Effects of Eutectic Si Particles on Mechanical Properties and Fracture Toughness of Cast A356 Aluminum Alloys

International Nuclear Information System (INIS)

Lee, Kyu Hong; Lee, Sung Hak; Kwon, Yong Nam

2007-01-01

The present study aims at investigating the effects of eutectic Si particles on mechanical properties and fracture toughness of three A356 aluminum alloys. These A356 alloys were fabricated by casting processes such as rheo-casting, squeeze-casting, and casting-forging, and their mechanical properties and fracture toughness were analyzed in relation with microfracture mechanism study. All the cast A356 alloys contained eutectic Si particles mainly segregated along solidification cells, and the distribution of Si particles was modified by squeeze-casting and casting-forging processes. Microfracture observation results showed that eutectic Si particles segregated along cells were cracked first, but that aluminum matrix played a role in blocking crack propagation. Tensile properties and fracture toughness of the squeeze cast and cast-forged alloys having homogeneous distribution of eutectic Si particles were superior to those of the rheo-cast alloy. In particular, the cast-forged alloy had excellent hardness, strength, ductility, and fracture toughness because of the matrix strengthening and homogeneous distribution of eutectic Si particles due to forging process

Effect of Forging Parameters on Low Cycle Fatigue Behaviour of Al/Basalt Short Fiber Metal Matrix Composites

Directory of Open Access Journals (Sweden)

R. Karthigeyan

2013-01-01

Full Text Available This paper deals with metal matrix composites (MMCs of Al 7075 alloy containing different weight percentage (2.5, 5, 7.5, and 10 basalt short fiber reinforcement and unreinforced matrix alloy. The samples were produced by the permanent stir casting technique. The casting ingots were cut into blanks to be forged in single stage and double stage, using MN press and graphite-based lubricant. The microstructures and fatigue properties of the matrix alloy and MMC samples were investigated in the as cast state and in the single and double stage forging operations. The microstructure results showed that the forged sample had a uniform distribution of the basalt short fiber throughout the specimens. Evaluation of the fatigue properties showed that the forged samples had higher values than those of the as cast counterparts. After forging, the enhancement of the fatigue strength of the matrix alloy was so significant and high in the case of 2.5 and 5.0 wt. percentage basalt short fiber reinforced MMC, and there was no enhancement in 7.5 and 10 weight percentages short fiber reinforced MMCs. The fracture damage was mainly due to decohesion at the matrix-fiber interface.

Effect of forging parameters on low cycle fatigue behaviour of Al/basalt short fiber metal matrix composites.

Science.gov (United States)

Karthigeyan, R; Ranganath, G

2013-01-01

This paper deals with metal matrix composites (MMCs) of Al 7075 alloy containing different weight percentage (2.5, 5, 7.5, and 10) basalt short fiber reinforcement and unreinforced matrix alloy. The samples were produced by the permanent stir casting technique. The casting ingots were cut into blanks to be forged in single stage and double stage, using MN press and graphite-based lubricant. The microstructures and fatigue properties of the matrix alloy and MMC samples were investigated in the as cast state and in the single and double stage forging operations. The microstructure results showed that the forged sample had a uniform distribution of the basalt short fiber throughout the specimens. Evaluation of the fatigue properties showed that the forged samples had higher values than those of the as cast counterparts. After forging, the enhancement of the fatigue strength of the matrix alloy was so significant and high in the case of 2.5 and 5.0 wt. percentage basalt short fiber reinforced MMC, and there was no enhancement in 7.5 and 10 weight percentages short fiber reinforced MMCs. The fracture damage was mainly due to decohesion at the matrix-fiber interface.

Ductile fracture evaluation of ductile cast iron and forged steel by nonlinear-fracture-mechanics. Pt. 1. Tensile test by large scaled test pieces with surface crack

International Nuclear Information System (INIS)

Kosaki, Akio; Ajima, Tatsuro; Inohara, Yasuto

1999-01-01

The ductile fracture tests of Ductile Cast Iron and Forged Steel under a tensile stress condition were conducted using large-scaled flat test specimens with a surface crack and were evaluated by the J-integral values, in order to propose an evaluation method of initiation of ductile fracture of a cask body with crack by nonlinear-fracture-mechanics. Following results were obtained. 1) 1 -strain relations of Ductile Cast Iron and Forged Steel under the tensile stress condition were obtained, which is necessary for the development of J-integral design curves for evaluating the initiation of ductile fracture of the cask body. 2) In case of Ductile Cast Iron, the experimental J-integral values obtained from strain-gauges showed a good agreement with the linear-elastic-theory by Raju and Newman at room temperature, in both elastic and plastic regions. But, at 70degC in plastic region, the experimental i-integral values showed middle values between those predicted by the linear-elastic-theory and by the non- linear-elastic- theory (based on the fully plastic solution by Yagawa et al.). 3) In case of Forged Steel at both -25degC and room temperature, the experimental i-integral values obtained from strain-gauges showed a good agreement with those predicted by the linear-elastic-theory by Raju and Newman, in the elastic region. In the plastic region, however, the experimental i-integral values fell apart from the curve predicted by the linear-elastic-theory by Raju and Newman, and also approached to those by the non-linear-elastic-theory with increasing strain.(author)

High-Temperature Oxidation Behavior and Kinetics of Forged 12Cr-MoVW Steel

Directory of Open Access Journals (Sweden)

Kim Yong Hwan

2017-06-01

Full Text Available The oxidation kinetics of forged 12Cr-MoVW steel was investigated in an air (N2+O2 atmosphere at 873-1073 K (Δ50 K using thermogravimetric analysis. The oxidized samples were characterized using X-ray diffraction, and the surface and cross-sectional morphologies were examined using scanning electron microscopy coupled with energy-dispersive X-ray spectroscopy. The forged 12Cr-MoVW steel samples exhibited parabolic behavior and a low oxidation rate compared with their as-cast counterparts. A protective oxide layer was uniformly formed at relatively low temperature (≤973 K for the forged samples, which thus exhibited better oxidation resistance than the as-cast ones. These oxides are considered solid-solution compounds such as (Fe, Cr2O3.

Forging of cast Mg-3Sn-2Ca-0.4Al-0.4Si magnesium alloy using processing map

International Nuclear Information System (INIS)

Rao, K. P.; Suresh, K.; Prasad, Y. V. R. K.; Hort, N.; Kainer, K. U.

2016-01-01

Mg-3Sn-2Ca (TX32) alloy has good creep resistance but limited workability. Minor amounts of Al and Si have been added to TX32 for improving its hot workability. The processing map for the TX32-0.4Al-0.4Si alloy exhibited two workability domains in the temperature and strain rate ranges: (1) 310-415.deg.C/0.0003-0.003 s-1 and (2) 430-500.deg.C/0.003-3 s-1. The alloy exhibited flow instability at temperatures < 350.deg.C at strain rates > 0.01 s-1. The alloy has been forged to produce a cup shape component to validate these findings of processing map. Finite-element (FE) simulation has been performed for obtaining the local variations of strain and strain rate within the forging. The microstructures of the forged components under the optimal domain conditions revealed dynamically recrystallized grains, and those forged in the flow instability regime have fractured and exhibited flow localization bands and cracks. The experimental load stroke curves correlated well with those obtained by FE simulation.

Forging of cast Mg-3Sn-2Ca-0.4Al-0.4Si magnesium alloy using processing map

Energy Technology Data Exchange (ETDEWEB)

Rao, K. P.; Suresh, K.; Prasad, Y. V. R. K. [University of Hong Kong, Hong Kong (China); Hort, N.; Kainer, K. U. [Magnesium Innovation Centre, Geesthacht (Germany)

2016-06-15

Mg-3Sn-2Ca (TX32) alloy has good creep resistance but limited workability. Minor amounts of Al and Si have been added to TX32 for improving its hot workability. The processing map for the TX32-0.4Al-0.4Si alloy exhibited two workability domains in the temperature and strain rate ranges: (1) 310-415.deg.C/0.0003-0.003 s-1 and (2) 430-500.deg.C/0.003-3 s-1. The alloy exhibited flow instability at temperatures < 350.deg.C at strain rates > 0.01 s-1. The alloy has been forged to produce a cup shape component to validate these findings of processing map. Finite-element (FE) simulation has been performed for obtaining the local variations of strain and strain rate within the forging. The microstructures of the forged components under the optimal domain conditions revealed dynamically recrystallized grains, and those forged in the flow instability regime have fractured and exhibited flow localization bands and cracks. The experimental load stroke curves correlated well with those obtained by FE simulation.

Physical modeling and numerical simulation of V-die forging ingot with central void

DEFF Research Database (Denmark)

Christiansen, Peter; Hattel, Jesper Henri; Bay, Niels

2014-01-01

Numerical simulation and physical modeling performed on small-scale ingots made from pure lead, having a hole drilled through their centerline to mimic porosity, are utilized to characterize the deformation mechanics of a single open die forging compression stage and to identify the influence...... of the lower V-die angle on porosity closure and forging load requirements of large cast ingots. Results show that a lower V-die angle of 120 provides the best closure of centerline porosity without demanding the highest forging loads or developing unreasonably asymmetric shapes that may create difficulties...... in multi-stage open die forging procedures....

Thin wall ductile iron casting as a substitute for aluminum alloy casting in automotive industry

Directory of Open Access Journals (Sweden)

M. Górny

2009-01-01

Full Text Available In paper it is presented thin wall ductile iron casting (TWDI as a substitute of aluminium alloy casting. Upper control arm made of ductile iron with wall thickness ranging from 2 – 3.7 mm was produced by inmold process. Structure, mechanical properties and computer simulations were investigated. Structural analysis of TWDI shows pearlitic-ferritic matrix free from chills and porosity. Mechanical testing disclose superior ultimate tensile strength (Rm, yield strength (Rp0,2 and slightly lower elongation (E of TWDI in comparison with forged control arm made of aluminium alloy (6061-T6. Moreover results of computer simulation of static loading for tested control arms are presented. Analysis show that the light-weight ductile iron casting can be loaded to similar working conditions as the forged Al alloy without any potential failures.

A Casting Yield Optimization Case Study: Forging Ram

DEFF Research Database (Denmark)

Kotas, Petr; Tutum, Cem Celal; Hattel, Jesper Henri

2010-01-01

This work summarizes the findings of multi-objective optimization of a gravity sand-cast steel part for which an increase of the casting yield via riser optimization was considered. This was accomplished by coupling a casting simulation software package with an optimization module. The benefits...... of this approach, recently adopted in foundry industry world wide and based on fully automated computer optimization, were demonstrated. First, analyses of filling and solidification of the original casting design were conducted in the standard simulation environment to determine potential flaws and inadequacies...

Titanium Aluminide Casting Technology Development

Science.gov (United States)

Bünck, Matthias; Stoyanov, Todor; Schievenbusch, Jan; Michels, Heiner; Gußfeld, Alexander

2017-12-01

Titanium aluminide alloys have been successfully introduced into civil aircraft engine technology in recent years, and a significant order volume increase is expected in the near future. Due to its beneficial buy-to-fly ratio, investment casting bears the highest potential for cost reduction of all competing production technologies for TiAl-LPTB. However, highest mechanical properties can be achieved by TiAl forging. In view of this, Access e.V. has developed technologies for the production of TiAl investment cast parts and TiAl die cast billets for forging purposes. While these parts meet the highest requirements, establishing series production and further optimizing resource and economic efficiency are present challenges. In order to meet these goals, Access has recently been certified according to aircraft standards, aiming at qualifying parts for production on technology readiness level 6. The present work gives an overview of the phases of development and certification.

Microstructure-based assessment of creep rupture behaviour of cast-forged P91 steel

Energy Technology Data Exchange (ETDEWEB)

Pandey, Chandan, E-mail: chandanpy.1989@gmail.com [Department of Mechanical and Industrial Engineering, Indian Institute of Technology Roorkee, Uttrakhand 247667 (India); Mahapatra, M.M. [School of Mechanical Sciences, Indian Institute of Technology Bhubaneswar, Odisha 751013 (India); Kumar, Pradeep; Vidyrathy, R.S. [Department of Mechanical and Industrial Engineering, Indian Institute of Technology Roorkee, Uttrakhand 247667 (India); Srivastava, A. [Senior Engineer, HEEP Section, BHEL Haridwar (India)

2017-05-17

The work presented in this study was performed with the intent to characterize the microstructure evolution for short term creep exposure of cast-forged P91 steel. The short-term creep test was performed at temperature range of 620–650 °C and stresses ranging from 120 to 200 MPa. To characterize the sample after creep exposure, field emission scanning electron microscopy (FESEM) with energy dispersive X-ray spectroscopy (EDS), optical microscope and micro-hardness testing were utilized. Creep tests were performed on round creep specimens. For low temperature service condition, longer creep life was obtained. The fracture surface of creep ruptured specimen were characterized by using the FESEM. The transgranular fracture mode was noticed in all the tests condition. The creep rupture life was found to be decreased with increase in applied stress. The maximum rupture life was measured about to be 3329.28 h for the sample exposed at 620 °C for 120 MPa. A negligible microstructural change was measured in gripping area compared to the gauge area (necking area) of crept sample. The laves phase formation was also noticed along the grain boundaries for creep exposure life of 3329.28 h.

Microstructure-based assessment of creep rupture behaviour of cast-forged P91 steel

International Nuclear Information System (INIS)

Pandey, Chandan; Mahapatra, M.M.; Kumar, Pradeep; Vidyrathy, R.S.; Srivastava, A.

2017-01-01

The work presented in this study was performed with the intent to characterize the microstructure evolution for short term creep exposure of cast-forged P91 steel. The short-term creep test was performed at temperature range of 620–650 °C and stresses ranging from 120 to 200 MPa. To characterize the sample after creep exposure, field emission scanning electron microscopy (FESEM) with energy dispersive X-ray spectroscopy (EDS), optical microscope and micro-hardness testing were utilized. Creep tests were performed on round creep specimens. For low temperature service condition, longer creep life was obtained. The fracture surface of creep ruptured specimen were characterized by using the FESEM. The transgranular fracture mode was noticed in all the tests condition. The creep rupture life was found to be decreased with increase in applied stress. The maximum rupture life was measured about to be 3329.28 h for the sample exposed at 620 °C for 120 MPa. A negligible microstructural change was measured in gripping area compared to the gauge area (necking area) of crept sample. The laves phase formation was also noticed along the grain boundaries for creep exposure life of 3329.28 h.

Numerical optimization of die geometry in open die forging

DEFF Research Database (Denmark)

Christiansen, Peter; Hattel, Jesper Henri; Bay, Niels

2013-01-01

This paper deals with numerical optimization of open die forging of large metallic ingots made by casting implying risk of defects, e.g. central pores. Different material hardening properties and die geometries are combined in order to investigate, which geometry gives rise to maximum closure...

Study on Manufacturing Process of Hollow Main Shaft by Open Die Forging

International Nuclear Information System (INIS)

Kwon, Yong Chul; Kang, Jong Hun; Kim, Sang Sik

2016-01-01

The main shaft is one of the key components connecting the rotor hub and gear box of a wind power generator. Typically, main shafts are manufactured by open die forging method. However, the main shaft for large MW class wind generators is designed to be hollow in order to reduce the weight. Additionally, the main shafts are manufactured by a casting process. This study aims to develop a manufacturing process for hollow main shafts by the open die forging method. The design of a forging process for a solid main shaft and hollow shaft was prepared by an open die forging process design scheme. Finite element analyses were performed to obtain the flow stress by a hot compression test at different temperature and strain rates. The control parameters of each forging process, such as temperature and effective strain, were obtained and compared to predict the suitability of the hollow main shaft forging process. Finally, high productivity reflecting material utilization ratio, internal quality, shape, and dimension was verified by the prototypes manufactured by the proposed forging process for hollow main shafts

Study on Manufacturing Process of Hollow Main Shaft by Open Die Forging

Energy Technology Data Exchange (ETDEWEB)

Kwon, Yong Chul [Gyeongnam Technopark, Changwon (Korea, Republic of); Kang, Jong Hun [Jungwon Univ., Goisan (Korea, Republic of); Kim, Sang Sik [Gyeongsang Natiional Univ., Jinju (Korea, Republic of)

2016-02-15

The main shaft is one of the key components connecting the rotor hub and gear box of a wind power generator. Typically, main shafts are manufactured by open die forging method. However, the main shaft for large MW class wind generators is designed to be hollow in order to reduce the weight. Additionally, the main shafts are manufactured by a casting process. This study aims to develop a manufacturing process for hollow main shafts by the open die forging method. The design of a forging process for a solid main shaft and hollow shaft was prepared by an open die forging process design scheme. Finite element analyses were performed to obtain the flow stress by a hot compression test at different temperature and strain rates. The control parameters of each forging process, such as temperature and effective strain, were obtained and compared to predict the suitability of the hollow main shaft forging process. Finally, high productivity reflecting material utilization ratio, internal quality, shape, and dimension was verified by the prototypes manufactured by the proposed forging process for hollow main shafts.

Tensile properties of a dual-axial forged Ti–Fe–Cu alloy containing boron

Energy Technology Data Exchange (ETDEWEB)

Zadorozhnyy, V.Yu., E-mail: zadorozhnyyvlad@gmail.com [National University of Science and Technology “MISIS”, Leninsky prospect, 4, Moscow 119049 (Russian Federation); Institute for Materials Research, Tohoku University, Katahira 2-1-1, Aoba-Ku, Sendai 980-8577 (Japan); Shchetinin, I.V.; Chirikov, N.V. [National University of Science and Technology “MISIS”, Leninsky prospect, 4, Moscow 119049 (Russian Federation); Louzguine-Luzgin, D.V. [WPI Advanced Institute for Materials Research, Tohoku University, Katahira 2-1-1, Aoba-Ku, Sendai 980-8577 (Japan)

2014-09-22

In the present work we introduce a micro/nano-structured α+β Ti-based low-alloy produced by the tilt-casting method and subjected to subsequent thermo-mechanical treatment. After hot dual-axial forging at 900 °C, subsequent heating at 700 °C and water quenching a Ti{sub 94}Fe{sub 3}Cu{sub 3}+1000 ppm of boron alloy, containing inexpensive alloying elements, showed an ultimate tensile strength value of about 950 MPa and percentage elongation of about 5.2%. It is shown that the intensive forging treatment and subsequent heat treatment are leading to significantly improved mechanical properties of such an alloy compared to the as-cast state.

Evolution of A-Type Macrosegregation in Large Size Steel Ingot After Multistep Forging and Heat Treatment

Science.gov (United States)

Loucif, Abdelhalim; Ben Fredj, Emna; Harris, Nathan; Shahriari, Davood; Jahazi, Mohammad; Lapierre-Boire, Louis-Philippe

2018-06-01

A-type macrosegregation refers to the channel chemical heterogeneities that can be formed during solidification in large size steel ingots. In this research, a combination of experiment and simulation was used to study the influence of open die forging parameters on the evolution of A-type macrosegregation patterns during a multistep forging of a 40 metric ton (MT) cast, high-strength steel ingot. Macrosegregation patterns were determined experimentally by macroetch along the longitudinal axis of the forged and heat-treated ingot. Mass spectroscopy, on more than 900 samples, was used to determine the chemical composition map of the entire longitudinal sectioned surface. FORGE NxT 1.1 finite element modeling code was used to predict the effect of forging sequences on the morphology evolution of A-type macrosegregation patterns. For this purpose, grain flow variables were defined and implemented in a large scale finite element modeling code to describe oriented grains and A-type segregation patterns. Examination of the A-type macrosegregation showed four to five parallel continuous channels located nearly symmetrical to the axis of the forged ingot. In some regions, the A-type patterns became curved or obtained a wavy form in contrast to their straight shape in the as-cast state. Mass spectrometry analysis of the main alloying elements (C, Mn, Ni, Cr, Mo, Cu, P, and S) revealed that carbon, manganese, and chromium were the most segregated alloying elements in A-type macrosegregation patterns. The observed differences were analyzed using thermodynamic calculations, which indicated that changes in the chemical composition of the liquid metal can affect the primary solidification mode and the segregation intensity of the alloying elements. Finite element modeling simulation results showed very good agreement with the experimental observations, thereby allowing for the quantification of the influence of temperature and deformation on the evolution of the shape of the

Forging Oxide-Dispersion-Strengthened Superalloys

Science.gov (United States)

Harf, F. H.; Glasgow, T. K.; Moracz, D. J.; Austin, C. M.

1986-01-01

Cladding of mild steel prevents surface cracking when alloy contacts die. Continual need for improvements in properties of alloys capable of withstanding elevated temperatures. Accomplished by using oxide-dispersion-strengthed superalloys such as Inconel Alloy MA 6000. Elevated tensile properties of forged alloy equal those of hot-rolled MA 6000 bar. Stress-rupture properties somewhat lower than those of bar stock but, at 1,100 degrees C, exceed those of strongest commercial single crystal, directionally solidified and conventionally cast superalloys.

Dome style heavy wall steel casting manufactured by metallic core mould system

International Nuclear Information System (INIS)

Yamamoto, Shiro; Saeki, Keiji; Hirose, Yutaka; Takebayashi, Kazunari; Kawasaki, Masatoshi

1986-01-01

Semi-spherical thick walled steel castings are one of the main products of Nippon Chutanko K.K., but there have been the problems of internal defects peculiar to large thick walled steel castings, and the various improvements have been carried out so far for the manufacturing method, but still some of those remains. Based on the anxiety about the reliability of large steel castings, the conversion to forging has been studied. For the purpose of thoroughly improving the internal quality of thick walled steel castings to compete with forgings, on the basis of the operating experience of chills, the development of the casting techniques changing cores completely to metallic cores has been advanced. After the preliminary experiment using models, a semi-spherical thick walled steel casting mentioned before was manufactured by this metallic core casting method for trial, and the detailed investigation was carried out. As the result, the excellent internal quality was confirmed, accordingly at present, the production is made by this method. The form, dimensions and specification of the semi-spherical thick walled steel castings, the conventional casting plan, the metallic core casting plan, the design of metallic cores, molding and casting, and the examination of the castings made for trial are reported. (Kako, I.)

Modelling the void deformation and closure by hot forging of ingot castings

DEFF Research Database (Denmark)

Christiansen, Peter; Hattel, Jesper Henri; Kotas, Petr

2012-01-01

by mechanical deformation. The aim of this paper is to analyze numerically if and to what degree the voids areclosed by the forging. Using the commercial simulation software ABAQUS, both simplified model ingots and physically manufactured ingots containing prescribed void distributions are deformed and analyzed....... The analysis concernsboth the void density change and the location of the voids in the part after deformation. The latter can be important for the subsequent reliability of the parts, for instance regarding fatigue properties. The analysis incorporates the Gurson yield criterion for metals containing voids...... and focuses on how the voids deform depending on their size and distribution in the ingot as well ashow the forging forces are applied....

Mechanical properties of Zr-2.5Nb pressure tube material manufactured employing forging routes for PHWR700 - Part 1: tensile behavior

International Nuclear Information System (INIS)

Bind, A.K.; Singh, R.N.; Sunil, Saurav; Chakravartty, J.K.; Ghosh, Agnish; Dhandharia, Priyesh; More, Nitin S.; Vijayakumar, S.; Chhatre, A.G.

2012-01-01

Tensile properties of Zr-2.5Nb alloy tubes produced employing forging to break the cast structure were evaluated by carrying out uni-axial tension test at temperatures between 25 and 325 degC and under strain-rate of 1.075 x 10 -4 /s for both longitudinal and transverse specimens. Both strength and elongation values were comparable for the samples obtained from front and back end of the tube. Transverse samples showed higher strength and lower uniform elongation values as compared to longitudinal samples. The yield strength of double forged material at 25 degC is higher than the PHWR700 specification of a maximum value of 586 MPa. (author)

Characteristics comparison of weld metal zones welded to cast and forged steels for piston crown material

Science.gov (United States)

Moon, Kyung-Man; Kim, Yun-Hae; Lee, Myeong-Hoon; Baek, Tae-Sil

2015-03-01

An optimum repair welding for the piston crown which is one of the engine parts exposed to the combustion chamber is considered to be very important to prolong the engine lifetime from an economical point of view. In this study, two types of filler metals such as 1.25Cr-0.5Mo, 0.5Mo were welded with SMAW method and the other two types of filler metals such as Inconel 625 and 718 were welded with GTAW method, respectively, and the used base metals were the cast and forged steels of the piston crown material. The weld metal zones welded with Inconel 625 and 718 filler metals exhibited higher corrosion resistance compared to 1.25Cr-0.5Mo and 0.5Mo filler metals. In particular, the weld metal zone welded with Inconel 718 and 0.5Mo, filler metals indicated the best and worst corrosion resistance, respectively. Consequently, it is suggested that the corrosion resistance of the weld metal zone surely depends on the chemical components of each filler metal and welding method irrespective of the types of piston crown material.

Manufacturing of Precision Forgings by Radial Forging

International Nuclear Information System (INIS)

Wallner, S.; Harrer, O.; Buchmayr, B.; Hofer, F.

2011-01-01

Radial forging is a multi purpose incremental forging process using four tools on the same plane. It is widely used for the forming of tool steels, super alloys as well as titanium- and refractory metals. The range of application goes from reducing the diameters of shafts, tubes, stepped shafts and axels, as well as for creating internal profiles for tubes in Near-Net-Shape and Net-Shape quality. Based on actual development of a weight optimized transmission input shaft, the specific features of radial forging technology is demonstrated. Also a Finite Element Model for the simulation of the process is shown which leads to reduced pre-processing effort and reduced computing time compared to other published simulation methods for radial forging. The finite element model can be applied to quantify the effects of different forging strategies.

Methods of forging steel

OpenAIRE

Pečoler, Primož

2014-01-01

The following work presents processes of steel forming, challenges when forging steel, forming machines suitable for forging and which choice of machine is most suitable for forging. We can separate steel forming to free forging and drop forging. Free forging can be divided to hand forging and machine forging. The correct choice of furnaces is also very important. We must reach correct temperature in the furnace for raw steel to melt with less scalings. In diploma I mentioned some machine...

Comparison study of multistep forging and injection forging of automobile fasteners

OpenAIRE

Chen Senyong; Qin Yi

2015-01-01

In order to improve production efficiency, injection forging as a feasible approach was introduced to automobile fasteners production. In the study reported in this paper, two forging approaches, traditional multistep forging and injection forging, were analysed by using a finite element method. Using ABAQUS and DEFORM, some significant factors, namely, forging force, energy consumption, component accuracy and stress distribution in the die, were compared to explore the potential and challeng...

2016 Accomplishments. Tritium aging studies on stainless steel. Forging process effects on the fracture toughness properties of tritium-precharged stainless steel

Energy Technology Data Exchange (ETDEWEB)

Morgan, Michael J. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

2017-01-01

Forged austenitic stainless steels are used as the materials of construction for pressure vessels designed to contain tritium at high pressure. These steels are highly resistant to tritium-assisted fracture but their resistance can depend on the details of the forging microstructure. During FY16, the effects of forging strain rate and deformation temperature on the fracture toughness properties of tritium-exposed-and-aged Type 304L stainless steel were studied. Forgings were produced from a single heat of steel using four types of production forging equipment – hydraulic press, mechanical press, screw press, and high-energy-rate forging (HERF). Each machine imparted a different nominal strain rate during the deformation. The objective of the study was to characterize the J-Integral fracture toughness properties as a function of the industrial strain rate and temperature. The second objective was to measure the effects of tritium and decay helium on toughness. Tritium and decay helium effects were measured by thermally precharging the as-forged specimens with tritium gas at 34.5 MPa and 350°C and aging for up to five years at -80°C to build-in decay helium prior to testing. The results of this study show that the fracture toughness properties of the as-forged steels vary with forging strain rate and forging temperature. The effect is largely due to yield strength as the higher-strength forgings had the lower toughness values. For non-charged specimens, fracture toughness properties were improved by forging at 871°C versus 816°C and Screw-Press forgings tended to have lower fracture toughness values than the other forgings. Tritium exposures reduced the fracture toughness values remarkably to fracture toughness values averaging 10-20% of as-forged values. However, forging strain rate and temperature had little or no effect on the fracture toughness after tritium precharging and aging. The result was confirmed by fractography which indicated that fracture modes

Effect of forging process on microstructure, mechanical and corrosion properties of biodegradable Mg-1Ca alloy

International Nuclear Information System (INIS)

Harandi, Shervin Eslami; Hasbullah Idris, Mohd; Jafari, Hassan

2011-01-01

Research highlights: → Forging temperature demonstrates more pronounced effect compared to forging speed. → Precipitation of Mg 2 Ca phase at grain boundaries accelerates corrosion rate. → Forging process doesn't provide the corrosion resistance required for bone healing. -- Abstract: The performance of Mg-1Ca alloy, a biodegradable metallic material, may be improved by hot working in order that it may be of use in bone implant applications. In this study, Mg-1Ca cast alloy was preheated to different temperatures before undergoing forging process with various forging speeds. Macro- and microstructure of the samples were examined by stereo and scanning electron microscopes (SEM) equipped with energy dispersive X-ray spectroscopy (EDS), respectively. To determine the mechanical properties of the alloy, hardness value and plastic deformation ability of the samples were measured. To investigate the corrosion behaviour of the alloy, immersion and electrochemical tests were performed on the samples in simulated body fluid and the corrosion products were characterized by SEM/EDS. The results showed that increasing forging temperature decreased grain size led to improved hardness value and plastic deformation ability of the alloy, whereas no significant effect was observed by changing forging speed. Moreover, forging at higher temperatures led to an increase in the amount of Mg 2 Ca phase at grain boundaries resulted in higher corrosion rates. It can be concluded that although forging process improved the mechanical properties of the alloy, it does not satisfy the corrosion resistance criteria required for bone healing.

Open die forging of large shafts with porosity defects – physical and numerical modelling

DEFF Research Database (Denmark)

Christiansen, Peter; Hattel, Jesper Henri; Bay, Niels

2013-01-01

The aim and scope of this paper is centered to analyze the influence of the geometry of V-shaped dies on the closure of internal centerline porosity defects in ingots during multistep open-die forging. The investigation is performed with small scale physical models made from lead using V-shaped d......The aim and scope of this paper is centered to analyze the influence of the geometry of V-shaped dies on the closure of internal centerline porosity defects in ingots during multistep open-die forging. The investigation is performed with small scale physical models made from lead using V......-shaped dies with 90o and 120o and a reference pair of flat parallel platens. Holes drilled through the center of these preforms are produced to mimic centerline porosity in full scale cast ingots and intermediate rotation of the preforms replicate a multi-stage forging sequence under laboratory testing...

Reparation of damaged forging dies

Directory of Open Access Journals (Sweden)

Vukić Lazić

2015-03-01

Full Text Available The forging dies are in exploitation exposed to elevated temperatures and variable impact loads, both compressive and shear. Steels for manufacturing of these tools must endure those loads while maintaining mechanical properties and being resistant to wear and thermal fatigue. For those reasons, the alloyed steels are used for making the forging dies, though they have less weldability, because alloying increases proneness to hardening. Any reparatory hard facing (HF of the damaged dies would require the specially adjusted technology to the particular piece. In this paper reparatory hard facing of dies used for forging pieces in the automobile industry is considered. Prior to reparatory hard facing of the real tools, numerous experimental hard facings on models were performed. All the model hard facings were done on the same steels which were used for production of the real forging dies. To define the optimal hard facing technology one needs to derive the optimal combination of the adequate heat treatment(s, to select the proper filler metals and the welding procedure. The established optimal HF technology was applied to real forging dies whose service life was further monitored in conditions of exploitation

Dicty_cDB: CFJ816 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CF (Link to library) CFJ816 (Link to dictyBase) - - - Contig-U16255-1 CFJ816P (Link... to Original site) CFJ816F 562 CFJ816Z 721 CFJ816P 1263 - - Show CFJ816 Library CF (Link to library) Clone ID CFJ816 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...ATGSATGQGTSGGTPGSCDKV NCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSHTTTGGSTTGSHTTT...PATGSATGQGTSGGTPGSCDKV NCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSHTTTGGSTTGSHTTTG GSTTGSHTTTGGSTTGSHTTTGGS

38 CFR 8.16 - Conversion of a 5-year level premium term policy as provided for under § 1904 of title 38 U.S.C.

Science.gov (United States)

2010-07-01

... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Conversion of a 5-year level premium term policy as provided for under § 1904 of title 38 U.S.C. 8.16 Section 8.16 Pensions... Plan § 8.16 Conversion of a 5-year level premium term policy as provided for under § 1904 of title 38 U...

30 CFR 816.151 - Primary roads.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Primary roads. 816.151 Section 816.151 Mineral... roads. Primary roads shall meet the requirements of section 816.150 and the additional requirements of this section. (a) Certification. The construction or reconstruction of primary roads shall be certified...

30 CFR 816.181 - Support facilities.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Support facilities. 816.181 Section 816.181... § 816.181 Support facilities. (a) Support facilities shall be operated in accordance with a permit... results. (b) In addition to the other provisions of this part, support facilities shall be located...

Effect of forging on mechanical properties of rice husk ash-silicon carbide reinforced Al1100 hybrid composites

Science.gov (United States)

Ghanaraja, S.; Gireesha, B. L.; Ravikumar, K. S.; Likith, P.

2018-04-01

During the past few years, material design has changed prominence to pursue light weight, environment friendliness, low cost, quality, higher service temperature, higher elastic modulus, improved wear resistance and performance. Straight monolithic materials have limitations in achieving the above decisive factors. To overcome these limitations and to convince the ever increasing demand of modern day technology, Attention has been shifted towards Metal Matrix Composites (MMC). Stir casting route is most hopeful for synthesizing discontinuous reinforcement aluminium matrix composites because of its relative simplicity and easy adaptability with all shape casting process used in metal casting industry. Hybridization of metal matrix composites is the introduction of more than one type/kind, size and shape of reinforcement during processing of composites. It is carried out to obtain synergistic properties of different reinforcements and matrix used, which may not be rea1ised in monolithic alloy or in conventional monocomposites. The present study involves synthesis of hybrid composites by addition of the desired amount of Silicon Carbide (SiC) and Rice Husk Ash (RHA) particles in to the molten Al 1100-Mg alloy through stir casting technique fallowed by hot forging of the cast composites. The influence of increasing in the wt% (3, 6, 9, 12 and 15 wt%) of SiC particles addition (3 wt% Rice husk ash kept constant) on evolution of microstructure is studied through XRD and SEM and their impact on the mechanical properties like hardness and tensile strength of the resulting forged hybrid composites has been investigated.

Development of fabrication technology for copper canisters with cast inserts. Status report in August 2001

Energy Technology Data Exchange (ETDEWEB)

Andersson, Claes-Goeran

2002-04-01

This report contains an account of the results of trial fabrication of copper canisters with cast inserts carried out during the period 1998 - 2001. The work of testing of fabrication methods is being focused on a copper thickness of 50 mm. Occasional canisters with 30 mm copper thickness are being fabricated for the purpose of gaining experience and evaluating fabrication and inspection methods for such canisters. For the fabrication of copper tubes, SKB has concentrated its efforts on seamless tubes made by extrusion and pierce and draw processing. Five tubes have been extruded and two have been pierced and drawn during the period. Materials testing has shown that the resultant structure and mechanical properties of these tubes are good. Despite certain problems with dimensional accuracy, it can be concluded that both of these methods can be developed for use in the serial production of SKB' copper tubes. No new trial fabrication with roll forming of copper plate and longitudinal welding has been done. This method is nevertheless regarded as a potential alternative. Copper lids and bottoms are made by forging of continuous-cast bars. The forged blanks are machined to the desired dimensions. Due to the Canister Laboratory's need for lids to develop the technique for sealing welding, a relatively large number of forged blanks have been fabricated. It is noted in the report that the grain size obtained in lids and bottoms is much coarser than in fabricated copper tubes. Development work has been commenced for the purpose of optimizing the forging process. Nine cast inserts have been cast during the three-year period. The results of completed material testing of test pieces taken at different places along the length of the inserts have in several cases shown an unacceptable range of variation in strength properties and structure. In the continued work, insert fabrication will be developed in terms of both casting technique and iron composition. Development

Phased array inspection of large size forged steel parts

Science.gov (United States)

Dupont-Marillia, Frederic; Jahazi, Mohammad; Belanger, Pierre

2018-04-01

High strength forged steel requires uncompromising quality to warrant advance performance for numerous critical applications. Ultrasonic inspection is commonly used in nondestructive testing to detect cracks and other defects. In steel blocks of relatively small dimensions (at least two directions not exceeding a few centimetres), phased array inspection is a trusted method to generate images of the inside of the blocks and therefore identify and size defects. However, casting of large size forged ingots introduces changes of mechanical parameters such as grain size, the Young's modulus, the Poisson's ratio, and the chemical composition. These heterogeneities affect the wave propagation, and consequently, the reliability of ultrasonic inspection and the imaging capabilities for these blocks. In this context, a custom phased array transducer designed for a 40-ton bainitic forged ingot was investigated. Following a previous study that provided local mechanical parameters for a similar block, two-dimensional simulations were made to compute the optimal transducer parameters including the pitch, width and number of elements. It appeared that depending on the number of elements, backwall reconstruction can generate high amplitude artefacts. Indeed, the large dimensions of the simulated block introduce numerous constructive interferences from backwall reflections which may lead to important artefacts. To increase image quality, the reconstruction algorithm was adapted and promising results were observed and compared with the scattering cone filter method available in the CIVA software.

Weldability and mechanical property characterization of weld clad alloy 800H tubesheet forging

International Nuclear Information System (INIS)

King, J.F.; McCoy, H.E.

1984-09-01

The weldability of an alloy 800H forging that simulates a steam generator tubesheet is studied. Weldability was of concern because a wide range of microstructures was present in this forging. The top and portions of the bottom were weld clad with ERNiC-3 weld metal to a thickness of 19 mm similar to that anticipated for HTGR steam generators. Examinations of the clad fusion line in various regions revealed no weldability problems except possibly on the bottom portion, which contained large grains and some as-cast structure. A few microfissures were evident in this region, but no excessive hot cracking tendency was observed. The tensile properties in all areas of the clad forging were reasonable and not influenced greatly by the microstructure. The elevated-temperature tests showed strong tendency for fracture in the heat-affected zone of the alloy 800H. Creep failure at 649 0 C consistently occurred in the heat-affected zone of the alloy 800H, but the creep strength exceeded the expected values for alloy 800H

Properties of a large carbon steel casting used in French PWR nuclear plant

International Nuclear Information System (INIS)

Benhamou, C.; Roux, F.; Nectoux, G.; Delorme, A.

