Koji

    2004-01-01

    An ammonia-oxidizing bacterium (strain YNSRA) was isolated from the rhizoplane of the reed (Phragmites communis) used in an aquaponics plant which is a wastewater treatment plant. Strain YNSRA was identified as Nitrosomonas communis by taxonomic studies. The hydroxylamine-cytochrome c reductase (HCR) of strain YNSRA was found to have a higher activity (25.60 u/mg) than that of Nitrosomonas europaea ATCC25978T (8.94 u/mg). Ribulose-1,5-bisphosphate carboxylase (RubisCO) activity was detected at very low levels in strain YNSRA, whereas strain ATCC25978T had definite activity. PMID:16233712

  4. Joint Experiments on the Tokamaks CASTOR and T-10

    International Nuclear Information System (INIS)

    Small tokamaks may significantly contribute to the better understanding of phenomena in a wide range of fields such as plasma confiement and energy transport; plasma stability in different magnetic configurations; plasma turbulence and its impact on local and global plasma parameters; processes at the plasma edge and plasma-wall interaction; scenarios of additional heating and non-inductive current drive; new methods of plasma profile and parameter control; development of novel plasma diagnostics; benchmarking of new numerical codes and so on. Furthermore, due to the compactness, flexibility, low operation costs and high skill of their personnel small tokamaks are very convenient to develop and test new materials and technologies. Small tokamaks are suitable and important for broad international cooperation, providing the necessary environment and manpower to conduct dedicated joint research programmes. In addition, the experimental work on small tokamaks is very appropriate for the education of students, scientific activities of post-graduate students and for the training of personnel for large tokamaks. The first Joint (Host Laboratory) Experiment (JE1) has been carried out in 2005 on the CASTOR tokamak at the IPP Prague, Czech Republic. It was jointly organized by the IPP-ASCR and KFKI HAC, Budapest, involved 20 scientists from 7 countries and was supported through the IAEA and the ICTP, Trieste. The objective of JE1 was to perform studies of plasma edge turbulence and plasma confinement. Following the success of JE1, JE2 has been performed on T-10 at RRC 'Kurchatov Institute' in Moscow; 30 scientists from 13 countries participated in this experiment. This experiment aimed to continue JE1 turbulence studies, now extending them to the plasma core. Results of JE1 and JE2 will be overviewed and compared

  5. Production of bran castor biochar through slow pyrolysis

    Science.gov (United States)

    Pissinati de Rezende, E. I.; Mangrich, A. S.; Batista, M. G. F.; Toledo, J. M. S.; Novotny, E. H.

    2012-04-01

    Pyrolysis is a thermal process of great importance in the present context, since it constitutes a significant alternative to adequate use of organic waste. The principal products obtained in the pyrolysis of discarded biomass are bio-oil, biogas and biochar. Biochar, in turn, may play a relevant role when applied to the soil to sequester carbon and as a soil conditioner, a material comparable to organic matter of Indians Black Earths from the Amazon Region [1]. Seeking to determine the best methods of preparation of biochar, we studied the pyrolysis of bran castor residue of the Brazilian biodiesel industry. Eight samples, from FM1 to FM8, were prepared in a factorial design 23 using two temperature (300 and 350 °C), two heating velocity (5 and 10 °C min-1) and two period of heating (30 and 60 min). The eight samples were studied using the spectroscopy: EPR, FTIR, RMN, XPS, and elemental analysis. By elemental analysis, the samples that keep for lower temperature of pyrolysis, 300 °C, showed H/C and N/C ratios greater than the samples of 350 °C. That higher value can be attributed to chemical structure more aliphatic than aromatic mainly in the FM7 sample (V = 10 °C min-1, T = 300 °C, P = 30 min). The greater N/C ratio correlated with a superior amount of nitrogenous functions, presenting by both FM7 and FM4 samples, as determined by 13C NMR spectroscopy with absorptions in 175 ppm (amide) and 55 ppm (N-alkyl).

  6. 蓖麻饼粕的脱毒及综合开发利用%The Detoxification and Comprehensive Development and Utilization of Castor Bean Meal

    Institute of Scientific and Technical Information of China (English)

    张树军; 狄建军; 白靓; 黄凤兰; 穆莎茉莉; 魏永春; 张国文

    2011-01-01

    Castor bean meal is a by-product after oil extraction,it contains rich protein and amino acids castor bean hulls and a spot of castor toxins,has a high utilization value.This paper reviewes the detoxification of castor bean meal,the development and utilization of proteins in detoxificated castor bean meal,castor toxins and castor bean hull.%蓖麻饼粕是蓖麻籽榨油后的副产品,含有丰富的蛋白和氨基酸、蓖麻壳及少量的蓖麻毒素,具有较高的综合利用价值.本文综述了蓖麻饼的脱毒,脱毒蓖麻饼蛋白质、蓖麻饼中毒素及蓖麻壳的开发利用.

  7. Anti-genotoxic and free-radical scavenging activities of extracts from (Tunisian) Myrtus communis.

    Science.gov (United States)

    Hayder, N; Abdelwahed, A; Kilani, S; Ammar, R Ben; Mahmoud, A; Ghedira, K; Chekir-Ghedira, L

    2004-11-14

    The effect of extracts from leaves of Myrtus communis on the SOS reponse induced by Aflatoxin B1 (AFB1) and Nifuroxazide was investigated in a bacterial assay system, i.e. the SOS chromotest with Escherichia coli PQ37. Aqueous extract, the total flavonoids oligomer fraction (TOF), hexane, chloroform, ethyl acetate and methanol extracts and essential oil obtained from M. communis significantly decreased the SOS response induced by AFB1 (10 microg/assay) and Nifuroxazide (20 microg/assay). Ethyl acetate and methanol extracts showed the strongest inhibition of the induction of the SOS response by the indirectly genotoxic AFB1. The methanol and aqueous extracts exhibited the highest level of protection towards the SOS-induced response by the directly genotoxic Nifuroxazide. In addition to anti-genotoxic activity, the aqueous extract, the TOF, and the ethyl acetate and methanol extracts showed an important free-radical scavenging activity towards the 1,1-diphenyl-2-picrylhydrazyl (DPPH) radical. These results suggest the future utilization of these extracts as additives in chemoprevention studies. PMID:15474415

  8. Seasonal changes in the fatty acid profile of the tick Ixodes ricinus (Acari, Ixodidae).

    Science.gov (United States)

    Cuber, Piotr; Urbanek, Aleksandra; Naczk, Aleksandra; Stepnowski, Piotr; Gołębiowski, Marek

    2016-06-01

    Fatty acids (FAs) from nymphs, females and males of Ixodes ricinus were analysed by gas chromatography/mass spectrometry. Ticks were collected from May to October 2013. The most abundant FAs were 18:1, 18:0, 16:0 and 18:2 which are also dominant FAs of insects. Adults contained higher concentrations of FAs in general than nymphs because they contain more fat body and probably a thicker layer of epicuticular lipids. Larger quantities of FAs > 20 carbon atoms in the carboxylic chain were present in females, which generally show higher content of lipids essential for oogenesis, whereas there were similar amounts of 14-18 in both sexes. In September and October, ticks contained large concentrations of the majority of FAs except for 18:1, the most abundant one in ticks collected from May through August. Thus, most FAs, especially those with more than 20 C atoms, tend to increase at lower temperatures. PMID:26976134

  9. Driving forces for changes in geographical distribution of Ixodes ricinus ticks in Europe

    Directory of Open Access Journals (Sweden)

    Medlock Jolyon M

    2013-01-01

    Full Text Available Abstract Many factors are involved in determining the latitudinal and altitudinal spread of the important tick vector Ixodes ricinus (Acari: Ixodidae in Europe, as well as in changes in the distribution within its prior endemic zones. This paper builds on published literature and unpublished expert opinion from the VBORNET network with the aim of reviewing the evidence for these changes in Europe and discusses the many climatic, ecological, landscape and anthropogenic drivers. These can be divided into those directly related to climatic change, contributing to an expansion in the tick’s geographic range at extremes of altitude in central Europe, and at extremes of latitude in Scandinavia; those related to changes in the distribution of tick hosts, particularly roe deer and other cervids; other ecological changes such as habitat connectivity and changes in land management; and finally, anthropogenically induced changes. These factors are strongly interlinked and often not well quantified. Although a change in climate plays an important role in certain geographic regions, for much of Europe it is non-climatic factors that are becoming increasingly important. How we manage habitats on a landscape scale, and the changes in the distribution and abundance of tick hosts are important considerations during our assessment and management of the public health risks associated with ticks and tick-borne disease issues in 21st century Europe. Better understanding and mapping of the spread of I. ricinus (and changes in its abundance is, however, essential to assess the risk of the spread of infections transmitted by this vector species. Enhanced tick surveillance with harmonized approaches for comparison of data enabling the follow-up of trends at EU level will improve the messages on risk related to tick-borne diseases to policy makers, other stake holders and to the general public.