1980-09-01

To introduce a large casting in a PWR nuclear plant migh appear detrimental to its safety when comparing with forgings or rollings. In this paper we would like to show the constant efforts of the founder in providing a product with reproducible and high quality. Furthermore a program test covering a complete investigation of a real channel head is presented; the three following aspects have been studied: characterisation of cast flaws by non destructive and destructive examination, homogeneity of casting and fatigue and use properties

Ageing of forged superaustenitic stainless steel: Precipitate phases and mechanical properties

Energy Technology Data Exchange (ETDEWEB)

Anburaj, J., E-mail: janburaj@gmail.com [Department of Metallurgical Engineering, PSG College of Technology, Coimbatore 641 004 (India); Nazirudeen, S.S. Mohamed; Narayanan, R.; Anandavel, B.; Chandrasekar, A. [Department of Metallurgical Engineering, PSG College of Technology, Coimbatore 641 004 (India)

2012-02-15

Highlights: Black-Right-Pointing-Pointer Solutionizing of 1250 Degree-Sign C and ageing of 500-1000 Degree-Sign C was done for hot forged SASS. Black-Right-Pointing-Pointer Strength and toughness increased by 25% on hot forged than the cast SASS. Black-Right-Pointing-Pointer Amounts of precipitates after ageing were evaluated by thermo-calc. Black-Right-Pointing-Pointer Sigma forms from chi at 900 Degree-Sign C and contains constant Cr and Mo contents, unlike chi. Black-Right-Pointing-Pointer Sigma is incoherent, contains high Mo and causes low toughness at 900 Degree-Sign C. - Abstract: Cast superaustenitic stainless steel (SASS), of composition 19 wt% Cr, 20 wt% Ni, 7.5 wt% Mo and 0.37 wt% N, is hot forged at 1200 Degree-Sign C. The forging was then solutionized at 1250 Degree-Sign C and aged for 1 h and 10 h at different temperatures in the range of 500-1000 Degree-Sign C. Effect of these treatments on (i) hardness and (ii) fracture toughness based on impact energy is reported. Chi is formed from low temperatures up to 800 Degree-Sign C, and sigma at temperatures above 900 Degree-Sign C. A model is proposed to illustrate the dissolution of chi and sigma in austenite at elevated temperatures. Compared with chi, sigma contains more Mo. Toughness decreased with increasing amounts of chi and sigma precipitates. However, in the temperature range of 850-950 Degree-Sign C, low toughness was observed for relatively a short ageing time, although virtually the volume of sigma phase is very low. This is attributed to the presence of incoherent sigma in austenite matrix. Fractographs of the impact-tested samples indicated an increased tendency for brittle fracture with increasing ageing temperatures (increase in sigma content). Thermodynamic calculations substantiated (i) EDS results of composition of secondary phases present in the aged SASS and (ii) the proposed model. From these studies it is concluded that sigma is enriched in Mo at 900 Degree-Sign C and can be as

Preliminary Physics Summary: Inclusive $\\Upsilon$ production in p-Pb collisions at $\\sqrt{s_{\\rm NN}} = 8.16$ TeV

CERN Document Server

2018-01-01

The inclusive $\\Upsilon$ production in p-Pb interactions at the centre-of-mass energy per nucleon-nucleon collision $\\sqrt{s_{\\rm NN}} = 8.16$ TeV is studied with the ALICE detector at the CERN LHC. The measurement has been performed reconstructing $\\Upsilon$(1S) and $\\Upsilon$(2S) mesons via their dimuon decay channel, in the centre-of-mass rapidities $2.03 < y_{\\rm cms} < 3.53$ and $-4.46 < y_{\\rm cms} < -2.96$, down to zero transverse momentum. Preliminary results on the inclusive $\\Upsilon$(1S) nuclear modification factors ($R_{\\rm pPb}$) as a function of rapidity, transverse momentum ($p_{\\rm T}$) and centrality of the collisions will be presented. The results will be compared with those obtained by ALICE in p-Pb collisions at $\\sqrt{s_{\\rm NN}} = 8.16$ TeV and with theoretical model calculations. The inclusive $\\Upsilon$(2S) $R_{\\rm pPb}$ will also be discussed and compared to the corresponding $\\Upsilon(1S)$ measurement.

Forging Long Shafts On Disks

Science.gov (United States)

Tilghman, Chris; Askey, William; Hopkins, Steven

1989-01-01

Isothermal-forging apparatus produces long shafts integral with disks. Equipment based on modification of conventional isothermal-forging equipment, required stroke cut by more than half. Enables forging of shafts as long as 48 in. (122 cm) on typical modified conventional forging press, otherwise limited to making shafts no longer than 18 in. (46cm). Removable punch, in which forged material cools after plastic deformation, essential novel feature of forging apparatus. Technology used to improve such products as components of gas turbines and turbopumps and of other shaft/disk parts for powerplants, drive trains, or static structures.

Mechanical properties of ductile cast iron and cast steel for intermediate level waste transport containers

International Nuclear Information System (INIS)

Gray, I.L.S.; Sievwright, R.W.T.; Egid, B.; Ajayi, F.; Donelan, P.

1994-01-01

UK Nirex Ltd is developing Type B re-usable shielded transport containers (RSTCs) in a range of shielding thicknesses to transport intermediate level radioactive waste (ILW) to a deep repository. The designs are of an essentially monolithic construction and rely principally on the plastic flow of their material to absorb the energies involved in impact events. Nirex has investigated the feasibility of manufacturing the RSTCs from ductile cast iron (DCI) or cast steel instead of from forgings, since this would bring advantages of reduced manufacturing time and costs. However, cast materials are perceived to lack toughness and ductility and it is necessary to show that sufficient fracture toughness can be obtained to preclude brittle failure modes, particularly at low temperatures. The mechanical testing carried out as part of that programme is described. It shows how the measured properties have been used to demonstrate avoidance of brittle fracture and provide input to computer modelling of the drop tests. (author)

The State of the Art in Cold Forging Lubrication

DEFF Research Database (Denmark)

Bay, Niels

1994-01-01

The manufature of components in steel, aluminium and copper alloys by cold forging production has increased ever since the 1950's. Typical processes are forward rod extrusion and backward can extrusion, upsetting, ironing, tube extrusion and radial extrusion. The tribological conditions in cold...... forging are extremely severe due to large surface expansion and normal pressure in the tool/workpiece interface combined with elevated tool temperatures. Except for the more simple cold forging operations successful production therefore requires advanced lubrication systems. The present paper gives...... a detailed description of the state of art for lubricant systems for cold forging of C-steels and low alloy steels as well as aluminium alloys including all the basic operations such as cleaning of the slugs, application of eventual conversion coating and lubrication. As regards cold forging of steel...

Properties of powder metallurgy steel forgings

International Nuclear Information System (INIS)

Crowson, A.; Anderson, F.E.

1977-01-01

The effects of processing variables on the mechanical properties of heat-treated powder metallurgy (P/M) steel forgings were determined. Prealloyed 4600 steel powder blended with graphite to yield 4640 was compacted into preforms and hot forged in a warm, closed die. Variables studied were preform density, method of lubrication, preform sintering (time, temperature and atmosphere), forging pressure (20 and 40 tsi) and temperature (1850 0 F, 2000 0 F and 2200 0 F), and forging ratio (0.75 and 0.95). Relationships between interconnected porosity and total porosity for the various preform densities were determined. High density compacts required higher sintering temperatures due to the restricted mobility of the reducing gases in the pores. Die wall lubrication was comparable to admixed lubrication, and it simplified powder mixing and preform sintering operations. Forgings with densities from 99 to 99.8 percent of theoretical density were attained with a forging pressure of 20 to 40 tsi and preform temperatures of 2000 0 F and above. At forging conditions which resulted in forgings with acceptable mechanical properties, complete die fill was accomplished at a forging ratio of 0.95, whereas incomplete die fill resulted at a forging ratio of 0.75. The response of P/M forgings to heat treatment was comparable to that for wrought materials, and the resultant tensile and yield strengths were equivalent to the strength values described for wrought 4640 steel in AMS specification 6317B. In addition, ductility and impact properties of P/M forgings with near theoretical density (99.5+ percent) were comparable to bar stock forgings

Development of ELID mirror surface grinding by cast iron bond grinding wheel. Ohkochi memorial technology prize; Chutetsu bond toishi ni yoru denkai inpurosesu doresshingu (ELID) kyomen kensakuho no kaihatsu. Okochi kinen gijutsusho jusho ni yosete

Energy Technology Data Exchange (ETDEWEB)

Omori, H.; Takahashi, I. [Institute of Physical and Chemical Research, Tokyo (Japan); Nakagawa, T. [The University of Tokyo, Tokyo (Japan). Institute of Industrial Science; Hagiuda, Y.; Karikome, K. [Tokyo Metropolitan College of Aeronautical Engineering, Tokyo (Japan)

1997-08-01

Development was accomplished on the electrolytic in-process dressing (ELID) mirror surface grinding process using a cast iron bonded grinding wheel. This paper describes the history of the development, which may be summarized as follows: a study was begun on powder forging of cutting chips in 1970; a research was started on powder forging of decarburized cast iron powder; developments were made on powder metallurgy of cast irons and cast iron bonded lapping tools in 1980, and cast iron bonded diamond grinding wheels were put on the market; a high-efficiency grinding process using MC and cast iron fiber-bonded grinding wheels were developed in 1985 and the grinding wheels made therefrom were put on the market; and a study was begun on the ELID grinding in 1987, and marketing was started on power supply, grinding liquid and tools for the ELID grinding process in 1990. Discussions on converting raw materials for the powder forging into cutting chips have triggered developing the cast iron bonded grinding wheel. The cast iron bonded diamond grinding wheel improves dressability and sharpness of conventional grinding wheels. The grinding wheel is fabricated by mixing carbonyl iron powder, diamond grinding grains and cast iron powder, pressing the mixture in a die, sintering it at 1140 degC, and assembling and dressing the sinter. The grinding stone can grind high-tech materials. 4 figs.

A new casting defect healing technology

Energy Technology Data Exchange (ETDEWEB)

Hodge, E.S.; Reddoch, T.W. [ForMat Industries, Inc., Knoxville, TN (United States); Viswanathan, S. [Oak Ridge National Lab., TN (United States)

1997-01-01

A new technology is presented for healing of defects in 356 aluminium alloys that provides economic upgrading of these cast alloys. It uses pneumatic isostatic forging (PIF) to produce high quality Al alloys products with enhanced mechanical properties uniform throughout the part, allowing higher design allowables and increased usage of Al alloy castings. The fundamental mechanism underlying PIF is a single mode plastic deformation process that uses isostatic application of pressures for 10-30 seconds at temperature. The process can be integrated in-line with other production operations, i.e., using the latent heat from the previous casting step. Results of applying the PIF process indicate lower cost and significant improvement in mechanical properties that rival and often exceed corresponding properties of other technologies like hot isostatic pressing and related processes. This process offers many advantages that are described in this paper in addition to presenting case histories of property enhancement by PIF and the mechanism responsible for property enhancement.

Investigation into the use of ductile cast iron and cast steel for transport containers with plastic flow shock absorbers

International Nuclear Information System (INIS)

Smith, M.J.S.; Gray, I.L.S.; Sievwright, R.W.T.; Miles, J.C.; Egid, B.; Donelan, P.

1993-01-01

UK Nirex Ltd is responsible for the development of facilities for the disposal of low and intermediate level waste in the United Kingdom, including the development of the transport facilities for this waste. As part of the development programme Nirex is examining the feasibility of manufacturing these transport containers by means of casting instead of the more usual forging process, as this would bring advantages of lower cost and shorter manufacturing time. This paper describes the programme of work to date which has been aimed at establishing the feasibility of utilizing casting as the manufacturing method for the ILW transport containers and selecting one of the materials for further development work. (J.P.N.)

Influence of S. mutans on base-metal dental casting alloy toxicity.

Science.gov (United States)

McGinley, E L; Dowling, A H; Moran, G P; Fleming, G J P

2013-01-01

We have highlighted that exposure of base-metal dental casting alloys to the acidogenic bacterium Streptococcus mutans significantly increases cellular toxicity following exposure to immortalized human TR146 oral keratinocytes. With Inductively Coupled Plasma-Mass Spectrometry (ICP-MS), S. mutans-treated nickel-based (Ni-based) and cobalt-chromium-based (Co-Cr-based) dental casting alloys were shown to leach elevated levels of metal ions compared with untreated dental casting alloys. We targeted several biological parameters: cell morphology, viable cell counts, cell metabolic activity, cell toxicity, and inflammatory cytokine expression. S. mutans-treated dental casting alloys disrupted cell morphology, elicited significantly decreased viable cell counts (p casting alloys induced elevated levels of cellular toxicity compared with S. mutans-treated Co-Cr-based dental casting alloys. While our findings indicated that the exacerbated release of metal ions from S. mutans-treated base-metal dental casting alloys was the likely result of the pH reduction during S. mutans growth, the exact nature of mechanisms leading to accelerated dissolution of alloy-discs is not yet fully understood. Given the predominance of S. mutans oral carriage and the exacerbated cytotoxicity observed in TR146 cells following exposure to S. mutans-treated base-metal dental casting alloys, the implications for the long-term stability of base-metal dental restorations in the oral cavity are a cause for concern.

Forging evaluaion of 304L stainless steel

International Nuclear Information System (INIS)

Packard, C.L.; Edstrom, C.M.

1979-01-01

The objective of this project was to evaluate and characterize the effects of various forging parameters on the metallographic structure and mechanical properties of 304L stainless steel forgings. Upset and die forgings were produced by hammer and Dynapak forging with forging temperatures ranging from 760 to 1145 0 C, upset reductions ranging from 20 to 60%, and annealing times ranging from 0 to 25 minutes at 843 0 C. The carbide precipitation behavior observed was found to be a function of forging temperature and annealing time. Higher forging temperatures were beneficial in avoiding continuous carbide precipitation and annealing at 843 0 C promoted increased carbide precipitation. The yield strength of the unannealed forgings decreased with increasing forging temperature and, with the exception of the 1145 0 C upset forgings, was significantly lowered by annealing

Fiscal 1999 achievement report on regional consortium research and development project. Regional consortium research and development of energy in its 1st year (Research and development of technologies for development and manufacture of magnesium alloys for cast and forged automotive parts); 1999 nendo jidosha muke chutanko buhin magnesium gokin no kaihatsu oyobi sono kako gijutsu no kenkyu kaihatsu seika hokokusho. 1

Energy Technology Data Exchange (ETDEWEB)

NONE

2000-03-01

The research and development efforts aim to use more magnesium alloys of high performance aboard passenger cars. In the research and development of magnesium alloys for die-casting, studies are conducted about 14 kinds of alloys with their heat treatment properties improved, all based on an Mg-9%Zn-4.5%Al-0.6%Ca alloy which is expected to be excellent in resistance to heat and corrosion. In the development of forging-oriented high-strength magnesium alloys to be excellent in withstanding a hot working process, tractive characteristics superior to those of a forged 6061 aluminum material are obtained from an annealed ZK31 alloy. In the development of a high-performance heat-resistant magnesium alloy die-casting technology, it is found that an injection speed higher than that used for the existing alloys is necessary to achieve a product quality which is sound. This is true for all heat-resistant alloys except the ZAC series. Furthermore, technologies are developed which involve the forging of high-performance magnesium alloys, high-precision high-speed wet cutting, surface reforming of the environmentally friendly type, laser beam welding, etc. (NEDO)

17 CFR 8.16 - Settlement offers.

Science.gov (United States)

2010-04-01

... Section 8.16 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION EXCHANGE PROCEDURES FOR DISCIPLINARY, SUMMARY, AND MEMBERSHIP DENIAL ACTIONS Disciplinary Procedure § 8.16 Settlement... the disciplinary committee at any time after the investigation report is completed. The disciplinary...

Modelling of defects in ingot forging

DEFF Research Database (Denmark)

Christiansen, Peter

The present report presents an investigation of the ingot forging process with special emphasis on modelling the influence of die geometry on the soundness of the ingot after hot forging. An investigation on how to model damage is also performed. The influence of the lower die angle is quantified...... angle of 130o-140o giving rise to the largest centreline porosity closure regardless of material hardening behaviour applied. Friction was found only to have minor influence on the optimum. Multi stroke forging operations have also been modelled since the ingot forging process consists of many forging...... damage. It is found that when evaluating damage only by relative density; feed size and lower die angle does not influence whether the hot forging process is successful or not. This is in disagreement with the general understanding of the ingot forging process. When evaluating ductile damage...

Forging Industry Leadtimes: An Analysis of Causes for and Solutions to Long Leadtimes for Aerospace Forgings

Science.gov (United States)

1986-09-01

Pamplet . Forging Industry Association, Cleveland-MT, uncatea. 20. Forging Industry Association, and American Society for Metals. Forging Handbook, edited... Pamplet . The Harris-Thomas Drop Forge Compnyayto--n R, undated. 43. Theeck, Michael F., TECH MOD Program Mana.er. Personal interview. Industrial Base... Brochure . Worcester MA, 3, . 125 "’ VITA Captain Stephen F. O’Neill was born on 19 June 1957 in Pittsfield, Massachusetts. He graduated from high school

The study of high-boron steel and high-boron cast iron used for shield

International Nuclear Information System (INIS)

Pan Xuerong; Lu Jixin; Wen Yaozeng; Wang Zhaishu; Cheng Jiantin; Cheng Wen; Shun Danqi; Yu Jinmu

1996-12-01

The smelting, forging, heat-treatment technology and the mechanical properties of three kinds of high-boron steels (type 1: 0.5% boron; type 2: 0.5% boron and 4% or 2% nickel; type 3: 0.5% boron, 0.5% nickel and 0.5% molybdenum) were studied. The test results show that the technology for smelting, forging and heat-treatment (1050 degree C/0.5 h water cooled + 810 degree C/1 h oil cooled) in laboratory is feasible. Being sensitive to notch, the impact toughness of high-boron steel type 1 is not steady and can not meet the technology requirements on mechanical properties. The mechanical properties of both high-boron steel type 2 and type 3 can meet the technological requirements. The smelting technology of high-boron casting iron containing 0.5% boron was researched. The tests show that this casting iron can be smelted in laboratory and its properties can basically satisfy the technology requirements. (10 refs., 6 figs., 11 tab.)

The influence of main parameters of the process of forging on the initial quality of forging for steel 35HM

International Nuclear Information System (INIS)

Banaszek, G.; Dyja, H.; Berski, S.

2001-01-01

The article discuss the effect of the main forging parameters and the selection of tools on improving the internal quality of forgings and closing up discontinuities of metallurgical origin during forging. As a result of investigations, the optimal values of the main technological parameters of forging have been determined and the application of an appropriate group of tools have been proposed for the flat die forging of forgings. (author)

Microstructure Evolution and Surface Cracking Behavior of Superheavy Forgings during Hot Forging

Directory of Open Access Journals (Sweden)

Zhenhua Wang

2018-01-01

Full Text Available In recent years, superheavy forgings that are manufactured from 600 t grade ingots have been applied in the latest generation of nuclear power plants to provide good safety. However, component production is pushing the limits of the current free-forging industry. Large initial grain sizes and a low strain rate are the main factors that contribute to the deformation of superheavy forgings during forging. In this study, 18Mn18Cr0.6N steel with a coarse grain structure was selected as a model material. Hot compression and hot tension tests were conducted at a strain rate of 10−4·s−1. The essential nucleation mechanism of the dynamic recrystallization involved low-angle grain boundary formation and subgrain rotation, which was independent of the original high-angle grain boundary bulging and the presence of twins. Twins were formed during the growth of dynamic recrystallization grains. The grain refinement was not obvious at 1150°C. A lowering of the deformation temperature to 1050°C resulted in a fine grain structure; however, the stress increased significantly. Crack-propagation paths included high-angle grain boundaries, twin boundaries, and the insides of grains, in that order. For superheavy forging, the ingot should have a larger height and a smaller diameter.

New Trends in Forging Technologies

Science.gov (United States)

Behrens, B.-A.; Hagen, T.; Knigge, J.; Elgaly, I.; Hadifi, T.; Bouguecha, A.

2011-05-01

Limited natural resources increase the demand on highly efficient machinery and transportation means. New energy-saving mobility concepts call for design optimisation through downsizing of components and choice of corrosion resistant materials possessing high strength to density ratios. Component downsizing can be performed either by constructive structural optimisation or by substituting heavy materials with lighter high-strength ones. In this context, forging plays an important role in manufacturing load-optimised structural components. At the Institute of Metal Forming and Metal-Forming Machines (IFUM) various innovative forging technologies have been developed. With regard to structural optimisation, different strategies for localised reinforcement of components were investigated. Locally induced strain hardening by means of cold forging under a superimposed hydrostatic pressure could be realised. In addition, controlled martensitic zones could be created through forming induced phase conversion in metastable austenitic steels. Other research focused on the replacement of heavy steel parts with high-strength nonferrous alloys or hybrid material compounds. Several forging processes of magnesium, aluminium and titanium alloys for different aeronautical and automotive applications were developed. The whole process chain from material characterisation via simulation-based process design to the production of the parts has been considered. The feasibility of forging complex shaped geometries using these alloys was confirmed. In spite of the difficulties encountered due to machine noise and high temperature, acoustic emission (AE) technique has been successfully applied for online monitoring of forging defects. New AE analysis algorithm has been developed, so that different signal patterns due to various events such as product/die cracking or die wear could be detected and classified. Further, the feasibility of the mentioned forging technologies was proven by means

Forging process design for risk reduction

Science.gov (United States)

Mao, Yongning

In this dissertation, forging process design has been investigated with the primary concern on risk reduction. Different forged components have been studied, especially those ones that could cause catastrophic loss if failure occurs. As an effective modeling methodology, finite element analysis is applied extensively in this work. Three examples, titanium compressor disk, superalloy turbine disk, and titanium hip prosthesis, have been discussed to demonstrate this approach. Discrete defects such as hard alpha anomalies are known to cause disastrous failure if they are present in those stress critical components. In this research, hard-alpha inclusion movement during forging of titanium compressor disk is studied by finite element analysis. By combining the results from Finite Element Method (FEM), regression modeling and Monte Carlo simulation, it is shown that changing the forging path is able to mitigate the failure risk of the components during the service. The second example goes with a turbine disk made of superalloy IN 718. The effect of forging on microstructure is the main consideration in this study. Microstructure defines the as-forged disk properties. Considering specific forging conditions, preform has its own effect on the microstructure. Through a sensitivity study it is found that forging temperature and speed have significant influence on the microstructure. In order to choose the processing parameters to optimize the microstructure, the dependence of microstructure on die speed and temperature is thoroughly studied using design of numerical experiments. For various desired goals, optimal solutions are determined. The narrow processing window of titanium alloy makes the isothermal forging a preferred way to produce forged parts without forging defects. However, the cost of isothermal forging (dies at the same temperature as the workpiece) limits its wide application. In this research, it has been demonstrated that with proper process design, the die

Development of fabrication technology for copper canisters with cast inserts. Status report in August 2001

International Nuclear Information System (INIS)

Andersson, Claes-Goeran

2002-04-01

This report contains an account of the results of trial fabrication of copper canisters with cast inserts carried out during the period 1998 - 2001. The work of testing of fabrication methods is being focused on a copper thickness of 50 mm. Occasional canisters with 30 mm copper thickness are being fabricated for the purpose of gaining experience and evaluating fabrication and inspection methods for such canisters. For the fabrication of copper tubes, SKB has concentrated its efforts on seamless tubes made by extrusion and pierce and draw processing. Five tubes have been extruded and two have been pierced and drawn during the period. Materials testing has shown that the resultant structure and mechanical properties of these tubes are good. Despite certain problems with dimensional accuracy, it can be concluded that both of these methods can be developed for use in the serial production of SKB' copper tubes. No new trial fabrication with roll forming of copper plate and longitudinal welding has been done. This method is nevertheless regarded as a potential alternative. Copper lids and bottoms are made by forging of continuous-cast bars. The forged blanks are machined to the desired dimensions. Due to the Canister Laboratory's need for lids to develop the technique for sealing welding, a relatively large number of forged blanks have been fabricated. It is noted in the report that the grain size obtained in lids and bottoms is much coarser than in fabricated copper tubes. Development work has been commenced for the purpose of optimizing the forging process. Nine cast inserts have been cast during the three-year period. The results of completed material testing of test pieces taken at different places along the length of the inserts have in several cases shown an unacceptable range of variation in strength properties and structure. In the continued work, insert fabrication will be developed in terms of both casting technique and iron composition. Development work on

Sharatchandra’s Caste and Gender Consciousness

Directory of Open Access Journals (Sweden)

Narasingha Sil

2015-01-01

Full Text Available Sharatchandra Chattopadhyay’s attitude to the prevalent caste system and social ethos, especially concerning sex, love, and marriage and chastity of married as well as widowed women, shows a marked ambivalence. On one hand, his work demonstrates his progressive and liberal ideas emanating from Western contact and impact on late colonial India, and on Bengal in particular. On the other hand, and by the same token, his attitude to love, marriage, and sex shows marked affinity with the Victorian morality emanating from the society of colonial India’s metropolitan masters. The upshot of this historical and social context is that Sharatchandra was basically a caste conscious Hindu Brahmin and a firm believer in the patriarchal ethos of his contemporary society, his reputation as a compassionate (daradī or maramī writer exposing the ills of his society notwithstanding.

29 CFR 1910.218 - Forging machines.

Science.gov (United States)

2010-07-01

... 29 Labor 5 2010-07-01 2010-07-01 false Forging machines. 1910.218 Section 1910.218 Labor... OCCUPATIONAL SAFETY AND HEALTH STANDARDS Machinery and Machine Guarding § 1910.218 Forging machines. (a... other identifier, for the forging machine which was inspected. (ii) Scheduling and recording the...

Wear Analysis of Die Inserts in the Hot Forging Process of a Forked Type Forging Using Reverse Scanning Techniques

Directory of Open Access Journals (Sweden)

Łukasz Dworzak

2017-12-01

Full Text Available This article presents a wear analysis of die inserts used in the hot forging process of a forked forging (yoke, an element applied in steering systems of passenger vehicles. Studies involved the application of an original reverse scanning method intended for rapid and reliable wear analysis of forging tools (with complicated shape affording easy assessment without the need to dismount tools from the forging unit. The developed method involves analysis of progressive wear of forging tools based on measurements (scanning of forgings periodically collected from the process and constitutes a useful tool for measurement and testing. As the authors’ earlier works have demonstrated, the proposed new approach to analysis of tool wear with the application of reverse 3D scanning has proven successful in multiple instances in the case of axially symmetrical objects. The presented results of studies indicate that it is possible to utilize the expanded method to analyze the lifetime of forging tools, including tools with complex geometry. Application of the reverse scanning method allows for continuous and practical monitoring of the condition of forging tools over the course of the forging process and should have a positive impact on improving production output and reducing production costs.

48 CFR 225.7102 - Forgings.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Forgings. 225.7102 Section 225.7102 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF... Forgings. ...

Forged Signature Distinction Using Convolutional Neural Network for Feature Extraction

Directory of Open Access Journals (Sweden)

Seungsoo Nam

2018-01-01

Full Text Available This paper proposes a dynamic verification scheme for finger-drawn signatures in smartphones. As a dynamic feature, the movement of a smartphone is recorded with accelerometer sensors in the smartphone, in addition to the moving coordinates of the signature. To extract high-level longitudinal and topological features, the proposed scheme uses a convolution neural network (CNN for feature extraction, and not as a conventional classifier. We assume that a CNN trained with forged signatures can extract effective features (called S-vector, which are common in forging activities such as hesitation and delay before drawing the complicated part. The proposed scheme also exploits an autoencoder (AE as a classifier, and the S-vector is used as the input vector to the AE. An AE has high accuracy for the one-class distinction problem such as signature verification, and is also greatly dependent on the accuracy of input data. S-vector is valuable as the input of AE, and, consequently, could lead to improved verification accuracy especially for distinguishing forged signatures. Compared to the previous work, i.e., the MLP-based finger-drawn signature verification scheme, the proposed scheme decreases the equal error rate by 13.7%, specifically, from 18.1% to 4.4%, for discriminating forged signatures.

Springer Pseudorapidity distributions of charged hadrons in proton-lead collisions at $\\sqrt{s_{_\\mathrm{NN}}} =$ 5.02 and 8.16 TeV

CERN Document Server

Sirunyan, Albert M; CMS Collaboration; Adam, Wolfgang; Ambrogi, Federico; Asilar, Ece; Bergauer, Thomas; Brandstetter, Johannes; Brondolin, Erica; Dragicevic, Marko; Erö, Janos; Flechl, Martin; Friedl, Markus; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Grossmann, Johannes; Hrubec, Josef; Jeitler, Manfred; König, Axel; Krammer, Natascha; Krätschmer, Ilse; Liko, Dietrich; Madlener, Thomas; Mikulec, Ivan; Pree, Elias; Rad, Navid; Rohringer, Herbert; Schieck, Jochen; Schöfbeck, Robert; Spanring, Markus; Spitzbart, Daniel; Waltenberger, Wolfgang; Wittmann, Johannes; Wulz, Claudia-Elisabeth; Zarucki, Mateusz; Chekhovsky, Vladimir; Mossolov, Vladimir; Suarez Gonzalez, Juan; De Wolf, Eddi A; Di Croce, Davide; Janssen, Xavier; Lauwers, Jasper; Van De Klundert, Merijn; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Abu Zeid, Shimaa; Blekman, Freya; D'Hondt, Jorgen; De Bruyn, Isabelle; De Clercq, Jarne; Deroover, Kevin; Flouris, Giannis; Lontkovskyi, Denys; Lowette, Steven; Moortgat, Seth; Moreels, Lieselotte; Python, Quentin; Skovpen, Kirill; Tavernier, Stefaan; Van Doninck, Walter; Van Mulders, Petra; Van Parijs, Isis; Beghin, Diego; Brun, Hugues; Clerbaux, Barbara; De Lentdecker, Gilles; Delannoy, Hugo; Dorney, Brian; Fasanella, Giuseppe; Favart, Laurent; Goldouzian, Reza; Grebenyuk, Anastasia; Karapostoli, Georgia; Lenzi, Thomas; Luetic, Jelena; Maerschalk, Thierry; Marinov, Andrey; Seva, Tomislav; Starling, Elizabeth; Vander Velde, Catherine; Vanlaer, Pascal; Vannerom, David; Yonamine, Ryo; Zenoni, Florian; Zhang, Fengwangdong; Cimmino, Anna; Cornelis, Tom; Dobur, Didar; Fagot, Alexis; Gul, Muhammad; Khvastunov, Illia; Poyraz, Deniz; Roskas, Christos; Salva Diblen, Sinem; Tytgat, Michael; Verbeke, Willem; Zaganidis, Nicolas; Bakhshiansohi, Hamed; Bondu, Olivier; Brochet, Sébastien; Bruno, Giacomo; Caputo, Claudio; Caudron, Adrien; David, Pieter; De Visscher, Simon; Delaere, Christophe; Delcourt, Martin; Francois, Brieuc; Giammanco, Andrea; Komm, Matthias; Krintiras, Georgios; Lemaitre, Vincent; Magitteri, Alessio; Mertens, Alexandre; Musich, Marco; Piotrzkowski, Krzysztof; Quertenmont, Loic; Saggio, Alessia; Vidal Marono, Miguel; Wertz, Sébastien; Zobec, Joze; Beliy, Nikita; Aldá Júnior, Walter Luiz; Alves, Fábio Lúcio; Alves, Gilvan; Brito, Lucas; Correa Martins Junior, Marcos; Hensel, Carsten; Moraes, Arthur; Pol, Maria Elena; Rebello Teles, Patricia; Belchior Batista Das Chagas, Ewerton; Carvalho, Wagner; Chinellato, Jose; Coelho, Eduardo; Melo Da Costa, Eliza; Da Silveira, Gustavo Gil; De Jesus Damiao, Dilson; Fonseca De Souza, Sandro; Huertas Guativa, Lina Milena; Malbouisson, Helena; Melo De Almeida, Miqueias; Mora Herrera, Clemencia; Mundim, Luiz; Nogima, Helio; Sanchez Rosas, Luis Junior; Santoro, Alberto; Sznajder, Andre; Thiel, Mauricio; Tonelli Manganote, Edmilson José; Torres Da Silva De Araujo, Felipe; Vilela Pereira, Antonio; Ahuja, Sudha; Bernardes, Cesar Augusto; Tomei, Thiago; De Moraes Gregores, Eduardo; Mercadante, Pedro G; Novaes, Sergio F; Padula, Sandra; Romero Abad, David; Ruiz Vargas, José Cupertino; Aleksandrov, Aleksandar; Hadjiiska, Roumyana; Iaydjiev, Plamen; Misheva, Milena; Rodozov, Mircho; Shopova, Mariana; Sultanov, Georgi; Dimitrov, Anton; Glushkov, Ivan; Litov, Leander; Pavlov, Borislav; Petkov, Peicho; Fang, Wenxing; Gao, Xuyang; Yuan, Li; Ahmad, Muhammad; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Chen, Mingshui; Chen, Ye; Jiang, Chun-Hua; Leggat, Duncan; Liao, Hongbo; Liu, Zhenan; Romeo, Francesco; Shaheen, Sarmad Masood; Spiezia, Aniello; Tao, Junquan; Wang, Chunjie; Wang, Zheng; Yazgan, Efe; Zhang, Huaqiao; Zhang, Sijing; Zhao, Jingzhou; Ban, Yong; Chen, Geng; Li, Qiang; Liu, Shuai; Mao, Yajun; Qian, Si-Jin; Wang, Dayong; Xu, Zijun; Avila, Carlos; Cabrera, Andrés; Chaparro Sierra, Luisa Fernanda; Florez, Carlos; González Hernández, Carlos Felipe; Ruiz Alvarez, José David; Segura Delgado, Manuel Alejandro; Courbon, Benoit; Godinovic, Nikola; Lelas, Damir; Puljak, Ivica; Ribeiro Cipriano, Pedro M; Sculac, Toni; Antunovic, Zeljko; Kovac, Marko; Brigljevic, Vuko; Ferencek, Dinko; Kadija, Kreso; Mesic, Benjamin; Starodumov, Andrei; Susa, Tatjana; Ather, Mohsan Waseem; Attikis, Alexandros; Mavromanolakis, Georgios; Mousa, Jehad; Nicolaou, Charalambos; Ptochos, Fotios; Razis, Panos A; Rykaczewski, Hans; Finger, Miroslav; Finger Jr, Michael; Carrera Jarrin, Edgar; Abdelalim, Ahmed Ali; Mohammed, Yasser; Salama, Elsayed; Dewanjee, Ram Krishna; Kadastik, Mario; Perrini, Lucia; Raidal, Martti; Tiko, Andres; Veelken, Christian; Eerola, Paula; Kirschenmann, Henning; Pekkanen, Juska; Voutilainen, Mikko; Havukainen, Joona; Heikkilä, Jaana Kristiina; Jarvinen, Terhi; Karimäki, Veikko; Kinnunen, Ritva; Lampén, Tapio; Lassila-Perini, Kati; Laurila, Santeri; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Siikonen, Hannu; Tuominen, Eija; Tuominiemi, Jorma; Talvitie, Joonas; Tuuva, Tuure; Besancon, Marc; Couderc, Fabrice; Dejardin, Marc; Denegri, Daniel; Faure, Jean-Louis; Ferri, Federico; Ganjour, Serguei; Ghosh, Saranya; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Kucher, Inna; Leloup, Clément; Locci, Elizabeth; Machet, Martina; Malcles, Julie; Negro, Giulia; Rander, John; Rosowsky, André; Sahin, Mehmet Özgür; Titov, Maksym; Abdulsalam, Abdulla; Amendola, Chiara; Antropov, Iurii; Baffioni, Stephanie; Beaudette, Florian; Busson, Philippe; Cadamuro, Luca; Charlot, Claude; Granier de Cassagnac, Raphael; Jo, Mihee; Lisniak, Stanislav; Lobanov, Artur; Martin Blanco, Javier; Nguyen, Matthew; Ochando, Christophe; Ortona, Giacomo; Paganini, Pascal; Pigard, Philipp; Salerno, Roberto; Sauvan, Jean-Baptiste; Sirois, Yves; Stahl Leiton, Andre Govinda; Strebler, Thomas; Yilmaz, Yetkin; Zabi, Alexandre; Zghiche, Amina; Agram, Jean-Laurent; Andrea, Jeremy; Bloch, Daniel; Brom, Jean-Marie; Buttignol, Michael; Chabert, Eric Christian; Chanon, Nicolas; Collard, Caroline; Conte, Eric; Coubez, Xavier; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Jansová, Markéta; Le Bihan, Anne-Catherine; Tonon, Nicolas; Van Hove, Pierre; Gadrat, Sébastien; Beauceron, Stephanie; Bernet, Colin; Boudoul, Gaelle; Chierici, Roberto; Contardo, Didier; Depasse, Pierre; El Mamouni, Houmani; Fay, Jean; Finco, Linda; Gascon, Susan; Gouzevitch, Maxime; Grenier, Gérald; Ille, Bernard; Lagarde, Francois; Laktineh, Imad Baptiste; Lethuillier, Morgan; Mirabito, Laurent; Pequegnot, Anne-Laure; Perries, Stephane; Popov, Andrey; Sordini, Viola; Vander Donckt, Muriel; Viret, Sébastien; Toriashvili, Tengizi; Tsamalaidze, Zviad; Autermann, Christian; Feld, Lutz; Kiesel, Maximilian Knut; Klein, Katja; Lipinski, Martin; Preuten, Marius; Schomakers, Christian; Schulz, Johannes; Zhukov, Valery; Albert, Andreas; Dietz-Laursonn, Erik; Duchardt, Deborah; Endres, Matthias; Erdmann, Martin; Erdweg, Sören; Esch, Thomas; Fischer, Robert; Güth, Andreas; Hamer, Matthias; Hebbeker, Thomas; Heidemann, Carsten; Hoepfner, Kerstin; Knutzen, Simon; Merschmeyer, Markus; Meyer, Arnd; Millet, Philipp; Mukherjee, Swagata; Pook, Tobias; Radziej, Markus; Reithler, Hans; Rieger, Marcel; Scheuch, Florian; Teyssier, Daniel; Thüer, Sebastian; Flügge, Günter; Kargoll, Bastian; Kress, Thomas; Künsken, Andreas; Müller, Thomas; Nehrkorn, Alexander; Nowack, Andreas; Pistone, Claudia; Pooth, Oliver; Stahl, Achim; Aldaya Martin, Maria; Arndt, Till; Asawatangtrakuldee, Chayanit; Beernaert, Kelly; Behnke, Olaf; Behrens, Ulf; Bermúdez Martínez, Armando; Bin Anuar, Afiq Aizuddin; Borras, Kerstin; Botta, Valeria; Campbell, Alan; Connor, Patrick; Contreras-Campana, Christian; Costanza, Francesco; Diez Pardos, Carmen; Eckerlin, Guenter; Eckstein, Doris; Eichhorn, Thomas; Eren, Engin; Gallo, Elisabetta; Garay Garcia, Jasone; Geiser, Achim; Gizhko, Andrii; Grados Luyando, Juan Manuel; Grohsjean, Alexander; Gunnellini, Paolo; Guthoff, Moritz; Harb, Ali; Hauk, Johannes; Hempel, Maria; Jung, Hannes; Kalogeropoulos, Alexis; Kasemann, Matthias; Keaveney, James; Kleinwort, Claus; Korol, Ievgen; Krücker, Dirk; Lange, Wolfgang; Lelek, Aleksandra; Lenz, Teresa; Leonard, Jessica; Lipka, Katerina; Lohmann, Wolfgang; Mankel, Rainer; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Mittag, Gregor; Mnich, Joachim; Mussgiller, Andreas; Ntomari, Eleni; Pitzl, Daniel; Raspereza, Alexei; Savitskyi, Mykola; Saxena, Pooja; Shevchenko, Rostyslav; Spannagel, Simon; Stefaniuk, Nazar; Van Onsem, Gerrit Patrick; Walsh, Roberval; Wen, Yiwen; Wichmann, Katarzyna; Wissing, Christoph; Zenaiev, Oleksandr; Aggleton, Robin; Bein, Samuel; Blobel, Volker; Centis Vignali, Matteo; Dreyer, Torben; Garutti, Erika; Gonzalez, Daniel; Haller, Johannes; Hinzmann, Andreas; Hoffmann, Malte; Karavdina, Anastasia; Klanner, Robert; Kogler, Roman; Kovalchuk, Nataliia; Kurz, Simon; Lapsien, Tobias; Marchesini, Ivan; Marconi, Daniele; Meyer, Mareike; Niedziela, Marek; Nowatschin, Dominik; Pantaleo, Felice; Peiffer, Thomas; Perieanu, Adrian; Scharf, Christian; Schleper, Peter; Schmidt, Alexander; Schumann, Svenja; Schwandt, Joern; Sonneveld, Jory; Stadie, Hartmut; Steinbrück, Georg; Stober, Fred-Markus Helmut; Stöver, Marc; Tholen, Heiner; Troendle, Daniel; Usai, Emanuele; Vanhoefer, Annika; Vormwald, Benedikt; Akbiyik, Melike; Barth, Christian; Baselga, Marta; Baur, Sebastian; Butz, Erik; Caspart, René; Chwalek, Thorsten; Colombo, Fabio; De Boer, Wim; Dierlamm, Alexander; Faltermann, Nils; Freund, Benedikt; Friese, Raphael; Giffels, Manuel; Harrendorf, Marco Alexander; Hartmann, Frank; Heindl, Stefan Michael; Husemann, Ulrich; Kassel, Florian; Kudella, Simon; Mildner, Hannes; Mozer, Matthias Ulrich; Müller, Thomas; Plagge, Michael; Quast, Gunter; Rabbertz, Klaus; Schröder, Matthias; Shvetsov, Ivan; Sieber, Georg; Simonis, Hans-Jürgen; Ulrich, Ralf; Wayand, Stefan; Weber, Marc; Weiler, Thomas; Williamson, Shawn; Wöhrmann, Clemens; Wolf, Roger; Anagnostou, Georgios; Daskalakis, Georgios; Geralis, Theodoros; Kyriakis, Aristotelis; Loukas, Demetrios; Topsis-Giotis, Iasonas; Karathanasis, George; Kesisoglou, Stilianos; Panagiotou, Apostolos; Saoulidou, Niki; Kousouris, Konstantinos; Evangelou, Ioannis; Foudas, Costas; Kokkas, Panagiotis; Mallios, Stavros; Manthos, Nikolaos; Papadopoulos, Ioannis; Paradas, Evangelos; Strologas, John; Triantis, Frixos A; Csanad, Mate; Filipovic, Nicolas; Pasztor, Gabriella; Surányi, Olivér; Veres, Gabor Istvan; Bencze, Gyorgy; Hajdu, Csaba; Horvath, Dezso; Hunyadi, Ádám; Sikler, Ferenc; Veszpremi, Viktor; Beni, Noemi; Czellar, Sandor; Karancsi, János; Makovec, Alajos; Molnar, Jozsef; Szillasi, Zoltan; Bartók, Márton; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Choudhury, Somnath; Komaragiri, Jyothsna Rani; Bahinipati, Seema; Bhowmik, Sandeep; Mal, Prolay; Mandal, Koushik; Nayak, Aruna; Sahoo, Deepak Kumar; Sahoo, Niladribihari; Swain, Sanjay Kumar; Bansal, Sunil; Beri, Suman Bala; Bhatnagar, Vipin; Chawla, Ridhi; Dhingra, Nitish; Kalsi, Amandeep Kaur; Kaur, Anterpreet; Kaur, Manjit; Kaur, Sandeep; Kumar, Ramandeep; Kumari, Priyanka; Mehta, Ankita; Singh, Jasbir; Walia, Genius; Kumar, Ashok; Shah, Aashaq; Bhardwaj, Ashutosh; Chauhan, Sushil; Choudhary, Brajesh C; Garg, Rocky Bala; Keshri, Sumit; Kumar, Ajay; Malhotra, Shivali; Naimuddin, Md; Ranjan, Kirti; Sharma, Ramkrishna; Bhardwaj, Rishika; Bhattacharya, Rajarshi; Bhattacharya, Satyaki; Bhawandeep, Bhawandeep; Dey, Sourav; Dutt, Suneel; Dutta, Suchandra; Ghosh, Shamik; Majumdar, Nayana; Modak, Atanu; Mondal, Kuntal; Mukhopadhyay, Supratik; Nandan, Saswati; Purohit, Arnab; Roy, Ashim; Roy Chowdhury, Suvankar; Sarkar, Subir; Sharan, Manoj; Thakur, Shalini; Behera, Prafulla Kumar; Chudasama, Ruchi; Dutta, Dipanwita; Jha, Vishwajeet; Kumar, Vineet; Mohanty, Ajit Kumar; Netrakanti, Pawan Kumar; Pant, Lalit Mohan; Shukla, Prashant; Topkar, Anita; Aziz, Tariq; Dugad, Shashikant; Mahakud, Bibhuprasad; Mitra, Soureek; Mohanty, Gagan Bihari; Sur, Nairit; Sutar, Bajrang; Banerjee, Sudeshna; Bhattacharya, Soham; Chatterjee, Suman; Das, Pallabi; Guchait, Monoranjan; Jain, Sandhya; Kumar, Sanjeev; Maity, Manas; Majumder, Gobinda; Mazumdar, Kajari; Sarkar, Tanmay; Wickramage, Nadeesha; Chauhan, Shubhanshu; Dube, Sourabh; Hegde, Vinay; Kapoor, Anshul; Kothekar, Kunal; Pandey, Shubham; Rane, Aditee; Sharma, Seema; Chenarani, Shirin; Eskandari Tadavani, Esmaeel; Etesami, Seyed Mohsen; Khakzad, Mohsen; Mohammadi Najafabadi, Mojtaba; Naseri, Mohsen; Paktinat Mehdiabadi, Saeid; Rezaei Hosseinabadi, Ferdos; Safarzadeh, Batool; Zeinali, Maryam; Felcini, Marta; Grunewald, Martin; Abbrescia, Marcello; Calabria, Cesare; Colaleo, Anna; Creanza, Donato; Cristella, Leonardo; De Filippis, Nicola; De Palma, Mauro; Errico, Filippo; Fiore, Luigi; Iaselli, Giuseppe; Lezki, Samet; Maggi, Giorgio; Maggi, Marcello; Miniello, Giorgia; My, Salvatore; Nuzzo, Salvatore; Pompili, Alexis; Pugliese, Gabriella; Radogna, Raffaella; Ranieri, Antonio; Selvaggi, Giovanna; Sharma, Archana; Silvestris, Lucia; Venditti, Rosamaria; Verwilligen, Piet; Abbiendi, Giovanni; Battilana, Carlo; Bonacorsi, Daniele; Borgonovi, Lisa; Braibant-Giacomelli, Sylvie; Campanini, Renato; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Chhibra, Simranjit Singh; Codispoti, Giuseppe; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Fasanella, Daniele; Giacomelli, Paolo; Grandi, Claudio; Guiducci, Luigi; Marcellini, Stefano; Masetti, Gianni; Montanari, Alessandro; Navarria, Francesco; Perrotta, Andrea; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gian Piero; Tosi, Nicolò; Albergo, Sebastiano; Costa, Salvatore; Di Mattia, Alessandro; Giordano, Ferdinando; Potenza, Renato; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Chatterjee, Kalyanmoy; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Lenzi, Piergiulio; Meschini, Marco; Paoletti, Simone; Russo, Lorenzo; Sguazzoni, Giacomo; Strom, Derek; Viliani, Lorenzo; Benussi, Luigi; Bianco, Stefano; Fabbri, Franco; Piccolo, Davide; Primavera, Federica; Calvelli, Valerio; Ferro, Fabrizio; Robutti, Enrico; Tosi, Silvano; Benaglia, Andrea; Beschi, Andrea; Brianza, Luca; Brivio, Francesco; Ciriolo, Vincenzo; Dinardo, Mauro Emanuele; Fiorendi, Sara; Gennai, Simone; Ghezzi, Alessio; Govoni, Pietro; Malberti, Martina; Malvezzi, Sandra; Manzoni, Riccardo Andrea; Menasce, Dario; Moroni, Luigi; Paganoni, Marco; Pauwels, Kristof; Pedrini, Daniele; Pigazzini, Simone; Ragazzi, Stefano; Redaelli, Nicola; Tabarelli de Fatis, Tommaso; Buontempo, Salvatore; Cavallo, Nicola; Di Guida, Salvatore; Fabozzi, Francesco; Fienga, Francesco; Iorio, Alberto Orso Maria; Khan, Wajid Ali; Lista, Luca; Meola, Sabino; Paolucci, Pierluigi; Sciacca, Crisostomo; Thyssen, Filip; Azzi, Patrizia; Bacchetta, Nicola; Benato, Lisa; Bisello, Dario; Boletti, Alessio; Carlin, Roberto; Carvalho Antunes De Oliveira, Alexandra; Checchia, Paolo; De Castro Manzano, Pablo; Dorigo, Tommaso; Dosselli, Umberto; Gasparini, Fabrizio; Gasparini, Ugo; Gozzelino, Andrea; Lacaprara, Stefano; Margoni, Martino; Meneguzzo, Anna Teresa; Pozzobon, Nicola; Ronchese, Paolo; Rossin, Roberto; Simonetto, Franco; Torassa, Ezio; Zanetti, Marco; Zotto, Pierluigi; Zumerle, Gianni; Braghieri, Alessandro; Magnani, Alice; Montagna, Paolo; Ratti, Sergio P; Re, Valerio; Ressegotti, Martina; Riccardi, Cristina; Salvini, Paola; Vai, Ilaria; Vitulo, Paolo; Alunni Solestizi, Luisa; Biasini, Maurizio; Bilei, Gian Mario; Cecchi, Claudia; Ciangottini, Diego; Fanò, Livio; Lariccia, Paolo; Leonardi, Roberto; Manoni, Elisa; Mantovani, Giancarlo; Mariani, Valentina; Menichelli, Mauro; Rossi, Alessandro; Santocchia, Attilio; Spiga, Daniele; Androsov, Konstantin; Azzurri, Paolo; Bagliesi, Giuseppe; Boccali, Tommaso; Borrello, Laura; Castaldi, Rino; Ciocci, Maria Agnese; Dell'Orso, Roberto; Fedi, Giacomo; Giannini, Leonardo; Giassi, Alessandro; Grippo, Maria Teresa; Ligabue, Franco; Lomtadze, Teimuraz; Manca, Elisabetta; Mandorli, Giulio; Messineo, Alberto; Palla, Fabrizio; Rizzi, Andrea; Savoy-Navarro, Aurore; Spagnolo, Paolo; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; Cipriani, Marco; Daci, Nadir; Del Re, Daniele; Di Marco, Emanuele; Diemoz, Marcella; Gelli, Simone; Longo, Egidio; Margaroli, Fabrizio; Marzocchi, Badder; Meridiani, Paolo; Organtini, Giovanni; Paramatti, Riccardo; Preiato, Federico; Rahatlou, Shahram; Rovelli, Chiara; Santanastasio, Francesco; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Bartosik, Nazar; Bellan, Riccardo; Biino, Cristina; Cartiglia, Nicolo; Cenna, Francesca; Costa, Marco; Covarelli, Roberto; Degano, Alessandro; Demaria, Natale; Kiani, Bilal; Mariotti, Chiara; Maselli, Silvia; Migliore, Ernesto; Monaco, Vincenzo; Monteil, Ennio; Monteno, Marco; Obertino, Maria Margherita; Pacher, Luca; Pastrone, Nadia; Pelliccioni, Mario; Pinna Angioni, Gian Luca; Ravera, Fabio; Romero, Alessandra; Ruspa, Marta; Sacchi, Roberto; Shchelina, Ksenia; Sola, Valentina; Solano, Ada; Staiano, Amedeo; Traczyk, Piotr; Belforte, Stefano; Casarsa, Massimo; Cossutti, Fabio; Della Ricca, Giuseppe; Zanetti, Anna; Kim, Dong Hee; Kim, Gui Nyun; Kim, Min Suk; Lee, Jeongeun; Lee, Sangeun; Lee, Seh Wook; Moon, Chang-Seong; Oh, Young Do; Sekmen, Sezen; Son, Dong-Chul; Yang, Yu Chul; Lee, Ari; Kim, Hyunchul; Moon, Dong Ho; Oh, Geonhee; Brochero Cifuentes, Javier Andres; Goh, Junghwan; Kim, Tae Jeong; Cho, Sungwoong; Choi, Suyong; Go, Yeonju; Gyun, Dooyeon; Ha, Seungkyu; Hong, Byung-Sik; Jo, Youngkwon; Kim, Yongsun; Lee, Kisoo; Lee, Kyong Sei; Lee, Songkyo; Lim, Jaehoon; Park, Sung Keun; Roh, Youn; Almond, John; Kim, Junho; Kim, Jae Sung; Lee, Haneol; Lee, Kyeongpil; Nam, Kyungwook; Oh, Sung Bin; Radburn-Smith, Benjamin Charles; Seo, Seon-hee; Yang, Unki; Yoo, Hwi Dong; Yu, Geum Bong; Choi, Minkyoo; Kim, Hyunyong; Kim, Ji Hyun; Lee, Jason Sang Hun; Park, Inkyu; Choi, Young-Il; Hwang, Chanwook; Lee, Jongseok; Yu, Intae; Dudenas, Vytautas; Juodagalvis, Andrius; Vaitkus, Juozas; Ahmed, Ijaz; Ibrahim, Zainol Abidin; Md Ali, Mohd Adli Bin; Mohamad Idris, Faridah; Wan Abdullah, Wan Ahmad Tajuddin; Yusli, Mohd Nizam; Zolkapli, Zukhaimira; Reyes-Almanza, Rogelio; Ramirez-Sanchez, Gabriel; Duran-Osuna, Cecilia; Castilla-Valdez, Heriberto; De La Cruz-Burelo, Eduard; Heredia-De La Cruz, Ivan; Rabadán-Trejo, Raúl Iraq; Lopez-Fernandez, Ricardo; Mejia Guisao, Jhovanny; Sánchez Hernández, Alberto; Carrillo Moreno, Salvador; Oropeza Barrera, Cristina; Vazquez Valencia, Fabiola; Pedraza, Isabel; Salazar Ibarguen, Humberto Antonio; Uribe Estrada, Cecilia; Morelos Pineda, Antonio; Krofcheck, David; Butler, Philip H; Ahmad, Ashfaq; Ahmad, Muhammad; Hassan, Qamar; Hoorani, Hafeez R; Saddique, Asif; Shah, Mehar Ali; Shoaib, Muhammad; Waqas, Muhammad; Bialkowska, Helena; Bluj, Michal; Boimska, Bozena; Frueboes, Tomasz; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Szleper, Michal; Zalewski, Piotr; Bunkowski, Karol; Byszuk, Adrian; Doroba, Krzysztof; Kalinowski, Artur; Konecki, Marcin; Krolikowski, Jan; Misiura, Maciej; Olszewski, Michal; Pyskir, Andrzej; Walczak, Marek; Bargassa, Pedrame; Beirão Da Cruz E Silva, Cristóvão; Di Francesco, Agostino; Faccioli, Pietro; Galinhas, Bruno; Gallinaro, Michele; Hollar, Jonathan; Leonardo, Nuno; Lloret Iglesias, Lara; Nemallapudi, Mythra Varun; Seixas, Joao; Strong, Giles; Toldaiev, Oleksii; Vadruccio, Daniele; Varela, Joao; Afanasiev, Serguei; Bunin, Pavel; Gavrilenko, Mikhail; Golutvin, Igor; Gorbunov, Ilya; Kamenev, Alexey; Karjavin, Vladimir; Lanev, Alexander; Malakhov, Alexander; Matveev, Viktor; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Shulha, Siarhei; Skatchkov, Nikolai; Smirnov, Vitaly; Voytishin, Nikolay; Zarubin, Anatoli; Ivanov, Yury; Kim, Victor; Kuznetsova, Ekaterina; Levchenko, Petr; Murzin, Victor; Oreshkin, Vadim; Smirnov, Igor; Sulimov, Valentin; Uvarov, Lev; Vavilov, Sergey; Vorobyev, Alexey; Andreev, Yuri; Dermenev, Alexander; Gninenko, Sergei; Golubev, Nikolai; Karneyeu, Anton; Kirsanov, Mikhail; Krasnikov, Nikolai; Pashenkov, Anatoli; Tlisov, Danila; Toropin, Alexander; Epshteyn, Vladimir; Gavrilov, Vladimir; Lychkovskaya, Natalia; Popov, Vladimir; Pozdnyakov, Ivan; Safronov, Grigory; Spiridonov, Alexander; Stepennov, Anton; Toms, Maria; Vlasov, Evgueni; Zhokin, Alexander; Aushev, Tagir; Bylinkin, Alexander; Chadeeva, Marina; Parygin, Pavel; Philippov, Dmitry; Polikarpov, Sergey; Popova, Elena; Rusinov, Vladimir; Andreev, Vladimir; Azarkin, Maksim; Dremin, Igor; Kirakosyan, Martin; Terkulov, Adel; Baskakov, Alexey; Belyaev, Andrey; Boos, Edouard; Demiyanov, Andrey; Ershov, Alexander; Gribushin, Andrey; Kodolova, Olga; Korotkikh, Vladimir; Lokhtin, Igor; Miagkov, Igor; Obraztsov, Stepan; Petrushanko, Sergey; Savrin, Viktor; Snigirev, Alexander; Vardanyan, Irina; Blinov, Vladimir; Skovpen, Yuri; Shtol, Dmitry; Azhgirey, Igor; Bayshev, Igor; Bitioukov, Sergei; Elumakhov, Dmitry; Kachanov, Vassili; Kalinin, Alexey; Konstantinov, Dmitri; Mandrik, Petr; Petrov, Vladimir; Ryutin, Roman; Sobol, Andrei; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Adzic, Petar; Cirkovic, Predrag; Devetak, Damir; Dordevic, Milos; Milosevic, Jovan; Rekovic, Vladimir; Alcaraz Maestre, Juan; Barrio Luna, Mar; Cerrada, Marcos; Colino, Nicanor; De La Cruz, Begona; Delgado Peris, Antonio; Escalante Del Valle, Alberto; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Flix, Jose; Fouz, Maria Cruz; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M; Josa, Maria Isabel; Moran, Dermot; Pérez-Calero Yzquierdo, Antonio María; Puerta Pelayo, Jesus; Quintario Olmeda, Adrián; Redondo, Ignacio; Romero, Luciano; Senghi Soares, Mara; Álvarez Fernández, Adrian; Albajar, Carmen; de Trocóniz, Jorge F; Missiroli, Marino; Cuevas, Javier; Erice, Carlos; Fernandez Menendez, Javier; Gonzalez Caballero, Isidro; González Fernández, Juan Rodrigo; Palencia Cortezon, Enrique; Sanchez Cruz, Sergio; Vischia, Pietro; Vizan Garcia, Jesus Manuel; Cabrillo, Iban Jose; Calderon, Alicia; Chazin Quero, Barbara; Curras, Esteban; Duarte Campderros, Jordi; Fernandez, Marcos; Garcia-Ferrero, Juan; Gomez, Gervasio; Lopez Virto, Amparo; Marco, Jesus; Martinez Rivero, Celso; Martinez Ruiz del Arbol, Pablo; Matorras, Francisco; Piedra Gomez, Jonatan; Rodrigo, Teresa; Ruiz-Jimeno, Alberto; Scodellaro, Luca; Trevisani, Nicolò; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Akgun, Bora; Auffray, Etiennette; Baillon, Paul; Ball, Austin; Barney, David; Bendavid, Joshua; Bianco, Michele; Bloch, Philippe; Bocci, Andrea; Botta, Cristina; Camporesi, Tiziano; Castello, Roberto; Cepeda, Maria; Cerminara, Gianluca; Chapon, Emilien; Chen, Yi; D'Enterria, David; Dabrowski, Anne; Daponte, Vincenzo; David Tinoco Mendes, Andre; De Gruttola, Michele; De Roeck, Albert; Deelen, Nikkie; Dobson, Marc; Du Pree, Tristan; Dünser, Marc; Dupont, Niels; Elliott-Peisert, Anna; Everaerts, Pieter; Fallavollita, Francesco; Franzoni, Giovanni; Fulcher, Jonathan; Funk, Wolfgang; Gigi, Dominique; Gilbert, Andrew; Gill, Karl; Glege, Frank; Gulhan, Doga; Harris, Philip; Hegeman, Jeroen; Innocente, Vincenzo; Jafari, Abideh; Janot, Patrick; Karacheban, Olena; Kieseler, Jan; Knünz, Valentin; Kornmayer, Andreas; Kortelainen, Matti J; Krammer, Manfred; Lange, Clemens; Lecoq, Paul; Lourenco, Carlos; Lucchini, Marco Toliman; Malgeri, Luca; Mannelli, Marcello; Martelli, Arabella; Meijers, Frans; Merlin, Jeremie Alexandre; Mersi, Stefano; Meschi, Emilio; Milenovic, Predrag; Moortgat, Filip; Mulders, Martijn; Neugebauer, Hannes; Ngadiuba, Jennifer; Orfanelli, Styliani; Orsini, Luciano; Pape, Luc; Perez, Emmanuel; Peruzzi, Marco; Petrilli, Achille; Petrucciani, Giovanni; Pfeiffer, Andreas; Pierini, Maurizio; Rabady, Dinyar; Racz, Attila; Reis, Thomas; Rolandi, Gigi; Rovere, Marco; Sakulin, Hannes; Schäfer, Christoph; Schwick, Christoph; Seidel, Markus; Selvaggi, Michele; Sharma, Archana; Silva, Pedro; Sphicas, Paraskevas; Stakia, Anna; Steggemann, Jan; Stoye, Markus; Tosi, Mia; Treille, Daniel; Triossi, Andrea; Tsirou, Andromachi; Veckalns, Viesturs; Verweij, Marta; Zeuner, Wolfram Dietrich; Bertl, Willi; Caminada, Lea; Deiters, Konrad; Erdmann, Wolfram; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; Kotlinski, Danek; Langenegger, Urs; Rohe, Tilman; Wiederkehr, Stephan Albert; Backhaus, Malte; Bäni, Lukas; Berger, Pirmin; Bianchini, Lorenzo; Casal, Bruno; Dissertori, Günther; Dittmar, Michael; Donegà, Mauro; Dorfer, Christian; Grab, Christoph; Heidegger, Constantin; Hits, Dmitry; Hoss, Jan; Kasieczka, Gregor; Klijnsma, Thomas; Lustermann, Werner; Mangano, Boris; Marionneau, Matthieu; Meinhard, Maren Tabea; Meister, Daniel; Micheli, Francesco; Musella, Pasquale; Nessi-Tedaldi, Francesca; Pandolfi, Francesco; Pata, Joosep; Pauss, Felicitas; Perrin, Gaël; Perrozzi, Luca; Quittnat, Milena; Reichmann, Michael; Sanz Becerra, Diego Alejandro; Schönenberger, Myriam; Shchutska, Lesya; Tavolaro, Vittorio Raoul; Theofilatos, Konstantinos; Vesterbacka Olsson, Minna Leonora; Wallny, Rainer; Zhu, De Hua; Aarrestad, Thea Klaeboe; Amsler, Claude; Canelli, Maria Florencia; De Cosa, Annapaola; Del Burgo, Riccardo; Donato, Silvio; Galloni, Camilla; Hreus, Tomas; Kilminster, Benjamin; Pinna, Deborah; Rauco, Giorgia; Robmann, Peter; Salerno, Daniel; Schweiger, Korbinian; Seitz, Claudia; Takahashi, Yuta; Zucchetta, Alberto; Candelise, Vieri; Doan, Thi Hien; Jain, Shilpi; Khurana, Raman; Kuo, Chia-Ming; Lin, Willis; Pozdnyakov, Andrey; Yu, Shin-Shan; Kumar, Arun; Chang, Paoti; Chao, Yuan; Chen, Kai-Feng; Chen, Po-Hsun; Fiori, Francesco; Hou, George Wei-Shu; Hsiung, Yee; Liu, Yueh-Feng; Lu, Rong-Shyang; Paganis, Efstathios; Psallidas, Andreas; Steen, Arnaud; Tsai, Jui-fa; Asavapibhop, Burin; Kovitanggoon, Kittikul; Singh, Gurpreet; Srimanobhas, Norraphat; Bakirci, Mustafa Numan; Bat, Ayse; Boran, Fatma; Damarseckin, Serdal; Demiroglu, Zuhal Seyma; Dozen, Candan; Girgis, Semiray; Gokbulut, Gul; Guler, Yalcin; Hos, Ilknur; Kangal, Evrim Ersin; Kara, Ozgun; Kiminsu, Ugur; Oglakci, Mehmet; Onengut, Gulsen; Ozdemir, Kadri; Ozturk, Sertac; Polatoz, Ayse; Tali, Bayram; Tok, Ufuk Guney; Topakli, Huseyin; Turkcapar, Semra; Zorbakir, Ibrahim Soner; Zorbilmez, Caglar; Bilin, Bugra; Karapinar, Guler; Ocalan, Kadir; Yalvac, Metin; Zeyrek, Mehmet; Gülmez, Erhan; Kaya, Mithat; Kaya, Ozlem; Tekten, Sevgi; Yetkin, Elif Asli; Nazlim Agaras, Merve; Atay, Serhat; Cakir, Altan; Cankocak, Kerem; Grynyov, Boris; Levchuk, Leonid; Ball, Fionn; Beck, Lana; Brooke, James John; Burns, Douglas; Clement, Emyr; Cussans, David; Davignon, Olivier; Flacher, Henning; Goldstein, Joel; Heath, Greg P; Heath, Helen F; Kreczko, Lukasz; Newbold, Dave M; Paramesvaran, Sudarshan; Sakuma, Tai; Seif El Nasr-storey, Sarah; Smith, Dominic; Smith, Vincent J; Belyaev, Alexander; Brew, Christopher; Brown, Robert M; Calligaris, Luigi; Cieri, Davide; Cockerill, David JA; Coughlan, John A; Harder, Kristian; Harper, Sam; Olaiya, Emmanuel; Petyt, David; Shepherd-Themistocleous, Claire; Thea, Alessandro; Tomalin, Ian R; Williams, Thomas; Auzinger, Georg; Bainbridge, Robert; Borg, Johan; Breeze, Shane; Buchmuller, Oliver; Bundock, Aaron; Casasso, Stefano; Citron, Matthew; Colling, David; Corpe, Louie; Dauncey, Paul; Davies, Gavin; De Wit, Adinda; Della Negra, Michel; Di Maria, Riccardo; Elwood, Adam; Haddad, Yacine; Hall, Geoffrey; Iles, Gregory; James, Thomas; Lane, Rebecca; Laner, Christian; Lyons, Louis; Magnan, Anne-Marie; Malik, Sarah; Mastrolorenzo, Luca; Matsushita, Takashi; Nash, Jordan; Nikitenko, Alexander; Palladino, Vito; Pesaresi, Mark; Raymond, David Mark; Richards, Alexander; Rose, Andrew; Scott, Edward; Seez, Christopher; Shtipliyski, Antoni; Summers, Sioni; Tapper, Alexander; Uchida, Kirika; Vazquez Acosta, Monica; Virdee, Tejinder; Wardle, Nicholas; Winterbottom, Daniel; Wright, Jack; Zenz, Seth Conrad; Cole, Joanne; Hobson, Peter R; Khan, Akram; Kyberd, Paul; Reid, Ivan; Symonds, Philip; Teodorescu, Liliana; Turner, Mark; Zahid, Sema; Borzou, Ahmad; Call, Kenneth; Dittmann, Jay; Hatakeyama, Kenichi; Liu, Hongxuan; Pastika, Nathaniel; Smith, Caleb; Bartek, Rachel; Dominguez, Aaron; Buccilli, Andrew; Cooper, Seth; Henderson, Conor; Rumerio, Paolo; West, Christopher; Arcaro, Daniel; Avetisyan, Aram; Bose, Tulika; Gastler, Daniel; Rankin, Dylan; Richardson, Clint; Rohlf, James; Sulak, Lawrence; Zou, David; Benelli, Gabriele; Cutts, David; Garabedian, Alex; Hadley, Mary; Hakala, John; Heintz, Ulrich; Hogan, Julie Managan; Kwok, Ka Hei Martin; Laird, Edward; Landsberg, Greg; Lee, Jangbae; Mao, Zaixing; Narain, Meenakshi; Pazzini, Jacopo; Piperov, Stefan; Sagir, Sinan; Syarif, Rizki; Yu, David; Band, Reyer; Brainerd, Christopher; Burns, Dustin; Calderon De La Barca Sanchez, Manuel; Chertok, Maxwell; Conway, John; Conway, Rylan; Cox, Peter Timothy; Erbacher, Robin; Flores, Chad; Funk, Garrett; Gardner, Michael; Ko, Winston; Lander, Richard; Mclean, Christine; Mulhearn, Michael; Pellett, Dave; Pilot, Justin; Shalhout, Shalhout; Shi, Mengyao; Smith, John; Stolp, Dustin; Tos, Kyle; Tripathi, Mani; Wang, Zhangqier; Bachtis, Michail; Bravo, Cameron; Cousins, Robert; Dasgupta, Abhigyan; Florent, Alice; Hauser, Jay; Ignatenko, Mikhail; Mccoll, Nickolas; Regnard, Simon; Saltzberg, David; Schnaible, Christian; Valuev, Vyacheslav; Bouvier, Elvire; Burt, Kira; Clare, Robert; Ellison, John Anthony; Gary, J William; Ghiasi Shirazi, Seyyed Mohammad Amin; Hanson, Gail; Heilman, Jesse; Kennedy, Elizabeth; Lacroix, Florent; Long, Owen Rosser; Olmedo Negrete, Manuel; Paneva, Mirena Ivova; Si, Weinan; Wang, Long; Wei, Hua; Wimpenny, Stephen; Yates, Brent; Branson, James G; Cittolin, Sergio; Derdzinski, Mark; Gerosa, Raffaele; Gilbert, Dylan; Hashemi, Bobak; Holzner, André; Klein, Daniel; Kole, Gouranga; Krutelyov, Vyacheslav; Letts, James; Macneill, Ian; Masciovecchio, Mario; Olivito, Dominick; Padhi, Sanjay; Pieri, Marco; Sani, Matteo; Sharma, Vivek; Simon, Sean; Tadel, Matevz; Vartak, Adish; Wasserbaech, Steven; Wood, John; Würthwein, Frank; Yagil, Avraham; Zevi Della Porta, Giovanni; Amin, Nick; Bhandari, Rohan; Bradmiller-Feld, John; Campagnari, Claudio; Dishaw, Adam; Dutta, Valentina; Franco Sevilla, Manuel; George, Christopher; Golf, Frank; Gouskos, Loukas; Gran, Jason; Heller, Ryan; Incandela, Joe; Ovcharova, Ana; Qu, Huilin; Richman, Jeffrey; Stuart, David; Suarez, Indara; Yoo, Jaehyeok; Anderson, Dustin; Bornheim, Adolf; Lawhorn, Jay Mathew; Newman, Harvey B; Nguyen, Thong; Pena, Cristian; Spiropulu, Maria; Vlimant, Jean-Roch; Xie, Si; Zhang, Zhicai; Zhu, Ren-Yuan; Andrews, Michael Benjamin; Ferguson, Thomas; Mudholkar, Tanmay; Paulini, Manfred; Russ, James; Sun, Menglei; Vogel, Helmut; Vorobiev, Igor; Weinberg, Marc; Cumalat, John Perry; Ford, William T; Jensen, Frank; Johnson, Andrew; Krohn, Michael; Leontsinis, Stefanos; Mulholland, Troy; Stenson, Kevin; Wagner, Stephen Robert; Alexander, James; Chaves, Jorge; Chu, Jennifer; Dittmer, Susan; Mcdermott, Kevin; Mirman, Nathan; Patterson, Juliet Ritchie; Quach, Dan; Rinkevicius, Aurelijus; Ryd, Anders; Skinnari, Louise; Soffi, Livia; Tan, Shao Min; Tao, Zhengcheng; Thom, Julia; Tucker, Jordan; Wittich, Peter; Zientek, Margaret; Abdullin, Salavat; Albrow, Michael; Alyari, Maral; Apollinari, Giorgio; Apresyan, Artur; Apyan, Aram; Banerjee, Sunanda; Bauerdick, Lothar AT; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C; Bolla, Gino; Burkett, Kevin; Butler, Joel Nathan; Canepa, Anadi; Cerati, Giuseppe Benedetto; Cheung, Harry; Chlebana, Frank; Cremonesi, Matteo; Duarte, Javier; Elvira, Victor Daniel; Freeman, Jim; Gecse, Zoltan; Gottschalk, Erik; Gray, Lindsey; Green, Dan; Grünendahl, Stefan; Gutsche, Oliver; Harris, Robert M; Hasegawa, Satoshi; Hirschauer, James; Hu, Zhen; Jayatilaka, Bodhitha; Jindariani, Sergo; Johnson, Marvin; Joshi, Umesh; Klima, Boaz; Kreis, Benjamin; Lammel, Stephan; Lincoln, Don; Lipton, Ron; Liu, Miaoyuan; Liu, Tiehui; Lopes De Sá, Rafael; Lykken, Joseph; Maeshima, Kaori; Magini, Nicolo; Marraffino, John Michael; Mason, David; McBride, Patricia; Merkel, Petra; Mrenna, Stephen; Nahn, Steve; O'Dell, Vivian; Pedro, Kevin; Prokofyev, Oleg; Rakness, Gregory; Ristori, Luciano; Schneider, Basil; Sexton-Kennedy, Elizabeth; Soha, Aron; Spalding, William J; Spiegel, Leonard; Stoynev, Stoyan; Strait, James; Strobbe, Nadja; Taylor, Lucas; Tkaczyk, Slawek; Tran, Nhan Viet; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vernieri, Caterina; Verzocchi, Marco; Vidal, Richard; Wang, Michael; Weber, Hannsjoerg Artur; Whitbeck, Andrew; Acosta, Darin; Avery, Paul; Bortignon, Pierluigi; Bourilkov, Dimitri; Brinkerhoff, Andrew; Carnes, Andrew; Carver, Matthew; Curry, David; Field, Richard D; Furic, Ivan-Kresimir; Gleyzer, Sergei V; Joshi, Bhargav Madhusudan; Konigsberg, Jacobo; Korytov, Andrey; Kotov, Khristian; Ma, Peisen; Matchev, Konstantin; Mei, Hualin; Mitselmakher, Guenakh; Rank, Douglas; Shi, Kun; Sperka, David; Terentyev, Nikolay; Thomas, Laurent; Wang, Jian; Wang, Sean-Jiun; Yelton, John; Joshi, Yagya Raj; Linn, Stephan; Markowitz, Pete; Rodriguez, Jorge Luis; Ackert, Andrew; Adams, Todd; Askew, Andrew; Hagopian, Sharon; Hagopian, Vasken; Johnson, Kurtis F; Kolberg, Ted; Martinez, German; Perry, Thomas; Prosper, Harrison; Saha, Anirban; Santra, Arka; Sharma, Varun; Yohay, Rachel; Baarmand, Marc M; Bhopatkar, Vallary; Colafranceschi, Stefano; Hohlmann, Marcus; Noonan, Daniel; Roy, Titas; Yumiceva, Francisco; Adams, Mark Raymond; Apanasevich, Leonard; Berry, Douglas; Betts, Russell Richard; Cavanaugh, Richard; Chen, Xuan; Evdokimov, Olga; Gerber, Cecilia Elena; Hangal, Dhanush Anil; Hofman, David Jonathan; Jung, Kurt; Kamin, Jason; Sandoval Gonzalez, Irving Daniel; Tonjes, Marguerite; Trauger, Hallie; Varelas, Nikos; Wang, Hui; Wu, Zhenbin; Zhang, Jingyu; Bilki, Burak; Clarida, Warren; Dilsiz, Kamuran; Durgut, Süleyman; Gandrajula, Reddy Pratap; Haytmyradov, Maksat; Khristenko, Viktor; Merlo, Jean-Pierre; Mermerkaya, Hamit; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Ogul, Hasan; Onel, Yasar; Ozok, Ferhat; Penzo, Aldo; Snyder, Christina; Tiras, Emrah; Wetzel, James; Yi, Kai; Blumenfeld, Barry; Cocoros, Alice; Eminizer, Nicholas; Fehling, David; Feng, Lei; Gritsan, Andrei; Maksimovic, Petar; Roskes, Jeffrey; Sarica, Ulascan; Swartz, Morris; Xiao, Meng; You, Can; Al-bataineh, Ayman; Baringer, Philip; Bean, Alice; Boren, Samuel; Bowen, James; Castle, James; Khalil, Sadia; Kropivnitskaya, Anna; Majumder, Devdatta; Mcbrayer, William; Murray, Michael; Royon, Christophe; Sanders, Stephen; Schmitz, Erich; Tapia Takaki, Daniel; Wang, Quan; Ivanov, Andrew; Kaadze, Ketino; Maravin, Yurii; Mohammadi, Abdollah; Saini, Lovedeep Kaur; Skhirtladze, Nikoloz; Toda, Sachiko; Rebassoo, Finn; Wright, Douglas; Anelli, Christopher; Baden, Drew; Baron, Owen; Belloni, Alberto; Calvert, Brian; Eno, Sarah Catherine; Feng, Yongbin; Ferraioli, Charles; Hadley, Nicholas John; Jabeen, Shabnam; Jeng, Geng-Yuan; Kellogg, Richard G; Kunkle, Joshua; Mignerey, Alice; Ricci-Tam, Francesca; Shin, Young Ho; Skuja, Andris; Tonwar, Suresh C; Abercrombie, Daniel; Allen, Brandon; Azzolini, Virginia; Barbieri, Richard; Baty, Austin; Bi, Ran; Brandt, Stephanie; Busza, Wit; Cali, Ivan Amos; D'Alfonso, Mariarosaria; Demiragli, Zeynep; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Hsu, Dylan; Hu, Miao; Iiyama, Yutaro; Innocenti, Gian Michele; Klute, Markus; Kovalskyi, Dmytro; Lai, Yue Shi; Lee, Yen-Jie; Levin, Andrew; Luckey, Paul David; Maier, Benedikt; Marini, Andrea Carlo; Mcginn, Christopher; Mironov, Camelia; Narayanan, Siddharth; Niu, Xinmei; Paus, Christoph; Roland, Christof; Roland, Gunther; Salfeld-Nebgen, Jakob; Stephans, George; Tatar, Kaya; Velicanu, Dragos; Wang, Jing; Wang, Ta-Wei; Wyslouch, Bolek; Benvenuti, Alberto; Chatterjee, Rajdeep Mohan; Evans, Andrew; Hansen, Peter; Hiltbrand, Joshua; Kalafut, Sean; Kubota, Yuichi; Lesko, Zachary; Mans, Jeremy; Nourbakhsh, Shervin; Ruckstuhl, Nicole; Rusack, Roger; Turkewitz, Jared; Wadud, Mohammad Abrar; Acosta, John Gabriel; Oliveros, Sandra; Avdeeva, Ekaterina; Bloom, Kenneth; Claes, Daniel R; Fangmeier, Caleb; Gonzalez Suarez, Rebeca; Kamalieddin, Rami; Kravchenko, Ilya; Monroy, Jose; Siado, Joaquin Emilo; Snow, Gregory R; Stieger, Benjamin; Dolen, James; Godshalk, Andrew; Harrington, Charles; Iashvili, Ia; Nguyen, Duong; Parker, Ashley; Rappoccio, Salvatore; Roozbahani, Bahareh; Alverson, George; Barberis, Emanuela; Hortiangtham, Apichart; Massironi, Andrea; Morse, David Michael; Orimoto, Toyoko; Teixeira De Lima, Rafael; Trocino, Daniele; Wood, Darien; Bhattacharya, Saptaparna; Charaf, Otman; Hahn, Kristan Allan; Mucia, Nicholas; Odell, Nathaniel; Pollack, Brian; Schmitt, Michael Henry; Sung, Kevin; Trovato, Marco; Velasco, Mayda; Dev, Nabarun; Hildreth, Michael; Hurtado Anampa, Kenyi; Jessop, Colin; Karmgard, Daniel John; Kellams, Nathan; Lannon, Kevin; Loukas, Nikitas; Marinelli, Nancy; Meng, Fanbo; Mueller, Charles; Musienko, Yuri; Planer, Michael; Reinsvold, Allison; Ruchti, Randy; Smith, Geoffrey; Taroni, Silvia; Wayne, Mitchell; Wolf, Matthias; Woodard, Anna; Alimena, Juliette; Antonelli, Louis; Bylsma, Ben; Durkin, Lloyd Stanley; Flowers, Sean; Francis, Brian; Hart, Andrew; Hill, Christopher; Ji, Weifeng; Liu, Bingxuan; Luo, Wuming; Winer, Brian L; Wulsin, Howard Wells; Cooperstein, Stephane; Driga, Olga; Elmer, Peter; Hardenbrook, Joshua; Hebda, Philip; Higginbotham, Samuel; Lange, David; Luo, Jingyu; Marlow, Daniel; Mei, Kelvin; Ojalvo, Isabel; Olsen, James; Palmer, Christopher; Piroué, Pierre; Stickland, David; Tully, Christopher; Malik, Sudhir; Norberg, Scarlet; Barker, Anthony; Barnes, Virgil E; Das, Souvik; Folgueras, Santiago; Gutay, Laszlo; Jha, Manoj; Jones, Matthew; Jung, Andreas Werner; Khatiwada, Ajeeta; Miller, David Harry; Neumeister, Norbert; Peng, Cheng-Chieh; Qiu, Hao; Schulte, Jan-Frederik; Sun, Jian; Wang, Fuqiang; Xie, Wei; Cheng, Tongguang; Parashar, Neeti; Stupak, John; Adair, Antony; Chen, Zhenyu; Ecklund, Karl Matthew; Freed, Sarah; Geurts, Frank JM; Guilbaud, Maxime; Kilpatrick, Matthew; Li, Wei; Michlin, Benjamin; Northup, Michael; Padley, Brian Paul; Roberts, Jay; Rorie, Jamal; Shi, Wei; Tu, Zhoudunming; Zabel, James; Zhang, Aobo; Bodek, Arie; de Barbaro, Pawel; Demina, Regina; Duh, Yi-ting; Ferbel, Thomas; Galanti, Mario; Garcia-Bellido, Aran; Han, Jiyeon; Hindrichs, Otto; Khukhunaishvili, Aleko; Lo, Kin Ho; Tan, Ping; Verzetti, Mauro; Ciesielski, Robert; Goulianos, Konstantin; Mesropian, Christina; Agapitos, Antonis; Chou, John Paul; Gershtein, Yuri; Gómez Espinosa, Tirso Alejandro; Halkiadakis, Eva; Heindl, Maximilian; Hughes, Elliot; Kaplan, Steven; Kunnawalkam Elayavalli, Raghav; Kyriacou, Savvas; Lath, Amitabh; Montalvo, Roy; Nash, Kevin; Osherson, Marc; Saka, Halil; Salur, Sevil; Schnetzer, Steve; Sheffield, David; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Thomassen, Peter; Walker, Matthew; Delannoy, Andrés G; Foerster, Mark; Heideman, Joseph; Riley, Grant; Rose, Keith; Spanier, Stefan; Thapa, Krishna; Bouhali, Othmane; Castaneda Hernandez, Alfredo; Celik, Ali; Dalchenko, Mykhailo; De Mattia, Marco; Delgado, Andrea; Dildick, Sven; Eusebi, Ricardo; Gilmore, Jason; Huang, Tao; Kamon, Teruki; Mueller, Ryan; Pakhotin, Yuriy; Patel, Rishi; Perloff, Alexx; Perniè, Luca; Rathjens, Denis; Safonov, Alexei; Tatarinov, Aysen; Ulmer, Keith; Akchurin, Nural; Damgov, Jordan; De Guio, Federico; Dudero, Phillip Russell; Faulkner, James; Gurpinar, Emine; Kunori, Shuichi; Lamichhane, Kamal; Lee, Sung Won; Libeiro, Terence; Mengke, Tielige; Muthumuni, Samila; Peltola, Timo; Undleeb, Sonaina; Volobouev, Igor; Wang, Zhixing; Greene, Senta; Gurrola, Alfredo; Janjam, Ravi; Johns, Willard; Maguire, Charles; Melo, Andrew; Ni, Hong; Padeken, Klaas; Sheldon, Paul; Tuo, Shengquan; Velkovska, Julia; Xu, Qiao; Arenton, Michael Wayne; Barria, Patrizia; Cox, Bradley; Hirosky, Robert; Joyce, Matthew; Ledovskoy, Alexander; Li, Hengne; Neu, Christopher; Sinthuprasith, Tutanon; Wang, Yanchu; Wolfe, Evan; Xia, Fan; Harr, Robert; Karchin, Paul Edmund; Poudyal, Nabin; Sturdy, Jared; Thapa, Prakash; Zaleski, Shawn; Brodski, Michael; Buchanan, James; Caillol, Cécile; Dasu, Sridhara; Dodd, Laura; Duric, Senka; Gomber, Bhawna; Grothe, Monika; Herndon, Matthew; Hervé, Alain; Hussain, Usama; Klabbers, Pamela; Lanaro, Armando; Levine, Aaron; Long, Kenneth; Loveless, Richard; Polese, Giovanni; Ruggles, Tyler; Savin, Alexander; Smith, Nicholas; Smith, Wesley H; Taylor, Devin; Woods, Nathaniel