  10. IrFC - An Ixodes ricinus injury-responsive molecule related to Limulus Factor C.

    Science.gov (United States)

    Urbanová, Veronika; Hartmann, David; Grunclová, Lenka; Šíma, Radek; Flemming, Tina; Hajdušek, Ondřej; Kopáček, Petr

    2014-10-01

    Limulus Clotting Factor C is a multi-domain serine protease that triggers horseshoe crab hemolymph clotting in the presence of trace amounts of bacterial lipopolysaccharides. Here we describe and functionally characterize an homologous molecule, designated as IrFC, from the hard tick Ixodes ricinus. Tick Factor C consists of an N-terminal cysteine-rich domain, four complement control protein (sushi) modules, an LCCL domain, a truncated C-lectin domain and a C-terminal trypsin-type domain. Developmental expression profiling by quantitative real-time PCR revealed that the irfc mRNA is expressed in all stages including eggs. In tissues dissected from adult I. ricinus females, the irfc mRNA is present mainly in tick hemocytes and accordingly, indirect immunofluorescence microscopy localized IrFC intracellularly, in tick hemocytes. Irfc mRNA levels were markedly increased upon injection of sterile saline, or different microbes, demonstrating that the irfc gene transcription occurs in response to injury. This indicates a possible role of IrFC in hemolymph clotting and/or wound healing, although these defense mechanisms have not been yet definitely demonstrated in ticks. RNAi silencing of irfc expression resulted in a significant reduction in phagocytic activity of tick hemocytes against the Gram-negative bacteria Chryseobacterium indologenes and Escherichia coli, but not against the yeast, Candida albicans. This result suggests that IrFC plays a role in the tick primordial complement system and as such possibly mediates transmission of tick-borne pathogens. PMID:24924263

  11. Dynamics of digestive proteolytic system during blood feeding of the hard tick Ixodes ricinus

    Directory of Open Access Journals (Sweden)

    Sojka Daniel

    2010-12-01

    Full Text Available Abstract Background Ticks are vectors of a wide variety of pathogens causing severe diseases in humans and domestic animals. Intestinal digestion of the host blood is an essential process of tick physiology and also a limiting factor for pathogen transmission since the tick gut represents the primary site for pathogen infection and proliferation. Using the model tick Ixodes ricinus, the European Lyme disease vector, we have previously demonstrated by genetic and biochemical analyses that host blood is degraded in the tick gut by a network of acidic peptidases of the aspartic and cysteine classes. Results This study reveals the digestive machinery of the I. ricinus during the course of blood-feeding on the host. The dynamic profiling of concentrations, activities and mRNA expressions of the major digestive enzymes demonstrates that the de novo synthesis of peptidases triggers the dramatic increase of the hemoglobinolytic activity along the feeding period. Overall hemoglobinolysis, as well as the activity of digestive peptidases are negligible at the early stage of feeding, but increase dramatically towards the end of the slow feeding period, reaching maxima in fully fed ticks. This finding contradicts the established opinion that blood digestion is reduced at the end of engorgement. Furthermore, we show that the digestive proteolysis is localized intracellularly throughout the whole duration of feeding. Conclusions Results suggest that the egressing proteolytic system in the early stage of feeding and digestion is a potential target for efficient impairment, most likely by blocking its components via antibodies present in the host blood. Therefore, digestive enzymes are promising candidates for development of novel 'anti-tick' vaccines capable of tick control and even transmission of tick-borne pathogens.

  12. Borrelia burgdorferi sensu lato in Ixodes ricinus ticks collected from migratory birds in Southern Norway

    Directory of Open Access Journals (Sweden)

    Skarpaas Tone

    2010-11-01

    Full Text Available Abstract Background Borrelia burgdorferi sensu lato (s.l. are the causative agent for Lyme borreliosis (LB, the most common tick-borne disease in the northern hemisphere. Birds are considered important in the global dispersal of ticks and tick-borne pathogens through their migration. The present study is the first description of B. burgdorferi prevalence and genotypes in Ixodes ricinus ticks feeding on birds during spring and autumn migration in Norway. Methods 6538 migratory birds were captured and examined for ticks at Lista Bird Observatory during the spring and the autumn migration in 2008. 822 immature I. ricinus ticks were collected from 215 infested birds. Ticks were investigated for infection with B. burgdorferi s.l. by real-time PCR amplification of the 16S rRNA gene, and B. burgdorferi s.l. were thereafter genotyped by melting curve analysis after real-time PCR amplification of the hbb gene, or by direct sequencing of the PCR amplicon generated from the rrs (16S-rrl (23S intergenetic spacer. Results B. burgdorferi s.l. were detected in 4.4% of the ticks. The most prevalent B. burgdorferi genospecies identified were B. garinii (77.8%, followed by B.valaisiana (11.1%, B. afzelii (8.3% and B. burgdorferi sensu stricto (2.8%. Conclusion Infection rate in ticks and genospecies composition were similar in spring and autumn migration, however, the prevalence of ticks on birds was higher during spring migration. The study supports the notion that birds are important in the dispersal of ticks, and that they may be partly responsible for the heterogeneous distribution of B. burgdorferi s.l. in Europe.

  13. Diversity of viruses in Ixodes ricinus, and characterization of a neurotropic strain of Eyach virus.

    Science.gov (United States)

    Moutailler, S; Popovici, I; Devillers, E; Vayssier-Taussat, M; Eloit, M

    2016-05-01

    Ticks transmit more pathogens-including bacteria, parasites and viruses-than any other arthropod vector. Although the epidemiological status of many tick-borne bacteria is very well characterized, tick-borne viruses are still relatively under-studied. Recently, several novel tick-borne viruses have been isolated from human febrile illnesses following tick bites, indicating the existence of other potential new and unknown tick-borne viruses. We used high-throughput sequencing to analyse the virome of Ixodes ricinus, the main vector of tick-borne pathogens in Europe. The majority of collected viral sequences were assigned to two potentially novel Nairovirus and Phlebovirus viruses, with prevalence rates ranging from 3.95% to 23.88% in adults and estimated to be between 0.14% and 72.16% in nymphs. These viruses could not be isolated from the brains of inoculated immunocompromised mice, perhaps indicating that they are unable to infect vertebrates. Within the I. ricinus virome, we also identified contigs with >90% identity to the known Eyach virus. Initially isolated in the 1980s, this virus was indirectly associated with human disease, but had never been extensively studied. Eyach virus prevalence varied between 0.07% and 5.26% in ticks from the French Ardennes and Alsace regions. Eyach virus was successfully isolated following intracerebral inoculation of immunocompromised mice with Eyach virus-positive tick extracts. This virus was also able to multiply and persist in the blood of immunocompetent mice inoculated by intraperitoneal injection, and caused brain infections in three of nine juveniles, without any obvious deleterious effects. PMID:27158509

  14. Diversity of viruses in Ixodes ricinus, and characterization of a neurotropic strain of Eyach virus

    Directory of Open Access Journals (Sweden)

    S. Moutailler

    2016-05-01

    Full Text Available Ticks transmit more pathogens—including bacteria, parasites and viruses—than any other arthropod vector. Although the epidemiological status of many tick-borne bacteria is very well characterized, tick-borne viruses are still relatively under-studied. Recently, several novel tick-borne viruses have been isolated from human febrile illnesses following tick bites, indicating the existence of other potential new and unknown tick-borne viruses. We used high-throughput sequencing to analyse the virome of Ixodes ricinus, the main vector of tick-borne pathogens in Europe. The majority of collected viral sequences were assigned to two potentially novel Nairovirus and Phlebovirus viruses, with prevalence rates ranging from 3.95% to 23.88% in adults and estimated to be between 0.14% and 72.16% in nymphs. These viruses could not be isolated from the brains of inoculated immunocompromised mice, perhaps indicating that they are unable to infect vertebrates. Within the I. ricinus virome, we also identified contigs with >90% identity to the known Eyach virus. Initially isolated in the 1980s, this virus was indirectly associated with human disease, but had never been extensively studied. Eyach virus prevalence varied between 0.07% and 5.26% in ticks from the French Ardennes and Alsace regions. Eyach virus was successfully isolated following intracerebral inoculation of immunocompromised mice with Eyach virus-positive tick extracts. This virus was also able to multiply and persist in the blood of immunocompetent mice inoculated by intraperitoneal injection, and caused brain infections in three of nine juveniles, without any obvious deleterious effects.

  15. Organic matter and soil water content influence on BRS 188 castor bean growth

    Energy Technology Data Exchange (ETDEWEB)

    Lacerda, Rogerio Dantas de; Araujo, Ester Luiz de; Nascimento, Elka Costa Santos; Barros Junior, Genival [Universidade Federal de Campina Grande (UFCG), PB (Brazil); Guerra, Hugo O. Carvallo; Chaves, Lucia Helena G. [Universidade Federal de Campina Grande (UAEAg/UFCG), PB (Brazil). Unidade Academica de Engenharia Agricola

    2008-07-01

    The castor bean culture has been highlighted due to the several applications of its oil, which constitutes one of the best row materials for biodiesel manufacturing, and the base for several other industrial products. The objective of the present work was to study the effect of different soil water and soil organic matter on the castor bean growth. The experiment was conducted from April to August 2006 under greenhouse conditions using a randomized block 2x4 factorial design with two soil organic mater content (5.0 g.kg{sup -1} e 25.0 g.kg{sup -1}), four levels of available water (100, 90, 80 e 70% ) and three replicates. For this, 24 plastic containers, 75 kg capacity, were used on which was grown one plant 120 days after the seedling. At regular intervals the plant height was measured and the results analyzed statistically. For the qualitative treatments (with and without organic matter) the treatment means were compared through the Tukey test. For the quantitative ones (water levels) were used regressions. The castor bean cultivar height was significantly influenced by the organic matter content only after 80 days. Castor bean height increased significantly with the soil water content after 40 days of growing. (author)

  16. Lipase catalyzed transesterification of castor oil by straight chain higher alcohols.

    Science.gov (United States)

    Malhotra, Deepika; Mukherjee, Joyeeta; Gupta, Munishwar N

    2015-03-01

    Biolubricants from Castor oil were produced enzymatically by transesterification with higher alcohols using a lipase mixture of immobilized Mucor miehei (RMIM) and immobilized Candida antarctica lipase B (Novozym 435) under low water conditions. The conversions were in the range of 80-95% under the optimized conditions. PMID:25204793

  17. Coherent structures in the plasma edge turbulence of the RFX and CASTOR experiments

    Czech Academy of Sciences Publication Activity Database

    Martines, E.; Antoni, V.; Cavazzana, R.; Regnoli, G.; Serianni, G.; Hron, Martin; Stöckel, Jan

    2002-01-01

    Roč. 52, supplement D (2002), s. D13-D24. ISSN 0011-4626. [Symposium on Plasma Physics and Technology/20th./. Prague, 10.06.2002-13.06.2002] Institutional research plan: CEZ:AV0Z2043910 Keywords : CASTOR, coherent structures, plasma edge turbulence Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 0.311, year: 2002

  18. REGIOSPECIFIC ANALYSIS OF DIRICINOLEOYL-ACYL-GLYCEROL IN CASTOR OIL USING ELECTROSPRAY IONIZATION-MASS SPECTROMETRY

    Science.gov (United States)

    HPLC fractions of castor oil were used to identify the regiospecific location of non-hydroxyl fatty acids on glycerol backbone in diricinoleoyl-acyl-glycerols using electrospray ionization MS3 of lithium adducts. The regiospecific ions in MS3 spectra were from the loss of 'a,B'-unsaturated fatty aci...