2018-01-11

The pseudorapidity distributions of charged hadrons in proton-lead collisions at nucleon-nucleon center-of-mass energies ${\\sqrt {\\smash [b]{s_{_{\\mathrm {NN}}}}}} = $ 5.02 and 8.16 TeV are presented. The measurements are based on data samples collected by the CMS experiment at the LHC. The number of primary charged hadrons produced in non-single-diffractive proton-lead collisions is determined in the pseudorapidity range $| \\eta_{\\text{lab}} | } | _ {| \\eta_{\\text{cm}} | < 0.5 }$ are 17.31 $\\pm$ 0.01 (stat) $\\pm$ 0.59 (syst) and 20.10 $\\pm$ 0.01 (stat) $\\pm$ 0.85 (syst) at ${\\sqrt {\\smash [b]{s_{_{\\mathrm {NN}}}}}} = $ 5.02 and 8.16 TeV, respectively. The particle densities per participant nucleon are compared to similar measurements in proton-proton, proton-nucleus, and nucleus-nucleus collisions.

30 CFR 816.83 - Coal mine waste: Refuse piles.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Coal mine waste: Refuse piles. 816.83 Section... ACTIVITIES § 816.83 Coal mine waste: Refuse piles. Refuse piles shall meet the requirements of § 816.81, the... drainage may not be diverted over the outslope of the refuse piles. Runoff from the areas above the refuse...

Investment casting: parameters, application and recent development

International Nuclear Information System (INIS)

Zaid, A.I.O.

2007-01-01

Investment casting process, also referred to as the lost wax method and as precision casting, has been known for more than 6000 years. However, industry paid little attention to the process until the urgent military demands of World War 1 overtaxed the machine tool industry and short cuts were then needed to provide finished tools and precision parts, avoiding time-consuming in machining and assembly. The use of the process for the production of commercial casting has grown in the second half of the 20th century. The process is highly flexible and can handle great variety of parts which are difficult or even not possible to be produced by forging or other casting methods. In this paper, the investment casting process, its applications, advantages and limitations together with the parameters affecting it as related to pattern material, cluster, slurry and molten metal are given and discussed. Furthermore, the recent developments in the process particularly in manufacturing parts made of superalloys e.g nickel-base alloys are given and discussed. The striking fact that the process has advanced further in the last 60 years than it has in the previous 6000 years ensures that in the coming years of this century development in the process and its application will continue to advance in the interest of achieving higher quality and precision which can meet the critical performance standards being imposed. (author)

Using of material-technological modelling for designing production of closed die forgings

Science.gov (United States)

Ibrahim, K.; Vorel, I.; Jeníček, Š.; Káňa, J.; Aišman, D.; Kotěšovec, V.

2017-02-01

Production of forgings is a complex and demanding process which consists of a number of forging operations and, in many cases, includes post-forge heat treatment. An optimized manufacturing line is a prerequisite for obtaining prime-quality products which in turn are essential to profitable operation of a forging company. Problems may, however, arise from modifications to the manufacturing route due to changing customer needs. As a result, the production may have to be suspended temporarily to enable changeover and optimization. Using material-technological modelling, the required modifications can be tested and optimized under laboratory conditions outside the plant without disrupting the production. Thanks to material-technological modelling, the process parameters can be varied rapidly in response to changes in market requirements. Outcomes of the modelling runs include optimum parameters for the forging part’s manufacturing route, values of mechanical properties, and results of microstructure analysis. This article describes the use of material-technological modelling for exploring the impact of the amount of deformation and the rate of cooling of a particular forged part from the finish-forging temperature on its microstructure and related mechanical properties.

Neutron radiography inspection of investment castings

International Nuclear Information System (INIS)

Richards, W.J.; Barrett, J.R.; Springgate, M.E.; Shields, K.C.

2004-01-01

Investment casting, also known as the lost wax process, is a manufacturing method employed to produce near net shape metal articles. Traditionally, investment casting has been used to produce structural titanium castings for aero-engine applications with wall thickness less than 1 in (2.54 cm). Recently, airframe manufacturers have been exploring the use of titanium investment casting to replace components traditionally produced from forgings. Use of titanium investment castings for these applications reduces weight, cost, lead time, and part count. Recently, the investment casting process has been selected to produce fracture critical structural titanium airframe components. These airframe components have pushed the traditional inspection techniques to their physical limits due to cross sections on the order of 3 in (7.6 cm). To overcome these inspection limitations, a process incorporating neutron radiography (n-ray) has been developed. In this process, the facecoat of the investment casting mold material contains a cocalcined mixture of yttrium oxide and gadolinium oxide. The presence of the gadolinium oxide, allows for neutron radiographic imaging (and eventual removal and repair) of mold facecoat inclusions that remain within these thick cross sectional castings. Probability of detection (POD) studies have shown a 3x improvement of detecting a 0.050x0.007 in 2 (1.270x0.178 mm 2 ) inclusion of this cocalcined material using n-ray techniques when compared to the POD using traditional X-ray techniques. Further, it has been shown that this n-ray compatible mold facecoat material produces titanium castings of equal metallurgical quality when compared to the traditional materials. Since investment castings can be very large and heavy, the neutron radiography facilities at the University of California, Davis McClellan Nuclear Radiation Center (UCD/MNRC) were used to develop the inspection techniques. The UCD/MNRC has very unique facilities that can handle large parts

Simulation and experimental verification of the filling process of semi-solid die forging for cup shell

OpenAIRE

Jianbo TAN; Zichao WANG; Dongxu WANG

2015-01-01

The filling mold process of semi-solid alloy blank influences severely the forming and properties of finished piece. In this paper, DEFORM is applied to simulate the process of cup-type 6061 alloy die forging casting. The influences of the temperature of semi-solid alloy blank, preheating temperature, and downward press speed of pressure head on process of mold filling and velocity field are investigated. The results show that the mold filling of semi-solid alloy paste smoothly fills along th...

Forging of Advanced Disk Alloy LSHR

Science.gov (United States)

Gabb, Timothy P.; Gayda, John; Falsey, John

2005-01-01

The powder metallurgy disk alloy LSHR was designed with a relatively low gamma precipitate solvus temperature and high refractory element content to allow versatile heat treatment processing combined with high tensile, creep and fatigue properties. Grain size can be chiefly controlled through proper selection of solution heat treatment temperatures relative to the gamma precipitate solvus temperature. However, forging process conditions can also significantly influence solution heat treatment-grain size response. Therefore, it is necessary to understand the relationships between forging process conditions and the eventual grain size of solution heat treated material. A series of forging experiments were performed with subsequent subsolvus and supersolvus heat treatments, in search of suitable forging conditions for producing uniform fine grain and coarse grain microstructures. Subsolvus, supersolvus, and combined subsolvus plus supersolvus heat treatments were then applied. Forging and subsequent heat treatment conditions were identified allowing uniform fine and coarse grain microstructures.

Role of forgings in powder metallurgy industry

International Nuclear Information System (INIS)

Hayes, A.F.; DeRidder, A.J.

1975-01-01

Forging of powder metallurgy materials is discussed. Information and data are included on forging powder metallurgy W, Mo, In 100, Rene 95, Astroloy, Be, and Ti. It is noted that the combination of powder metallurgy and forging work provides the best product from standpoints of reproducibility, freedom from segregation, low scrap rate, and uniform mechanical properties. Experience is being used to develop contour forging from hot isostatic pressed billets or preforms. The quality of this product is under evaluation. Results show steady improvement and it is anticipated that continued effort will soon produce a reliable, less costly product. Forging can continue to be relied upon to correct subtle defects present in powder metallurgy material

Forging loads, deformation modes and fracture in axi-symmetrric closed die cold forging of sintered aluminium powder compacts

International Nuclear Information System (INIS)

Butt, M.A.; Ali, L.

2003-01-01

An experimental investigation into closed-die cold forging of sintered aluminium powder rod- shaped compacts was carried out. Axi-symmetric components were forged from sintered powder preforms with different initial diameter to height ratios. Different compaction pressures, sintering and lubrication conditions were used as variables during the investigations. Detailed observations were made on green/sintered density, compaction defects, forging loads, deformation modes and on the onset of fracture during progressive forging of sintered powder compacts. Experimental results obtained during the investigations have been presented and discussed in detail. (author)

Improving the casting properties of high-strength aluminium alloys:

OpenAIRE

Ekrt, Ondřej; Šerák, Jan; Vojtěch, Dalibor

2004-01-01

Al-Zn-Mg-Cu alloys are examples of high-strength alloys. After age-hardening they often possess tensile strengths of more than 500 MPa. However, their casting properties are relatively poor as a result of solidification intervals that are too wide. Therefore, they often require an extrusion, rolling, or forging treatment, and the production of small series of special parts can, as a consequence, be very expensive. In this study, an improvement in the castability and a reduction of the hot-tea...

30 CFR 816.79 - Protection of underground mining.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Protection of underground mining. 816.79 Section 816.79 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND ENFORCEMENT, DEPARTMENT OF THE INTERIOR PERMANENT PROGRAM PERFORMANCE STANDARDS PERMANENT PROGRAM PERFORMANCE STANDARDS-SURFACE MINING...

30 CFR 816.46 - Hydrologic balance: Siltation structures.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Hydrologic balance: Siltation structures. 816...-SURFACE MINING ACTIVITIES § 816.46 Hydrologic balance: Siltation structures. (a) For the purpose of this... activities include diversion ditches, siltation structures, or roads that are designed constructed and...

Pseudorapidity distributions of charged hadrons in proton-lead collisions at √{s_{NN}}=5.02 and 8.16 TeV

Science.gov (United States)

Sirunyan, A. M.; Tumasyan, A.; Adam, W.; Ambrogi, F.; Asilar, E.; Bergauer, T.; Brandstetter, J.; Brondolin, E.; Drag-icevic, M.; Erö, J.; Flechl, M.; Friedl, M.; Frühwirth, R.; Ghete, V. M.; Grossmann, J.; Hrubec, J.; Jeitler, M.; König, A.; Krammer, N.; Krätschmer, I.; Liko, D.; Madlener, T.; Mikulec, I.; Pree, E.; Rad, N.; Rohringer, H.; Schieck, J.; Schöfbeck, R.; Spanring, M.; Spitzbart, D.; Waltenberger, W.; Wittmann, J.; Wulz, C.-E.; Zarucki, M.; Chekhovsky, V.; Mossolov, V.; Suarez Gonzalez, J.; De Wolf, E. A.; Di Croce, D.; Janssen, X.; Lauwers, J.; Van De Klundert, M.; Van Haevermaet, H.; Van Mechelen, P.; Van Remortel, N.; Abu Zeid, S.; Blekman, F.; D'Hondt, J.; De Bruyn, I.; De Clercq, J.; Deroover, K.; Flouris, G.; Lontkovskyi, D.; Lowette, S.; Moortgat, S.; Moreels, L.; Python, Q.; Skovpen, K.; Tavernier, S.; Van Doninck, W.; Van Mulders, P.; Van Parijs, I.; Beghin, D.; Brun, H.; Clerbaux, B.; De Lentdecker, G.; Delannoy, H.; Dorney, B.; Fasanella, G.; Favart, L.; Goldouzian, R.; Grebenyuk, A.; Karapostoli, G.; Lenzi, T.; Luetic, J.; Maerschalk, T.; Marinov, A.; Seva, T.; Starling, E.; Vander Velde, C.; Vanlaer, P.; Vannerom, D.; Yonamine, R.; Zenoni, F.; Zhang, F.; Cimmino, A.; Cornelis, T.; Dobur, D.; Fagot, A.; Gul, M.; Khvastunov, I.; Poyraz, D.; Roskas, C.; Salva, S.; Tytgat, M.; Verbeke, W.; Zaganidis, N.; Bakhshiansohi, H.; Bondu, O.; Brochet, S.; Bruno, G.; Caputo, C.; Caudron, A.; David, P.; De Visscher, S.; Delaere, C.; Delcourt, M.; Francois, B.; Giammanco, A.; Komm, M.; Krintiras, G.; Lemaitre, V.; Magitteri, A.; Mertens, A.; Musich, M.; Piotrzkowski, K.; Quertenmont, L.; Saggio, A.; Vidal Marono, M.; Wertz, S.; Zobec, J.; Beliy, N.; Aldá Júnior, W. L.; Alves, F. L.; Alves, G. A.; Brito, L.; Correa Martins Junior, M.; Hensel, C.; Moraes, A.; Pol, M. E.; Rebello Teles, P.; Belchior Batista Das Chagas, E.; Carvalho, W.; Chinellato, J.; Coelho, E.; Da Costa, E. M.; Da Silveira, G. G.; De Jesus Damiao, D.; Fonseca De Souza, S.; Huertas Guativa, L. M.; Malbouisson, H.; Melo De Almeida, M.; Mora Herrera, C.; Mundim, L.; Nogima, H.; Sanchez Rosas, L. J.; Santoro, A.; Sznajder, A.; Thiel, M.; Tonelli Manganote, E. J.; Torres Da Silva De Araujo, F.; Vilela Pereira, A.; Ahuja, S.; Bernardes, C. A.; Fernandez Perez Tomei, T. R.; Gregores, E. M.; Mercadante, P. G.; Novaes, S. F.; Padula, Sandra S.; Romero Abad, D.; Ruiz Vargas, J. C.; Aleksandrov, A.; Hadjiiska, R.; Iaydjiev, P.; Misheva, M.; Rodozov, M.; Shopova, M.; Sultanov, G.; Dimitrov, A.; Glushkov, I.; Litov, L.; Pavlov, B.; Petkov, P.; Fang, W.; Gao, X.; Yuan, L.; Ahmad, M.; Bian, J. G.; Chen, G. M.; Chen, H. S.; Chen, M.; Chen, Y.; Jiang, C. H.; Leggat, D.; Liao, H.; Liu, Z.; Romeo, F.; Shaheen, S. M.; Spiezia, A.; Tao, J.; Wang, C.; Wang, Z.; Yazgan, E.; Zhang, H.; Zhang, S.; Zhao, J.; Ban, Y.; Chen, G.; Li, Q.; Liu, S.; Mao, Y.; Qian, S. J.; Wang, D.; Xu, Z.; Avila, C.; Cabrera, A.; Chaparro Sierra, L. F.; Florez, C.; González Hernández, C. F.; Ruiz Alvarez, J. D.; Segura Delgado, M. A.; Courbon, B.; Godinovic, N.; Lelas, D.; Puljak, I.; Ribeiro Cipriano, P. M.; Sculac, T.; Antunovic, Z.; Kovac, M.; Brigljevic, V.; Ferencek, D.; Kadija, K.; Mesic, B.; Starodumov, A.; Susa, T.; Ather, M. W.; Attikis, A.; Mavromanolakis, G.; Mousa, J.; Nicolaou, C.; Ptochos, F.; Razis, P. A.; Rykaczewski, H.; Finger, M.; Finger, M.; Carrera Jarrin, E.; Abdelalim, A. A.; Mohammed, Y.; Salama, E.; Dewanjee, R. K.; Kadastik, M.; Perrini, L.; Raidal, M.; Tiko, A.; Veelken, C.; Eerola, P.; Kirschenmann, H.; Pekkanen, J.; Voutilainen, M.; Havukainen, J.; Heikkilä, J. K.; Järvinen, T.; Karimäki, V.; Kinnunen, R.; Lampén, T.; Lassila-Perini, K.; Laurila, S.; Lehti, S.; Lindén, T.; Luukka, P.; Siikonen, H.; Tuominen, E.; Tuominiemi, J.; Talvitie, J.; Tuuva, T.; Besancon, M.; Couderc, F.; Dejardin, M.; Denegri, D.; Faure, J. L.; Ferri, F.; Ganjour, S.; Ghosh, S.; Givernaud, A.; Gras, P.; Hamel de Monchenault, G.; Jarry, P.; Kucher, I.; Leloup, C.; Locci, E.; Machet, M.; Malcles, J.; Negro, G.; Rander, J.; Rosowsky, A.; Sahin, M. Ö.; Titov, M.; Abdulsalam, A.; Amendola, C.; Antropov, I.; Baffioni, S.; Beaudette, F.; Busson, P.; Cadamuro, L.; Charlot, C.; Granier de Cassagnac, R.; Jo, M.; Lisniak, S.; Lobanov, A.; Martin Blanco, J.; Nguyen, M.; Ochando, C.; Ortona, G.; Paganini, P.; Pigard, P.; Salerno, R.; Sauvan, J. B.; Sirois, Y.; Stahl Leiton, A. G.; Strebler, T.; Yilmaz, Y.; Zabi, A.; Zghiche, A.; Agram, J.-L.; Andrea, J.; Bloch, D.; Brom, J.-M.; Buttignol, M.; Chabert, E. C.; Chanon, N.; Collard, C.; Conte, E.; Coubez, X.; Fontaine, J.-C.; Gelé, D.; Goerlach, U.; Jansová, M.; Le Bihan, A.-C.; Tonon, N.; Van Hove, P.; Gadrat, S.; Beauceron, S.; Bernet, C.; Boudoul, G.; Chierici, R.; Contardo, D.; Depasse, P.; El Mamouni, H.; Fay, J.; Finco, L.; Gascon, S.; Gouzevitch, M.; Grenier, G.; Ille, B.; Lagarde, F.; Laktineh, I. B.; Lethuillier, M.; Mirabito, L.; Pequegnot, A. L.; Perries, S.; Popov, A.; Sordini, V.; Vander Donckt, M.; Viret, S.; Toriashvili, T.; Tsamalaidze, Z.; Autermann, C.; Feld, L.; Kiesel, M. K.; Klein, K.; Lipinski, M.; Preuten, M.; Schomakers, C.; Schulz, J.; Zhukov, V.; Albert, A.; Dietz-Laursonn, E.; Duchardt, D.; Endres, M.; Erdmann, M.; Erdweg, S.; Esch, T.; Fischer, R.; Güth, A.; Hamer, M.; Hebbeker, T.; Heidemann, C.; Hoepfner, K.; Knutzen, S.; Merschmeyer, M.; Meyer, A.; Millet, P.; Mukherjee, S.; Pook, T.; Radziej, M.; Reithler, H.; Rieger, M.; Scheuch, F.; Teyssier, D.; Thüer, S.; Flügge, G.; Kargoll, B.; Kress, T.; Künsken, A.; Müller, T.; Nehrkorn, A.; Nowack, A.; Pistone, C.; Pooth, O.; Stahl, A.; Aldaya Martin, M.; Arndt, T.; Asawatangtrakuldee, C.; Beernaert, K.; Behnke, O.; Behrens, U.; Bermúdez Martínez, A.; Bin Anuar, A. A.; Borras, K.; Botta, V.; Campbell, A.; Connor, P.; Contreras-Campana, C.; Costanza, F.; Diez Pardos, C.; Eckerlin, G.; Eckstein, D.; Eichhorn, T.; Eren, E.; Gallo, E.; Garay Garcia, J.; Geiser, A.; Gizhko, A.; Grados Luyando, J. M.; Grohsjean, A.; Gunnellini, P.; Guthoff, M.; Harb, A.; Hauk, J.; Hempel, M.; Jung, H.; Kalogeropoulos, A.; Kasemann, M.; Keaveney, J.; Kleinwort, C.; Korol, I.; Krücker, D.; Lange, W.; Lelek, A.; Lenz, T.; Leonard, J.; Lipka, K.; Lohmann, W.; Mankel, R.; Melzer-Pellmann, I.-A.; Meyer, A. B.; Mittag, G.; Mnich, J.; Mussgiller, A.; Ntomari, E.; Pitzl, D.; Raspereza, A.; Savitskyi, M.; Saxena, P.; Shevchenko, R.; Spannagel, S.; Stefaniuk, N.; Van Onsem, G. P.; Walsh, R.; Wen, Y.; Wichmann, K.; Wissing, C.; Zenaiev, O.; Aggleton, R.; Bein, S.; Blobel, V.; Centis Vignali, M.; Dreyer, T.; Garutti, E.; Gonzalez, D.; Haller, J.; Hinzmann, A.; Hoffmann, M.; Karavdina, A.; Klanner, R.; Kogler, R.; Kovalchuk, N.; Kurz, S.; Lapsien, T.; Marchesini, I.; Marconi, D.; Meyer, M.; Niedziela, M.; Nowatschin, D.; Pantaleo, F.; Peiffer, T.; Perieanu, A.; Scharf, C.; Schleper, P.; Schmidt, A.; Schumann, S.; Schwandt, J.; Sonneveld, J.; Stadie, H.; Steinbrück, G.; Stober, F. M.; Stöver, M.; Tholen, H.; Troendle, D.; Usai, E.; Vanhoefer, A.; Vormwald, B.; Akbiyik, M.; Barth, C.; Baselga, M.; Baur, S.; Butz, E.; Caspart, R.; Chwalek, T.; Colombo, F.; De Boer, W.; Dierlamm, A.; Faltermann, N.; Freund, B.; Friese, R.; Giffels, M.; Harrendorf, M. A.; Hartmann, F.; Heindl, S. M.; Husemann, U.; Kassel, F.; Kudella, S.; Mildner, H.; Mozer, M. U.; Müller, Th.; Plagge, M.; Quast, G.; Rabbertz, K.; Schröder, M.; Shvetsov, I.; Sieber, G.; Simonis, H. J.; Ulrich, R.; Wayand, S.; Weber, M.; Weiler, T.; Williamson, S.; Wöhrmann, C.; Wolf, R.; Anagnostou, G.; Daskalakis, G.; Geralis, T.; Kyriakis, A.; Loukas, D.; Topsis-Giotis, I.; Karathanasis, G.; Kesisoglou, S.; Panagiotou, A.; Saoulidou, N.; Kousouris, K.; Evangelou, I.; Foudas, C.; Kokkas, P.; Mallios, S.; Manthos, N.; Papadopoulos, I.; Paradas, E.; Strologas, J.; Triantis, F. A.; Csanad, M.; Filipovic, N.; Pasztor, G.; Surányi, O.; Veres, G. I.; Bencze, G.; Hajdu, C.; Horvath, D.; Hunyadi, Á.; Sikler, F.; Veszpremi, V.; Beni, N.; Czellar, S.; Karancsi, J.; Makovec, A.; Molnar, J.; Szillasi, Z.; Bartók, M.; Raics, P.; Trocsanyi, Z. L.; Ujvari, B.; Choudhury, S.; Komaragiri, J. R.; Bahinipati, S.; Bhowmik, S.; Mal, P.; Mandal, K.; Nayak, A.; Sahoo, D. K.; Sahoo, N.; Swain, S. K.; Bansal, S.; Beri, S. B.; Bhatnagar, V.; Chawla, R.; Dhingra, N.; Kalsi, A. K.; Kaur, A.; Kaur, M.; Kaur, S.; Kumar, R.; Kumari, P.; Mehta, A.; Singh, J. B.; Walia, G.; Kumar, Ashok; Shah, Aashaq; Bhardwaj, A.; Chauhan, S.; Choudhary, B. C.; Garg, R. B.; Keshri, S.; Kumar, A.; Malhotra, S.; Naimuddin, M.; Ranjan, K.; Sharma, R.; Bhardwaj, R.; Bhattacharya, R.; Bhattacharya, S.; Bhawandeep, U.; Dey, S.; Dutt, S.; Dutta, S.; Ghosh, S.; Majumdar, N.; Modak, A.; Mondal, K.; Mukhopadhyay, S.; Nandan, S.; Purohit, A.; Roy, A.; Roy Chowdhury, S.; Sarkar, S.; Sharan, M.; Thakur, S.; Behera, P. K.; Chudasama, R.; Dutta, D.; Jha, V.; Kumar, V.; Mohanty, A. K.; Netrakanti, P. K.; Pant, L. M.; Shukla, P.; Topkar, A.; Aziz, T.; Dugad, S.; Mahakud, B.; Mitra, S.; Mohanty, G. B.; Sur, N.; Sutar, B.; Banerjee, S.; Bhattacharya, S.; Chatterjee, S.; Das, P.; Guchait, M.; Jain, Sa.; Kumar, S.; Maity, M.; Majumder, G.; Mazumdar, K.; Sarkar, T.; Wickramage, N.; Chauhan, S.; Dube, S.; Hegde, V.; Kapoor, A.; Kothekar, K.; Pandey, S.; Rane, A.; Sharma, S.; Chenarani, S.; Eskandari Tadavani, E.; Etesami, S. M.; Khakzad, M.; Mohammadi Najafabadi, M.; Naseri, M.; Paktinat Mehdiabadi, S.; Rezaei Hosseinabadi, F.; Safarzadeh, B.; Zeinali, M.; Felcini, M.; Grunewald, M.; Abbrescia, M.; Calabria, C.; Colaleo, A.; Creanza, D.; Cristella, L.; De Filippis, N.; De Palma, M.; Errico, F.; Fiore, L.; Iaselli, G.; Lezki, S.; Maggi, G.; Maggi, M.; Miniello, G.; My, S.; Nuzzo, S.; Pompili, A.; Pugliese, G.; Radogna, R.; Ranieri, A.; Selvaggi, G.; Sharma, A.; Silvestris, L.; Venditti, R.; Verwilligen, P.; Abbiendi, G.; Battilana, C.; Bonacorsi, D.; Borgonovi, L.; Braibant-Giacomelli, S.; Campanini, R.; Capiluppi, P.; Castro, A.; Cavallo, F. R.; Chhibra, S. S.; Codispoti, G.; Cuffiani, M.; Dallavalle, G. M.; Fabbri, F.; Fanfani, A.; Fasanella, D.; Giacomelli, P.; Grandi, C.; Guiducci, L.; Marcellini, S.; Masetti, G.; Montanari, A.; Navarria, F. L.; Perrotta, A.; Rossi, A. M.; Rovelli, T.; Siroli, G. P.; Tosi, N.; Albergo, S.; Costa, S.; Di Mattia, A.; Giordano, F.; Potenza, R.; Tricomi, A.; Tuve, C.; Barbagli, G.; Chatterjee, K.; Ciulli, V.; Civinini, C.; D'Alessandro, R.; Focardi, E.; Lenzi, P.; Meschini, M.; Paoletti, S.; Russo, L.; Sguazzoni, G.; Strom, D.; Viliani, L.; Benussi, L.; Bianco, S.; Fabbri, F.; Piccolo, D.; Primavera, F.; Calvelli, V.; Ferro, F.; Robutti, E.; Tosi, S.; Benaglia, A.; Beschi, A.; Brianza, L.; Brivio, F.; Ciriolo, V.; Dinardo, M. E.; Fiorendi, S.; Gennai, S.; Ghezzi, A.; Govoni, P.; Malberti, M.; Malvezzi, S.; Manzoni, R. A.; Menasce, D.; Moroni, L.; Paganoni, M.; Pauwels, K.; Pedrini, D.; Pigazzini, S.; Ragazzi, S.; Redaelli, N.; Tabarelli de Fatis, T.; Buontempo, S.; Cavallo, N.; Di Guida, S.; Fabozzi, F.; Fienga, F.; Iorio, A. O. M.; Khan, W. A.; Lista, L.; Meola, S.; Paolucci, P.; Sciacca, C.; Thyssen, F.; Azzi, P.; Bacchetta, N.; Benato, L.; Bisello, D.; Boletti, A.; Carlin, R.; Carvalho Antunes De Oliveira, A.; Checchia, P.; De Castro Manzano, P.; Dorigo, T.; Dosselli, U.; Gasparini, F.; Gasparini, U.; Gozzelino, A.; Lacaprara, S.; Margoni, M.; Meneguzzo, A. T.; Pozzobon, N.; Ronchese, P.; Rossin, R.; Simonetto, F.; Torassa, E.; Zanetti, M.; Zotto, P.; Zumerle, G.; Braghieri, A.; Magnani, A.; Montagna, P.; Ratti, S. P.; Re, V.; Ressegotti, M.; Riccardi, C.; Salvini, P.; Vai, I.; Vitulo, P.; Alunni Solestizi, L.; Biasini, M.; Bilei, G. M.; Cecchi, C.; Ciangottini, D.; Fanò, L.; Lariccia, P.; Leonardi, R.; Manoni, E.; Mantovani, G.; Mariani, V.; Menichelli, M.; Rossi, A.; Santocchia, A.; Spiga, D.; Androsov, K.; Azzurri, P.; Bagliesi, G.; Boccali, T.; Borrello, L.; Castaldi, R.; Ciocci, M. A.; Dell'Orso, R.; Fedi, G.; Giannini, L.; Giassi, A.; Grippo, M. T.; Ligabue, F.; Lomtadze, T.; Manca, E.; Mandorli, G.; Messineo, A.; Palla, F.; Rizzi, A.; Savoy-Navarro, A.; Spagnolo, P.; Tenchini, R.; Tonelli, G.; Venturi, A.; Verdini, P. G.; Barone, L.; Cavallari, F.; Cipriani, M.; Daci, N.; Del Re, D.; Di Marco, E.; Diemoz, M.; Gelli, S.; Longo, E.; Margaroli, F.; Marzocchi, B.; Meridiani, P.; Organtini, G.; Paramatti, R.; Preiato, F.; Rahatlou, S.; Rovelli, C.; Santanastasio, F.; Amapane, N.; Arcidiacono, R.; Argiro, S.; Arneodo, M.; Bartosik, N.; Bellan, R.; Biino, C.; Cartiglia, N.; Cenna, F.; Costa, M.; Covarelli, R.; Degano, A.; Demaria, N.; Kiani, B.; Mariotti, C.; Maselli, S.; Migliore, E.; Monaco, V.; Monteil, E.; Monteno, M.; Obertino, M. M.; Pacher, L.; Pastrone, N.; Pelliccioni, M.; Pinna Angioni, G. L.; Ravera, F.; Romero, A.; Ruspa, M.; Sacchi, R.; Shchelina, K.; Sola, V.; Solano, A.; Staiano, A.; Traczyk, P.; Belforte, S.; Casarsa, M.; Cossutti, F.; Della Ricca, G.; Zanetti, A.; Kim, D. H.; Kim, G. N.; Kim, M. S.; Lee, J.; Lee, S.; Lee, S. W.; Moon, C. S.; Oh, Y. D.; Sekmen, S.; Son, D. C.; Yang, Y. C.; Lee, A.; Kim, H.; Moon, D. H.; Oh, G.; Brochero Cifuentes, J. A.; Goh, J.; Kim, T. J.; Cho, S.; Choi, S.; Go, Y.; Gyun, D.; Ha, S.; Hong, B.; Jo, Y.; Kim, Y.; Lee, K.; Lee, K. S.; Lee, S.; Lim, J.; Park, S. K.; Roh, Y.; Almond, J.; Kim, J.; Kim, J. S.; Lee, H.; Lee, K.; Nam, K.; Oh, S. B.; Radburn-Smith, B. C.; Seo, S. h.; Yang, U. K.; Yoo, H. D.; Yu, G. B.; Choi, M.; Kim, H.; Kim, J. H.; Lee, J. S. H.; Park, I. C.; Choi, Y.; Hwang, C.; Lee, J.; Yu, I.; Dudenas, V.; Juodagalvis, A.; Vaitkus, J.; Ahmed, I.; Ibrahim, Z. A.; Ali, M. A. B. Md; Mohamad Idris, F.; Wan Abdullah, W. A. T.; Yusli, M. N.; Zolkapli, Z.; Reyes-Almanza, R.; Ramirez-Sanchez, G.; Duran-Osuna, M. C.; Castilla-Valdez, H.; De La Cruz-Burelo, E.; Heredia-De La Cruz, I.; Rabadan-Trejo, R. I.; Lopez-Fernandez, R.; Mejia Guisao, J.; Sanchez-Hernandez, A.; Carrillo Moreno, S.; Oropeza Barrera, C.; Vazquez Valencia, F.; Pedraza, I.; Salazar Ibarguen, H. A.; Uribe Estrada, C.; Morelos Pineda, A.; Krofcheck, D.; Butler, P. H.; Ahmad, A.; Ahmad, M.; Hassan, Q.; Hoorani, H. R.; Saddique, A.; Shah, M. A.; Shoaib, M.; Waqas, M.; Bialkowska, H.; Bluj, M.; Boimska, B.; Frueboes, T.; Górski, M.; Kazana, M.; Nawrocki, K.; Szleper, M.; Zalewski, P.; Bunkowski, K.; Byszuk, A.; Doroba, K.; Kalinowski, A.; Konecki, M.; Krolikowski, J.; Misiura, M.; Olszewski, M.; Pyskir, A.; Walczak, M.; Bargassa, P.; Beirão Da Cruz E Silva, C.; Di Francesco, A.; Faccioli, P.; Galinhas, B.; Gallinaro, M.; Hollar, J.; Leonardo, N.; Lloret Iglesias, L.; Nemallapudi, M. V.; Seixas, J.; Strong, G.; Toldaiev, O.; Vadruccio, D.; Varela, J.; Afanasiev, S.; Bunin, P.; Gavrilenko, M.; Golutvin, I.; Gorbunov, I.; Kamenev, A.; Karjavin, V.; Lanev, A.; Malakhov, A.; Matveev, V.; Palichik, V.; Perelygin, V.; Shmatov, S.; Shulha, S.; Skatchkov, N.; Smirnov, V.; Voytishin, N.; Zarubin, A.; Ivanov, Y.; Kim, V.; Kuznetsova, E.; Levchenko, P.; Murzin, V.; Oreshkin, V.; Smirnov, I.; Sulimov, V.; Uvarov, L.; Vavilov, S.; Vorobyev, A.; Andreev, Yu.; Dermenev, A.; Gninenko, S.; Golubev, N.; Karneyeu, A.; Kirsanov, M.; Krasnikov, N.; Pashenkov, A.; Tlisov, D.; Toropin, A.; Epshteyn, V.; Gavrilov, V.; Lychkovskaya, N.; Popov, V.; Pozdnyakov, I.; Safronov, G.; Spiridonov, A.; Stepennov, A.; Toms, M.; Vlasov, E.; Zhokin, A.; Aushev, T.; Bylinkin, A.; Chadeeva, M.; Parygin, P.; Philippov, D.; Polikarpov, S.; Popova, E.; Rusinov, V.; Andreev, V.; Azarkin, M.; Dremin, I.; Kirakosyan, M.; Terkulov, A.; Baskakov, A.; Belyaev, A.; Boos, E.; Demiyanov, A.; Ershov, A.; Gribushin, A.; Kodolova, O.; Korotkikh, V.; Lokhtin, I.; Miagkov, I.; Obraztsov, S.; Petrushanko, S.; Savrin, V.; Snigirev, A.; Vardanyan, I.; Blinov, V.; Skovpen, Y.; Shtol, D.; Azhgirey, I.; Bayshev, I.; Bitioukov, S.; Elumakhov, D.; Kachanov, V.; Kalinin, A.; Konstantinov, D.; Mandrik, P.; Petrov, V.; Ryutin, R.; Sobol, A.; Troshin, S.; Tyurin, N.; Uzunian, A.; Volkov, A.; Adzic, P.; Cirkovic, P.; Devetak, D.; Dordevic, M.; Milosevic, J.; Rekovic, V.; Alcaraz Maestre, J.; Barrio Luna, M.; Cerrada, M.; Colino, N.; De La Cruz, B.; Delgado Peris, A.; Escalante Del Valle, A.; Fernandez Bedoya, C.; Fernández Ramos, J. P.; Flix, J.; Fouz, M. C.; Gonzalez Lopez, O.; Goy Lopez, S.; Hernandez, J. M.; Josa, M. I.; Moran, D.; Pérez-Calero Yzquierdo, A.; Puerta Pelayo, J.; Quintario Olmeda, A.; Redondo, I.; Romero, L.; Soares, M. S.; Álvarez Fernández, A.; Albajar, C.; de Trocóniz, J. F.; Missiroli, M.; Cuevas, J.; Erice, C.; Fernandez Menendez, J.; Gonzalez Caballero, I.; González Fernández, J. R.; Palencia Cortezon, E.; Sanchez Cruz, S.; Vischia, P.; Vizan Garcia, J. M.; Cabrillo, I. J.; Calderon, A.; Chazin Quero, B.; Curras, E.; Duarte Campderros, J.; Fernandez, M.; Garcia-Ferrero, J.; Gomez, G.; Lopez Virto, A.; Marco, J.; Martinez Rivero, C.; Martinez Ruiz del Arbol, P.; Matorras, F.; Piedra Gomez, J.; Rodrigo, T.; Ruiz-Jimeno, A.; Scodellaro, L.; Trevisani, N.; Vila, I.; Vilar Cortabitarte, R.; Abbaneo, D.; Akgun, B.; Auffray, E.; Baillon, P.; Ball, A. H.; Barney, D.; Bendavid, J.; Bianco, M.; Bloch, P.; Bocci, A.; Botta, C.; Camporesi, T.; Castello, R.; Cepeda, M.; Cerminara, G.; Chapon, E.; Chen, Y.; d'Enterria, D.; Dabrowski, A.; Daponte, V.; David, A.; De Gruttola, M.; De Roeck, A.; Deelen, N.; Dobson, M.; du Pree, T.; Dünser, M.; Dupont, N.; Elliott-Peisert, A.; Everaerts, P.; Fallavollita, F.; Franzoni, G.; Fulcher, J.; Funk, W.; Gigi, D.; Gilbert, A.; Gill, K.; Glege, F.; Gulhan, D.; Harris, P.; Hegeman, J.; Innocente, V.; Jafari, A.; Janot, P.; Karacheban, O.; Kieseler, J.; Knünz, V.; Kornmayer, A.; Kortelainen, M. J.; Krammer, M.; Lange, C.; Lecoq, P.; Lourenço, C.; Lucchini, M. T.; Malgeri, L.; Mannelli, M.; Martelli, A.; Meijers, F.; Merlin, J. A.; Mersi, S.; Meschi, E.; Milenovic, P.; Moortgat, F.; Mulders, M.; Neugebauer, H.; Ngadiuba, J.; Orfanelli, S.; Orsini, L.; Pape, L.; Perez, E.; Peruzzi, M.; Petrilli, A.; Petrucciani, G.; Pfeiffer, A.; Pierini, M.; Rabady, D.; Racz, A.; Reis, T.; Rolandi, G.; Rovere, M.; Sakulin, H.; Schäfer, C.; Schwick, C.; Seidel, M.; Selvaggi, M.; Sharma, A.; Silva, P.; Sphicas, P.; Stakia, A.; Steggemann, J.; Stoye, M.; Tosi, M.; Treille, D.; Triossi, A.; Tsirou, A.; Veckalns, V.; Verweij, M.; Zeuner, W. D.; Bertl, W.; Caminada, L.; Deiters, K.; Erdmann, W.; Horisberger, R.; Ingram, Q.; Kaestli, H. C.; Kotlinski, D.; Langenegger, U.; Rohe, T.; Wiederkehr, S. A.; Backhaus, M.; Bäni, L.; Berger, P.; Bianchini, L.; Casal, B.; Dissertori, G.; Dittmar, M.; Donegà, M.; Dorfer, C.; Grab, C.; Heidegger, C.; Hits, D.; Hoss, J.; Kasieczka, G.; Klijnsma, T.; Lustermann, W.; Mangano, B.; Marionneau, M.; Meinhard, M. T.; Meister, D.; Micheli, F.; Musella, P.; Nessi-Tedaldi, F.; Pandolfi, F.; Pata, J.; Pauss, F.; Perrin, G.; Perrozzi, L.; Quittnat, M.; Reichmann, M.; Sanz Becerra, D. A.; Schönenberger, M.; Shchutska, L.; Tavolaro, V. R.; Theofilatos, K.; Vesterbacka Olsson, M. L.; Wallny, R.; Zhu, D. H.; Aarrestad, T. K.; Amsler, C.; Canelli, M. F.; De Cosa, A.; Del Burgo, R.; Donato, S.; Galloni, C.; Hreus, T.; Kilminster, B.; Pinna, D.; Rauco, G.; Robmann, P.; Salerno, D.; Schweiger, K.; Seitz, C.; Takahashi, Y.; Zucchetta, A.; Candelise, V.; Doan, T. H.; Jain, Sh.; Khurana, R.; Kuo, C. M.; Lin, W.; Pozdnyakov, A.; Yu, S. S.; Kumar, Arun; Chang, P.; Chao, Y.; Chen, K. F.; Chen, P. H.; Fiori, F.; Hou, W.-S.; Hsiung, Y.; Liu, Y. F.; Lu, R.-S.; Paganis, E.; Psallidas, A.; Steen, A.; Tsai, J. f.; Asavapibhop, B.; Kovitanggoon, K.; Singh, G.; Srimanobhas, N.; Bakirci, M. N.; Bat, A.; Boran, F.; Damarseckin, S.; Demiroglu, Z. S.; Dozen, C.; Girgis, S.; Gokbulut, G.; Guler, Y.; Hos, I.; Kangal, E. E.; Kara, O.; Kiminsu, U.; Oglakci, M.; Onengut, G.; Ozdemir, K.; Ozturk, S.; Polatoz, A.; Tali, B.; Tok, U. G.; Topakli, H.; Turkcapar, S.; Zorbakir, I. S.; Zorbilmez, C.; Bilin, B.; Karapinar, G.; Ocalan, K.; Yalvac, M.; Zeyrek, M.; Gülmez, E.; Kaya, M.; Kaya, O.; Tekten, S.; Yetkin, E. A.; Agaras, M. N.; Atay, S.; Cakir, A.; Cankocak, K.; Grynyov, B.; Levchuk, L.; Ball, F.; Beck, L.; Brooke, J. J.; Burns, D.; Clement, E.; Cussans, D.; Davignon, O.; Flacher, H.; Goldstein, J.; Heath, G. P.; Heath, H. F.; Kreczko, L.; Newbold, D. M.; Paramesvaran, S.; Sakuma, T.; Seif El Nasr-storey, S.; Smith, D.; Smith, V. J.; Belyaev, A.; Brew, C.; Brown, R. M.; Calligaris, L.; Cieri, D.; Cockerill, D. J. A.; Coughlan, J. A.; Harder, K.; Harper, S.; Olaiya, E.; Petyt, D.; Shepherd-Themistocleous, C. H.; Thea, A.; Tomalin, I. R.; Williams, T.; Auzinger, G.; Bainbridge, R.; Borg, J.; Breeze, S.; Buchmuller, O.; Bundock, A.; Casasso, S.; Citron, M.; Colling, D.; Corpe, L.; Dauncey, P.; Davies, G.; De Wit, A.; Della Negra, M.; Di Maria, R.; Elwood, A.; Haddad, Y.; Hall, G.; Iles, G.; James, T.; Lane, R.; Laner, C.; Lyons, L.; Magnan, A.-M.; Malik, S.; Mastrolorenzo, L.; Matsushita, T.; Nash, J.; Nikitenko, A.; Palladino, V.; Pesaresi, M.; Raymond, D. M.; Richards, A.; Rose, A.; Scott, E.; Seez, C.; Shtipliyski, A.; Summers, S.; Tapper, A.; Uchida, K.; Vazquez Acosta, M.; Virdee, T.; Wardle, N.; Winterbottom, D.; Wright, J.; Zenz, S. C.; Cole, J. E.; Hobson, P. R.; Khan, A.; Kyberd, P.; Reid, I. D.; Symonds, P.; Teodorescu, L.; Turner, M.; Zahid, S.; Borzou, A.; Call, K.; Dittmann, J.; Hatakeyama, K.; Liu, H.; Pastika, N.; Smith, C.; Bartek, R.; Dominguez, A.; Buccilli, A.; Cooper, S. I.; Henderson, C.; Rumerio, P.; West, C.; Arcaro, D.; Avetisyan, A.; Bose, T.; Gastler, D.; Rankin, D.; Richardson, C.; Rohlf, J.; Sulak, L.; Zou, D.; Benelli, G.; Cutts, D.; Garabedian, A.; Hadley, M.; Hakala, J.; Heintz, U.; Hogan, J. M.; Kwok, K. H. M.; Laird, E.; Landsberg, G.; Lee, J.; Mao, Z.; Narain, M.; Pazzini, J.; Piperov, S.; Sagir, S.; Syarif, R.; Yu, D.; Band, R.; Brainerd, C.; Burns, D.; Calderon De La Barca Sanchez, M.; Chertok, M.; Conway, J.; Conway, R.; Cox, P. T.; Erbacher, R.; Flores, C.; Funk, G.; Gardner, M.; Ko, W.; Lander, R.; Mclean, C.; Mulhearn, M.; Pellett, D.; Pilot, J.; Shalhout, S.; Shi, M.; Smith, J.; Stolp, D.; Tos, K.; Tripathi, M.; Wang, Z.; Bachtis, M.; Bravo, C.; Cousins, R.; Dasgupta, A.; Florent, A.; Hauser, J.; Ignatenko, M.; Mccoll, N.; Regnard, S.; Saltzberg, D.; Schnaible, C.; Valuev, V.; Bouvier, E.; Burt, K.; Clare, R.; Ellison, J.; Gary, J. W.; Ghiasi Shirazi, S. M. A.; Hanson, G.; Heilman, J.; Kennedy, E.; Lacroix, F.; Long, O. R.; Olmedo Negrete, M.; Paneva, M. I.; Si, W.; Wang, L.; Wei, H.; Wimpenny, S.; Yates, B. R.; Branson, J. G.; Cittolin, S.; Derdzinski, M.; Gerosa, R.; Gilbert, D.; Hashemi, B.; Holzner, A.; Klein, D.; Kole, G.; Krutelyov, V.; Letts, J.; Macneill, I.; Masciovecchio, M.; Olivito, D.; Padhi, S.; Pieri, M.; Sani, M.; Sharma, V.; Simon, S.; Tadel, M.; Vartak, A.; Wasserbaech, S.; Wood, J.; Würthwein, F.; Yagil, A.; Zevi Della Porta, G.; Amin, N.; Bhandari, R.; Bradmiller-Feld, J.; Campagnari, C.; Dishaw, A.; Dutta, V.; Franco Sevilla, M.; George, C.; Golf, F.; Gouskos, L.; Gran, J.; Heller, R.; Incandela, J.; Ovcharova, A.; Qu, H.; Richman, J.; Stuart, D.; Suarez, I.; Yoo, J.; Anderson, D.; Bornheim, A.; Lawhorn, J. M.; Newman, H. B.; Nguyen, T.; Pena, C.; Spiropulu, M.; Vlimant, J. R.; Xie, S.; Zhang, Z.; Zhu, R. Y.; Andrews, M. B.; Ferguson, T.; Mudholkar, T.; Paulini, M.; Russ, J.; Sun, M.; Vogel, H.; Vorobiev, I.; Weinberg, M.; Cumalat, J. P.; Ford, W. T.; Jensen, F.; Johnson, A.; Krohn, M.; Leontsinis, S.; Mulholland, T.; Stenson, K.; Wagner, S. R.; Alexander, J.; Chaves, J.; Chu, J.; Dittmer, S.; Mcdermott, K.; Mirman, N.; Patterson, J. R.; Quach, D.; Rinkevicius, A.; Ryd, A.; Skinnari, L.; Soffi, L.; Tan, S. M.; Tao, Z.; Thom, J.; Tucker, J.; Wittich, P.; Zientek, M.; Abdullin, S.; Albrow, M.; Alyari, M.; Apollinari, G.; Apresyan, A.; Apyan, A.; Banerjee, S.; Bauerdick, L. A. T.; Beretvas, A.; Berryhill, J.; Bhat, P. C.; Bolla, G.; Burkett, K.; Butler, J. N.; Canepa, A.; Cerati, G. B.; Cheung, H. W. K.; Chlebana, F.; Cremonesi, M.; Duarte, J.; Elvira, V. D.; Freeman, J.; Gecse, Z.; Gottschalk, E.; Gray, L.; Green, D.; Grünendahl, S.; Gutsche, O.; Harris, R. M.; Hasegawa, S.; Hirschauer, J.; Hu, Z.; Jayatilaka, B.; Jindariani, S.; Johnson, M.; Joshi, U.; Klima, B.; Kreis, B.; Lammel, S.; Lincoln, D.; Lipton, R.; Liu, M.; Liu, T.; Lopes De Sá, R.; Lykken, J.; Maeshima, K.; Magini, N.; Marraffino, J. M.; Mason, D.; McBride, P.; Merkel, P.; Mrenna, S.; Nahn, S.; O'Dell, V.; Pedro, K.; Prokofyev, O.; Rakness, G.; Ristori, L.; Schneider, B.; Sexton-Kennedy, E.; Soha, A.; Spalding, W. J.; Spiegel, L.; Stoynev, S.; Strait, J.; Strobbe, N.; Taylor, L.; Tkaczyk, S.; Tran, N. V.; Uplegger, L.; Vaandering, E. W.; Vernieri, C.; Verzocchi, M.; Vidal, R.; Wang, M.; Weber, H. A.; Whitbeck, A.; Acosta, D.; Avery, P.; Bortignon, P.; Bourilkov, D.; Brinkerhoff, A.; Carnes, A.; Carver, M.; Curry, D.; Field, R. D.; Furic, I. K.; Gleyzer, S. V.; Joshi, B. M.; Konigsberg, J.; Korytov, A.; Kotov, K.; Ma, P.; Matchev, K.; Mei, H.; Mitselmakher, G.; Rank, D.; Shi, K.; Sperka, D.; Terentyev, N.; Thomas, L.; Wang, J.; Wang, S.; Yelton, J.; Joshi, Y. R.; Linn, S.; Markowitz, P.; Rodriguez, J. L.; Ackert, A.; Adams, T.; Askew, A.; Hagopian, S.; Hagopian, V.; Johnson, K. F.; Kolberg, T.; Martinez, G.; Perry, T.; Prosper, H.; Saha, A.; Santra, A.; Sharma, V.; Yohay, R.; Baarmand, M. M.; Bhopatkar, V.; Colafranceschi, S.; Hohlmann, M.; Noonan, D.; Roy, T.; Yumiceva, F.; Adams, M. R.; Apanasevich, L.; Berry, D.; Betts, R. R.; Cavanaugh, R.; Chen, X.; Evdokimov, O.; Gerber, C. E.; Hangal, D. A.; Hofman, D. J.; Jung, K.; Kamin, J.; Sandoval Gonzalez, I. D.; Tonjes, M. B.; Trauger, H.; Varelas, N.; Wang, H.; Wu, Z.; Zhang, J.; Bilki, B.; Clarida, W.; Dilsiz, K.; Durgut, S.; Gandrajula, R. P.; Haytmyradov, M.; Khristenko, V.; Merlo, J.-P.; Mermerkaya, H.; Mestvirishvili, A.; Moeller, A.; Nachtman, J.; Ogul, H.; Onel, Y.; Ozok, F.; Penzo, A.; Snyder, C.; Tiras, E.; Wetzel, J.; Yi, K.; Blumenfeld, B.; Cocoros, A.; Eminizer, N.; Fehling, D.; Feng, L.; Gritsan, A. V.; Maksimovic, P.; Roskes, J.; Sarica, U.; Swartz, M.; Xiao, M.; You, C.; Al-bataineh, A.; Baringer, P.; Bean, A.; Boren, S.; Bowen, J.; Castle, J.; Khalil, S.; Kropivnitskaya, A.; Majumder, D.; Mcbrayer, W.; Murray, M.; Royon, C.; Sanders, S.; Schmitz, E.; Tapia Takaki, J. D.; Wang, Q.; Ivanov, A.; Kaadze, K.; Maravin, Y.; Mohammadi, A.; Saini, L. K.; Skhirtladze, N.; Toda, S.; Rebassoo, F.; Wright, D.; Anelli, C.; Baden, A.; Baron, O.; Belloni, A.; Calvert, B.; Eno, S. C.; Feng, Y.; Ferraioli, C.; Hadley, N. J.; Jabeen, S.; Jeng, G. Y.; Kellogg, R. G.; Kunkle, J.; Mignerey, A. C.; Ricci-Tam, F.; Shin, Y. H.; Skuja, A.; Tonwar, S. C.; Abercrombie, D.; Allen, B.; Azzolini, V.; Barbieri, R.; Baty, A.; Bi, R.; Brandt, S.; Busza, W.; Cali, I. A.; D'Alfonso, M.; Demiragli, Z.; Gomez Ceballos, G.; Goncharov, M.; Hsu, D.; Hu, M.; Iiyama, Y.; Innocenti, G. M.; Klute, M.; Kovalskyi, D.; Lai, Y. S.; Lee, Y.-J.; Levin, A.; Luckey, P. D.; Maier, B.; Marini, A. C.; Mcginn, C.; Mironov, C.; Narayanan, S.; Niu, X.; Paus, C.; Roland, C.; Roland, G.; Salfeld-Nebgen, J.; Stephans, G. S. F.; Tatar, K.; Velicanu, D.; Wang, J.; Wang, T. W.; Wyslouch, B.; Benvenuti, A. C.; Chatterjee, R. M.; Evans, A.; Hansen, P.; Hiltbrand, J.; Kalafut, S.; Kubota, Y.; Lesko, Z.; Mans, J.; Nourbakhsh, S.; Ruckstuhl, N.; Rusack, R.; Turkewitz, J.; Wadud, M. A.; Acosta, J. G.; Oliveros, S.; Avdeeva, E.; Bloom, K.; Claes, D. R.; Fangmeier, C.; Gonzalez Suarez, R.; Kamalieddin, R.; Kravchenko, I.; Monroy, J.; Siado, J. E.; Snow, G. R.; Stieger, B.; Dolen, J.; Godshalk, A.; Harrington, C.; Iashvili, I.; Nguyen, D.; Parker, A.; Rappoccio, S.; Roozbahani, B.; Alverson, G.; Barberis, E.; Hortiangtham, A.; Massironi, A.; Morse, D. M.; Orimoto, T.; Teixeira De Lima, R.; Trocino, D.; Wood, D.; Bhattacharya, S.; Charaf, O.; Hahn, K. A.; Mucia, N.; Odell, N.; Pollack, B.; Schmitt, M. H.; Sung, K.; Trovato, M.; Velasco, M.; Dev, N.; Hildreth, M.; Hurtado Anampa, K.; Jessop, C.; Karmgard, D. J.; Kellams, N.; Lannon, K.; Loukas, N.; Marinelli, N.; Meng, F.; Mueller, C.; Musienko, Y.; Planer, M.; Reinsvold, A.; Ruchti, R.; Smith, G.; Taroni, S.; Wayne, M.; Wolf, M.; Woodard, A.; Alimena, J.; Antonelli, L.; Bylsma, B.; Durkin, L. S.; Flowers, S.; Francis, B.; Hart, A.; Hill, C.; Ji, W.; Liu, B.; Luo, W.; Winer, B. L.; Wulsin, H. W.; Cooperstein, S.; Driga, O.; Elmer, P.; Hardenbrook, J.; Hebda, P.; Higginbotham, S.; Lange, D.; Luo, J.; Marlow, D.; Mei, K.; Ojalvo, I.; Olsen, J.; Palmer, C.; Piroué, P.; Stickland, D.; Tully, C.; Malik, S.; Norberg, S.; Barker, A.; Barnes, V. E.; Das, S.; Folgueras, S.; Gutay, L.; Jha, M. K.; Jones, M.; Jung, A. W.; Khatiwada, A.; Miller, D. H.; Neumeister, N.; Peng, C. C.; Qiu, H.; Schulte, J. F.; Sun, J.; Wang, F.; Xie, W.; Cheng, T.; Parashar, N.; Stupak, J.; Adair, A.; Chen, Z.; Ecklund, K. M.; Freed, S.; Geurts, F. J. M.; Guilbaud, M.; Kilpatrick, M.; Li, W.; Michlin, B.; Northup, M.; Padley, B. P.; Roberts, J.; Rorie, J.; Shi, W.; Tu, Z.; Zabel, J.; Zhang, A.; Bodek, A.; de Barbaro, P.; Demina, R.; Duh, Y. t.; Ferbel, T.; Galanti, M.; Garcia-Bellido, A.; Han, J.; Hindrichs, O.; Khukhunaishvili, A.; Lo, K. H.; Tan, P.; Verzetti, M.; Ciesielski, R.; Goulianos, K.; Mesropian, C.; Agapitos, A.; Chou, J. P.; Gershtein, Y.; Gómez Espinosa, T. A.; Halkiadakis, E.; Heindl, M.; Hughes, E.; Kaplan, S.; Kunnawalkam Elayavalli, R.; Kyriacou, S.; Lath, A.; Montalvo, R.; Nash, K.; Osherson, M.; Saka, H.; Salur, S.; Schnetzer, S.; Sheffield, D.; Somalwar, S.; Stone, R.; Thomas, S.; Thomassen, P.; Walker, M.; Delannoy, A. G.; Foerster, M.; Heideman, J.; Riley, G.; Rose, K.; Spanier, S.; Thapa, K.; Bouhali, O.; Castaneda Hernandez, A.; Celik, A.; Dalchenko, M.; De Mattia, M.; Delgado, A.; Dildick, S.; Eusebi, R.; Gilmore, J.; Huang, T.; Kamon, T.; Mueller, R.; Pakhotin, Y.; Patel, R.; Perloff, A.; Perniè, L.; Rathjens, D.; Safonov, A.; Tatarinov, A.; Ulmer, K. A.; Akchurin, N.; Damgov, J.; De Guio, F.; Dudero, P. R.; Faulkner, J.; Gurpinar, E.; Kunori, S.; Lamichhane, K.; Lee, S. W.; Libeiro, T.; Mengke, T.; Muthumuni, S.; Peltola, T.; Undleeb, S.; Volobouev, I.; Wang, Z.; Greene, S.; Gurrola, A.; Janjam, R.; Johns, W.; Maguire, C.; Melo, A.; Ni, H.; Padeken, K.; Sheldon, P.; Tuo, S.; Velkovska, J.; Xu, Q.; Arenton, M. W.; Barria, P.; Cox, B.; Hirosky, R.; Joyce, M.; Ledovskoy, A.; Li, H.; Neu, C.; Sinthuprasith, T.; Wang, Y.; Wolfe, E.; Xia, F.; Harr, R.; Karchin, P. E.; Poudyal, N.; Sturdy, J.; Thapa, P.; Zaleski, S.; Brodski, M.; Buchanan, J.; Caillol, C.; Dasu, S.; Dodd, L.; Duric, S.; Gomber, B.; Grothe, M.; Herndon, M.; Hervé, A.; Hussain, U.; Klabbers, P.; Lanaro, A.; Levine, A.; Long, K.; Loveless, R.; Polese, G.; Ruggles, T.; Savin, A.; Smith, N.; Smith, W. H.; Taylor, D.; Woods, N.

2018-01-01

The pseudorapidity distributions of charged hadrons in proton-lead collisions at nucleon-nucleon center-of-mass energies √{s_{NN}}=5.02 and 8.16 TeV are presented. The measurements are based on data samples collected by the CMS experiment at the LHC. The number of primary charged hadrons produced in non-single-diffractive proton-lead collisions is determined in the pseudorapidity range | η lab| < 2 .4. The charged-hadron multiplicity distributions are compared to the predictions from theoretical calculations and Monte Carlo event generators. In the center-of-mass pseudorapidity range | η cm| < 0 .5, the average charged-hadron multiplicity densities 〈d N ch/d η cm〉| ηcm| < 0.5 are 17 .31 ± 0 .01 (stat) ± 0 .59 (syst) and 20 .10 ± 0 .01 (stat) ± 0 .85(syst) at √{s_{NN}}=5.02 and 8.16 TeV, respectively. The particle densities per participant nucleon are compared to similar measurements in proton-proton, proton-nucleus, and nucleus-nucleus collisions. [Figure not available: see fulltext.

Cast iron - a predictable material

Directory of Open Access Journals (Sweden)

Jorg C. Sturm

2011-02-01

Full Text Available High strength compacted graphite iron (CGI or alloyed cast iron components are substituting previously used non-ferrous castings in automotive power train applications. The mechanical engineering industry has recognized the value in substituting forged or welded structures with stiff and light-weight cast iron castings. New products such as wind turbines have opened new markets for an entire suite of highly reliable ductile iron cast components. During the last 20 years, casting process simulation has developed from predicting hot spots and solidification to an integral assessment tool for foundries for the entire manufacturing route of castings. The support of the feeding related layout of the casting is still one of the most important duties for casting process simulation. Depending on the alloy poured, different feeding behaviors and self-feeding capabilities need to be considered to provide a defect free casting. Therefore, it is not enough to base the prediction of shrinkage defects solely on hot spots derived from temperature fields. To be able to quantitatively predict these defects, solidification simulation had to be combined with density and mass transport calculations, in order to evaluate the impact of the solidification morphology on the feeding behavior as well as to consider alloy dependent feeding ranges. For cast iron foundries, the use of casting process simulation has become an important instrument to predict the robustness and reliability of their processes, especially since the influence of alloying elements, melting practice and metallurgy need to be considered to quantify the special shrinkage and solidification behavior of cast iron. This allows the prediction of local structures, phases and ultimately the local mechanical properties of cast irons, to asses casting quality in the foundry but also to make use of this quantitative information during design of the casting. Casting quality issues related to thermally driven

Recent technological developments in forging; Recentes avancos tecnologicos no forjamento

Energy Technology Data Exchange (ETDEWEB)

Schaeffer, Lirio [Rio Grande do Sul Univ., Porto Alegre, RS (Brazil). Programa de Pos-graduacao em Engenharia Metalurgica e dos Materiais

1987-12-31

Recent advances in the area of open and closed die forging are summarized and discussed. The use of computer and alternatives such as incremental forging, sinter forging, liquid forging and precision forging are the main items reviewed 11 refs., 10 figs.

Heavy forgings for reactor pressure vessels

International Nuclear Information System (INIS)

Cerjak, H.; Papouschek, F.

1979-01-01

The importance of forgings for an optimal design of nuclear components is described. Problems concerning the correlation of requirements, material behavior, fabrication and testing of forgings are discussed. (orig.) [de

Study of the structural and mechanical properties of the alloy U-0.2V (weight percent) forged in the α phase

International Nuclear Information System (INIS)

Couterne, A.; Guillaume, C.

1980-01-01

The effects of forging carried out in the 2 phase on the structural properties of the alloy U-0.2V (evtl.%) carburized or not have been studied. A carbon content of the order of 300 x 10 6 , contrary to the one used for the cast alloy, is neither detrimental to the micrographic structure nor to the mechanical properties of the alloy. The forged plates have a semicrystalline structure with alternative, formed bands, on the one hand by small recrystallization grains, on the other by quite deformed coarse grains. The preferential orientations developed resume to a fibrous structure. The fiber axis, practically the [002] axis, is parallell to the normal to the surface of the forged disc. This result implies a good isotropy of the dilatometric and mechanical properities in the whole plane parallel to the disc faces. A correlation has been made between the found structure and the thermal expansion of the material. Furthermore, the mechanical characteristics reach an excellent level (Rsup(M) approx. 900 MPa, A approx. 38%). (orig.)

Forging technology for large nuclear pressure vessel parts

International Nuclear Information System (INIS)

Kakimoto, Hideki; Ikegami, Tomonori

2014-01-01

The increasing output of nuclear power generation calls for larger vessels for next-generation nuclear power plants. A vessel with an increased diameter requires increased load for its forging, which can make it difficult to use a conventional solid die. In order to reduce the forging load, a rotary incremental forging method has been applied to hot forging. This method includes pressing and rotating a material in an incremental manner such that a target shape is obtained. This study aimed at improving the accuracy of numerical simulation for the rotary incremental forging to reduce the load when forging large vessels. This has enabled the temperature of the material and flow stress to be precisely predicted; an example of this is reported in the paper. Specifically, the heat transfer coefficient to be used for the numerical simulation had been determined experimentally from a small-scale hot-forging. The reduction of the flow stress associated with incremental forging, had been deduced from a compression test, and the value was applied to the numerical simulation. A preform was designed on the basis of the above simulation to perform a 1/1 size scale experiment. A precision of better than 5% has been confirmed for the shape prediction. (author)

Forging New Cocoa Keys: The Impact of Unlocking the Cocoa Bean’s Genome on Pre-harvest Food Safety

Science.gov (United States)

Forging New Cocoa Keys: The Impact of Unlocking the Cocoa Bean’s Genome on Pre-harvest Food Safety David N. Kuhn, USDA ARS SHRS, Miami FL Sometimes it's hard to see the value and application of genomics to real world problems. How will sequencing the cacao genome affect West African farmers? Thi...

30 CFR 816.14 - Casing and sealing of drilled holes: Temporary.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Casing and sealing of drilled holes: Temporary. 816.14 Section 816.14 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND ENFORCEMENT...-SURFACE MINING ACTIVITIES § 816.14 Casing and sealing of drilled holes: Temporary. Each exploration hole...

Constraints on nuclear parton distributions from W boson production in pPb collisions at $\\sqrt{s_{\\mathrm{NN}}} = 8.16~\\mathrm{TeV}$

CERN Document Server

CMS Collaboration

2018-01-01

The production of W bosons has been measured in proton-lead collisions at a nucleon-nucleon center-of-mass energy of $\\sqrt{s_{\\mathrm{NN}}} = 8.16~\\mathrm{TeV}$. The measurement of W bosons is performed in the $\\mathrm{W}\\rightarrow\\mu\

International cooperation in cold forging technology

DEFF Research Database (Denmark)

Bay, Niels; Lange, K

1992-01-01

International cooperation in the field of cold forging technology started in 1961 by formation of the OECD Group of Experts on Metal Forming. In 1967 this group was transformed into the International Cold Forging Group, ICFG, an independent body which has now been operative for 25 years. Members...... of the ICFG are personally elected by the Plenary as experts within the field, often representing national groups within cold forging. The main work within the ICFG is carried out in its subgroups which are established by the Plenary to collect, compile and evaluate data and eventually also produce data...... by cooperative activities or by instigating national research. These subgroups have produced 9 data sheets and 7 guidelines on subjects such as materials, tool design and construction, calculation methods for cold forging tools, manufacture of slugs, lubrication aspects and small quantity production. Plenary...

Stainless steel forgings for nuclear chemical plants

International Nuclear Information System (INIS)

1982-02-01

This Specification covers detailed requirements for the supply of austenitic stainless steel forgings used in radioactive and corrosive areas within the Nuclear Industry. With the exception of 316S51 the materials specified are all suitable for contact with nitric acid, 316S51 being included as suitable for use in contact with sodium and other alkali metals at elevated temperatures. (author)

Forging the frontiers: Travellers and documents on the South Africa-Mozambique border, 1890s-1940s

Directory of Open Access Journals (Sweden)

Andrew MacDonald

Full Text Available It is well known that the Union of South Africa started to build an onerous border regime at the turn of the twentieth century in order to secure a White Man's Country in southern Africa. Newly formed, ambitious Immigration Departments consequently targeted 'Asiatics', poor whites and finally 'surplus' Africans from the 1920s onwards. An infrastructure of exclusion (detention and deportation compounds, police patrols, fingerprint offices and so on soon emerged at the region's maritime gateways as the colonial states sought to undermine decentralised indigenous societies characterised by long-term mobility. This article shows that the Union remained vulnerable on its eastern frontier with Mozambique and Swaziland, where 'undesirables' continued to arrive in numbers. Long-distance movement had a long precedent in these borderlands, and it proved difficult for colonial states to forge effective border controls until deep into the twentieth century. Based on extensive and critical engagement with multiple border control archives, the article traces the gradual 'paperisation of the border, and follows a thriving market in identity permits in southern Mozambique and Swaziland, which became important backdoor entry points to the Union. The main people to exploit corrupt local officials and entrepreneurial headmen on either side of the border were those associated with the merchant houses of coastal west India, syndicates from the Portuguese Atlantic island of Madeira, and long-distance, so-called 'tropical', African migrants. Together they forged sophisticated networks that moved permits, people and money across the region and gave south-east Africa's border builders hard and often thankless paperwork.

30 CFR 816.105 - Backfilling and grading: Thick overburden.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Backfilling and grading: Thick overburden. 816...-SURFACE MINING ACTIVITIES § 816.105 Backfilling and grading: Thick overburden. (a) Definition. Thick... surrounding terrain. (b) Performance standards. Where thick overburden occurs within the permit area, the...

Fractography analysis of tool samples used for cold forging

DEFF Research Database (Denmark)

Dahl, K.V.

2002-01-01

Three fractured tool dies used for industrial cold forging have been investigated using light optical microscopy and scanning electron microscopy. Two of the specimens were produced using the traditional Böhler P/M steel grade s790, while the lastspecimen was a third generation P/M steel produced...... using new technology developed by Böhler. All three steels have the same nominal composition of alloying elements. The failure in both types of material occurs as a crack formation at a notch inside ofthe tool. Generally the cold forging dies constructed in third generation steels have a longer lifetime...

Sharatchandra’s Caste and Gender Consciousness

OpenAIRE

Narasingha Sil

2015-01-01

Sharatchandra Chattopadhyay’s attitude to the prevalent caste system and social ethos, especially concerning sex, love, and marriage and chastity of married as well as widowed women, shows a marked ambivalence. On one hand, his work demonstrates his progressive and liberal ideas emanating from Western contact and impact on late colonial India, and on Bengal in particular. On the other hand, and by the same token, his a...

Press forging and optical properties of lithium fluoride

Science.gov (United States)

Ready, J. F.; Vora, H.

1980-07-01

Lithium fluoride is an important candidate material for windows on high power, short-pulse ultraviolet and visible lasers. Lithium fluoride crystals were press forged in one step over the temperature range 300 to 600 C to obtain fine grained polycrystalline material with improved mechanical properties. The deformation that can be given to a lithium fluoride crystal during forging is limited by the formation of internal cloudiness (veiling) with the deformation limit increasing with increasing forging temperature from about 40 percent at 400 C to 65 percent at 600 C. To suppress veiling, lithium fluoride crystals were forged in two steps over the temperature range 300 to 600 C, to total deformations of 69 to 76 percent, with intermediate annealing at 700 C. This technique yields a material which has lower scattering with more homogeneous microstructure than that obtained in one step forging. The results of characterization of various optical and mechanical properties of single crystal and forged lithium fluoride, including scattering, optical homogeneity, residual absorption, damage thresholds, environmental stability, and thresholds for microyield are described.

Press forging and optical properties of lithium fluoride

International Nuclear Information System (INIS)

Ready, J.F.; Vora, H.

1979-01-01

Lithium fluoride is an important candidate material for windows on high-power, short-pulse ultraviolet and visible lasers. Lithium fluoride crystals have been press forged in one step over the temperature range 300 to 600 0 c to obtain fine-grained polycrystalline material with improved mechanical properties. The deformation that can be given to a lithium fluoride crystal during forging is limited by the formation of internal cloudiness (veiling) with the deformation limit increasing with increasing forging temperature from about 40% at 400 0 C to 65% at 600 0 C. To suppress veiling, lithium fluoride crystals were forged in two steps over the temperature range 300 to 600 0 C, to total deformations of 69-76%, with intermediate annealing at 700 0 C. This technique yields a material which has lower scattering with more homogeneous microstructure than that obtained in one-step forging. The results of characterization of various optical and mechanical properties of single-crystal and forged lithium fluoride, including scattering, optical homogeneity, residual absorption, damage thresholds, environmental stability, and thresholds for microyield are described

Effect of Welding Parameters on Microstructure and Mechanical Properties of Cast Fe-40Al Alloy

Directory of Open Access Journals (Sweden)

Osman Torun

2016-09-01

Full Text Available Friction welding of cast Fe-40Al alloy was carried out at 1000 rmp for various friction times, friction pressures, and forging pressures. The microstructures of the interface of welded samples were analyzed by optical and scanning electron microscopy (SEM. Micrographs demonstrated that excellent welding formed continuously along the interface, except for samples welded for 3 s. Chemical compositions of the interface of the friction welded samples and of the fractured surface of all the specimens were determined using energy dispersive spectroscopy (EDS. After the welding process, shear tests were applied to the welded samples to determine the shear strength of joints. Test results indicated that the maximum shear strength was 469.5 MPa.