  19. Recycling of waste poly(ethylene terephthalate) with castor oil using microwave heating

    Czech Academy of Sciences Publication Activity Database

    Beneš, Hynek; Slabá, J.; Walterová, Zuzana; Rais, David

    2013-01-01

    Roč. 98, č. 11 (2013), s. 2232-2243. ISSN 0141-3910 R&D Projects: GA MPO 2A-2TP1/135 Institutional support: RVO:61389013 Keywords : poly(ethylene terephthalate) * castor oil * chemical recycling Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.633, year: 2013

  20. Characterization and Utilization of castor bean seed oil extract for production of medicated soap.

    Directory of Open Access Journals (Sweden)

    Abdulrasheed A

    2015-12-01

    Full Text Available The research work is to investigate the potential utilization of castor bean seed oil extract in the production of medicated soap. The oil was extracted via soxhlet extractor using hexane as solvent. The characterization analysis reveals the acid value and saponification value of the oil which were between the ranges of values specified by ASTM. The soap produced gave a pH of (8.9, foam height (16cm, alcohol insoluble (3.45%, moisture content (4.2% and free acidity of (0.10. The antibacterial activity of soap produced from castor oil on bacteria isolate (Staphylococcus Aureus was promising with an inhibition zone of 15.5mm but at dilutions of 10-1 , 10-2 and 10-3 , were found to be 11.5mm, 9.5mm and 6mm respectively. This shows that as concentration decreases, the sensitivity of the soap to the bacteria isolate also decreases. The sensitivity of the medicated soap to the bacteria isolate is as a result of the presence of ricinoleic acid present in large proportion in the fatty acid composition of castor oil. It can be concluded that a highly effective soap can be produced from castor bean seed oil extract.

  1. Film-forming properties of castor oil polyol ester blends in elastohydrodynamic conditions

    Science.gov (United States)

    The viscosities and elastohydrodynamic (EHD) film thickness properties of binary blends of castor oil with polyol esters were determined experimentally. Predicted blend viscosity was calculated from the viscosity of the pure blend components. Measured viscosity values were closer to the values pre...

  2. Differential Contribution of Malic Enzymes during Soybean and Castor Seeds Maturation.

    Directory of Open Access Journals (Sweden)

    Mariel Claudia Gerrard Wheeler

    Full Text Available Malic enzymes (ME catalyze the decarboxylation of malate generating pyruvate, CO2 and NADH or NADPH. In some organisms it has been established that ME is involved in lipids biosynthesis supplying carbon skeletons and reducing power. In this work we studied the MEs of soybean and castor, metabolically different oilseeds. The comparison of enzymatic activities, transcript profiles and organic acid contents suggest different metabolic strategies operating in soybean embryo and castor endosperm in order to generate precursors for lipid biosynthesis. In castor, the malate accumulation pattern agrees with a central role of this metabolite in the provision of carbon to plastids, where the biosynthesis of fatty acids occurs. In this regard, the genome of castor possesses a single gene encoding a putative plastidic NADP-ME, whose expression level is high when lipid deposition is active. On the other hand, NAD-ME showed an important contribution to the maturation of soybean embryos, perhaps driving the carbon relocation from mitochondria to plastids to support the fatty acids synthesis in the last stages of seed filling. These findings provide new insights into intermediary metabolism in oilseeds and provide new biotechnological targets to improve oil yields.

  3. Synthesis and properties of radiation modified thermally cured castor oil based polyurethanes

    Science.gov (United States)

    Mortley, Aba; Bonin, H. W.; Bui, V. T.

    2007-12-01

    Thermally cured polyurethanes were prepared from castor oil and hexamethylene diisocyanate (HMDI). Due to the long aliphatic chain of the castor oil component of polyurethane, thermal curing of castor oil based polyurethane (COPU) is limited by increasing polymer viscosity. To enhance further crosslinking, COPUs were exposed to doses up to 3.0 MGy produced by the mixed ionizing radiation field of a SLOWPOKE-2 research nuclear reactor. The physico-mechanical properties of castor oil based polyurethanes (COPU), unirradiated and irradiated, were characterized by mechanical tensile tests. A four-fold increase in modulus and tensile strength values from 0.930 to 4.365 MPa and 0.149 to 0.747 MPa, respectively, suggests improved physico-mechanical properties resulting from radiation. The changing areas of the carbonyl and the NH absorbance peaks and the disappearance of the isocyanate peak in the FTIR spectra as radiation progressed, indicates increased hydrogen bonding and intermolecular crosslinking, which is in agreement with the mechanical tests. Unchanging 13C solid state NMR spectra imply limited sample degradation with increasing radiation.

  4. Synthesis and properties of radiation modified thermally cured castor oil based polyurethanes

    International Nuclear Information System (INIS)

    Thermally cured polyurethanes were prepared from castor oil and hexamethylene diisocyanate (HMDI). Due to the long aliphatic chain of the castor oil component of polyurethane, thermal curing of castor oil based polyurethane (COPU) is limited by increasing polymer viscosity. To enhance further crosslinking, COPUs were exposed to doses up to 3.0 MGy produced by the mixed ionizing radiation field of a SLOWPOKE-2 research nuclear reactor. The physico-mechanical properties of castor oil based polyurethanes (COPU), unirradiated and irradiated, were characterized by mechanical tensile tests. A four-fold increase in modulus and tensile strength values from 0.930 to 4.365 MPa and 0.149 to 0.747 MPa, respectively, suggests improved physico-mechanical properties resulting from radiation. The changing areas of the carbonyl and the NH absorbance peaks and the disappearance of the isocyanate peak in the FTIR spectra as radiation progressed, indicates increased hydrogen bonding and intermolecular crosslinking, which is in agreement with the mechanical tests. Unchanging 13C solid state NMR spectra imply limited sample degradation with increasing radiation

  5. Measurement of the Fluctuation-Induced Flux with Emissive Probe in the CASTOR Tokamak

    Czech Academy of Sciences Publication Activity Database

    Balan, P.; Adámek, Jiří; Ďuran, Ivan; Hron, Martin; Ionita, C.; Martines, E.; Schrittwieser, R.; Stöckel, Jan; Tichý, M.; Van Oost, G.

    Mulhouse: European Physical Society, 2002 - (Behn, R.; Varandas, C.), s. P-2.072 [EPS Conference on Controlled Fusion and Plasma Physics /29./. Montreux (CH), 17.06.2002-21.06.2002] Institutional research plan: CEZ:AV0Z2043910 Keywords : CASTOR tokamak, electric field Subject RIV: BL - Plasma and Gas Discharge Physics

  6. Differential Contribution of Malic Enzymes during Soybean and Castor Seeds Maturation.

    Science.gov (United States)

    Gerrard Wheeler, Mariel Claudia; Arias, Cintia Lucía; Righini, Silvana; Badia, Mariana Beatriz; Andreo, Carlos Santiago; Drincovich, María Fabiana; Saigo, Mariana

    2016-01-01

    Malic enzymes (ME) catalyze the decarboxylation of malate generating pyruvate, CO2 and NADH or NADPH. In some organisms it has been established that ME is involved in lipids biosynthesis supplying carbon skeletons and reducing power. In this work we studied the MEs of soybean and castor, metabolically different oilseeds. The comparison of enzymatic activities, transcript profiles and organic acid contents suggest different metabolic strategies operating in soybean embryo and castor endosperm in order to generate precursors for lipid biosynthesis. In castor, the malate accumulation pattern agrees with a central role of this metabolite in the provision of carbon to plastids, where the biosynthesis of fatty acids occurs. In this regard, the genome of castor possesses a single gene encoding a putative plastidic NADP-ME, whose expression level is high when lipid deposition is active. On the other hand, NAD-ME showed an important contribution to the maturation of soybean embryos, perhaps driving the carbon relocation from mitochondria to plastids to support the fatty acids synthesis in the last stages of seed filling. These findings provide new insights into intermediary metabolism in oilseeds and provide new biotechnological targets to improve oil yields. PMID:27347875

  7. Sources of nitrogenous fertilizers and their effects in the growth of the castor bean plant

    Directory of Open Access Journals (Sweden)

    Joelma Sales dos Santos

    2008-12-01

    Full Text Available The main goal of this research was to verify and quantify the effects of doses (equivalent to nitrogen of fertilizers, manure from corral, residential sewage sludge, castor oil cake and urea, in the early growth of castor beans, BRS Nordestina in a greenhouse. The experiment was conducted in the Embrapa, at county of Campina Grande, state of Paraiba, Brazil, and it was used an experimental design of randomized with three replicates and 13 treatments, with a factorial 4 x 3 + 1, which factors were: types of organic fertilizers (manure from corral and manure, biosolids and castor bean cake and urea at rates of (85,170 and 255 kg N ha-¹, plus an additional treatment, which was the absolute witness without the fertilization. All the treatments witness received a mineral supplement P and K, at doses of 80 kg of P2O2 and K2O, applied in the foundation, with triple superphosphate and potassium chloride. Among the fertilizers, which further promoted the initial growth of castor beans was the pie of Euphorbia that, in addition to nutrients, especially of nitrogen, have much fiber, more than 35%, constituting themselves, thus a factor in improving soil physical environment.

  8. Treatment of Sebacic Acid Industrial Wastewater by Extraction Process Using Castor Oil Acid as Extractant*

    Institute of Scientific and Technical Information of China (English)

    徐航; 周全; 王金福

    2013-01-01

    Wastewater containing high concentrations of phenol and sodium sulfate is generated in sebacic acid (SA) industry. Castor oil acid, a raw material for producing SA, can be used to extract phenol from wastewater in order to reduce the amount of phenol used in the process and discharge of phenol. The results show that the extrac-tion mechanism is that hydroxyl group of phenol is linked to carboxyl group of castor oil acid by hydrogen bond. The extraction process approaches equilibrium in 30 min. Extraction ratio increases with the increase of sodium sulfate and castor oil acid, and decreases as phenol increases. When the oil-water ratio is 1︰3, the optimal distribu-tion coefficient of 40 is obtained. Phenol saturation concentration in castor oil acid is 1.03 mol·L−1 after extraction for 4 times. The equilibrium constant (Kex) at 25 °C is 8.41 and the endothermic enthalpy (ΔH) is 1.513 kJ·mol−1. The Gibbs free energy (ΔG) is−5.277 kJ·mol−1 and the value ofΔS is calculated to be 22.3 J·mol−1·K−1.