Quality assurance for hammer forgings

International Nuclear Information System (INIS)

Potthast, E.

1984-01-01

The quality assurance program introduced by Arbed Saarstahl and laid down in a quality assurance manual is described. A particular attention is attached thereby both to quality practice proper and to a reliable flow of information amongst all the persons involved. The production and test sequence schedules of the hammer forging plant are illustrated by the example of a forged valve housing for nuclear power plants. These schedules specify not only the forging process in the individual production stages but also the workpiece contour after each working operation, the heat treatment, the furnace charging, and the inspection of finished parts. The formalization of the tests is designed both to promote the customer's trust towards the supplier and to prevent the formal operations involved from hindering further technical development. (orig.) [de

Co-Operative Training in the Sheffield Forging Industry

Science.gov (United States)

Duncan, R.

2008-01-01

Purpose: The purpose of this paper is to give details of an operation carried out in Sheffield to increase the recruitment of young men into the steel forging industry. Design/methodology/approach: The Sheffield Forges Co-operative Training Scheme was designed to encourage boys to enter the forging industry and to provide them with training and…

21 CFR 172.816 - Methyl glucoside-coconut oil ester.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Methyl glucoside-coconut oil ester. 172.816 Section... HUMAN CONSUMPTION Multipurpose Additives § 172.816 Methyl glucoside-coconut oil ester. Methyl glucoside-coconut oil ester may be safely used in food in accordance with the following conditions: (a) It is the...

30 CFR 816.81 - Coal mine waste: General requirements.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Coal mine waste: General requirements. 816.81... ACTIVITIES § 816.81 Coal mine waste: General requirements. (a) General. All coal mine waste disposed of in an... within a permit area, which are approved by the regulatory authority for this purpose. Coal mine waste...

Phased Array Ultrasonic Inspection of Titanium Forgings

International Nuclear Information System (INIS)

Howard, P.; Klaassen, R.; Kurkcu, N.; Barshinger, J.; Chalek, C.; Nieters, E.; Sun, Zongqi; Fromont, F. de

2007-01-01

Aerospace forging inspections typically use multiple, subsurface-focused sound beams in combination with digital C-scan image acquisition and display. Traditionally, forging inspections have been implemented using multiple single element, fixed focused transducers. Recent advances in phased array technology have made it possible to perform an equivalent inspection using a single phased array transducer. General Electric has developed a system to perform titanium forging inspection based on medical phased array technology and advanced image processing techniques. The components of that system and system performance for titanium inspection will be discussed

20 CFR 408.816 - When does SVB entitlement end due to death?

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false When does SVB entitlement end due to death? 408.816 Section 408.816 Employees' Benefits SOCIAL SECURITY ADMINISTRATION SPECIAL BENEFITS FOR CERTAIN WORLD WAR II VETERANS Suspensions and Terminations Termination § 408.816 When does SVB entitlement end due to death? Your SVB entitlement ends wit...

Kinematics at the Main Mechanism of a Railbound Forging Manipulator

Directory of Open Access Journals (Sweden)

Florian Ion Tiberiu Petrescu

2015-09-01

Full Text Available Normal 0 false false false EN-US X-NONE X-NONE MicrosoftInternetExplorer4 Heavy payload forging manipulators are mainly characterized by large load output and large capacitive load input. The relationship between outputs and inputs will greatly influence the control and the reliability. Forging manipulators have become more prevalent in the industry today. They are used to manipulate objects to be forged. The most common forging manipulators are moving on a railway to have a greater precision and stability. They have been called the railbound forging manipulators. In this paper we analyze the general kinematics of the main mechanism from a such manipulator. Kinematic scheme shows a typical forging manipulator, with the basic motions in operation process: walking, motion of the tong and buffering. The lifting mechanism consists of several parts including linkages, hydraulic drives and motion pairs. The principle of type design from the viewpoints of the relationship between output characteristics and actuator inputs is discussed. An idea of establishing the incidence relationship between output characteristics and actuator inputs is proposed. These novel forging manipulators which satisfy certain functional requirements provide an effective help for the design of forging manipulators.

Study on the isothermal forging process of MB26 magnesium alloy adaptor

Directory of Open Access Journals (Sweden)

Xu Wenchen

2015-01-01

Full Text Available The isothermal forging process is an effective method to manufacture complex-shaped components of hard-to-work materials, such as magnesium alloys. This study investigates the isothermal forging process of an MB26 magnesium alloy adaptor with three branches. The results show that two-step forging process is appropriate to form the adaptor forging, which not only improves the filling quality but also reduces the forging load compared with one-step forging process. Moreover, the flow line is distributed along the contour of the complex-shaped adaptor forging.

Near-Net Forging Technology Demonstration Program

Science.gov (United States)

Hall, I. Keith

1996-01-01

Significant advantages in specific mechanical properties, when compared to conventional aluminum (Al) alloys, make aluminum-lithium (Al-Li) alloys attractive candidate materials for use in cryogenic propellant tanks and dry bay structures. However, the cost of Al-Li alloys is typically five times that of 2219 aluminum. If conventional fabrication processes are employed to fabricate launch vehicle structure, the material costs will restrict their utilization. In order to fully exploit the potential cost and performance benefits of Al-Li alloys, it is necessary that near-net manufacturing methods be developed to off-set or reduce raw material costs. Near-net forging is an advanced manufacturing method that uses elevated temperature metal movement (forging) to fabricate a single piece, near-net shape, structure. This process is termed 'near-net' because only a minimal amount of post-forge machining is required. The near-net forging process was developed to reduce the material scrap rate (buy-to-fly ratio) and fabrication costs associated with conventional manufacturing methods. The goal for the near-net forging process, when mature, is to achieve an overall cost reduction of approximately 50 percent compared with conventional manufacturing options for producing structures fabricated from Al-Li alloys. This NASA Marshall Space Flight Center (MSFC) sponsored program has been a part of a unique government / industry partnership, coordinated to develop and demonstrate near-net forging technology. The objective of this program was to demonstrate scale-up of the near-net forging process. This objective was successfully achieved by fabricating four integrally stiffened, 170- inch diameter by 20-inch tall, Al-Li alloy 2195, Y-ring adapters. Initially, two 2195 Al-Li ingots were converted and back extruded to produce four cylindrical blockers. Conventional ring rolling of the blockers was performed to produce ring preforms, which were then contour ring rolled to produce

Instant forgedUI starter

CERN Document Server

Luiz, Joseandro

2013-01-01

Get to grips with a new technology, understand what it is and what it can do for you, and then get to work with the most important features and tasks.The book is a Starter guide to learning ForgedUI. This book will start by unfolding the installation and creating a simple application using Titanium and ForgedUI, followed by taking you through the features to model an engaging UI and generate multi-platform code with Titanium, while covering the best design practice for Apple and Android application development. Last but not least, you will also come across the available resources where you can

An empirical model for friction in cold forging

DEFF Research Database (Denmark)

Bay, Niels; Eriksen, Morten; Tan, Xincai

2002-01-01

With a system of simulative tribology tests for cold forging the friction stress for aluminum, steel and stainless steel provided with typical lubricants for cold forging has been determined for varying normal pressure, surface expansion, sliding length and tool/work piece interface temperature...... of normal pressure and tool/work piece interface temperature. The model is verified by process testing measuring friction at varying reductions in cold forward rod extrusion. KEY WORDS: empirical friction model, cold forging, simulative friction tests....

40 CFR 467.40 - Applicability; description of the forging subcategory.

Science.gov (United States)

2010-07-01

... forging subcategory. 467.40 Section 467.40 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS ALUMINUM FORMING POINT SOURCE CATEGORY Forging Subcategory § 467.40 Applicability; description of the forging subcategory. This subpart applies to discharges of...

Die forging of the alloys Az80 and Zk60

NARCIS (Netherlands)

Kurz, G.; Clauw, B.; Sillekens, W.H.; Letzig, D.

2009-01-01

Overall goal of the MagForge project is to provide tailored and cost-effective technologies for the industrial manufacturing of magnesium forged components. Scientific and technological aspects are new alloys/feedstock materials with improved performance, forging process modeling and design tools

30 CFR 816.43 - Diversions.

Science.gov (United States)

2010-07-01

... into underground mines without approval of the regulatory authority under § 816.41(i). (2) The... construction of all diversions of perennial and intermittent streams and all stream restorations. The design... diversion or stream restoration meets all construction requirements of this section and is in accordance...

U.S. Geological Survey's ShakeCast: A cloud-based future

Science.gov (United States)

Wald, David J.; Lin, Kuo-Wan; Turner, Loren; Bekiri, Nebi

2014-01-01

When an earthquake occurs, the U. S. Geological Survey (USGS) ShakeMap portrays the extent of potentially damaging shaking. In turn, the ShakeCast system, a freely-available, post-earthquake situational awareness application, automatically retrieves earthquake shaking data from ShakeMap, compares intensity measures against users’ facilities, sends notifications of potential damage to responsible parties, and generates facility damage assessment maps and other web-based products for emergency managers and responders. ShakeCast is particularly suitable for earthquake planning and response purposes by Departments of Transportation (DOTs), critical facility and lifeline utilities, large businesses, engineering and financial services, and loss and risk modelers. Recent important developments to the ShakeCast system and its user base are described. The newly-released Version 3 of the ShakeCast system encompasses advancements in seismology, earthquake engineering, and information technology applicable to the legacy ShakeCast installation (Version 2). In particular, this upgrade includes a full statistical fragility analysis framework for general assessment of structures as part of the near real-time system, direct access to additional earthquake-specific USGS products besides ShakeMap (PAGER, DYFI?, tectonic summary, etc.), significant improvements in the graphical user interface, including a console view for operations centers, and custom, user-defined hazard and loss modules. The release also introduces a new adaption option to port ShakeCast to the "cloud". Employing Amazon Web Services (AWS), users now have a low-cost alternative to local hosting, by fully offloading hardware, software, and communication obligations to the cloud. Other advantages of the "ShakeCast Cloud" strategy include (1) Reliability and robustness of offsite operations, (2) Scalability naturally accommodated, (3), Serviceability, problems reduced due to software and hardware uniformity, (4

Sintering and densification; new techniques: sinter forging

International Nuclear Information System (INIS)

Winnubst, A.J.A.

1998-01-01

In this chapter pressure assisted sintering methods will be described. Attention will mainly be paid to sinter forging as a die-wall free uniaxial pressure sintering technique, where large creep strains are possible. Sinter forging is an effective tool to reduce sintering temperature and time and to obtain a nearly theoretically dense ceramic. In this way grain size in tetragonal zirconia ceramics can be reduced down to 100 nm. Another important phenomenon is the reduction of the number density and size of cracks and flaws resulting in higher strength and improved reliability, which is of utmost importance for engineering ceramics. The creep deformation during sinter forging causes a rearrangement of the grains resulting in a reduction of interatomic spaces between grains, while grain boundary (glassy) phases can be removed. The toughness and in some cases the wear resistance is enhanced after sinter forging as a result of the grain-boundary-morphology improvement. (orig.)

A-508 class 3 forgings for pressure vessels

International Nuclear Information System (INIS)

Comon, J.

1977-01-01

The manufacture of the forged parts of the first PWR nuclear pressure vessel installed in France started in the Creusot-Loire's Forge Plant in 1961. Since this date, more than 300 forgings of this type were delivered (flanges, rings, zones, and nozzles). The major part of these forgings were made of Mn, Ni, Mo steel (SA 508 class 3). They represent a population large and homogeneous enough to attempt a statistical analysis of chemical and mechanical test results. The aim of this analysis was double: (1) a better knowledge of the scattering of the results and a better estimate of what can be introduced or accepted in a specification, and (2) the setting up of correlations existing between these results, particularly between chemical analysis and mechanical test results. In addition to this statistical analysis concerning industrial results, several laboratory studies are presented, giving a more complete characterization of SA 508 class 3. All these results form a very complete documentation showing that SA 508 class 3 steel is suitable for the manufacture of large forged vessels requiring a high degree of reliability

THE INFLUENCE OF PRE-HEAT TREATMENT ON WHITE CAST IRONS PLASTICITY

Directory of Open Access Journals (Sweden)

T. M. Myronova

2013-11-01

Full Text Available Purpose. The development of heat treatment modes of white cast irons for structure changes in their eutectic constituent, namely in disturbing the monolithic structure of ledeburite colonies cementite structure and eutectic net continuity. Also the mentioned heat treatment modes are targeted to the eutectic net shift for the most suitable position from the point of plastic deforming. Methodology. The hypoeutectic white cast irons with 2.92…3.35 % carbon content and additionally alloyed by 3.18 % vanadium have been used as the research materials. The mentioned alloys have been pre-heat treated and hot twist tested. Findings. The research results showed that the carbide net breaking by plastic deforming leads to cast irons mechanical properties increasing but has difficulties in implementation due to the white cast irons low plasticity. The influence of different pre-heat treatment modes on structure and plasticity of white hypoeutectic cast irons have been investigated. They include the isotherm soaking under the different temperatures as well as multiply soakings and thermo-cycling. The influence of eutectic level, as well as pre heat treatment modes on different composition white cast irons hot plasticity have been investigated. Originality. It was determined that the heat treatment, which leads to double α→γ recrystallization under 860 – 950 °С and reperlitization under 720-680 °С results in significant increase of plasticity, as well as in un-alloyed and alloyed by vanadium white cast irons. It takes place due to carbide matrix phase separation in ledeburite colonies by new phase boundaries forming especially due to carbide transformations under vanadium alloying. Practical value. The implementation of pre-heat treatment with phase recrystallization resulted in hypoeutectic white cast irons plasticity increasing. The obtained level of cast iron plasticity corresponds to the one of carbide class steels, which ensures the successful

Strain-induced grain growth of cryomilled nanocrystalline Al in trimodal composites during forging

International Nuclear Information System (INIS)

Yao, B.; Simkin, B.; Majumdar, B.; Smith, C.; Bergh, M. van den; Cho, K.; Sohn, Y.H.

2012-01-01

Highlights: ► Grain growth of cryomilled nanocrystalline aluminum during hot forging. ► Use of hollow cone dark field imaging technique in TEM for grain size measurement. ► Grain growth model of strain, strain rate and temperature for forging optimization. - Abstract: Grain growth of nanocrystalline aluminum ( nc Al) in trimodal Al metal-matrix-composites (MMCs) during hot forging was investigated. The nc Al phase formed through cryomilling of inert gas-atomized powders in liquid nitrogen has an average grain size down to 21 nm, exhibits excellent thermal stability. However, substantial grain growth of nc Al up to 63 nm was observed when the Al MMCs were thermo-mechanically processed even at relatively low temperatures. Grain growth of the cryomilled nc Al phase in trimodal Al MMCs after hot forging was documented with respect to temperature ranging from 175 °C to 287 °C, true strain ranging from 0.4 to 1.35 and strain rate ranging from 0.1 to 0.5 s −1 . Hollow cone dark field imaging technique was employed to provide statistically confident measurements of nc Al grain size that ranged from 21 to 63 nm. An increase in forging temperature and an increase in true strain were correlated with an increase in grain size of nc Al. Results were correlated to devise a phenomenological grain growth model for forging that takes strain, strain rate and temperature into consideration. Activation energy for the grain growth during thermo-mechanical hot-forging was determined to be 35 kJ/mol, approximately a quarter of activation energy for bulk diffusion of Al and a half of activation energy for static recrystallization.

Effect of Laser Preheating AISI 4140 Specimens for Micro-Forging

Directory of Open Access Journals (Sweden)

Jung C.

2017-06-01

Full Text Available Many high performance and permanent service parts require suitable material characteristics-high fatigue strength is one of the most important characteristics. For this reason, surface treatment processes are essential to increase the material performance and avoid the use of costly ineffective material. There exist various surface treatment processes for various applications. Each process has advantages and disadvantages and hybridization can solve various problems. The micro-forging process delivers a controlled and uniform surface hardness, but the depth of the forged surface is limited. On the other hand, laser heat treatment can increase the hardness drastically, but the surface may become brittle, which reduces the fatigue life. Laser-assisted micro-forging is a novel hybrid process of laser heat treatment and micro-forging that has the potential to increase the forging depth and relax the stress caused by the high temperature of the forging process.

Microstructural development under interrupted hot deformation and the mechanical properties of a cast Mg–Gd–Y–Zr alloy

Energy Technology Data Exchange (ETDEWEB)

Xiao, Zhenyu [Educational Key Laboratory of Nonferrous Metal Materials Science and Engineering, School of Materials Science and Engineering, Central South University, Changsha 410083 (China); Yang, Xuyue [Educational Key Laboratory of Nonferrous Metal Materials Science and Engineering, School of Materials Science and Engineering, Central South University, Changsha 410083 (China); Institute for Materials Microstructure, Central South University, Changsha 410083 (China); Yang, Yi; Zhang, Zhirou; Zhang, Duxiu; Li, Yi [Educational Key Laboratory of Nonferrous Metal Materials Science and Engineering, School of Materials Science and Engineering, Central South University, Changsha 410083 (China); Sakai, Taku [UEC Tokyo (The University of Electro-Communications), Chofu, Tokyo 182-8585 (Japan)

2016-01-15

Microstructural development under interrupted hot deformation of a cast Mg–Gd–Y–Zr alloy was investigated by optical microscopy (OM) and electron backscattering diffraction (EBSD) technology and the resultant mechanical properties were detected through tensile tests at room temperature. Ultrafine grains (UFGs) were remarkably developed under the condition of interrupted hot forging, resulting in an improvement of ambient mechanical properties. The basal texture was weakened by an effective increase of the volume fraction of UFGs under interrupted hot forging. These resulted in an improvement of tensile ductility with little or no drop in strength, i.e. the volume fraction of UFGs was raised from 30% to 70%, leading to an increase of the ambient tensile elongation from 15% to 23%.

Transmission electron microscopy of Ti-12Mo-13Nb Alloy aged after heat forging

International Nuclear Information System (INIS)

Oliveira, Nathalia Rodrigues; Baldan, Renato; Gabriel, Sinara Borborema

2014-01-01

Metastable β-Ti alloys possess mechanical properties, in particular a elastic modulus that depends not only on its composition but also the applied thermomechanical treatments. These alloys require high mechanical strength and a low Young’s modulus to avoid stress shielding. Preliminary studies on the development of Ti- 13Nb-12Mo alloy showed than the better properties were obtained at aged at 500 ° C / 24 h after cold forging , whose microstructure consisted of bimodal α phase in the β matrix. In this work, Ti-12Mo-13Nb alloy was heat forged and aged at 500 deg C for 24h and the microstructure was analyzed by employing X-ray diffraction and transmission electron microscopy. According to the results, while the cold forging resulted in bimodal α phase in the β matrix, hot forging resulted in a fine and homogeneous α phase in the β matrix. (author)

Screening of cannabis-related problems among youth: the CPQ-A-S and CAST questionnaires

Directory of Open Access Journals (Sweden)

Fernandez-Artamendi Sergio

2012-04-01

Full Text Available Abstract Background Cannabis use among young people is a significant problem, making particularly necessary validated screening instruments that permit secondary prevention. The purpose of this study was to analyze and compare the psychometric properties of the CAST and CPQ-A-S questionnaires, two screening instruments specifically addressing the youth population. Methods Information was obtained on sociodemographics, frequency of substance use, psychopathological symptoms and cannabis-use problems, and the CPQ-A-S and CAST were applied, as well as an infrequency scale for discarding responses made randomly. The sample was made up of 144 young people aged 16 to 20 that had used cannabis in the last month, of which 71.5% were boys. Mean age of the sample was 17.38 years (SD = 1.16. Results The results show that from the psychometric point of view both the CAST and the CPQ-A-S are good screening instruments. Conclusions The CAST is shorter and presents slightly better internal consistency than the CPQ-A-S. Both instruments show high sensitivity and specificity in the detection of young people dependent on cannabis according to the DSM IV-TR criteria. The CPQ-A-S appears to show greater capacity for detecting psychopathological distress associated with use. Both questionnaires yield significant odds ratios as predictors of frequent cannabis use and of the DSM IV-TR abuse and dependence criteria. In general, the CPQ-A-S emerges as a better predictor than the CAST.

48 CFR 252.225-7025 - Restriction on acquisition of forgings.

Science.gov (United States)

2010-10-01

... of forgings. 252.225-7025 Section 252.225-7025 Federal Acquisition Regulations System DEFENSE... CLAUSES Text of Provisions And Clauses 252.225-7025 Restriction on acquisition of forgings. As prescribed in 225.7102-4, use the following clause: Restriction on Acquisition of Forgings (DEC 2009) (a...

Data-Driven Neural Network Model for Robust Reconstruction of Automobile Casting

Science.gov (United States)

Lin, Jinhua; Wang, Yanjie; Li, Xin; Wang, Lu

2017-09-01

In computer vision system, it is a challenging task to robustly reconstruct complex 3D geometries of automobile castings. However, 3D scanning data is usually interfered by noises, the scanning resolution is low, these effects normally lead to incomplete matching and drift phenomenon. In order to solve these problems, a data-driven local geometric learning model is proposed to achieve robust reconstruction of automobile casting. In order to relieve the interference of sensor noise and to be compatible with incomplete scanning data, a 3D convolution neural network is established to match the local geometric features of automobile casting. The proposed neural network combines the geometric feature representation with the correlation metric function to robustly match the local correspondence. We use the truncated distance field(TDF) around the key point to represent the 3D surface of casting geometry, so that the model can be directly embedded into the 3D space to learn the geometric feature representation; Finally, the training labels is automatically generated for depth learning based on the existing RGB-D reconstruction algorithm, which accesses to the same global key matching descriptor. The experimental results show that the matching accuracy of our network is 92.2% for automobile castings, the closed loop rate is about 74.0% when the matching tolerance threshold τ is 0.2. The matching descriptors performed well and retained 81.6% matching accuracy at 95% closed loop. For the sparse geometric castings with initial matching failure, the 3D matching object can be reconstructed robustly by training the key descriptors. Our method performs 3D reconstruction robustly for complex automobile castings.

Analysis of reforming process of large distorted ring in final enlarging forging

International Nuclear Information System (INIS)

Miyazawa, Takeshi; Murai, Etsuo

2002-01-01

In the construction of reactors or pressure vessels for oil chemical plants and nuclear power stations, mono block open-die forging rings are often utilized. Generally, a large forged ring is manufactured by means of enlarging forging with reductions of the wall thickness. During the enlarging process the circular ring is often distorted and becomes an ellipse in shape. However the shape control of the ring is a complicated work. This phenomenon makes the matter still worse in forging of larger rings. In order to make precision forging of large rings, we have developed the forging method using a v-shape anvil. The v-shape anvil is geometrically adjusted to fit the distorted ring in the final circle and reform automatically the shape of the ring during enlarging forging. This paper has analyzed the reforming process of distorted ring by computer program based on F.E.M. and examined the effect on the precision of ring forging. (author)

Influence of heat treatment on microstructure and properties of bainitic cast steel used for frogs in railway crossovers

Directory of Open Access Journals (Sweden)

E. Tasak

2010-01-01

Full Text Available This work deals with influence of heat treatment on microstructure and properties of sample cast assigned as a material used for frogs in railway crossover. Materials used in railway industry for frogs (manganese cast steel and forged pearlitic steel do not fulfil strict conditions of exploitation of railway. One of the solutions is using cast steel with bainitic or bainite-martensite microstructure, what allows to gain high resistance properties (Rm = 1400 MPa, Rp0,2 = 900 MPa, hardness to 400 HBW. The cooling rates of rail type UIC60 shows that it is possible to reach the bainitic microstructure in cast of frog. The microstructure of lower banite should have an advantageous influence on cracking resistance. In order to set the parameters of heat treatment, the critical temperatures were determined by dilatometric methods determined. This heat treatment consisted of normalizing that prepared it to the farther process of resistance welding. Moreover, the CCT diagram of proposed bainitic cast steel was prepared. The exams were done that can be used to evaluate the influence of heat treatment on microstructure and properties of the sample cast.

File list: Unc.Emb.50.AllAg.8-16h_embryos [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available Unc.Emb.50.AllAg.8-16h_embryos dm3 Unclassified Embryo 8-16h embryos SRX025491,SRX0...25483,SRX025465,SRX025481 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Unc.Emb.50.AllAg.8-16h_embryos.bed ...

File list: Unc.Emb.10.AllAg.8-16h_embryos [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available Unc.Emb.10.AllAg.8-16h_embryos dm3 Unclassified Embryo 8-16h embryos SRX025491,SRX0...25483,SRX026868,SRX026870,SRX025481,SRX025465 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Unc.Emb.10.AllAg.8-16h_embryos.bed ...

Medium carbon vanadium steels for closed die forging

International Nuclear Information System (INIS)

Jeszensky, Gabor; Plaut, Ronald Lesley

1993-01-01

This work analyses the medium carbon micro alloyed vanadium potential for closed die forged production. The steels reach the mechanical resistance requests during cooling after forging, eliminating the subsequent thermal treatment. Those steels also present good fatigue resistance and machinability. The industrial scale experiments are also reported

Gear hot forging process robust design based on finite element method

International Nuclear Information System (INIS)

Xuewen, Chen; Won, Jung Dong

2008-01-01

During the hot forging process, the shaping property and forging quality will fluctuate because of die wear, manufacturing tolerance, dimensional variation caused by temperature and the different friction conditions, etc. In order to control this variation in performance and to optimize the process parameters, a robust design method is proposed in this paper, based on the finite element method for the hot forging process. During the robust design process, the Taguchi method is the basic robust theory. The finite element analysis is incorporated in order to simulate the hot forging process. In addition, in order to calculate the objective function value, an orthogonal design method is selected to arrange experiments and collect sample points. The ANOVA method is employed to analyze the relationships of the design parameters and design objectives and to find the best parameters. Finally, a case study for the gear hot forging process is conducted. With the objective to reduce the forging force and its variation, the robust design mathematical model is established. The optimal design parameters obtained from this study indicate that the forging force has been reduced and its variation has been controlled

Optimum design of forging process parameters and preform shape under uncertainties

International Nuclear Information System (INIS)

Repalle, Jalaja; Grandhi, Ramana V.

2004-01-01

Forging is a highly complex non-linear process that is vulnerable to various uncertainties, such as variations in billet geometry, die temperature, material properties, workpiece and forging equipment positional errors and process parameters. A combination of these uncertainties could induce heavy manufacturing losses through premature die failure, final part geometric distortion and production risk. Identifying the sources of uncertainties, quantifying and controlling them will reduce risk in the manufacturing environment, which will minimize the overall cost of production. In this paper, various uncertainties that affect forging tool life and preform design are identified, and their cumulative effect on the forging process is evaluated. Since the forging process simulation is computationally intensive, the response surface approach is used to reduce time by establishing a relationship between the system performance and the critical process design parameters. Variability in system performance due to randomness in the parameters is computed by applying Monte Carlo Simulations (MCS) on generated Response Surface Models (RSM). Finally, a Robust Methodology is developed to optimize forging process parameters and preform shape. The developed method is demonstrated by applying it to an axisymmetric H-cross section disk forging to improve the product quality and robustness

Ultra-large size austenitic stainless steel forgings for fast breeder reactor 'Monju'

International Nuclear Information System (INIS)

Tsukada, Hisashi; Suzuki, Komei; Sato, Ikuo; Miura, Ritsu.

1988-01-01

The large SUS 304 austenitic stainless steel forgings for the reactor vessel of the prototype FBR 'Monju' of 280 MWe output were successfully manufactured. The reactor vessel contains the heart of the reactor and sodium coolant at 530 deg C, and its inside diameter is about 7 m, and height is about 18 m. It is composed of 12 large forgings, that is, very thick flanges and shalls made by ring forging and an end plate made by disk forging and hot forming, using a special press machine. The manufacture of these large forgings utilized the results of the basic test on the material properties in high temperature environment and the effect that the manufacturing factors exert on the material properties and the results of the development of manufacturing techniques for superlarge forgings. The problems were the manufacturing techniques for the large ingots of 250 t class of high purity, the hot working techniques for stainless steel of fine grain size, the forging techniques for superlarge rings and disks, and the machining techniques of high precision for particularly large diameter, thin wall rings. The manufacture of these large stainless steel forgings is reported. (Kako, I.)

77 FR 14445 - Application for a License To Export Steel Forging

Science.gov (United States)

2012-03-09

... NUCLEAR REGULATORY COMMISSION Application for a License To Export Steel Forging Pursuant to 10 CFR 110.70(b) ``Public Notice of Receipt of an Application,'' please take notice that the Nuclear... head steel February 7, 2012 forging. forging will be XR175 machined into the 11005983 finished vessel...

Mannes of Forging and Perspectives of Knuckle Joint Presses Modernization

Directory of Open Access Journals (Sweden)

A. A. Antsifirov

2014-01-01

Full Text Available The article raises an issue to enhance technological forging capabilities on the known knuckle joint presses. It provides an illustrated overview of main design types of presses with crank-knuckle, toggle-knuckle, and knuckle joint mechanisms. The article also shows the advantages of the modernization way and improvement just of the active press equipment in terms of quality-to-price ratio, for example, as compared to the similar new foreign press equipment.It gives an overview of features, which provide forging processes owing to kinetic energy accumulated with the moving parts of the known designs of the knuckle joint presses depending on the drive actuating mechanism. Focused attention is drawn to forging on the knuckle joint presses for a time of contact with a work piece to be comparable with the duration of the work piece deformation process on hydraulic forging hammers. This allows us to forge thin-wall products with process automation compared to the forging hammers.Analysis of accumulating processes of kinetic energy by the moving parts of the knuckle joint presses has shown that presses driven by hydraulic cylinders or two screw hydraulic cylinder are the most optimal for technological operations as evidenced by references to domestic and foreign invention certificates and patents. The article presents disadvantages of forging on presses with hydraulic or pneumatic drive. It is a dependence of the deformation force, caused, mainly, by a force of the drive cylinder. The article gives linear movement rate quantities of press moving members depending on the drives of the actuating mechanism. Based on the above analysis of the features to manufacture work pieces on the knuckle joint presses, the article gives the rationale for the relevance of forging in a short period of time, provided that the moving parts of the press accumulate the required kinetic energy. This can be achieved only through modernization and improvement of forging

Optical Forging of Graphene into Three-Dimensional Shapes.

Science.gov (United States)

Johansson, Andreas; Myllyperkiö, Pasi; Koskinen, Pekka; Aumanen, Jukka; Koivistoinen, Juha; Tsai, Hung-Chieh; Chen, Chia-Hao; Chang, Lo-Yueh; Hiltunen, Vesa-Matti; Manninen, Jyrki J; Woon, Wei Yen; Pettersson, Mika

2017-10-11

Atomically thin materials, such as graphene, are the ultimate building blocks for nanoscale devices. But although their synthesis and handling today are routine, all efforts thus far have been restricted to flat natural geometries, since the means to control their three-dimensional (3D) morphology has remained elusive. Here we show that, just as a blacksmith uses a hammer to forge a metal sheet into 3D shapes, a pulsed laser beam can forge a graphene sheet into controlled 3D shapes in the nanoscale. The forging mechanism is based on laser-induced local expansion of graphene, as confirmed by computer simulations using thin sheet elasticity theory.

Essaying the mechanical hypothesis: Descartes, La Forge, and Malebranche on the formation of birthmarks.

Science.gov (United States)

Wilkin, Rebecca M

2008-01-01

This essay examines the determination by Cartesians to explain the maternal imagination's alleged role in the formation of birthmarks and the changing notion of monstrosity. Cartesians saw the formation of birthmarks as a challenge through which to demonstrate the heuristic capacity of mechanism. Descartes claimed to be able to explain the transmission of a perception from the mother's imagination to the fetus' skin without having recourse to the little pictures postulated by his contemporaries. La Forge offered a detailed account stating that the failure to explain the maternal imagination's impressions would cast doubt on mechanism. Whereas both characterized the birthmark as a deformation or monstrosity in miniature, Malebranche attributed a role to the maternal imagination in fashioning family likenesses. However, he also charged the mother's imagination with the transmission of original sin.

ALICE luminosity determination for p-Pb collisions at $\\sqrt{s_{\\rm NN}}=8.16$ TeV

CERN Document Server

2018-01-01

Luminosity determination in ALICE is based on visible cross sections measured in van der Meer scans. In 2016, the Large Hadron Collider provided proton-lead collisions at a centre-of-mass energy of $\\sqrt{s_{\\rm NN}}=8.16$ TeV. There were two scans, one with the proton beam traveling towards the ALICE forward muon spectrometer and the second with the proton beam traveling in the opposite direction. During these scans cross sections were measured for two classes of visible interactions, based on particle detection in the ALICE luminometers: the T0 detector with pseudorapidity coverage $4.6<\\eta< 4.9$, $-3.3<\\eta<-3.0$ and the V0 detector covering $2.8<\\eta< 5.1$, $-3.7<\\eta<-1.7$. This document describes the experimental setup for such measurements and reports their results.

Development of High-Performance Cast Crankshafts. Final Technical Report

Energy Technology Data Exchange (ETDEWEB)

Bauer, Mark E [General Motors, Detroit, MI (United States)

2017-03-31

The objective of this project was to develop technologies that would enable the production of cast crankshafts that can replace high performance forged steel crankshafts. To achieve this, the Ultimate Tensile Strength (UTS) of the new material needs to be 850 MPa with a desired minimum Yield Strength (YS; 0.2% offset) of 615 MPa and at least 10% elongation. Perhaps more challenging, the cast material needs to be able to achieve sufficient local fatigue properties to satisfy the durability requirements in today’s high performance gasoline and diesel engine applications. The project team focused on the development of cast steel alloys for application in crankshafts to take advantage of the higher stiffness over other potential material choices. The material and process developed should be able to produce high-performance crankshafts at no more than 110% of the cost of current production cast units, perhaps the most difficult objective to achieve. To minimize costs, the primary alloy design strategy was to design compositions that can achieve the required properties with minimal alloying and post-casting heat treatments. An Integrated Computational Materials Engineering (ICME) based approach was utilized, rather than relying only on traditional trial-and-error methods, which has been proven to accelerate alloy development time. Prototype melt chemistries designed using ICME were cast as test specimens and characterized iteratively to develop an alloy design within a stage-gate process. Standard characterization and material testing was done to validate the alloy performance against design targets and provide feedback to material design and manufacturing process models. Finally, the project called for Caterpillar and General Motors (GM) to develop optimized crankshaft designs using the final material and manufacturing processing path developed. A multi-disciplinary effort was to integrate finite element analyses by engine designers and geometry-specific casting

Development of Oxide Dispersion Strengthened (ODS) Ferritic Steel Through Powder Forging

Science.gov (United States)

Kumar, Deepak; Prakash, Ujjwal; Dabhade, Vikram V.; Laha, K.; Sakthivel, T.

2017-04-01

Oxide dispersion strengthened (ODS) ferritic steels are candidates for cladding tubes in fast breeder nuclear reactors. In this study, an 18%Cr ODS ferritic steel was prepared through powder forging route. Elemental powders with a nominal composition of Fe-18Cr-2 W-0.2Ti (composition in wt.%) with 0 and 0.35% yttria were prepared by mechanical alloying in a Simoloyer attritor under argon atmosphere. The alloyed powders were heated in a mild steel can to 1473 K under flowing hydrogen atmosphere. The can was then hot forged. Steps of sealing, degassing and evacuation are eliminated by using powder forging. Heating ODS powder in hydrogen atmosphere ensures good bonding between alloy powders. A dense ODS alloy with an attractive combination of strength and ductility was obtained after re-forging. On testing at 973 K, a loss in ductility was observed in yttria-containing alloy. The strength and ductility increased with increase in strain rate at 973 K. Reasons for this are discussed. The ODS alloy exhibited a recrystallized microstructure which is difficult to achieve by extrusion. No prior particle boundaries were observed after forging. The forged compacts exhibited isotropic mechanical properties. It is suggested that powder forging may offer several advantages over the traditional extrusion/HIP routes for fabrication of ODS alloys.

KIT(D816V) Induces SRC-Mediated Tyrosine Phosphorylation of MITF and Altered Transcription Program in Melanoma

DEFF Research Database (Denmark)

Phung, Bengt; Kazi, Julhash U; Lundby, Alicia

2017-01-01

The oncogenic D816V mutation of the KIT receptor is well characterized in systemic mastocytosis and acute myeloid leukemia. Although KIT(D816V) has been found in melanoma, its function and involvement in this malignancy is not understood. Here we show that KIT(D816V) induces tyrosine phosphorylat......The oncogenic D816V mutation of the KIT receptor is well characterized in systemic mastocytosis and acute myeloid leukemia. Although KIT(D816V) has been found in melanoma, its function and involvement in this malignancy is not understood. Here we show that KIT(D816V) induces tyrosine.......Implications: This study demonstrates that an oncogenic tyrosine kinase mutant, KIT(D816V), can alter the transcriptional program of the transcription factor MITF in melanoma Mol Cancer Res; 15(9); 1265-74. ©2017 AACR....

Medium carbon vanadium micro alloyed steels for drop forging

International Nuclear Information System (INIS)

Jeszensky, Gabor; Plaut, Ronald Lesley

1992-01-01

Growing competitiveness of alternative manufacturing routes requires cost minimization in the production of drop forged components. The authors analyse the potential of medium carbon, vanadium microalloyed steels for drop forging. Laboratory and industrial experiments have been carried out emphasizing deformation and temperature cycles, strain rates and dwell times showing a typical processing path, associated mechanical properties and corresponding microstructures. The steels the required levels of mechanical properties on cooling after forging, eliminating subsequent heat treatment. The machinability of V-microalloyed steels is also improved when compared with plain medium carbon steels. (author)

Hot Deformation Behavior and Pulse Current Auxiliary Isothermal Forging of Hot Pressing Sintering TiAl Based Alloys.

Science.gov (United States)

Shi, Chengcheng; Jiang, Shaosong; Zhang, Kaifeng

2017-12-16

This paper focuses on the fabrication of as-forged Ti46.5Al2Cr1.8Nb-(W, B) alloy via pulse current auxiliary isothermal forging (PCIF). The starting material composed of near gamma (NG) microstructure was fabricated by adopting pre-alloyed powders via hot pressing sintering (HPS) at 1300 °C. Isothermal compression tests were conducted at a strain rate range of 0.001-0.1 s -1 and a temperature range of 1125-1275 °C to establish the constitutive model and processing map. The optimal hot deformation parameters were successfully determined (in a strain rate range of 10 -3 -2.5 × 10 -3 s -1 and temperature range of 1130-1180 °C) based on the hot processing map and microstructure observation. Accordingly, an as-forged TiAl based alloy without cracks was successfully fabricated by PCIF processing at 1175 °C with a nominal strain rate of 10 -3 s -1 . Microstructure observation indicated that complete dynamic recrystallization (DRX) and phase transformation of γ→α₂ occurred during the PCIF process. The elongation of as-forged alloy was 136%, possessing a good secondary hot workability, while the sintered alloy was only 66% when tested at 900 °C with a strain rate of 2 × 10 -4 s -1 .