  9. Ratios of regioisomers of triacylglycerols containing dihydroxy fatty acids in castor oil by mass spectrometry

    Science.gov (United States)

    The triacylglycerols (TAG) containing dihydroxy fatty acids have been recently identified by mass spectrometry in castor oil. These new dihydroxy fatty acids were proposed earlier as 11,12-dihydroxy-9-octadecenoic acid (diOH18:1), 11,12-dihydroxy-9,13-octadecadienoic acid (diOH18:2) and 11,12-dihydr...

  10. Regiospecific Quantification of Triacylglycerols Containing Dihydroxy Fatty Acids in Castor Oil by Mass Spectrometry

    Science.gov (United States)

    The triacylglycerols (TAG) containing dihydroxy fatty acids have been recently identified by mass spectrometry in castor oil. These new dihydroxy fatty acids were proposed earlier as 11,12-dihydroxy-9-octadecenoic acid (diOH18:1), 11,12-dihydroxy-9,13-octadecadienoic acid (diOH18:2) and 11,12-dihydr...

  11. Multi-source analysis reveals latitudinal and altitudinal shifts in range of Ixodes ricinus at its northern distribution limit

    Directory of Open Access Journals (Sweden)

    Kristoffersen Anja B

    2011-05-01

    Full Text Available Abstract Background There is increasing evidence for a latitudinal and altitudinal shift in the distribution range of Ixodes ricinus. The reported incidence of tick-borne disease in humans is on the rise in many European countries and has raised political concern and attracted media attention. It is disputed which factors are responsible for these trends, though many ascribe shifts in distribution range to climate changes. Any possible climate effect would be most easily noticeable close to the tick's geographical distribution limits. In Norway- being the northern limit of this species in Europe- no documentation of changes in range has been published. The objectives of this study were to describe the distribution of I. ricinus in Norway and to evaluate if any range shifts have occurred relative to historical descriptions. Methods Multiple data sources - such as tick-sighting reports from veterinarians, hunters, and the general public - and surveillance of human and animal tick-borne diseases were compared to describe the present distribution of I. ricinus in Norway. Correlation between data sources and visual comparison of maps revealed spatial consistency. In order to identify the main spatial pattern of tick abundance, a principal component analysis (PCA was used to obtain a weighted mean of four data sources. The weighted mean explained 67% of the variation of the data sources covering Norway's 430 municipalities and was used to depict the present distribution of I. ricinus. To evaluate if any geographical range shift has occurred in recent decades, the present distribution was compared to historical data from 1943 and 1983. Results Tick-borne disease and/or observations of I. ricinus was reported in municipalities up to an altitude of 583 metres above sea level (MASL and is now present in coastal municipalities north to approximately 69°N. Conclusion I. ricinus is currently found further north and at higher altitudes than described in

  12. Repertoire of SSRs in the Castor Bean Genome and Their Utilization in Genetic Diversity Analysis in Jatropha curcas

    OpenAIRE

    Arti Sharma; Rajinder Singh Chauhan

    2011-01-01

    Castor bean and Jatropha contain seed oil of industrial importance, share taxonomical and biochemical similarities, which can be explored for identifying SSRs in the whole genome sequence of castor bean and utilized in Jatropha curcas. Whole genome analysis of castor bean identified 5,80,986 SSRs with a frequency of 1 per 680 bp. Genomic distribution of SSRs revealed that 27% were present in the non-genic region whereas 73% were also present in the putative genic regions with 26% in 5′UTRs, 2...

  13. A rapid method for evaluation of the oxidation stability of castor oil FAME: influence of antioxidant type and concentration

    Energy Technology Data Exchange (ETDEWEB)

    Araujo, Susana V.; Luna, F. Murilo T.; Rola, Estelio M. Jr.; Azevedo, Diana C.S.; Cavalcante, Celio L. Jr. [Universidade Federal do Ceara, Departamento de Engenharia Quimica, Grupo de Pesquisa em Separacoes por Adsorcao - GPSA, Campus do Pici, 709, Fortaleza, CE, 60.455-900 (Brazil)

    2009-10-15

    The oxidation stability of castor oil fatty methyl ester (FAME), doped with four different phenolic antioxidants, was evaluated using a rapid method of thermal and air-contact degradation. The methodology is based on the induction times observed when the samples are contacted with pure oxygen at elevated pressures and temperatures. The results indicate different performances of the antioxidants as well as synergisms between antioxidants and biodiesel. In general, the addition of antioxidants increased from 6-15 times the stability of castor oil FAME., with BHA (butylated hydroxyanisol) showing the best results for improving antioxidation in castor oil biodiesel. (author)

  14. Iridoids and phenylpropanoid glucosides from Agalinis communis (Cham. & Schlecht) D'Arcy and Scoparia ericacea Cham. (Scrophulariaceae)

    DEFF Research Database (Denmark)

    von Poser, Gilsane Lino; Henriques, Amélia T.; Schripsema, Jan; Jensen, Søren Rosendal

    1996-01-01

    In this work we report the isolation of iridoid glucosides from two species of Scrophulariaceae. From the aerial parts of Scoparia ericacea geniposidic acid, geniposide, scandoside methylester, shanzhiside methylester, caryoptoside and the phenylpropanoid glucoside verbascoside were isolated. In...... Agalinis communis aucubin, shanzhiside methylester, 5-deoxypulchelloside I, bartsioside, gardoside methylester, 8-epi-loganin and verbascoside were identified....

  15. Accumulation of chromium by Commelina communis L. grown in solution with different concentrations of Cr and L-histidine

    Institute of Scientific and Technical Information of China (English)

    唐世荣; 席磊

    2002-01-01

    Hydroponic experiments conducted to examine the chromiun uptake by C. communis in the presence of different Cr concentrations (Cr6+ 100 and 200 mg/L, respectively) and free histidine supplementation (0.5 and 1.0 mol/L) showed that shoot and root growth of C. communis decreased greatly with increasing Cr concentrations in the medium; and that the species was a typical excluder since it accumulated high concentrations of Cr in roots but comparatively low concentrations in shoots. Chromium in shoots and roots of Cr24 -supplied plants ranged from 329-1880 and 3788-4240 mg/kg DW, respectively, while those of Cr24 -histidine-supplied plants ranged from 478 to 629 mg/kg and 4157-4303 mg/kg DW, respectively. With Cr present in the hydroponic solution, C. communis accumulated more Cr in its tissues. Increasing histidine application to the solution significantly increased chromium accumulation in the plant tissues but could not alter the accumulation pattern of plants although it induced a higher concentration of Cr in its shoots and roots. These features suggested that C. communis may serve as an alternative species in a constructed wetland for phytoextraction treatment of Cr-containing wastewater and for phytostabilization of Cr mining spoils.

  16. COMMUNI-CARE: Assessment tool for reactions and behaviours of patients with dementia in a multisensory stimulation environment.

    Science.gov (United States)

    Lopez, José Javier Blanco; Bolívar, Juan Carlos Cejudo; Perez, Manuel Sánchez

    2014-04-01

    BackgroundThe 'Snoezelen' is an approach based on stimulation and sensory stimulation proposals, giving priority to the notion of caretaking. The aim of this paper is to present the creation and validation of the COMMUNI-CARE scale. This is a new tool that allows for an evaluation of the psycho-emotional well-being that the patient with dementia shows in a 'Snoezelen' multisensory stimulation environment.MethodsIn total 429 evaluations in 143 multisensory stimulation interventions were made using the COMMUNI-CARE scale, in 16 patients between 53 and 85 years of age, diagnosed with moderate to severe dementia. The goal was to evaluate the psycho-emotional well-being the patients present.ResultsThe tool's internal consistency showed a Crombach alpha of 0.90. The concurrent validity between the COMMUNI-CARE scale and the Clinical Global Impression (CGI) was of r = -0.961. The Kappa index used to determine the reliability between evaluators was of K = 0.87.ConclusionsThe COMMUNI-CARE scale fulfills the basic principles of classic psychometrics of construct, and criterion validity and reliability. It does so while showing a clear idea, through its five subscales (anxiety, communication, pleasure, adaptation to the surroundings and affection), of the degree of well-being that the patient with dementia shows during such interventions. This scale embodies, through psychometrics, a very subjective human experience with a tool unavailable to date. PMID:24691272

  17. Expressão gênica diferencial em genótipos de mamona (Ricinus communis L. submetidos a déficit hídrico induzido por PEG

    Directory of Open Access Journals (Sweden)

    Patrícia Favoretto Moraes

    2015-03-01

    Full Text Available A mamoneira é uma cultura de relevância econômica e social no Brasil e no mundo. O óleo produzido por suas sementes, composto principalmente pelo ácido ricinoleico, é estratégico para as indústrias de lubrificantes, cosméticos, polímeros, dentre outras. Embora a mamoneira seja considerada tolerante à seca, a ausência de chuvas no período da floração pode reduzir a produtividade da planta. Respostas diferenciais ao déficit hídrico na espécie têm sido observadas em acessos de bancos de germoplasma e entre cultivares comerciais. Com intuito de conhecer melhor os mecanismos fisiológicos de resposta ao déficit hídrico e direcionar programas de melhoramento genético, o objetivo do trabalho foi analisar a expressão diferencial de genes potencialmente relacionados com a tolerância da mamoneira ao déficit hídrico e o comportamento de enzimas do sistema de defesa antioxidante. O estudo foi conduzido com três acessos (China Careca, IAC 2028 e PB 07 submetidos a um ensaio com solução de polietilenoglicol (PEG 6.000 por um período de 24 horas para indução do déficit hídrico. Os genes CAT, APX, SOD-Cu/Zn, SOD-Fe e SOD-Mn tiveram maior expressão diferencial no acesso China Careca. O gene SOD-Cu/Zn foi o mais diferencialmente expresso quanto comparado ao controle (3,57 vezes no acesso China Careca. Análise da atividade de enzimas relacionadas com estresse oxidativo (Catalase – CAT, Ascorbato Peroxidase – APX, Guaiacol Peroxidase – GPOX e Superoxide Dismutase – SOD revelou que os acessos possuem diferentes mecanismos de resposta ao déficit hídrico. Os resultados apontam que o acesso China Careca pode ser considerado de grande importância para programas de melhoramento genético por apresentar característica de precocidade, sistema de defesa antioxidante mais eficiente e resistência ao déficit hídrico.