30 CFR 816.150 - Roads: general.

Science.gov (United States)

2010-07-01

... altering the normal flow of water in streambeds or drainage channels; (6) Prevent or control damage to... part of any road shall be located in the channel of an intermittent or perennial stream unless... 816.57 of this chapter. (2) Roads shall be located to minimize downstream sedimentation and flooding...

Optimising mechanical properties of hot forged nickel superalloy 625 components

Science.gov (United States)

Singo, Nthambe; Coles, John; Rosochowska, Malgorzata; Lalvani, Himanshu; Hernandez, Jose; Ion, William

2018-05-01

Hot forging and subsequent heat treatment were resulting in substandard mechanical properties of nickel superalloy, Alloy 625, components. The low strength was found to be due to inadequate deformation during forging, excessive grain growth and precipitation of carbides during subsequent heat treatment. Experimentation in a drop forging company and heat treatment facility led to the establishment of optimal parameters to minimise grain size and mitigate the adverse effects of carbide precipitation, leading to successful fulfilment of mechanical property specifications. This was achieved by reducing the number of operations, maximising the extent of deformation by changing the slug dimensions and its orientation in the die, and minimising the time of exposure to elevated temperatures in both the forging and subsequent heat treatment processes to avoid grain growth.

Multiparticle correlations and higher order harmonics in pPb collisions at $\\sqrt{s_{_\\text{NN}}} = 8.16~\\mathrm{TeV}$

CERN Document Server

CMS Collaboration

2018-01-01

The second- and third-order azimuthal anisotropy Fourier harmonics are studied in pPb collisions at $\\sqrt{s_{_\\text{NN}}}=8.16~\\mathrm{TeV}$ over a wide range of event multiplicities. The second-order, ``elliptic'' harmonic moment is obtained through four-, six-, and eight-particle correlations and the third-order, ``triangular'' harmonic moment is studied using four-particle correlations. The data were collected by the CMS experiment during the 2016 LHC run. A sample of peripheral PbPb collisions at $\\sqrt{s_{_{\\text{NN}}}}=5.02~\\mathrm{TeV}$, covering a similar range of event multiplicities to the pPb results, is also analyzed. Theoretical predictions that assume a hydrodynamic evolution of the created medium with initial-state density fluctuations are compared to the experimental results.

The microstructure of steels and cast irons. History and interpretation

International Nuclear Information System (INIS)

Durand-Charre, M.

2003-01-01

The microstructure of steels and cast irons is a monograph on the history and interpretation of the microstructure of steels and iron alloys. Its 400 pages are illustrated by a lot of micrographies of commercial alloys or model alloys at each the available scales with the modern investigations means of electronic microscopy and the optical macro/microscopy. The first part of this book is an historical introduction on the development of the metallurgical structures manually forged for the iron knowledge, in particular the famous structures called damask. The second part of this book deals with the fundamental notions in order to give all the reasoning bases required on the phases equilibria and the transformations kinetics. Concerning the phases equilibria, a lot of diagrams are included. The reading of ternary systems is analyzed for six systems representative of the reactions encountered in steels, Fe-Cr-C, Fe-Ni-Cr, Fe-Mn-S, Fe-Co-Cu, Fe-Mo-Cr and Fe-C-V. The solidification structures are studied through all the classical cases but in others too as the markings of peritectic or metatectic reactions or transformations in series. Solid phases transformations are illustrated and commented with recent interpretations, in particular in the case of bainitic structures. A lot of references allow to deepen the non developed aspects. The third part is a guide to understand and discuss on scientific bases the role of alloy elements and those of different specific treatments resulting to the optimisation of steels and iron casts, to define the micrographic characteristics in relation with the use properties. Steels are classified in series for the very low alloy steels to steels with high amounts in alloy elements resulting of a very fine composition adjustment. Cast irons are presented naturally according to their microstructure, classified in white irons, lamellar grey and nodular irons. (O.M.)

Simulation and experimental verification of the filling process of semi-solid die forging for cup shell

Directory of Open Access Journals (Sweden)

Jianbo TAN

2015-06-01

Full Text Available The filling mold process of semi-solid alloy blank influences severely the forming and properties of finished piece. In this paper, DEFORM is applied to simulate the process of cup-type 6061 alloy die forging casting. The influences of the temperature of semi-solid alloy blank, preheating temperature, and downward press speed of pressure head on process of mold filling and velocity field are investigated. The results show that the mold filling of semi-solid alloy paste smoothly fills along the whole of mould cavity in “total wall thickness” form when the temperature of semi-solid alloy blank is 620 ℃, preheating temperature of pressure head is 200 ℃ and speed of pressure head is 40 mm/s. Along with the increase of the preheating temperature of pressure head, the filling process of the semi-solid alloy paste trends toward stable when the temperature of semi-solid alloy blank is 620 ℃ and the speed of pressure head is 20 mm/s. Along with the increasing of the temperature of semi-solid alloy, the process of mould filling becomes off balance and the liquid becomes turbulent flow. The velocity field in the process of mould filling affects severely the structure uniformity of the finished product.

Study on isothermal precision forging process of rare earth intensifying magnesium alloy

International Nuclear Information System (INIS)

Shan, Debin; Xu, Wenchen; Han, Xiuzhu; Huang, Xiaolei

2012-01-01

A three dimensional rigid-plastic finite element model is established to simulate the isothermal precision forging process of the magnesium alloy bracket based on DEFORM 3D in order to analyze the material flow rule and determine the forging process scheme. Some problems such as underfilling and too large forging pressure are predicted and resolved through optimizing the shapes of the billet successfully. Compared to the initial microstructure, the isothermal-forged microstructure of the alloy refines obviously and amounts of secondary phases precipitate on the matrix during isothermal forging process. In subsequent ageing process, large quantities of secondary phases precipitate from α-Mg matrix with increasing ageing time. The optimal comprehensive mechanical properties of the alloy have been obtained after aged at 473 K, 63 h with the ultimate tensile strength, tensile yield strength and elongation 380 MPa, 243 MPa and 4.07% respectively, which shows good potential for application of isothermal forging process of rare earth intensifying magnesium alloy.

Near net shape forging of titanium alloy turbine blade

International Nuclear Information System (INIS)

Morita, Akiyasu; Hattori, Shigeo; Tani, Kazuhito; Takemura, Atsushi; Ashida, Yoshio

1991-01-01

The isothermal forging process has been developed to produce turbine blades made of near β Ti-alloy Ti-10V-2Fe-3Al. It is important to set the preform at the optimum position of the die in order to get a high precision product. The deformation analysis by using FEM is effective to determine the optimum position. And also it is necessary to avoid buckling induced by the restriction of axial elongation of the material. As a result, Ti-10V-2Fe-3Al blades could be formed precisely by using only one stage of forging, and machining was needed only at the root. The thickness of the oxide layer induced on the surface of the forged blade was only 70μm. The mechanical properties of Ti-10V-2Fe-3Al blades after forging and annealing were superior to those of Ti-6Al-4V blades and were nearly uniform across the length of the blades. (author)

Sensitivity analysis and optimization algorithms for 3D forging process design

International Nuclear Information System (INIS)

Do, T.T.; Fourment, L.; Laroussi, M.

2004-01-01

This paper presents several approaches for preform shape optimization in 3D forging. The process simulation is carried out using the FORGE3 registered finite element software, and the optimization problem regards the shape of initial axisymmetrical preforms. Several objective functions are considered, like the forging energy, the forging force or a surface defect criterion. Both deterministic and stochastic optimization algorithms are tested for 3D applications. The deterministic approach uses the sensitivity analysis that provides the gradient of the objective function. It is obtained by the adjoint-state method and semi-analytical differentiation. The study of stochastic approaches aims at comparing genetic algorithms and evolution strategies. Numerical results show the feasibility of such approaches, i.e. the achieving of satisfactory solutions within a limited number of 3D simulations, less than fifty. For a more industrial problem, the forging of a gear, encouraging optimization results are obtained

Influence of segregations and hydrogen flakes on the mechanical properties of forged RPV steels

International Nuclear Information System (INIS)

Eiselt, C.C.; May, J.; Hein, H.

2013-01-01

In the frame of relevant 1970s/80s German research programs (e.g. FKS research program on component safety and others), many investigations on large forgings manufactured from Reactor Pressure Vessel (RPV) materials such as 20 MnMoNi 5 5 and 22 NiMoCr 3 7 have been performed. Lately, after ultrasonic testing hydrogen flakes in connection with segregation zones have been observed in a few RPV forgings. The earlier R and D programs contained a number of special heats, which covered a defined defect state (lower bound heats) with relevance to the recent observations of numerous UT indications in RPV forgings of two PWRs. Therefore, the results of these former research programs were now reviewed. The studies included an evaluation of the effects of macro/micro segregations as well as hydrogen flakes on the mechanical properties. As part of the mechanical technological experiments Charpy impact tests in different orientations (e.g. L-T, T-L and S-T) together with fracture mechanics and large scale tensile tests were carried out in segregated and non segregated material zones. In this context the letters L,T,S indicate the longitudinal, transversal and short transverse (thickness) direction with respect to rolling direction of the forging axis. The first letter indicates the direction of the principal stress, while the second letter stands for the crack propagation direction [1]. Furthermore the irradiation behavior of segregated material regions was analyzed and compared to non segregated material regions. Key results of these analyses indicate that in most cases upper shelf levels are lowered in segregated material parts compared to non segregated areas. In addition the segregations cause a larger scattering of impact energies. A high hydrogen content in combination with segregations has overall detrimental effects on the mechanical properties. However, there seems to be no specific segregation influence on the materials' irradiation reaction.

Simulation of Distortion and Residual Stress Development During Heat Treatment of Steel Castings

Energy Technology Data Exchange (ETDEWEB)

Beckermann, Christoph; Carlson, Kent

2011-07-22

Heat treatment and associated processing, such as quenching, are critical during high strength steel casting production. These processes must be managed closely to prevent thermal and residual stresses that may result in distortion, cracking (particularly after machining), re-work, and weld repair. The risk of casting distortion limits aggressive quenching that can be beneficial to the process and yield an improved outcome. As a result of these distortions, adjustments must be made to the casting or pattern design, or tie bars must be added. Straightening castings after heat treatments can be both time-consuming and expensive. Residual stresses may reduce a casting's overall service performance, possibly resulting in catastrophic failure. Stress relieving may help, but expends additional energy in the process. Casting software is very limited in predicting distortions during heat treatment, so corrective measures most often involve a tedious trial-and-error procedure. An extensive review of existing heat treatment residual stress and distortion modeling revealed that it is vital to predict the phase transformations and microstructure of the steel along with the thermal stress development during heat treatment. After reviewing the state-of-the-art in heat treatment residual stress and distortion modeling, an existing commercial code was selected because of its advanced capabilities in predicting phase transformations, the evolving microstructure and related properties along with thermal stress development during heat treatment. However, this software was developed for small parts created from forgings or machined stock, and not for steel castings. Therefore, its predictive capabilities for heat treatment of steel castings were investigated. Available experimental steel casting heat treatment data was determined to be of insufficient detail and breadth, and so new heat treatment experiments were designed and performed, casting and heat treating modified versions

High yttria ferritic ODS steels through powder forging

Energy Technology Data Exchange (ETDEWEB)

Kumar, Deepak [Department of Metallurgical and Materials Engineering, I.I.T-Roorkee, Uttarakhand 247667 (India); Prakash, Ujjwal, E-mail: ujwalfmt@iitr.ac.in [Department of Metallurgical and Materials Engineering, I.I.T-Roorkee, Uttarakhand 247667 (India); Dabhade, Vikram V. [Department of Metallurgical and Materials Engineering, I.I.T-Roorkee, Uttarakhand 247667 (India); Laha, K.; Sakthivel, T. [Mechanical Metallurgy Group, IGCAR, Kalpakkam, Tamilnadu 603102 (India)

2017-05-15

Oxide dispersion strengthened (ODS) steels are being developed for future nuclear reactors. ODS Fe-18%Cr-2%W-0.2%Ti steels with 0, 0.35, 0.5, 1 and 1.5% Y{sub 2}O{sub 3} (all compositions in weight%) dispersion were fabricated by mechanical alloying of elemental powders. The powders were placed in a mild steel can and forged in a stream of hydrogen gas at 1473 K. The steels were forged again to final density. The strength of ODS steel increased with yttria content. Though this was accompanied by a decrease in tensile elongation, all the steels showed significant ductility. The ductility in high yttria alloys may be attributed to improved inter-particle bonding between milled powders due to reduction of surface oxides by hydrogen. This may permit development of ODS steels with yttria contents higher than the conventional limit of 0.5%. It is suggested that powder forging is a promising route to fabricate ODS steels with high yttria contents and improved ductility. - Highlights: •ODS steels with yttria contents beyond the conventional limit of 0.5 wt% were fabricated by powder forging in a hydrogen atmosphere. •All the alloys exhibited significant ductility. •This may be attributed to improved inter-particle bonding due to reduction of surface oxides by hydrogen. •Strength in excess of 300 MPa was obtained at 973 K for 0.5%, 1% and 1.5% yttria ODS alloys. •Powder forging is a promising route to fabricate ODS steels and permits development of compositions with up to 1.5% yttria.

Residual analysis applied to S-N data of a surface rolled cast iron

Directory of Open Access Journals (Sweden)

Omar Maluf

2005-09-01

Full Text Available Surface rolling is a process extensively employed in the manufacture of ductile cast iron crankshafts, specifically in regions containing stress concentrators with the main aim to enhance fatigue strength. Such process hardens and introduces compressive residual stresses to the surface as a result of controlled strains, reducing cyclic tensile stresses near the surface of the part. The main purpose of this work was to apply the residual analysis to check the suitability of the S-N approach to describe the fatigue properties of a surface rolled cast iron. The analysis procedure proved to be very efficient and easy to implement and it can be applied in the verification of any other statistical model used to describe fatigue behavior. Results show that the conventional S-N methodology is able to model the high cycle fatigue behavior of surface rolled notch testpieces of a pearlitic ductile cast iron submitted to rotating bending fatigue tests.

Close toleranoe forging of chromium steel blades for powerful steam turbines

International Nuclear Information System (INIS)

Shastin, Eh.G.; Kositskij, Yu.N.; Lyubchits, G.A.

1989-01-01

Work on simulating technological process on die-forging hammer was performed in order to reduce the preparation period bringing technology of close tolerance forging of turbine blades to a commercial level. A special attention was paid to development of accurate forming of forgings of 20Kh13Sh, 12Kh13 and 15Kh11MFSh steels on screw presses with nominal effort equal to 80 and 144 MN

What history reveals about Forge River pollution on Long Island, New York's south shore.

Science.gov (United States)

Swanson, R Lawrence; Brownawell, B; Wilson, Robert E; O'Connell, Christine

2010-06-01

Fifty years ago, the Forge River and Moriches Bay, of Long Island's south shore lagoonal system, achieved notoriety when their polluted conditions were alluded to in a report of the US President's Science Advisory Committee (1965). The Woods Hole Oceanographic Institution investigated the bay throughout the 1950s, identifying duck farming as the cause of "objectionable", "highly contaminated" conditions of these waters. Much has changed: duck farming declined; the river was dredged to remove polluted sediments, improve navigation; and barrier island inlets stabilized. Yet, the river remains seasonally eutrophic. Why? This paper reviews what occurred in the Forge River watershed. While governments aggressively curtailed the impacts of duck pollution, they failed to manage development and sewage pollution. The Forge experience indicates that watershed management is a continuing governmental responsibility as development accelerates. Otherwise, we will always be looking for that instantaneous remediation that is usually not affordable and is socially contentious.

Numerical simulation and experimental verification of microstructure evolution in large forged pipe used for AP1000 nuclear power plants

International Nuclear Information System (INIS)

Wang, Shenglong; Yang, Bin; Zhang, Mingxian; Wu, Huanchun; Peng, Jintao; Gao, Yang

2016-01-01

Highlights: • Establish systematically the database of 316LN stainless steel for Deform-3D. • Simulate the microstructure evolution during forging of AP1000 primary coolant pipe. • Carry out full-scale forging experiment for verification in engineering practice. • Get desirable grain size in simulation and experiment. • The variation trends of grain sizes in simulation and experiment are consistent. - Abstract: AP1000 primary coolant pipe is a large special-shaped forged pipe made of 316LN stainless steel. Due to the non-uniform temperature and deformation during its forging, coarse and fine grains usually coexist in the forged pipe, resulting in the heterogeneous microstructure and anisotropic performance. To investigate the microstructure evolution during the entire forging process, in the present research, the database of the 316LN stainless steel was established and a numerical simulation was performed. The results indicate that the middle body section of the forged pipe has an extremely uniform average grain size with the value smaller than 30 μm. The grain sizes in the ends of body sections were ranged from 30 μm to 60 μm. Boss sections have relatively homogeneous microstructure with the average grain size 30 μm to 44 μm. Furthermore, a full-scale hot forging was carried out for verification. Comparison of theoretical and experimental results showed good agreement and hence demonstrated the capabilities of the numerical simulation presented here. It is noteworthy that all grains in the workpiece were confirmed less than 180 μm, which meets the designer’s demands.

Anisotropy effects during dwell-fatigue caused by δ-phase orientation in forged Inconel 718

Energy Technology Data Exchange (ETDEWEB)

Saarimäki, Jonas, E-mail: jonas.saarimaki@liu.se [Division of Engineering Materials, Department of Management and Engineering, Linköping University, SE-58183 Linköping (Sweden); Colliander, Magnus Hörnqvist [Department of Applied Physics, Chalmers University of Technology, SE-41296 Göteborg (Sweden); GKN Aerospace Engine Systems, R& T Centre, SE-46181 Trollhättan (Sweden); Moverare, Johan J. [Division of Engineering Materials, Department of Management and Engineering, Linköping University, SE-58183 Linköping (Sweden)

2017-04-24

Inconel 718 is a commonly used superalloy for turbine discs in the gas turbine industry. Turbine discs are often subjected to dwell-fatigue as a result of long constant load cycles. The effect of anisotropy on dwell-fatigue cracking in forged turbine discs have not yet been thoroughly investigated. Crack propagation behaviour was characterised using compact tension (CT) samples cut in different orientations from a real turbine disc forging. Samples were also cut in two different thicknesses in order to investigate the influence of plane strain and plane stress condition on the crack propagation rates. The samples were subjected to dwell-fatigue tests at 550 °C with 90 s or 2160 s dwell-times at maximum load. Microstructure characterisation was done using scanning electron microscopy (SEM) techniques such as electron channelling contrast imaging (ECCI), electron backscatter diffraction (EBSD), and light optical microscopy (LOM). The forged alloy exhibits strong anisotropic behaviour caused by the non-random δ-phase orientation. When δ-phases were oriented perpendicular compared to parallel to the loading direction, the crack growth rates were approximately ten times faster. Crack growth occurred preferably in the interface between the γ-matrix and the δ-phase.

The use of electromagnetic field in designing the high quality Al alloys for hot forging process

Directory of Open Access Journals (Sweden)

Zvonko Gulišija

2014-12-01

Full Text Available This work presents a way to obtain the better quality of EN AW 7075 aluminum high-strength alloy by application of electromagnetic field (EMF during the casting process. In this way, the uniform fine-grained microstructure, and hence the better mechanical properties of the alloy can be achieved. The microstructure and mechanical characterization for samples obtained with and without EMF were performed. The application of numerical simulation for hot forging process, using appropriate software, is efficient and highly useful tool for problem prediction in industrial production, reducing the time and costs in the process of development of new products. The input data of high strength Al-alloy EN AW-7075 is used for simulation because it enables the development of parts with complex dimensions and shape.

Integral forged pump casing for the primary coolant circuit of a nuclear reactor: Development in design, forging technology, and material

International Nuclear Information System (INIS)

Austel, W.; Korbe, H.

1986-01-01

Developments in the forging of large casings for primary circuit coolant pumps for light water reactors in Germany are demonstrated beginning with the multiple forging fabricated version and ending with the integral forged type. This version is the result of the joint efforts of the pump manufacturer and the forgemaster after a cost-gain evaluation and represents an optimum solution in view of its functional and economical performance and also considering the high requirements for mechanical-technological properties, including homogeneity of the material. The development from 22 NiMoCr 3 7/A 508 Class 2 to 20 MnMoNi 5 5/A 508 Class 3 and their optimization will be demonstrated. This development is based mainly on minimizing the sulfur content and on vacuum carbon deoxidation (VCD), which results in a reduction of the A-segregations, in improving fracture toughness and isotropy, and in the desired fine-grain structure

Processing of Advanced Cast Alloys for A-USC Steam Turbine Applications

Science.gov (United States)

Jablonski, Paul D.; Hawk, Jeffery A.; Cowen, Christopher J.; Maziasz, Philip J.

2012-02-01

The high-temperature components within conventional supercritical coal-fired power plants are manufactured from ferritic/martensitic steels. To reduce greenhouse-gas emissions, the efficiency of pulverized coal steam power plants must be increased to as high a temperature and pressure as feasible. The proposed steam temperature in the DOE/NETL Advanced Ultra Supercritical power plant is high enough (760°C) that ferritic/martensitic steels will not work for the majority of high-temperature components in the turbine or for pipes and tubes in the boiler due to temperature limitations of this class of materials. Thus, Ni-based superalloys are being considered for many of these components. Off-the-shelf forged nickel alloys have shown good promise at these temperatures, but further improvements can be made through experimentation within the nominal chemistry range as well as through thermomechanical processing and subsequent heat treatment. However, cast nickel-based superalloys, which possess high strength, creep resistance, and weldability, are typically not available, particularly those with good ductility and toughness that are weldable in thick sections. To address those issues related to thick casting for turbine casings, for example, cast analogs of selected wrought nickel-based superalloys such as alloy 263, Haynes 282, and Nimonic 105 have been produced. Alloy design criteria, melt processing experiences, and heat treatment are discussed with respect to the as-processed and heat-treated microstructures and selected mechanical properties. The discussion concludes with the prospects for full-scale development of a thick section casting for a steam turbine valve chest or rotor casing.

Application of CAD/CAE/CAM in forging process: a review

International Nuclear Information System (INIS)

Ahmad Baharuddin Abdullah; Hamouda, A.M.S.

2005-01-01

Forging can be described as the process in which metal is plastically deformed with application of huge pressure. The process not only changes the shape but also improves the properties of the forged parts due to grain size refinement. Conventionally, the empirical trial and error method has been applied, but recently there are various tools are employed to improved product quality and economic of the process. For example, Computer Aided Design (CAD) is widely used in modeling of the process, while Computer Aided Engineering (CAE) tools have been utilized in analyzing the process. To physically demonstrate the process, Computer Aided Manufacturing (CAM) such as CNC machine has been exploited. In order to improve forging process efficiency, an integrated system that combines all advantages of CAD, CAM and CAE need to be developed. This paper presents an overview of computer aided simulation such as CAD, CAE and CAM application in forging process. (Author)

Examples on cold forged aluminium components in automotive industry

DEFF Research Database (Denmark)

Bay, Niels; Kolsgaard, A.

2000-01-01

The present paper describes the possibilites of applying cold forging for manufacturing of light weight components in aluminium. A short description of the basic cold forming processes forms the basis for describing the great variety in design of cold forged components. Examples are mainly taken ...... from automotive industry but in a few cases also from other industrial sectors to show the possibilities....

Calculation of recovery plasticity in multistage hot forging under isothermal conditions.

Science.gov (United States)

Zhbankov, Iaroslav G; Perig, Alexander V; Aliieva, Leila I

2016-01-01

A widely used method for hot forming steels and alloys, especially heavy forging, is the process of multistage forging with pauses between stages. The well-known effect which accompanies multistage hot forging is metal plasticity recovery in comparison with monotonic deformation. A method which takes into consideration the recovery of plasticity in pauses between hot deformations of a billet under isothermal conditions is proposed. This method allows the prediction of billet forming limits as a function of deformation during the forging stage and the duration of the pause between the stages. This method takes into account the duration of pauses between deformations and the magnitude of subdivided deformations. A hot isothermal upsetting process with pauses was calculated by the proposed method. Results of the calculations have been confirmed with experimental data.

Mathematical model of the crystallizing blank`s thermal state at the horizontal continuous casting machine

Directory of Open Access Journals (Sweden)

Kryukov Igor Yu.

2017-01-01

Full Text Available Present article is devoted to the development of the mathematical model, which describes thermal state and crystallization process of the rectangular cross-section blank while continious process of extraction from a horysontal continious casting machine (HCCM.The developed model took cue for the heat-transfer properties of non-iron metal teeming; its temperature on entry to the casting mold; cooling conditions of blank in the carbon molds in the presence of a copper water cooler. Besides, has been considered the asymmetry of heat interchange from blank`s head and drag at mold, coming out from fluid contraction and features of the horizontal casting mold. The developed mathematical model allows to determine alterations in crystallizing blank of the following factors with respect to time: temperature pattern of crystallizing blank under different technical working regimes of HCCM; boundaries of solid two-phase field and liquid two-phase filed; blank`s thickness variation under shrinkage of the ingot`s material

Material Behavior Based Hybrid Process for Sheet Draw-Forging Thin Walled Magnesium Alloys

International Nuclear Information System (INIS)

Sheng, Z.Q.; Shivpuri, R.

2005-01-01

Magnesium alloys are conventionally formed at the elevated temperatures. The thermally improved formability is sensitive to the temperature and strain rate. Due to limitations in forming speeds, tooling strength and narrow processing windows, complex thin walled parts cannot be made by traditional warm drawing or hot forging processes. A hybrid process, which is based on the deformation mechanism of magnesium alloys at the elevated temperature, is proposed that combines warm drawing and hot forging modes to produce an aggressive geometry at acceptable forming speed. The process parameters, such as temperatures, forming speeds etc. are determined by the FEM modeling and simulation. Sensitivity analysis under the constraint of forming limits of Mg alloy sheet material and strength of tooling material is carried out. The proposed approach is demonstrated on a conical geometry with thin walls and with bottom features. Results show that designed geometry can be formed in about 8 seconds, this cannot be formed by conventional forging while around 1000s is required for warm drawing. This process is being further investigated through controlled experiments

Finite element simulations and experimental investigations on ductile fracture in cold forging of aluminum alloy

Science.gov (United States)

Amiri, Amir; Nikpour, Amin; Saraeian, Payam

2018-05-01

Forging is one of the manufacturing processes of aluminium parts which has two major categories: called hot and cold forging. In the cold forging, the dimensional and geometrical accuracy of final part is high. However, fracture may occur in some aluminium alloys during the process because of less workability. Fracture in cold forging can be in the form of ductile, brittle or combination of both depending on the alloy type. There are several criteria for predicting fracture in cold forging. In this study, cold forging process of 6063 aluminium alloy for three different parts is simulated in order to predict fracture. The results of numerical simulations of Freudenthal criterion is in conformity with experimental tests.

Influence of performance improvement of AP1000 nuclear island main equipment forging on manufacturing

International Nuclear Information System (INIS)

Liu Zhiying

2013-01-01

In order to comply with the 60-year design life of an AP1000 nuclear power station, higher strength and ductility requirements have been made on AP1000 nuclear island SG forgings than on CPR1000 nuclear island main equipment. In addition, bigger size of AP1000 nuclear island SG forgings increases the difficulty of manufacturing them. Insufficient recognition of these changes may cause unstable quality of forgings and possible quality problems in follow-up welding procedure. On the basis of comparison and analysis of AP1000 nuclear island SG forgings and CPR1000 nuclear island forgings, this thesis suggests clear directions for the actions we need to take. (author)

30 CFR 816.131 - Cessation of operations: Temporary.

Science.gov (United States)

2010-07-01

..., revegetation, environmental monitoring, and water treatment activities that will continue during the temporary... Section 816.131 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND ENFORCEMENT, DEPARTMENT OF THE INTERIOR PERMANENT PROGRAM PERFORMANCE STANDARDS PERMANENT PROGRAM PERFORMANCE STANDARDS-SURFACE MINING...

Simulation and analysis of hot forging process for industrial locking gear elevators

Science.gov (United States)

Maarefdoust, M.; Kadkhodayan, M.

2010-06-01

In this paper hot forging process for industrial locking gear elevators is simulated and analyzed. An increase in demand of industrial locking gear elevators with better quality and lower price caused the machining process to be replaced by hot forging process. Production of industrial locking gear elevators by means of hot forging process is affected by many parameters such as billet temperature, geometry of die and geometry of pre-formatted billet. In this study the influences of billet temperature on effective plastic strain, radius of die corners on internal stress of billet and thickness of flash on required force of press are investigated by means of computer simulation. Three-dimensional modeling of initial material and die are performed by Solid Edge, while simulation and analysis of forging are performed by Super Forge. Based on the computer simulation the required dies are designed and the workpieces are formed. Comparison of simulation results with experimental data demonstrates great compatibility.

Research into Oil-based Colloidal-Graphite Lubricants for Forging of Al-based Alloys

International Nuclear Information System (INIS)

Petrov, A.; Petrov, P.; Petrov, M.

2011-01-01

The presented paper describes the topical problem in metal forging production. It deals with the choice of an optimal lubricant for forging of Al-based alloys. Within the scope of the paper, the properties of several oil-based colloidal-graphite lubricants were investigated. The physicochemical and technological properties of these lubricants are presented. It was found that physicochemical properties of lubricant compositions have an influence on friction coefficient value and quality of forgings.The ring compression method was used to estimate the friction coefficient value. Hydraulic press was used for the test. The comparative analysis of the investigated lubricants was carried out. The forging quality was estimated on the basis of production test. The practical recommendations were given to choose an optimal oil-based colloidal-graphite lubricant for isothermal forging of Al-based alloy.

Study on the microstructure of the different parts for new aluminum alloy forgings

International Nuclear Information System (INIS)

Gao Wei; Zheng Xiaojing; Wu Fu

2014-01-01

The mechanical properties of former aluminium alloy forgings cannot achieve technique demand. Because the component, dimension and preparation technology of new aluminum alloy have changed, the microstructure and mechanical properties of forgings are researched. It is concluded that the flowline of forgings has good continuity and uniformity, it does not have a prominent difference on microhardness of different parts. The results prove that the microstructure of forgings has good consistency. The matrix structure of forgings consists of fiber texture and equiaxed structure. The residual second phases, which are harmful to mechanical properties, are observed in the equiaxed structure. The center of equiaxed structure core zone, the edge of equiaxed structure transition zone and equiaxed structure edge zone should be focus on observing test, they are the sampling location of tensile property. (authors)

75 FR 70689 - Kaiser Aluminum Fabricated Products, LLC; Kaiser Aluminum-Greenwood Forge Division; Currently...

Science.gov (United States)

2010-11-18

... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-70,376] Kaiser Aluminum Fabricated Products, LLC; Kaiser Aluminum- Greenwood Forge Division; Currently Known As Contech Forgings, LLC..., applicable to workers of Kaiser Aluminum Fabricated Products, LLC, Kaiser Aluminum-Greenwood Forge Division...

SLIP CASTING METHOD

Science.gov (United States)

Allison, A.G.

1959-09-01

S>A process is described for preparing a magnesium oxide slip casting slurry which when used in conjunction with standard casting techniques results in a very strong "green" slip casting and a fired piece of very close dimensional tolerance. The process involves aging an aqueous magnestum oxide slurry, having a basic pH value, until it attains a specified critical viscosity at which time a deflocculating agent is added without upsetting the basic pH value.

Prompt and nonprompt J/ψ production and nuclear modification in pPb collisions at sNN=8.16 TeV

Directory of Open Access Journals (Sweden)

R. Aaij

2017-11-01

Full Text Available The production of J/ψ mesons is studied in proton-lead collisions at the centre-of-mass energy per nucleon pair sNN=8.16 TeV with the LHCb detector at the LHC. The double differential cross-sections of prompt and nonprompt J/ψ production are measured as a function of the J/ψ transverse momentum and rapidity in the nucleon–nucleon centre-of-mass frame. Forward-to-backward ratios and nuclear modification factors are determined. The results are compared with theoretical calculations based on collinear factorisation using nuclear parton distribution functions, on the colour glass condensate or on coherent energy loss models.

Numerical modelling of damage evolution in ingot forging

DEFF Research Database (Denmark)

Christiansen, Peter; Martins, Paulo A.F.; Bay, Niels Oluf

2015-01-01

The ingot forging process is numerically simulated applying both the Shima-Oyane porous plasticity model as a coupled damage model and the uncoupled normalized Cockcroft & Latham criterion. Four different cases including two different lower die angles (120º and 180º) and two different sizes of feed...... (400mm and 800mm) are analysed. Comparison of the simulation results with recommendations in literature on ingot forging, indicates the normalized Cockcroft & Latham damage criterion to be the most realistic of the two....

Manufacturing and material properties of ultralarge size forgings for advanced BWRPV

International Nuclear Information System (INIS)

Suzuki, Komei; Sato, Ikuo; Tsukada, Hisashi

1994-01-01

Ultralarge size forgings for the advanced boiling water reactor (ABWR) pressure vessel as represented by the bottom petal made from a 600ton ingot have been developed. The bottom petal is a larger wall thickness ring with 10 integrated nozzles inside and outside the ring. The outer diameter is 7.8m, the height is 1.8m and the wall thickness if 1.1m in the as-forged condition. A very high purity level of P≤qslant0.003% and S≤qslant0.003% can be obtained by the application of double-refining processes to all the molten steel. The forging shows a homogeneous chemical distribution, sound internal qualities and adequate impact properties.This paper summarizes the manufacturing technique and material properties of large size forgings such as the bottom petal, the shell with integrated skirt and the bottom dome. ((orig.))

Investigation of the influence of hybrid layers on the life time of hot forging dies

Directory of Open Access Journals (Sweden)

S. Legutko

2013-04-01

Full Text Available The paper deals with the issues related in the process of drop forging with special attention paid to the durability of forging tools. It presents the results of industrial investigation of the influence of hybrid layers on hot forging dies. The effectiveness of hybrid layers type nitrided layer/PVD coating applied for extending the life of forging tools whose working surfaces are exposed to such complex exploitation conditions as, among others, cyclically varying high thermal and mechanical loads, as well as intensive abrasion at raised temperature. The examination has been performed on a set of forging tools made of Unimax steel and intended for forging steel rings of gear box synchronizer in the factory FAS in Swarzedz (Poland.

“De-Casteing” India: How Dalit Women’s Rights Civil Society Organizations Tackle Caste Based Socio-Political & Religio-Cultural Challenges

OpenAIRE

Boateng, Godwin Festival; Matadamas, Erika; Sharma, Reesha; Winkler, Caroline

2014-01-01

Untouchability practices and caste based discrimination and injustices are under yet another siege after Ambedkar. In the past 50 years, India has seen tremendous mobilization by the lower caste members, specifically, vibrant women’s movements challenging the Indian caste society with the view of securing social change and abating caste based discrimination, violence and mistreatments. However, just like the era of Ambedkar, the anti-caste movements of today have the socio-political and relig...

Analysis of Filling and Stresses in the Hot Forging Process Depending on Flange Die Shapes

International Nuclear Information System (INIS)

Kim, Jun Hyoung; Kim, Cheol

2010-01-01

Hot closed-forging process and the die used for forming an automotive flange were analyzed from the viewpoints of heat transfer, grain-flow lines, and stresses to obtain a forged product without defects such as surface cracks, laps, cold shots, and partial filling. The forging process including up-set, pre-forging, final forging and pressing forces was investigated using finite element analysis. The influence of the preform die and the ratio of the heights of the upper die to lower die on the forging process and die were investigated and a die shape (10 .deg. for the preform die, and 1.5:1 ratio for the final die) suitable to achieve successful forging was determined on the basis of a parametric study. All parametric design requirements such as strength, full filling, and a load limit of 13,000 KN were satisfied for this newly developed flange die. New dies and flanges were fabricated and investigated. Defects such as partial filling and surface cracks were not observed

Manufacturing of ultra-large diameter 20 MnMoNi 5 5 steel forgings for reactor pressure vessels and their properties

International Nuclear Information System (INIS)

Onodera, S.; Kawaguchi, S.; Tsukada, H.; Moritani, H.; Suzuki, K.; Sato, I.

1985-01-01

As the structural material for RPV typical of increased dimensions, as set of ultra-large diameter steel forgings for a PHWR RPV is presented as outlined below. (1) Material designation: 20 MnMoNi 5 5 (similar to SA508, Cl.3) (2) Size of the forgings: flanges, 8.440 mm OD, a weight of 238 tons for shell flange; shells and torus, 7,920 mm OD, with large height, cover dome, 6,800 mm OD in chord and 460 mm thick; blank before formed to dome is ca. 8,000 mm OD. (3) Chemical composition: particular effort was made for minimizing the tramp elements as P, S, As, Sn, Sb, Cu. (4) Manufacturing, key points: steel making - combined refining and degassing in ladle; ingot making - largest size ingots, including 570 ton and 500 ton ingots; forging - special ''outside-the-press'' forging and forming techniques; heat treatment - prevention of H 2 flaking in normalizing and tempering and handling of the extra-large forgings at water quenching. (5) Metallurgical properties: sufficiently uniform carbon distributions in the forgings; a lowest possible content of hydrogen, non-metallic inclusions and oxygen. Mechanical properties: uniformity in tensile and toughness properties; flaws - only limited number of spots of UT indications under 2 mm EFG (EFS). (orig.)

High yttria ferritic ODS steels through powder forging

Science.gov (United States)

Kumar, Deepak; Prakash, Ujjwal; Dabhade, Vikram V.; Laha, K.; Sakthivel, T.

2017-05-01

Oxide dispersion strengthened (ODS) steels are being developed for future nuclear reactors. ODS Fe-18%Cr-2%W-0.2%Ti steels with 0, 0.35, 0.5, 1 and 1.5% Y2O3 (all compositions in weight%) dispersion were fabricated by mechanical alloying of elemental powders. The powders were placed in a mild steel can and forged in a stream of hydrogen gas at 1473 K. The steels were forged again to final density. The strength of ODS steel increased with yttria content. Though this was accompanied by a decrease in tensile elongation, all the steels showed significant ductility. The ductility in high yttria alloys may be attributed to improved inter-particle bonding between milled powders due to reduction of surface oxides by hydrogen. This may permit development of ODS steels with yttria contents higher than the conventional limit of 0.5%. It is suggested that powder forging is a promising route to fabricate ODS steels with high yttria contents and improved ductility.

76 FR 66996 - Agency Information Collection Activities; Submission for OMB Review; Comment Request; Forging...

Science.gov (United States)

2011-10-28

... for OMB Review; Comment Request; Forging Machines ACTION: Notice. SUMMARY: The Department of Labor... collection request (ICR) titled, ``Forging Machines,'' to the Office of Management and Budget (OMB) for....218, it is mandatory for covered employers to conduct and to document periodic inspections of forging...

30 CFR 816.47 - Hydrologic balance: Discharge structures.

Science.gov (United States)

2010-07-01

...-SURFACE MINING ACTIVITIES § 816.47 Hydrologic balance: Discharge structures. Discharge from sedimentation... shall be controlled, by energy dissipators, riprap channels, and other devices, where necessary, to reduce erosion, to prevent deepening or enlargement of stream channels, and to minimize disturbance of...