  18. Component composition of essential oils and ultrastructure of secretory cells of resin channel needles Juniperus communis (Cupressaceae

    Directory of Open Access Journals (Sweden)

    N. V. Gerling

    2015-12-01

    Full Text Available The results of determining the qualitative and quantitative composition of essential oil Juniperus communis, growing under the canopy of spruce blueberry sphagnum subzone middle taiga. Juniperus communis essential oil is liquid light yellow color. The content of essential oil was 0.46 % in shoots with needles. 37 substances of components identified. Mass fraction of components in the essential oil of Juniperus communis reached 89 %. The highest percentage of occupied fraction of monoterpenes (82.3 %, the proportion of sesquiterpenes less than 0.5 % of the total composition of essential oils, alcohols 3.5 and 0.7 % esters. In monoterpenes fraction predominant α-pinene (24.5–32.6 %, β-pinene (15–20.3 % and α-phellandrene (6.4–8.8 %. Essential oil of Juniperus communis is characterized by high content of monoterpenoids in contrast to other conifers of the taiga zone. All stages of biosynthesis essential oils occur in the epithelial cells of the resin channel (terpenoidogennyh cells. An oval shape have epithelial cells of the resin channel needles in transverse sections the Juniperus communis, which is situated vacuole in the center. Large number of lipid globules (up to 40 noted in the hyaloplasm of explored cells. Leucoplasts surrounded by membranes of smooth endoplasmic reticulum in cross sections of epithelial cells in resin channel of juniper. Endoplasmic reticulum is poorly developed in epithelial cells, which corresponds to the low content of sesquiterpenes in the needles during the study period. Development of large leucoplasts and large number of mitochondria associated with predominance of synthesis monoterpenoids the in the epithelium cells resin channel.

  19. Ir-CPI, a coagulation contact phase inhibitor from the tick Ixodes ricinus, inhibits thrombus formation without impairing hemostasis

    OpenAIRE

    Decrem, Yves; Rath, Géraldine; Blasioli, Virginie; Cauchie, Philippe; Robert, Severine; Beaufays, Jerome; Frere, Jean-Marie; Feron, Olivier; Dogne, Jean-Michel; Dessy, Chantal; Vanhamme, Luc; Godfroid, Edmond

    2009-01-01

    Blood coagulation starts immediately after damage to the vascular endothelium. This system is essential for minimizing blood loss from an injured blood vessel but also contributes to vascular thrombosis. Although it has long been thought that the intrinsic coagulation pathway is not important for clotting in vivo, recent data obtained with genetically altered mice indicate that contact phase proteins seem to be essential for thrombus formation. We show that recombinant Ixodes ricinus contact ...

  20. Ixodes ricinus ticks are reservoir hosts for Rickettsia helvetica and potentially carry flea-borne Rickettsia species

    Directory of Open Access Journals (Sweden)

    Gaasenbeek Cor

    2009-09-01

    Full Text Available Abstract Background Hard ticks have been identified as important vectors of rickettsiae causing the spotted fever syndrome. Tick-borne rickettsiae are considered to be emerging, but only limited data are available about their presence in Western Europe, their natural life cycle and their reservoir hosts. Ixodes ricinus, the most prevalent tick species, were collected and tested from different vegetation types and from potential reservoir hosts. In one biotope area, the annual and seasonal variability of rickettsiae infections of the different tick stages were determined for 9 years. Results The DNA of the human pathogen R. conorii as well as R. helvetica, R. sp. IRS and R. bellii-like were found. Unexpectedly, the DNA of the highly pathogenic R. typhi and R. prowazekii and 4 other uncharacterized Rickettsia spp. related to the typhus group were also detected in I. ricinus. The presence of R. helvetica in fleas isolated from small rodents supported our hypothesis that cross-infection can occur under natural conditions, since R. typhi/prowazekii and R. helvetica as well as their vectors share rodents as reservoir hosts. In one biotope, the infection rate with R. helvetica was ~66% for 9 years, and was comparable between larvae, nymphs, and adults. Larvae caught by flagging generally have not yet taken a blood meal from a vertebrate host. The simplest explanation for the comparable prevalence of R. helvetica between the defined tick stages is, that R. helvetica is vertically transmitted through the next generation with high efficiency. The DNA of R. helvetica was also present in whole blood from mice, deer and wild boar. Conclusion Besides R. helvetica, unexpected rickettsiae are found in I. ricinus ticks. We propose that I. ricinus is a major reservoir host for R. helvetica, and that vertebrate hosts play important roles in the further geographical dispersion of rickettsiae.

  1. Effect of salivary gland extract from Ixodes ricinus ticks on the proliferation of Borrelia burgdorferi sensu stricto in vivo

    Czech Academy of Sciences Publication Activity Database

    Macháčková, Martina; Oborník, Miroslav; Kopecký, Jan

    2006-01-01

    Roč. 53, č. 2 (2006), s. 153-158. ISSN 0015-5683 R&D Projects: GA ČR GA524/05/0811 Grant ostatní: Studentská grantová agentura, Biologická fakulta Jihočeské univerzity(CZ) SGA2004/009 Institutional research plan: CEZ:AV0Z60220518 Keywords : Borrelia burgdorferi * Ixodes ricinus * saliva -activated transmission Subject RIV: EC - Immunology Impact factor: 1.511, year: 2006

  2. Detection of Ehrlichia phagocytophila DNA in Ixodes ricinus Ticks from Areas in Switzerland Where Tick-Borne Fever Is Endemic

    OpenAIRE

    Pusterla, Nicola; Huder, Jon B.; Lutz, Hans; Braun, Ueli

    1998-01-01

    A total of 1,523 adult Ixodes ricinus ticks were collected from regions where bovine ehrlichiosis is endemic and were examined for Ehrlichia phagocytophila via PCR. Of the ticks from cattle with ehrlichiosis, the ticks from healthy cattle, and the free-living ticks, 26.5% (18 of 68), 4.4% (35 of 802), and 0.8% (5 of 653), respectively, were positive.

  3. Functional expression and characterization of cathepsin B and L from the gut of the tick Ixodes ricinus

    Czech Academy of Sciences Publication Activity Database

    Franta, Zdeněk; Pěničková, Helena; Dvorak, J.; Schneider, E. I.; Horn, Martin; Mareš, Michael; Sojka, Daniel; McKerrow, J. H.; Caffrey, C. R.; Kopáček, Petr

    2009-01-01

    Roč. 276, S1 (2009), s. 309-309. ISSN 1742-464X. [34th FEBS Congress: Life's Molecular Interactions. 04.07.2009-09.07.2009, Prague] R&D Projects: GA AV ČR IAA600960910; GA MŠk(CZ) LC06009 Institutional research plan: CEZ:AV0Z60220518; CEZ:AV0Z40550506 Keywords : cathepsin B and L * Ixodes ricinus * functionl expresssion Subject RIV: EB - Genetics ; Molecular Biology

  4. Identification de facteurs des glandes salivaires d’Ixodes ricinus impliqués dans la transmission de Bartonella henselae

    OpenAIRE

    Liu, Xiangye

    2013-01-01

    Ticks are obligate blood-feeding ectoparasites of many hosts including mammals, birds and reptiles. After mosquitoes, they are the most important vectors worldwide, and are able to transmit the highest variety of pathogens including virus, bacteria and parasites. Ixodes ricinus (Acari: Ixodidae), the most common tick species in Europe, is a three-life stage hard tick. It is frequently associated with bites in humans, and transmits several pathogens, including Tick-Borne Encephalitis, Babesia ...

  5. Two ways of experimental infection of Ixodes ricinus ticks (Acari: Ixodidae) with spirochetes of Borrelia burgdorferi sensu lato complex

    Czech Academy of Sciences Publication Activity Database

    Fišerová, Lenka; Černá, Kateřina; Horká, Helena; Kopecký, Jan

    2008-01-01

    Roč. 55, č. 2 (2008), s. 150-154. ISSN 0015-5683 R&D Projects: GA ČR GA524/05/0811; GA MŠk(CZ) LC06009 Institutional research plan: CEZ:AV0Z60220518 Keywords : Lyme disease spirochete * Borrelia burgdorferi * Borrelia baronii * Borrelia afzelii * tick * Ixodes ricinus Subject RIV: EC - Immunology Impact factor: 1.307, year: 2008

  6. Transesterification of triacetin and castor oil with methanol catalyzed by supported polyaniline-sulfate. A role of polymer morphology

    Czech Academy of Sciences Publication Activity Database

    Drelinkiewicz, A.; Kalemba-Jaje, Z.; Lalik, E.; Zieba, A.; Mucha, D.; Konyushenko, Elena; Stejskal, Jaroslav

    2013-01-01

    Roč. 455, 30 March (2013), s. 92-106. ISSN 0926-860X Institutional support: RVO:61389013 Keywords : transesterification * triacetin * castor oil Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.674, year: 2013

  7. Multiplication par marcottage de l'arbre à pain Artocarpus communis var. Apyrenna

    Directory of Open Access Journals (Sweden)

    Kibungu Kembelo, AO.

    1992-01-01

    Full Text Available Trials of multiplication by means of layering of the bread tree Artocarpus communis var. Apyrenna. The bread tree, introduced in Zaire near 1910, suscitates hopes as ornemental as well as food plant. Up to now, it has been propagated by means of piping of parts of the roots. In spite of very satisfactory results, this ancient method harms the plant's general state (condition. On the other hand, layering has shown during trials that it also gives good results, with the supplementary advantage that it embellishes the tree by enabling it to keep a nice look and a balanced production. The layers, moreover, grow quickly and produce fruit in less than three years instead of the five years required by roots ' piping.

  8. Influence of growth retardants on the development of Gladiolus communis L. plants

    Directory of Open Access Journals (Sweden)

    Marcelo Ferraz de Campos

    2010-09-01

    Full Text Available Treatments involving plant growth retardants were studied in sword lily plants (Gladiolus communis L. spp. to evaluate plant height, number of leaves and flower buds, stem diameter, and flower stalk length. The experimental design was a completely randomized layout, with four replicates and seven treatments (control; applications of mepiquat chloride at 200mg.L-1, 3 and 6 times; chlormequat chloride at 200mg.L-1, 3 and 6 times; and ethephon at 200mg.L-1, 3 and 6 times. Seven non-destructive evaluations were made every 7 days, in addition to a final collection. The ethephon treatments caused reductions in plant height and flower stalk length, and decreased stem diameter. The chlormequat chloride treatment also decreased plant stem diameter.

  9. Commelina communis L.:Copper Hyperaccumulator Found in Anhui Province of China

    Institute of Scientific and Technical Information of China (English)

    TANGSHIRONG; HUANGCHANGYONG; 等

    1997-01-01

    Commelina communis L. growing over some new copper mining wastelangds at Bijiashan,Tongling City of Anhui Province,China,was found to be a copper hyperaccumulator,Its copper concentrations were 2707-6159( 4439±2434) mg kg-1 ,369-831,(731±142)mg kg-1 ,and 429-587(547±57)mg kg-1 ,respectively,in the roots,stems,and leaves.The soils supporting the growth of the species had a copper concentration ranging from 4620 to 5020 mg kg-1 and averaging 4835±262 mg kg-1 ,suggesting that the species could not only grow on heavily copper-contaminated soils but aslo accumulate extraordinarily high concentration of copper, thus,it shows great potential in the phytoremediation of copper-contaminated soils,the restoration of mined land,geochemical prospecting ,and the study of environmental pollution changes.

  10. Micropropagation of Pear Rootstock (Pyrus Communis) by using tissue culture technique and gamma irradiation

    International Nuclear Information System (INIS)

    New growing shoots from healthy pear rootstock (Pyrus communis) trees were taken and sterilized 3 times in dipping water. Explants were subjected to antioxidant treatment, different media, different additives and different BAP and NAA concentrations. The obtained results showed that Murashig-Skoog (MS) supplemented with 1 mg/l BA was better than Gamborg medium. Adding antioxidant solution and adenine sulphate to the culture medium was preferred for maximizing explants development. Exposing the explants to gamma irradiation at different doses decreased tissue culture parameters with increasing gamma doses. However, the low dose of gamma rays (1 Krad) significantly increased the number of shoots than other gamma treatments. Adding of BAP at 2 mg/l to the culture medium increased number and length of shoots. However, addition of 1 mg/l NAA to the rooting medium led to increase the root formation

  11. Toxicological effects of ammonia on gills of Cyprinus carpio var. communis (Linn.)

    Institute of Scientific and Technical Information of China (English)

    Senthamilselvan Devaraj; Chezhian Arulprakasam; Arul Pandian Kandhan; Kabilan Neelamegam; Rajalakshmi Kalaiselvan

    2014-01-01

    Objective:To monitor the response of gills of Cyprinus carpio var. communis to LC50 levels of ammonia over a period of 96 h by bath exposure, using scanning electron microscopy (SEM). Methods: Cyprinus carpio procured from a local fish farm in Vadalore, Cuddalore District, Tamil Nadu, India were acclimatized under laboratory conditions for 20 d. Fish were placed into experimental tanks with 20 L of water and 22 mg/L ammonia. A total of 10 fish were collected from each experimental tank every 24 h for histopathological studies. Results:Histopathological studies showed these changes in the gills:secondary lamellar fusion, haemorrhage, oedema, epithelial hyperplasia, and chloride cell proliferation. Occasionally, multifocal necrosis of inter-lamellar regions of gill filaments but with no apparent haemorrhage was observed under electron microscopy. Conclusion:The present study shows that histopathological and ultrastructural alterations in gills are useful indicators for ammonia toxicity in Cyprinus carpio.

  12. In vitro degradability and total gas production of biodiesel chain byproducts used as a replacement for cane sugar feed

    Directory of Open Access Journals (Sweden)

    Milenna Nunes Moreira

    2014-09-01

    Full Text Available This study aimed to determine the in vitro degradability of dry matter and the total gas production of oil seed press cake from biodiesel production (Gossypium hirsutum L., Helianthus annuus L., Ricinus communis, Moringa oleífera L. and Pinhão manso curcas L. at four different levels of replacement (0, 30, 50, and 70% for cane sugar (Saccharum officinarum RB. in ruminant feed. Inocula were prepared using the ruminal fluid of three Holstein cows, and data were collected after 48 hours of incubation. The byproducts of Moringa had the highest degradability, and castor presented the lowest values at all evaluated levels of replacement. Castor bean byproduct showed the highest total gas production, cotton showed the lowest production, and the byproduct of Moringa at the 70% level showed the best ruminal fermentation results. These results demonstrate that the use of oil seed press cake from biodiesel production (Helianthus annuus L. and Ricinus communis can replace cane sugar in ruminant feed.

  13. Synthesis and Physicochemical Behaviour of Polyurethane-Multiwalled Carbon Nanotubes Nanocomposites Based on Renewable Castor Oil Polyols

    OpenAIRE

    2014-01-01

    Polyurethanes (PUs) are high performance materials, with vast industrial and engineering applications. In this research, effects of Multiwalled Carbon Nanotubes (MWCNTs) on physicochemical properties of Castor Oil based Polyurethanes (COPUs) were studied. MWCNTs were added in different weight percentages (0% to 1% wt) in a castor oil based polyurethane (COPUs-MWCNTs) nanocomposites. The composition, structure, and morphology of polyurethanes were characterized by Fourier transform infrared sp...

  14. Polyols Prepared from Ring-Opening Epoxidized Soybean Oil by a Castor Oil-Based Fatty Diol

    OpenAIRE

    Jing Zhang; Ji Jun Tang; Jiao Xia Zhang

    2015-01-01

    Several biorenewable vegetable oil-based polyols with different molecular weights and various hydroxyl functionalities were successfully prepared by ring-opening epoxidized soybean oil with a castor oil-based fatty diol. It was found that several factors, including reaction time, reaction temperature, and molar ratios between epoxidized soybean oil and castor oil diol, affect structures and rheology behaviors of the final polyols. Proton NMR, FT-IR, GPC, and rheometry results revealed that th...

  15. Phytochemical analysis,hypotensive effect and antioxidant properties of Myrtus communis L.growing in Algeria

    Institute of Scientific and Technical Information of China (English)

    Amel; Bouaziz; Seddik; khennouf; Mussa; Abu; zarga; Shtaywy; Abdalla; Abderahmane; Baghiani; Noureddine; Charef

    2015-01-01

    Objective:To analyze Myrlus communis chemically and evaluate the hypotensive effects and antioxidant properties of methanol,chloroform,ethyl acetate and aqueous extracts from the leaves of this plant.Methods:Total phenolic and flavonoid contents as well as the antioxidant potential of methanol,chloroform,ethyl acetate and aqueous extracts have been investigated by using different in vitro methods.The hypotensive effects of methanol and ethyl acetate extracts were evaluated in anaesthetized rats by using the method of invasive blood pressure recording.Moreover,ethyl acetate extract was subjected to analysis by different chromatographic methods in order to identify new compounds.Results:Chemical analysis of ethyl acetate extract revealed the presence of myrecitin-3-O-α-rhamnoside.Ethyl acetate extract was found to have the highest total phenolic and total flavonoid contents with the values of 435.37 ma gallic acid equivalents/g dried weight and 130.75 mg quercetin equivalent/g dried weight,respectively.Ethyl acetate extract also exhibited the highest activity in scavenging 2.2-diphenyl-1-picrylhydrazyl.2,2’-azinobis-(3-ethylbenzthiazoline-6-sulfonic acid),hydroxy]radical and reducing power:whereas,methanol extract exhibited higher chelating activity than ethyl acetate extract did.Chloroform was found to be strong inhibitor of lipid peroxidation in β-carotene bleaching assay(91.19%).ferric thiocyanate method(87.55%).and thiobarbituric acid method(82.59%) as compared to butylated hydroxytoluene.Intravenous administration of methanol and ethyl acetate extract(0.04 to 12 mg/kg body weight) decreased the maximum mean arterial blood pressure with values of 20.6%and 32.49%at 12 mg/kg body weight,respectively in anesthetized rats.Conclusions:This study provides a scientific basis for the use of Myruts communis in traditional medicine as hypertensive agent as well as additional resources for natural antioxidants.

  16. Organic Matter and Barium Absorption by Plant Species Grown in an Area Polluted with Scrap Metal Residue

    Directory of Open Access Journals (Sweden)

    Cleide Aparecida Abreu

    2012-01-01

    Full Text Available The effect of organic matter addition on Ba availability to Helianthus annuus L., Raphanus sativus L., and Ricinus communis L. grown on a Neossolo Litólico Chernossólico fragmentário (pH 7.5, contaminated with scrap residue was evaluated. Four rates (0, 20, 40, and 80 Mg ha−1, organic carbon basis of peat or sugar cane filter, with three replicates, were tested. Plant species were grown until the flowering stage. No effect of organic matter addition to soil on dry matter yield of oilseed radish shoots was observed, but there was an increase in sunflower and castor oil plant shoots when sugar cane filter cake was used. The average Ba transferred from roots to shoots was more than 89% for oilseed radish, 71% for castor oil plants, and 59% for sunflowers. Organic matter treatments were not efficient in reducing Ba availability due to soil liming.

  17. Fatty acid methyl esters (FAMEs) from castor oil: Production process assessment and synergistic effects in its properties

    Energy Technology Data Exchange (ETDEWEB)

    Canoira, Laureano; Garcia Galean, Juan; Alcantara, Ramon [Department of Chemical Engineering and Fuels, ETS Ingenieros de Minas, Universidad Politecnica de Madrid, Rios Rosas 21, 28003 Madrid (Spain); Lapuerta, Magin; Garcia-Contreras, Reyes [Maquinas y Motores Termicos, ETS Ingenieros Industriales, Universidad de Castilla La Mancha, Avda. Camilo Jose Cela s/n, 13071 Ciudad Real (Spain)

    2010-01-15

    Fatty acid methyl esters (FAMEs) from castor oil have been synthesized by methanolysis catalyzed by sodium methoxide and the optimal transesterification conditions have been found. However, some properties of the castor FAME render it unsuitable in pure state for its direct use as fuel in internal combustion engines. Thus, blends with reference diesel have been prepared and their properties have been evaluated. Among these properties, the oxidative stability of the blends shows a negative anti-synergistic effect, that is, all the blends have an induction period lower than the pure reference diesel and the pure castor FAME. On the contrary, the lubricity shows a positive synergistic effect, the wear scar of the blends being always lower than those of the pure components. The cold-filter plugging point of the blends shows also a singular effect, since the filterability remains identical to that of the reference diesel until around 50 vol% of castor FAME has been blended with it. The blends of castor FAME and reference diesel until approximately 40 vol% of castor FAME meet most of the specifications of the EN 590 standard. (author)

  18. Determination of the status of Phragmites communis within the Fish Springs marsh and a determination of an economic means of control: Final report

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This report discusses approaches to controlling marsh cane Phragmites communis at Fish Springs National Wildlife Refuge. The objectives of this study include: 1...

  19. Occurrence of Babesia spp., Rickettsia spp. and Bartonella spp. in Ixodes ricinus in Bavarian public parks, Germany

    Directory of Open Access Journals (Sweden)

    Mahling Monia

    2011-07-01

    Full Text Available Abstract Background Only limited information is available about the occurrence of ticks and tick-borne pathogens in public parks, which are areas strongly influenced by human beings. For this reason, Ixodes ricinus were collected in public parks of different Bavarian cities in a 2-year survey (2009 and 2010 and screened for DNA of Babesia spp., Rickettsia spp. and Bartonella spp. by PCR. Species identification was performed by sequence analysis and alignment with existing sequences in GenBank. Additionally, coinfections with Anaplasma phagocytophilum were investigated. Results The following prevalences were detected: Babesia spp.: 0.4% (n = 17, including one pool of two larvae in 2009 and 0.5 to 0.7% (n = 11, including one pool of five larvae in 2010; Rickettsia spp.: 6.4 to 7.7% (n = 285, including 16 pools of 76 larvae in 2009. DNA of Bartonella spp. in I. ricinus in Bavarian public parks could not be identified. Sequence analysis revealed the following species: Babesia sp. EU1 (n = 25, B. divergens (n = 1, B. divergens/capreoli (n = 1, B. gibsoni-like (n = 1, R. helvetica (n = 272, R. monacensis IrR/Munich (n = 12 and unspecified R. monacensis (n = 1. The majority of coinfections were R. helvetica with A. phagocytophilum (n = 27, but coinfections between Babesia spp. and A. phagocytophilum, or Babesia spp. and R. helvetica were also detected. Conclusions I. ricinus ticks in urban areas of Germany harbor several tick-borne pathogens and coinfections were also observed. Public parks are of particularly great interest regarding the epidemiology of tick-borne pathogens, because of differences in both the prevalence of pathogens in ticks as well as a varying species arrangement when compared to woodland areas. The record of DNA of a Babesia gibsoni-like pathogen detected in I. ricinus suggests that I. ricinus may harbor and transmit more Babesia spp. than previously known. Because of their high recreational value for human beings, urban green

  20. Application of In vitro Tissue Culture Techniques for Propagation of Amygdalus communis L. Cultivars, Garrigues and Yaltsinki

    OpenAIRE

    Haki Yapar; Canan Can; Mehmet Ozaslan; Turkan Aytekin; Halit Atli

    2006-01-01

    Almond (Amygdalus communis L.) is planted and naturally spreads in the Southeastern Anatolian region where some hybrid varieties are cultivated and the adaptation studies have still been continued. Although being easily propagated through grafting, plantation in large areas may have some problems, due to the environmental stress. Embryos, nodal segmets of mature shoots and shoot tips of two A. communis L. cultivars, Garrigues and Yaltsinki, were cultured on MS media supplemented with several ...

  1. Analysis of quality of the biogasoils of palm oil and castor oil

    International Nuclear Information System (INIS)

    Biodiesel is a fuel made from raw materials of renewable origin such as vegetable oils. The objective of this work is to make a quality analysis of two types of biodiesel made from raw materials available in Colombia such as palm oil and castor oil. Biodiesel from palm oil complies with the majority of technical requirements specified by ASTM standards D-975 y D-6751. A high cloud point is the main drawback of this kind of biodiesel. This is a consequence of its highly saturated chemical nature. On the other hand, biodiesel from castor oil presents more difficulties in order to be used in diesel engines because of having a low cetane index and a high viscosity

  2. Comparison of lubricant properties of castor oil and commercial engine oil

    Directory of Open Access Journals (Sweden)

    Binfa Bongfa

    2015-06-01

    Full Text Available The tribological performance of crude Nigeria-based castor oil has been investigated and compared with that of a foreign, 20W-50 high quality crankcase oil, to see its suitability as base oil for lubricating oils in indigenous vehicle and power plants engines. The experiment was conducted using a four ball tester. The results showed that unrefined castor oil has superior friction reduction and load bearing capability in an unformulated form than the commercial oil; can compete favourably with the commercial oil in wear protection when formulated with suitable antiwear agent, hence can be a good alternative base stock for crankcase oils suitable for Nigeria serviced vehicles, and plants engines from tribological, environmental, and non-food competitive points of view.

  3. Production and characterization of MDF using eucalyptus fibers and castor oil-based polyurethane resin

    Directory of Open Access Journals (Sweden)

    Campos Cristiane Inácio de

    2004-01-01

    Full Text Available The growing popularity of wooden panels renders this market segment increasingly competitive. MDF (Medium Density Fiberboard, in particular, is widely employed for a variety of applications, including civil construction, furniture, and packaging. This paper discusses a study of MDF produced from alternative raw materials, i.e., Eucalyptus fibers and castor-oil-based polyurethane resin. Physical and mechanical tests were performed to determine the MDF's modulus of elasticity and modulus of rupture in static bending tests, its swelling, water absorption, moisture and density. The results of the physical and mechanical characterization of this laboratory-produced MDF are discussed and compared with the Euro MDF Board standard. MDF produced with eucalyptus fiber and castor-oil-based polyurethane resin presents results very satisfactory.

  4. Large spatial self-phase modulation in castor oil enhanced by gold nanoparticles

    Science.gov (United States)

    Alencar, Márcio A. R. C.; Nascimento, César M.; Chávez-Cerda, Sabino; da Silva, Monique G. A.; Meneghetti, Mario R.; Hickmann, Jandir M.

    2006-02-01

    Spatial self-phase modulation was observed when a CW laser beam propagated along a cell containing castor oil. The minimum power needed to excite this effect decreases when the sample length is increased, as well as when the laser wavelength approaches to the absorption band of the medium. The same phenomenon was also observed when a laser beam interacts with a colloidal solution of gold nanoparticles in castor oil. For this system the self-phase modulation minimum power decreased dramatically, which indicates that the nonlinear refractive index for this system is enhanced due to the gold nanoparticles. Moreover, for laser wavelength near to the plasmon resonance of the gold nanoparticles, this enhancement factor is even higher. Although the large value of those media nonlinearity, its temporal response is slow. This fact suggests that this phenomenon is due to thermal effects mainly.

  5. Comments on edge turbulence during lower hybrid current drive experiment on CASTOR tokamak

    International Nuclear Information System (INIS)

    Edge plasma electrostatic turbulence is discussed from the point of view of its role in inducing anomalous particle transport. Preliminary results are presented of plasma edge fluctuation measurements obtained in the CASTOR tokamak by using the Langmuir probe technique. The level of edge turbulence found is sufficiently high to explain the anomalous particle losses observed in the ohmic heting regime of the tokamak discharge. On the other hand, it decreases appreciably during the combined lower hybrid current drive and ohmic heating regimes, the particle confinement time simultaneously increasing about twice. Thus, the fluctuation induced transport seems to be responsible for the anomalous particle transport in the CASTOR tokamak. (J.U.). 10 figs., 26 refs

  6. Analyses to demonstrate the thermal performance of the CASTOR KN12

    Energy Technology Data Exchange (ETDEWEB)

    Diersch, R.; Weiss, M. [Gesellschaft fuer Nuklear-Behaelter mbH (Germany); Tso, C.F.; Powell, D. [Arup (United Kingdom); Choy, B.I.; Lee, H.Y. [KHNP-NETEC (Korea)

    2004-07-01

    The CASTOR {sup registered} KN-12 is a new cask design of GNB for dry and wet transportation of up to 12 PWR spent nuclear fuel assemblies in Korea. It complies with the requirements of 10 CFR 71 [1] and IAEA ST-1 [2] for TYPE B(U)F packages. It received its transport license from the Korean Competent Authority KINS in July 2002 and is now in use in South Korea. Demonstration of the cask's compliance with the regulatory requirements in the area of thermal performance has been carried out by a combination of testing carried out by Korea Atomic Energy Research Institute and analyses carried out by Arup. This paper describes the analyses to demonstrate the thermal performance of the cask and compliance with regulatory requirements under normal and hypothetical accident conditions of transport. Other aspects of the design of the CASTOR {sup registered} KN12 are presented in other papers at this conference.

  7. Characterization of adhesive of polyurethane from castor oil by FTIR, TGA and XRD

    International Nuclear Information System (INIS)

    Castor oil polyurethanes are an alternative to adhesives that emanate volatile compounds. This adhesive come from a renewable source and has very low toxicity. In this work the microstructural and thermal characterization is presented. This material is partially crystalline. The mass loss start at 240 deg C and the glass transition temperature is 60 deg C. Then the adhesive is adequate to be employed at temperatures lower than 60 deg C. (author)

  8. Field anaesthetic and surgical techniques for implantation of intraperitoneal radio transmitters in Eurasian beavers Castor fiber

    OpenAIRE

    Ranheim, Birgit; Rosell, Frank; Haga, Henning Andreas; Arnemo, Jon Martin

    2004-01-01

    Radio transmitters were implanted intraperitoneally in 22 (nine females, 13 males) adult, territorial Eurasian beavers Castor fiber under field conditions. Two different injectable anaesthestic drug combinations were tested. Access to the peritoneal cavity was made through a ventral midline incision. The animals in group # 1 (N = 10) were initially injected with medetomidine (0.05 mg/kg), ketamine (5 mg/kg) and butorphanol (0.1 mg/kg). Three animals needed additional injections of the drug co...

  9. Glutathione Preservation during Storage of Rat Lenses in Optisol-GS and Castor Oil

    DEFF Research Database (Denmark)

    Holm, Thomas; Brøgger-Jensen, Martin Rocho; Johnson, Leif;

    2013-01-01

    Glutathione concentration in the lens decreases in aging and cataractous lenses, providing a marker for tissue condition. Experimental procedures requiring unfrozen lenses from donor banks rely on transportation in storage medium, affecting lens homeostasis and alterations in glutathione levels....... The aim of the study was to examine the effects of Optisol-GS and castor oil on lens condition, determined from their ability to maintain glutathione concentrations....

  10. Optimum Operating Conditions for Epoxidation Reaction of Jojoba and Castor Oils

    Directory of Open Access Journals (Sweden)

    El-Adly R. A

    2014-03-01

    Full Text Available The goal of this paper is to determine the best set of parameters such as, glacial acetic acid to ethylenic unsaturation mole ratio (acid/ethylene, hydrogen peroxide to ethylenic unsaturation mole ratio (H2O2/ethylene and temperature on epoxidation conversion based on experimental results, with respect to time. The effect of these parameters has been studied in a separate set of experiments. Their ranges were as follows: 0.2-0.8Wt%, 0.75-3Wt%, and 40oC-80oC respectively. Six models have been introduced to indicate the effect of these three variables on conversion for both jojoba and castor oil, and the prediction abilities of the resultant models were tested. Regression analysis is used to extract the introduced non linear models. In addition, two new correlations have been introduced to incorporate all the studied variables and their effect on conversion simultaneously for both jojoba and castor oil. An optimization program has been introduced to determine the optimum operating conditions for maximum conversion for both jojoba and castor oil. The study shows that, the maximum conversion for epoxidized jojoba oil (66% could be achieved at acid/ethylene ratio: 0.4, H2O2/ethylene ratio: 1.44; temp: 66.5 and time is 8hr. While the maximum conversion for epoxidized castor oil (53.24% could be achieved at acid/ethylene ratio: 0.37; H2O2/ethylenes ratio: 1.32; temp: 61 and time is 8hr. the model results are strongly agreed with the experimental results.

  11. Accelerated artificial aging of particleboards from residues of CCB treated Pinus sp. and castor oil resin

    OpenAIRE

    Marília da Silva Bertolini; Francisco Antonio Rocco Lahr; Maria Fátima do Nascimento; José Augusto Marcondes Agnelli

    2013-01-01

    Tests simulating exposure to severe weather conditions have been relevant in seeking new applications for particleboard. This study aimed to produce particleboards with residues of CCB (chromium-copper-boron oxides) impregnated Pinus sp. and castor oil-based polyurethane resin, and to evaluate their performance before and after artificial accelerated aging. Panels were produced with different particle mass, resin content and pressing time, resulting eight treatments. Particles moisture and si...

  12. Production and Characterization of Biodiesel Using Nonedible Castor Oil by Immobilized Lipase from Bacillus aerius

    OpenAIRE

    2015-01-01

    A novel thermotolerant lipase from Bacillus aerius was immobilized on inexpensive silica gel matrix. The immobilized lipase was used for the synthesis of biodiesel using castor oil as a substrate in a solvent free system at 55°C under shaking in a chemical reactor. Several crucial parameters affecting biodiesel yield such as incubation time, temperature, substrate molar ratio, and amount of lipase were optimized. Under the optimized conditions, the highest biodiesel yield was up to 78.13%. Th...

  13. Formation of convective cells in the scrape-off layer of the Castor tokamak

    International Nuclear Information System (INIS)

    We describe experiments with a biased electrode inserted into the scrape-off layer (SOL) of the CASTOR tokamak. The resulting radial and poloidal electric field and plasma density modification are measured by means of Langmuir probe arrays with high temporal and spatial resolutions. Poloidally and radially localized stationary structures of the electric field (convective cells) are identified and a related significant modification of the particle transport in the SOL is observed. (authors)

  14. Castor oil and commercial thermoplastic polyurethane membranes modified with polyaniline: a comparative study

    OpenAIRE

    José Humberto Santos Almeida Júnior; Daniel Assumpção Bertuol; Alvaro Meneguzzi; Carlos Arthur Ferreira; Franco Dani Rico Amado

    2013-01-01

    The study of conducting polymeric membranes is decisive in some areas, as in fuel cells and electrodialysis. This work aims the study of membranes using conventional and conductive polymers blends. Two types of polyurethane were used as conventional polymers, commercial thermoplastic polyurethane and polyurethane synthesized from castor oil and 4-4-dicyclohexylmethane isocyanate. Two kinds of conducting polymers were used, polyaniline doped with organic acid and a self doped polyaniline. The ...

  15. Antimicrobial action of sodium hypochlorite and castor oil solutions for denture cleaning – in vitro evaluation

    Directory of Open Access Journals (Sweden)

    Marcela Moreira SALLES

    2015-01-01

    Full Text Available The objective of this in vitro study was to evaluate the antimicrobial action of sodium hypochlorite (0.25% and 0.50% and 10% castor oil solutions against specific microorganisms, by counting Colony Forming Units (CFU of clinically important bacteria and Candida species. Acrylic resin specimens (n = 320; Lucitone 550 were obtained from square metal matrices (10 x 10 x 2 mm, sterilized by microwave (650W, for 6 minutes and contaminated by Staphylococcus aureus, Pseudomonas aeruginosa, Candida albicans, Bacillus subtilis, Escherichia coli, Streptococcus mutans, Enterococcus faecalisand Candida glabrata. The specimens were immersed for 20 minutes in one of the following hygiene solutions (n = 10/each: A – 0.25% Sodium hypochlorite; B – 0.5% Sodium hypochlorite; C – 10% Castor oil solution; and D (Control – saline. Adhered cells were suspended and inoculated into a selective solid medium (37ºC for 24 h. The Student’s t-test (α = 0.05 was performed to compare log10(CFU+1/mL between Groups C and D. The results showed that sodium hypochlorite (0.25% and 0.5% completely eliminated all detectable microorganisms. The castor oil solution eliminatedB. subtilisand reduced counts for other strains. Differences between C and D were significant (p E. faecalis. Both sodium hypochlorite solutions (0.25% and 0.5% were effective in eliminating all microorganisms evaluated, and may be useful as cleaning solutions for complete dentures. The castor oil solution provided moderate efficacy and performed differently on the tested species, with the strongest effect on B. subtilis and with non-significant action on E. faecalis.

  16. Graphite–castor oil polyurethane composite electrode surfaces – AFM morphological and electrochemical characterisation

    OpenAIRE

    Chiorcea-Paquim, Ana-Maria; Diculescu, Victor Constantin; Cervini, Priscila; Cavalheiro, Eder Tadeu Gomes; Brett, Ana Maria Oliveira

    2014-01-01

    Graphite–castor oil polyurethane composite electrodes with different graphite weight percentages, 30–70% graphite–polyurethane w w−1, were morphologically studied by atomic force microscopy (AFM) and voltammetry. AFM images and r.m.s. roughness measurements demonstrated that the polyurethane roughness decreased with increasing the graphite content, composites of 50% and 60% graphite–polyurethane w w−1 showing the smother electrode surface. The electrochemical characterisation was performed in...

  17. Production and characterization of MDF using eucalyptus fibers and castor oil-based polyurethane resin

    OpenAIRE

    Campos Cristiane Inácio de; Lahr Francisco Antonio Rocco

    2004-01-01

    The growing popularity of wooden panels renders this market segment increasingly competitive. MDF (Medium Density Fiberboard), in particular, is widely employed for a variety of applications, including civil construction, furniture, and packaging. This paper discusses a study of MDF produced from alternative raw materials, i.e., Eucalyptus fibers and castor-oil-based polyurethane resin. Physical and mechanical tests were performed to determine the MDF's modulus of elasticity and modulus of ru...

  18. Isocyanate-Functionalized Chitin and Chitosan as Gelling Agents of Castor Oil

    OpenAIRE

    Franco, José M.; Rocío Gallego; Jesús F. Arteaga; Concepción Valencia

    2013-01-01

    The main objective of this work was the incorporation of reactive isocyanate groups into chitin and chitosan in order to effectively use the products as reactive thickening agents in castor oil. The resulting gel-like dispersions could be potentially used as biodegradable lubricating greases. Three different NCO–functionalized polymers were obtained: two of them by promoting the reaction of chitosan with 1,6-hexamethylene diisocyanate (HMDI), and the other by using chitin instead of chitosan....

  19. Alternative castor oil-based polyurethane adhesive used in the production of plywood

    OpenAIRE

    2004-01-01

    Plywood is normally produced with urea-formaldehyde and/or phenol-formaldehyde adhesives. However, the former is considerably toxic and environmentally damaging, while the latter is expensive, thus motivating the search for alternative raw materials in plywood production. The castor oil-based polyurethane adhesive developed at the São Carlos Institute of Chemistry, University of São Paulo, is an environmentally friendly vegetal oil-based polymer that is harmless to humans. The wood species Eu...

  20. Effect of microwave-assisted system on transesterification of castor oil with ethanol

    OpenAIRE

    Gina M. Hincapié1, Sabine Valange2, Joël Barrault2, Jorge A. Moreno1, Diana P. López1

    2014-01-01

    Abstract A systematic study of microwave-assisted transesterification of castor oil was conducted in the presence of ethanol and of potassium hydroxide as catalyst. Effects of various reaction parameters such as reaction time, catalyst concentration, reaction temperature and ethanol-oil molar ratio were analyzed. Ethyl esters were successfully produced by microwave-assisted transesterification. The maximum yield was 80.1% at 60°C, 10:1 alcohol: oil molar ratio, 1.5% potassium hydroxide...