High-Performance All-Solid-State Na-S Battery Enabled by Casting-Annealing Technology.

Science.gov (United States)

Fan, Xiulin; Yue, Jie; Han, Fudong; Chen, Ji; Deng, Tao; Zhou, Xiuquan; Hou, Singyuk; Wang, Chunsheng

2018-04-24

Room-temperature all-solid-state Na-S batteries (ASNSBs) using sulfide solid electrolytes are a promising next-generation battery technology due to the high energy, enhanced safety, and earth abundant resources of both sodium and sulfur. Currently, the sulfide electrolyte ASNSBs are fabricated by a simple cold-pressing process leaving with high residential stress. Even worse, the large volume change of S/Na 2 S during charge/discharge cycles induces additional stress, seriously weakening the less-contacted interfaces among the solid electrolyte, active materials, and the electron conductive agent that are formed in the cold-pressing process. The high and continuous increase of the interface resistance hindered its practical application. Herein, we significantly reduce the interface resistance and eliminate the residential stress in Na 2 S cathodes by fabricating Na 2 S-Na 3 PS 4 -CMK-3 nanocomposites using melting-casting followed by stress-release annealing-precipitation process. The casting-annealing process guarantees the close contact between the Na 3 PS 4 solid electrolyte and the CMK-3 mesoporous carbon in mixed ionic/electronic conductive matrix, while the in situ precipitated Na 2 S active species from the solid electrolyte during the annealing process guarantees the interfacial contact among these three subcomponents without residential stress, which greatly reduces the interfacial resistance and enhances the electrochemical performance. The in situ synthesized Na 2 S-Na 3 PS 4 -CMK-3 composite cathode delivers a stable and highly reversible capacity of 810 mAh/g at 50 mA/g for 50 cycles at 60 °C. The present casting-annealing strategy should provide opportunities for the advancement of mechanically robust and high-performance next-generation ASNSBs.

Design and Analysis of a Forging Die for Manufacturing of Multiple Connecting Rods

Science.gov (United States)

Megharaj, C. E.; Nagaraj, P. M.; Jeelan Pasha, K.

2016-09-01

This paper demonstrates to utilize the hammer capacity by modifying the die design such that forging hammer can manufacture more than one connecting rod in a given forging cycle time. To modify the die design study is carried out to understand the parameters that are required for forging die design. By considering these parameters, forging die is designed using design modelling tool solid edge. This new design now can produce two connecting rods in same capacity hammer. The new design is required to validate by verifying complete filing of metal in die cavities without any defects in it. To verify this, analysis tool DEFORM 3D is used in this project. Before start of validation process it is require to convert 3D generated models in to. STL file format to import the models into the analysis tool DEFORM 3D. After importing these designs they are analysed for material flow into the cavities and energy required to produce two connecting rods in new forging die design. It is found that the forging die design is proper without any defects and also energy graph shows that the forging energy required to produce two connecting rods is within the limit of that hammer capacity. Implementation of this project increases the production of connecting rods by 200% in less than previous cycle time.

Development and efficiency assessment of process lubrication for hot forging

Science.gov (United States)

Kargin, S.; Artyukh, Viktor; Ignatovich, I.; Dikareva, Varvara

2017-10-01

The article considers innovative technologies in testing and production of process lubricants for hot bulk forging. There were developed new compositions of eco-friendly water-graphite process lubricants for hot extrusion and forging. New approaches to efficiency assessment of process lubricants are developed and described in the following article. Laboratory and field results are presented.

Development of strategies for saving energy by temperature reduction in warm forging processes

Science.gov (United States)

Varela, Sonia; Santos, Maite; Vadillo, Leire; Idoyaga, Zuriñe; Valbuena, Óscar

2016-10-01

This paper is associated to the European policy of increasing efficiency in raw material and energy usage. This policy becomes even more important in sectors consuming high amount of resources, like hot forging industry, where material costs sums up to 50% of component price and energy ones are continuously raising. The warm forging shows a clear potential of raw material reduction (near-net-shape components) and also of energy saving (forging temperature under 1000°C). However and due to the increment of the energy costs, new solutions are required by the forging sector in order to reduce the temperature below 900°C. The reported research is based on several approaches to reduce the forging temperature applied to a flanged shaft of the automotive sector as demonstration case. The developed investigations have included several aspects: raw material, process parameters, tools and dies behavior during forging process and also metallographic evaluation of the forged parts. This paper summarizes analysis of the ductility and the admissible forces of the flanged shaft material Ck45 in as-supplied state (as-rolled) and also in two additional heat treated states. Hot compression and tensile tests using a GLEEBLE 3800C Thermo mechanical simulator have been performed pursuing this target. In the same way, a coupled numerical model based on Finite Element Method (FEM) has been developed to predict the material flow, the forging loads and the stresses on the tools at lower temperature with the new heat treatments of the raw material. In order to validate the previous development, experimental trials at 850 °C and 750 °C were carried out in a mechanical press and the results were very promising.

Analysis of the thermo-mechanical deformations in a hot forging tool by numerical simulation

International Nuclear Information System (INIS)

L-Cancelos, R.; Varas, F.; Viéitez, I.; Martín, E.

2016-01-01

Although programs have been developed for the design of tools for hot forging, its design is still largely based on the experience of the tool maker. This obliges to build some test matrices and correct their errors to minimize distortions in the forged piece. This phase prior to mass production consumes time and material resources, which makes the final product more expensive. The forging tools are usually constituted by various parts made of different grades of steel, which in turn have different mechanical properties and therefore suffer different degrees of strain. Furthermore, the tools used in the hot forging are exposed to a thermal field that also induces strain or stress based on the degree of confinement of the piece. Therefore, the mechanical behaviour of the assembly is determined by the contact between the different pieces. The numerical simulation allows to analyse different configurations and anticipate possible defects before tool making, thus, reducing the costs of this preliminary phase. In order to improve the dimensional quality of the manufactured parts, the work presented here focuses on the application of a numerical model to a hot forging manufacturing process in order to predict the areas of the forging die subjected to large deformations. The thermo-mechanical model developed and implemented with free software (Code-Aster) includes the strains of thermal origin, strains during forge impact and contact effects. The numerical results are validated with experimental measurements in a tooling set that produces forged crankshafts for the automotive industry. The numerical results show good agreement with the experimental tests. Thereby, a very useful tool for the design of tooling sets for hot forging is achieved. (paper)

Analysis of the thermo-mechanical deformations in a hot forging tool by numerical simulation

Science.gov (United States)

L-Cancelos, R.; Varas, F.; Martín, E.; Viéitez, I.

2016-03-01

Although programs have been developed for the design of tools for hot forging, its design is still largely based on the experience of the tool maker. This obliges to build some test matrices and correct their errors to minimize distortions in the forged piece. This phase prior to mass production consumes time and material resources, which makes the final product more expensive. The forging tools are usually constituted by various parts made of different grades of steel, which in turn have different mechanical properties and therefore suffer different degrees of strain. Furthermore, the tools used in the hot forging are exposed to a thermal field that also induces strain or stress based on the degree of confinement of the piece. Therefore, the mechanical behaviour of the assembly is determined by the contact between the different pieces. The numerical simulation allows to analyse different configurations and anticipate possible defects before tool making, thus, reducing the costs of this preliminary phase. In order to improve the dimensional quality of the manufactured parts, the work presented here focuses on the application of a numerical model to a hot forging manufacturing process in order to predict the areas of the forging die subjected to large deformations. The thermo-mechanical model developed and implemented with free software (Code-Aster) includes the strains of thermal origin, strains during forge impact and contact effects. The numerical results are validated with experimental measurements in a tooling set that produces forged crankshafts for the automotive industry. The numerical results show good agreement with the experimental tests. Thereby, a very useful tool for the design of tooling sets for hot forging is achieved.

The structural and phase state formed in construction titanium alloy by radial forging

Energy Technology Data Exchange (ETDEWEB)

Shlyakhova, Galina V.; Danilov, Vladimir I.; Orlova, Dina V.; Zuev, Lev B. [Institute of Strength Physics and Materials Science SB RAS, Tomsk (Russian Federation); Zavodchikov, Aleksandr S. [Perm State Technical University, Perm (Russian Federation)

2011-07-01

The feasibility of rod manufacture from construction titanium alloy using radial forging on a high duty machine SXK16 was investigated. The investigations were carried on for titanium rod samples using the methods of metallography, electron transmission microscophy and X-ray analysis. The results obtained are described herein. It is found that radial forging results in the formation of homogeneous fine-grained structure.Using radial forging process, high-quality items are produced. As-worked material has submicrocrystalline globular structure and an optimal α:β phase ratio. Besides, the technology is more cost-effective relative to conventional flow charts. Key words: forging, titanium alloy, fine-grain structure, substructure, pore size.

Controlled austempering of hammer forgings aimed at pseudo normalized microstructure directly after deformation

Directory of Open Access Journals (Sweden)

P. Skubisz

2017-01-01

Full Text Available The study concerns cost-effective realization of controlled thermomechanical processing (CTMP of medium-carbon and HSLA steel aimed at producing microstructure and properties equivalent to normalized condition directly after forging. The results of theoretical and physical modeling of hot forging with subsequent heat treating adopted for industrial realization in continuous manner were verified in semi-industrial conditions of a forge plant.

Research on Energy-Saving Production Scheduling Based on a Clustering Algorithm for a Forging Enterprise

Directory of Open Access Journals (Sweden)

Yifei Tong

2016-02-01

Full Text Available Energy efficiency is a buzzword of the 21st century. With the ever growing need for energy efficient and low-carbon production, it is a big challenge for high energy-consumption enterprises to reduce their energy consumption. To this aim, a forging enterprise, DVR (the abbreviation of a forging enterprise, is researched. Firstly, an investigation into the production processes of DVR is given as well as an analysis of forging production. Then, the energy-saving forging scheduling is decomposed into two sub-problems. One is for cutting and machining scheduling, which is similar to traditional machining scheduling. The other one is for forging and heat treatment scheduling. Thirdly, former forging production scheduling is presented and solved based on an improved genetic algorithm. Fourthly, the latter is discussed in detail, followed by proposed dynamic clustering and stacking combination optimization. The proposed stacking optimization requires making the gross weight of forgings as close to the maximum batch capacity as possible. The above research can help reduce the heating times, and increase furnace utilization with high energy efficiency and low carbon emissions.

The Marine Guanidine Alkaloid Crambescidin 816 Induces Calcium Influx and Cytotoxicity in Primary Cultures of Cortical Neurons through Glutamate Receptors.

Science.gov (United States)

Mendez, Aida G; Juncal, Andrea Boente; Silva, Siguara B L; Thomas, Olivier P; Martín Vázquez, Víctor; Alfonso, Amparo; Vieytes, Mercedes R; Vale, Carmen; Botana, Luís M

2017-07-19

Crambescidin 816 is a guanidine alkaloid produced by the sponge Crambe crambe with known antitumoral activity. While the information describing the effects of this alkaloid in central neurons is scarce, Cramb816 is known to block voltage dependent calcium channels being selective for L-type channels. Moreover, Cramb816 reduced neuronal viability through an unknown mechanism. Here, we aimed to describe the toxic activity of Cramb816 in cortical neurons. Since calcium influx is considered the main mechanism responsible for neuronal cell death, the effects of Cramb816 in the cytosolic calcium concentration of cortical neurons were studied. The alkaloid decreased neuronal viability and induced a dose-dependent increase in cytosolic calcium that was also related to the presence of calcium in the extracellular media. The increase in calcium influx was age dependent, being higher in younger neurons. Moreover, this effect was prevented by glutamate receptor antagonists, which did not fully block the cytotoxic effect of Cramb816 after 24 h of treatment but completely prevented Cramb816 cytotoxicity after 10 min exposure. Therefore, the findings presented herein provide new insights into the cytotoxic effect of Cramb816 in cortical neurons.

46 CFR 176.816 - Miscellaneous systems and equipment.

Science.gov (United States)

2010-10-01

... 100 GROSS TONS) INSPECTION AND CERTIFICATION Material Inspections § 176.816 Miscellaneous systems and equipment. At each initial and subsequent inspection for certification the owner or managing operator shall be prepared to test and make available for inspection all items in the ship's outfit, such as ground...

Improvement of mechanical properties of zirconia-toughened alumina by sinter forging

NARCIS (Netherlands)

He, Y.; Winnubst, Aloysius J.A.; Verweij, H.; Burggraaf, Anthonie; Burggraaf, A.J.

1994-01-01

ZTA powder with a composition of 85 wt% alumina/15 wt% zirconia was prepared by a gel precipitation method. Sinter forging was performed with this powder to enhance the mechanical properties of ZTA materials. The influence of processing flaws on mechanical properties of sinter forged materials and

Precipitation-hardening stainless steel bars, shapes, and forgings (ASME SA-564 with additional requirements)

International Nuclear Information System (INIS)

1975-05-01

A standard prescribing requirements for precipitation-hardening stainless steel bars, shapes, and forgings (ASME SA-564 with additional requirements) for nuclear and associated applications is presented. This standard supersedes RDT M 7-6T, dated January 1974. (U.S.)

Comparative Thermal Aging Effects on PM-HIP and Forged Inconel 690

Science.gov (United States)

Bullens, Alexander L.; Bautista, Esteban; Jaye, Elizabeth H.; Vas, Nathaniel L.; Cain, Nathan B.; Mao, Keyou; Gandy, David W.; Wharry, Janelle P.

2018-03-01

This study compares thermal aging effects in Inconel 690 (IN690) produced by forging and powder metallurgy with hot isostatic pressing (PM-HIP). Isothermal aging is carried out over 400-800°C for up to 1000 h and then metallography and nanoindentation are utilized to relate grain microstructure with hardness and yield strength. The PM-HIP IN690 maintains a constant grain size through all aging conditions, while the forged IN690 exhibits limited grain growth at the highest aging temperature and longest aging time. The PM-HIP IN690 exhibits comparable mechanical integrity as the forged material throughout aging: hardness and yield strength are unchanged with 100 h aging, but increase after 1000 h aging at all temperatures. In both the PM-HIP and forged IN690, the Hall-Petch relationship for Ni-based superalloys predicts yield strength for 0-100 h aged specimens, but underestimates yield strength in the 1000 h aged specimens because of thermally induced precipitation.

Disintegration of the net-shaped grain-boundary phase by multi-directional forging and its influence on the microstructure and properties of Cu-Ni-Si alloy

Science.gov (United States)

Zhang, Jinlong; Lu, Zhenlin; Zhao, Yuntao; Jia, Lei; Xie, Hui; Tao, Shiping

2017-09-01

Cu-Ni-Si alloys with 90% Cu content and Ni to Si ratios of 5:1 were fabricated by fusion casting, and severe plastic deformation of the Cu-Ni-Si alloy was carried out by multi-direction forging (MDF). The results showed that the as-cast and homogenized Cu-Ni-Si alloys consisted of three phases, namely the matrix phase α-Cu (Ni, Si), the reticular grain boundary phase Ni31Si12 and the precipitated phase Ni2Si. MDF significantly destroyed the net-shaped grain boundary phase, the Ni31Si12 phase and refined the grain size of the Cu matrix, and also resulted in the dissolving of Ni2Si precipitates into the Cu matrix. The effect of MDF on the conductivity of the solid solution Cu-Ni-Si alloy was very significant, with an average increase of 165.16%, and the hardness of the Cu-Ni-Si alloy also increased obviously.

Geologic setting of the proposed Fallon FORGE Site, Nevada: Suitability for EGS research and development

Science.gov (United States)

Faulds, James E.; Blankenship, Douglas; Hinz, Nicholas H.; Sabin, Andrew; Nordquist, Josh; Hickman, Stephen H.; Glen, Jonathan; Kennedy, Mack; Siler, Drew; Robinson-Tait, Ann; Williams, Colin F.; Drakos, Peter; Calvin, Wendy M.

2015-01-01

The proposed Fallon FORGE site lies within and adjacent to the Naval Air Station Fallon (NASF) directly southeast of the town of Fallon, Nevada, within the large basin of the Carson Sink in west-central Nevada. The site is located on two parcels that include land owned by the NASF and leased and owned by Ormat Nevada, Inc. The Carson Sink in the vicinity of the Fallon site is covered by Quaternary deposits, including alluvial fan, eolian, and lacustrine sediments. Four wells penetrate the entire Neogene section and bottom in Mesozoic basement. Late Miocene to Quaternary basin-fill sediments are 0.5 to >1 km thick and overlie Oligocene-Miocene volcanic and lesser sedimentary rocks. The volcanic section is 0.5 to 1.0 km thick and dominated by Miocene mafic lavas. The Neogene section rests nonconformably on heterogeneous Mesozoic basement, which consists of Triassic-Jurassic metamorphic rocks intruded by Cretaceous granitic plutons. The structural framework is dominated by a gently west-tilted half graben cut by moderately to steeply dipping N- to NNEstriking normal faults that dip both east and west. Quaternary faults have not been observed within the proposed FORGE site. Fallon was selected for a potential FORGE site due to its extensional tectonic setting, abundance of available data, existing infrastructure, and documented temperatures, permeability, and lithologic composition of potential reservoirs that fall within the ranges specified by DOE for FORGE. Since the early 1970s, more than 45 wells have been drilled for geothermal exploration within the area. Four exploration wells within the FORGE site are available for use in the project. Several additional wells are available for monitoring outside the central FORGE site within the NASF and Ormat lease area, including numerous temperature gradient holes. There is an existing, ten-station micro-seismic earthquake (MEQ) array that has been collecting data since 2001; the MEQ array can be expanded to encompass the

Manufacturing and properties of closure head forging integrated with flange for PWR reactor pressure vessel

International Nuclear Information System (INIS)

Tomoharu Sasaki; Iku Kurihara; Etsuo Murai; Yasuhiko Tanaka; Koumei Suzuki

2003-01-01

Closure head forging (SA508, Gr.3 Cl.1) integrated with flange for PWR reactor pressure vessel has been developed. This is intended to enhance structural integrity of closure head resulted in elimination of ISI, by eliminating weld joint between closure head and flange in the conventional design. Manufacturing procedures have been established so that homogeneity and isotropy of the material properties can be assured in the closure head forging integrated with flange. Acceptance tensile and impact test specimens are taken and tested regarding the closure head forging integrated with flange as very thick and complex forgings. This paper describes the manufacturing technologies and material properties of the closure head forging integrated with flange. (orig.)

Design and economic justification of group blanks application

Directory of Open Access Journals (Sweden)

V. Todić

2012-04-01

Full Text Available Within the manufacturing process planning, blanks are either selected or designed, respectively forms of input material for the manufacture of products. Reviewed in this paper are three types of group blanks: group castings, group forgings manufactured by closed die forging and free forging, and group blanks manufactured by pressing melted metal in casts. The paper also presents requisites for design and evaluation of economic justification of group blanks application.

Design of the Driving and Clamp Rotation Hydraulic Control System for the Heavy Load Forging Manipulator

Directory of Open Access Journals (Sweden)

Li Geqiang

2015-01-01

Full Text Available The manipulator was equipped with full hydraulic drive. We designed the hydraulic systems for the driving and clamping rotation. We used a fuzzy PID control strategy to design the electro-hydraulic proportional control system. We built a united simulation model based on the co-simulation of MATLAB/Simulink and AMEsim. A mathematical model of the system was also established. We did separate simulations of the system’s dynamic characteristics for fast forging and normal forging working conditions. The parameters were optimized. The field test shows that the steady-state error of the hydraulic system is small and the system response is fast. The system’s rapid response speed, high precision, and stability under heavy load were realized.

Fatigue in cold-forging dies: Tool life analysis

DEFF Research Database (Denmark)

Skov-Hansen, P.; Bay, Niels; Grønbæk, J.

1999-01-01

In the present investigation it is shown how the tool life of heavily loaded cold-forging dies can be predicted. Low-cycle fatigue and fatigue crack growth testing of the tool materials are used in combination with finite element modelling to obtain predictions of tool lives. In the models...... the number of forming cycles is calculated first to crack initiation and then during crack growth to fatal failure. An investigation of a critical die insert in an industrial cold-forging tool as regards the influence of notch radius, the amount and method of pre-stressing and the selected tool material...

Room and high temperature deformation behaviour of a forged Fe–15Al–5Nb alloy with a reinforcing dispersion of equiaxed Laves phase particles

International Nuclear Information System (INIS)

Morris, D.G.; Muñoz-Morris, M.A.

2012-01-01

Highlights: ► Forged Fe–15%Al–5%Nb has a composite structure of soft matrix with equiaxed Laves phase particles. ► The material shows good strength with excellent ductility at room temperature. ► Good creep strength is maintained to 700 °C. ► The coarse composite microstructure ensures good long term stability at high temperatures. ► High temperature strength depends on load sharing between phases and microstructural refinement. - Abstract: The cast-in network of continuous Laves phase in a Fe–15%Al–5%Nb alloy has been converted to a dispersion of coarse Laves phase particles by high temperature forging, and the room temperature and high temperature deformation behaviour examined. The material shows good room temperature tensile ductility and good creep strength at temperatures up to 700 °C. The good high temperature strength is explained by the refinement of substructure by the dispersion of Laves phase particles and load and strain partitioning between the stiff and hard phase and the softer matrix. The relatively coarse microstructure is expected to be highly stable against coarsening at high temperatures, which should allow retention of creep properties even for long exposure times.

The FORGE (Fate Of Repository Gases) pan European project

International Nuclear Information System (INIS)

Shaw, Richard

2010-01-01

-scaling allowing the optimisation of concepts through detailed scenario analysis. The FORGE partners are committed to training and CPD through a broad portfolio of training opportunities and initiatives which form a significant part of the project. The FORGE project is divided into five work packages. - WP 1 Treatment of gas in performance assessment; - WP 2 Gas generation; - WP 3 Engineered barrier systems; - WP 4 Disturbed host rock formations; - WP 5 Undisturbed host rock formations. There are modelling activities in all of these work packages and a Modelling Co-ordinator specifically to overview all aspects of this work thus ensuring appropriate focus, facilitating the cross-flow of ideas and concepts between WP's is an integral part of the project. This will also ensure best practice is shared between all participants and teams. Further details on the FORGE project and its outcomes can be accessed at www.FORGEproject.org. (author)

Design and verification of thermomechanical parameters of P/M Ti6Al4V alloy forging

Energy Technology Data Exchange (ETDEWEB)

Wojtaszek, Marek, E-mail: mwojtasz@metal.agh.edu.pl; Śleboda, Tomasz

2014-12-05

Highlights: • Thermomechanical parameters of P/M Ti6Al4V alloy processing were determined. • The use of the mixture of elemental powders allows reducing manufacturing costs. • Numerical modelling allowed to elaborate favourable parameters of forging. • The industrial trials of hot forging of P/M Ti6Al4V alloy were successful. - Abstract: This work is focused on the design of technology of forging high-quality Ti6Al4V alloy by means of powder metallurgy methods. A mixture of elemental powders, with the chemical composition of that of Ti6Al4V alloy, was used as a starting material for the investigation. Powder mixtures were fully densified by hot compaction under precisely controlled conditions. The mechanical properties of the obtained compacts were examined. The mechanical behaviour of the investigated alloy powder compacts was evaluated by compression test under various thermomechanical conditions using Gleeble simulator. The microstructure of powder compacts as well as P/M alloy samples deformed in compression tests was examined. All data obtained from the experimental tests were applied as boundary conditions for numerical simulation of forging of selected forgings. Basing on the results of both plastometric tests and simulations, thermomechanical parameters of the investigated alloy forging were determined. Designed parameters of forging technology were verified by forging trials performed in industrial conditions. The quality of the obtained forgings was examined by means of computed tomography.

Design and verification of thermomechanical parameters of P/M Ti6Al4V alloy forging

International Nuclear Information System (INIS)

Wojtaszek, Marek; Śleboda, Tomasz

2014-01-01

Highlights: • Thermomechanical parameters of P/M Ti6Al4V alloy processing were determined. • The use of the mixture of elemental powders allows reducing manufacturing costs. • Numerical modelling allowed to elaborate favourable parameters of forging. • The industrial trials of hot forging of P/M Ti6Al4V alloy were successful. - Abstract: This work is focused on the design of technology of forging high-quality Ti6Al4V alloy by means of powder metallurgy methods. A mixture of elemental powders, with the chemical composition of that of Ti6Al4V alloy, was used as a starting material for the investigation. Powder mixtures were fully densified by hot compaction under precisely controlled conditions. The mechanical properties of the obtained compacts were examined. The mechanical behaviour of the investigated alloy powder compacts was evaluated by compression test under various thermomechanical conditions using Gleeble simulator. The microstructure of powder compacts as well as P/M alloy samples deformed in compression tests was examined. All data obtained from the experimental tests were applied as boundary conditions for numerical simulation of forging of selected forgings. Basing on the results of both plastometric tests and simulations, thermomechanical parameters of the investigated alloy forging were determined. Designed parameters of forging technology were verified by forging trials performed in industrial conditions. The quality of the obtained forgings was examined by means of computed tomography

Manufacturing of large and integral-type steel forgings for nuclear steam supply system components

International Nuclear Information System (INIS)

Kawaguchi, S.; Tsukada, H.; Suzuki, K.; Sato, I.; Onodera, S.

1986-01-01

Forgings for the reactor pressure vessel (RPV) of the pressurized heavy water reactor (PHWR) 700 MWe, which is composed of seven major parts and nozzles totaling about 965 tons, were successfully developed. These forgings are: 1. Flanges: an outside diameter of 8440 mm and a weight of 238 tons max, requiring an ingot of 570 tons. 2. Shells and torus: an outside diameter of about 8000 mm with large height. 3. Cover dome: a diameter of 6800 mm and a thickness of 460 mm, requiring a blank forging before forming of 8000 mm in diameter and 550 m thick. The material designation is 20Mn-Mo-Ni 5 5 (equivalent to SA508, Class 3). In this paper, the manufacturing of and the properties of such large and integral forgings are discussed, including an overview of manufacturing processes for ultralarge-sized forgings over the last two decades

New design of process for cold forging to improve multi-stage gas fitting

Directory of Open Access Journals (Sweden)

Han-Sung Huang

2016-04-01

Full Text Available This work develops a process that solves the problem of the formation of cracks inside forged gas fittings in the cold forging process that arises from poor forging process design. DEFORM-3D forming software was utilized, and macroscopic experiments with optical microscopy and scanning electron microscopy were conducted to investigate the processed structures and the distribution therein of metal flow lines, and to find the internal micro-cracks to determine whether the cold forging process is reasonable. Analytical results herein demonstrate that the stress and strain inside the gas fitting can be elucidated using metal forming software. Together with experimental results, they demonstrate that a concentration of stress damages the workpiece in the forming process. Moreover, as metal flow lines become narrower, the workpiece becomes more easily damaged. Consequently, the improved cold forging process that is described in this work should be utilized to reduce the occurrence of fine cracks and defects. Planning for proper die design and production, increasing the quality of products, and reducing the number of defective products promote industrial competitiveness.

Managing Tensions And Forging Creative Synergies Between ...

African Journals Online (AJOL)

Managing Tensions And Forging Creative Synergies Between Indigenous And Modern Settlement Planning Concepts And Practices: Lessons For The Design And Planning For Sustainable Settlements And Built-Forms In Southern Africa.

Casting characteristics of Al-Mg alloy 535 cast in permanent moulds

International Nuclear Information System (INIS)

Fasoyinu, F.A.; Thomson, J.; Cousineau, D.; Castles, T.; Sahoo, M.

2002-01-01

Aluminum alloy 535 could be used for automotive and marine applications because of its good corrosion resistance against mild alkaline and salt spray exposure. The majority of components from this alloy are usually produced by sand casting because it is prone to hot shortness and has poor fluidity when poured in permanent moulds. In an attempt to improve its castability in permanent moulds, casting characteristics such as casting fluidity and hot tear resistance have been studied. In addition, the effectiveness of titanium, boron, scandium, zirconium and a combination of selected elements from this group as grain refiners were evaluated. It s shown that alloy 535 exhibits good casting fluidity when poured with adequate metal superheat and that there is significant improvement in hot tear resistance following grain refinement. (author)

Crambescidin 816 induces calcium influx though glutamate receptors in primary cultures of cortical neurons

Directory of Open Access Journals (Sweden)

Víctor Martín Vázquez

2014-06-01

In summary, our data suggest that the cytotoxic effect of 10 μM Cramb816 in cortical neurons may be related to an increase in the cytosolic calcium concentration elicited by the toxin, which is shown to be mediated by glutamate receptor activation. Further studies analyzing the effect of glutamate receptor blockers on the cytotoxic effect of Cramb816 are needed to confirm this hypothesis.

Prompt photon production in $\\sqrt{s_\\mathrm{NN}} = 8.16$ TeV $p$+Pb collisions with ATLAS

CERN Document Server

The ATLAS collaboration

2017-01-01

The inclusive production cross-section for isolated, prompt photons in $p$+Pb collisions at $\\sqrt{s_\\mathrm{NN}} = 8.16$~TeV is studied with the ATLAS detector at the LHC using a data set with an integrated luminosity of $162$~nb$^{-1}$. The cross-section is measured as a function of photon transverse energy from $25$ to $500$~GeV and over nearly five units of pseudorapidity, including kinematic regions in both the downstream proton-- and nucleus--going directions. Results are reported in the nucleon--nucleon center of mass collision frame. The nuclear modification factor $R_{p\\mathrm{Pb}}$ is reported using a extrapolation, derived using NLO pQCD, of a previous measurement of photon production in $pp$ collisions at $8$~TeV. The cross-sections and $R_{p\\mathrm{Pb}}$ values are compared to the results of a next-to-leading order perturbative QCD calculation and to the expectations based on a picture of the energy loss of partons incoming to the hard scattering. At large nucleus-going rapidity, the cross-sectio...

Distribution of Microstructure and Vickers Hardness in Spur Bevel Gear Formed by Cold Rotary Forging

Directory of Open Access Journals (Sweden)

Wuhao Zhuang

2014-11-01

Full Text Available Cold rotary forging is a novel metal forming technology which is widely used to produce the high performance gears. Investigating the microstructure and mechanical property of cold rotary forged gears has a great significance in improving their service performance. In this study, the grain morphology in different regions of the spur bevel gear which is processed by cold rotary forging is presented. And the distribution regulars of the grain deformation and Vickers hardness in the transverse and axial sections of the gear tooth are studied experimentally. A three-dimensional rigid-plastic FE model is developed to simulate the cold rotary forging process of a spur bevel gear under the DEFORM-3D software environment. The variation of effective strain in the spur bevel gear has been investigated so as to explain the distribution regulars of the microstructure and Vickers hardness. The results of this research thoroughly reveal the inhomogeneous deformation mechanisms in cold rotary forging of spur bevel gears and provide valuable guidelines for improving the performance of cold rotary forged spur bevel gears.

Metallurgy of steels for PWR pressure vessels

International Nuclear Information System (INIS)

Kepka, M.; Mocek, J.; Barackova, L.

1980-01-01

A survey and the chemical compositions are presented of reactor pressure vessel steels. The metallurgy is described of steel making for pressure vessels in Japan and the USSR. Both acidic and alkaline open-hearth steel is used for the manufacture of ingots. The leading world manufacturers of forging ingots for pressure vessels, however, exclusively use electric steel. Vacuum casting techniques are exclusively used. Experience is shown gained with the introduction of the manufacture of forging ingots for pressure vessels at SKODA, Plzen. The metallurgical procedure was tested utilizing alkaline open hearths, electric arc furnaces and facilities for vacuum casting of steel. Pure charge raw materials should be used for securing high steel purity. Prior to forging pressure vessel rings, not only should sufficiently big bottoms and heads be removed but also the ingot middle part should be scrapped showing higher contents of impurities and nonhomogeneous structure. (B.S.)

76 FR 30200 - Forging Machines; Extension of the Office of Management and Budget's (OMB) Approval of...

Science.gov (United States)

2011-05-24

...] Forging Machines; Extension of the Office of Management and Budget's (OMB) Approval of Information... extend OMB approval of the information collection requirements contained in the Forging Machines Standard... to reduce employees' risk of death or serious injury by ensuring that forging machines used by them...

Effect of Forging Allowance Value on the Power Consumption of Machining Process

Directory of Open Access Journals (Sweden)

L. D. Mal'kova

2015-01-01

Full Text Available The paper aim is to develop and study possible energy-efficiency measures for machined forgings drawing on analysis of the impact of the allowance for machining and its scatter.The most sophisticated option to take into consideration the effect of the cut depth is the work-piece machining in which the forging allowance value results from the blank production.Research of power consumption was conducted for turning the cylindrical surface of 144 mm length and  1,5 33 0,5   diameter on forgings of the work-pieces "screw of steering control" made from steel 60PP. A radial dimension allowance at said cylindrical surface at six points of the five sections was sized to assess the allowance value dispersion. The size of the sample measurements at the control points was n = 600. Statistic processing has shown normal law of distribution and sample homogeneity.To analyze the results of experiments was calculated a range of allowances for this workpiece. Calculated minimum and maximum allowance per one side for rough lathing were, respectively, 0.905 mm and 1.905mm. It was found that 77% points under control lie in calculated range of allowance values. And there are no points out of the range on lesser side that proves a lack of rejects; but there are points out of the range on the bigger side, that will require additional costs for machining the specified surface, including the cost of electricity.There were three power consumption calculations based on factory- recommended duty: for processing the entire sample of forgings with an average allowance, for machining forgings allowances of which are within the recommended design range of allowance, and for processing the entire sample of forgings with a minimum value of allowance.It was found that elimination of allowance values which are outside the recommended range enables to reduce the power consumption, at least, by 6%, and the overall power consumption for processing the measured forgings

Materials for Advanced Ultrasupercritical Steam Turbines Task 4: Cast Superalloy Development

Energy Technology Data Exchange (ETDEWEB)

Thangirala, Mani

2015-09-30

The Steam Turbine critical stationary structural components are high integrity Large Shell and Valve Casing heavy section Castings, containing high temperature steam under high pressures. Hence to support the development of advanced materials technology for use in an AUSC steam turbine capable of operating with steam conditions of 760°C (1400°F) and 35 Mpa (5000 psia), Casting alloy selection and evaluation of mechanical, metallurgical properties and castability with robust manufacturing methods are mandated. Alloy down select from Phase 1 based on producability criteria and creep rupture properties tested by NETL-Albany and ORNL directed the consortium to investigate cast properties of Haynes 282 and Haynes 263. The goals of Task 4 in Phase 2 are to understand a broader range of mechanical properties, the impact of manufacturing variables on those properties. Scale up the size of heats to production levels to facilitate the understanding of the impact of heat and component weight, on metallurgical and mechanical behavior. GE Power & Water Materials and Processes Engineering for the Phase 2, Task 4.0 Castings work, systematically designed and executed casting material property evaluation, multiple test programs. Starting from 15 lbs. cylinder castings to world’s first 17,000 lbs. poured weight, heavy section large steam turbine partial valve Haynes 282 super alloy casting. This has demonstrated scalability of the material for steam Turbine applications. Activities under Task 4.0, Investigated and characterized various mechanical properties of Cast Haynes 282 and Cast Nimonic 263. The development stages involved were: 1) Small Cast Evaluation: 4 inch diam. Haynes 282 and Nimonic 263 Cylinders. This provided effects of liquidus super heat range and first baseline mechanical data on cast versions of conventional vacuum re-melted and forged Ni based super alloys. 2) Step block castings of 300 lbs. and 600 lbs. Haynes 282 from 2 foundry heats were evaluated which

Computer Οptimization of Geometric Form of Tool and Preform for Closed-die Forging of Compressor Blade Simulator

Directory of Open Access Journals (Sweden)

A. V. Botkin

2014-07-01

Full Text Available Using the software package DEFORM 3D when developing technology of isothermal forging workpiece blades it is possible to reduce the pre-production time, to improve the quality of forgings and increase lifetime of forging dies. Computer modeling allows to predict the formation of such defects during forging as notches and wrinkles, underfilling of die impression, to estimate tool loads. Preform shape and angular position of the blade simulator were optimized in order to minimize the lateral forces generated during the forging operation.

Manufacture of large monoblock LP rotor forgings and their quality

International Nuclear Information System (INIS)

Suzuki, Akira; Kinoshita, Shushi; Kohno, Masayoshi; Miyakawa, Mutsuhiro; Kikuchi, Hideo

1986-01-01

This paper describes the manufacturing and the quality of large monoblock low pressure rotors forged from 360 ton and 420 ton ingots. To obtain good and homogenous mechanical properties throughout a rotor, a computer was used to determine the heat treatment conditions. It was found that the technique was very effective at predicting mechanical properties of a monoblock rotor. Mechanical properties including the fracture toughness and fatigue crack propagation characteristics of monoblock rotor forgings proved satisfactory. (author)

Identification of forged Bank of England £20 banknotes using IR spectroscopy.

Science.gov (United States)

Sonnex, Emily; Almond, Matthew J; Baum, John V; Bond, John W

2014-01-24

Bank of England notes of £20 denomination have been studied using infrared spectroscopy in order to generate a method to identify forged notes. An aim of this work was to develop a non-destructive method so that a small, compact Fourier transform infrared spectrometer (FT-IR) instrument could be used by bank workers, police departments or others such as shop assistants to identify forged notes in a non-lab setting. The ease of use of the instrument is the key to this method, as well as the relatively low cost. The presence of a peak at 1400 cm(-1) arising from νasym (CO3(2-)) from the blank paper section of a forged note proved to be a successful indicator of the note's illegality for the notes that we studied. Moreover, differences between the spectra of forged and genuine £20 notes were observed in the ν(OH) (ca. 3500 cm(-1)), ν(C-H) (ca. 2900 cm(-1)) and ν(C=O) (ca. 1750 cm(-1)) regions of the IR spectrum recorded for the polymer film covering the holographic strip. In cases where these simple tests fail, we have shown how an infrared microscope can be used to further differentiate genuine and forged banknotes by producing infrared maps of selected areas of the note contrasting inks with background paper. Copyright © 2013 Elsevier B.V. All rights reserved.

Identification of forged Bank of England £20 banknotes using IR spectroscopy

Science.gov (United States)

Sonnex, Emily; Almond, Matthew J.; Baum, John V.; Bond, John W.

2014-01-01

Bank of England notes of £20 denomination have been studied using infrared spectroscopy in order to generate a method to identify forged notes. An aim of this work was to develop a non-destructive method so that a small, compact Fourier transform infrared spectrometer (FT-IR) instrument could be used by bank workers, police departments or others such as shop assistants to identify forged notes in a non-lab setting. The ease of use of the instrument is the key to this method, as well as the relatively low cost. The presence of a peak at 1400 cm-1 arising from νasym (CO32-) from the blank paper section of a forged note proved to be a successful indicator of the note's illegality for the notes that we studied. Moreover, differences between the spectra of forged and genuine £20 notes were observed in the ν(OH) (ca. 3500 cm-1), ν(Csbnd H) (ca. 2900 cm-1) and ν(Cdbnd O) (ca. 1750 cm-1) regions of the IR spectrum recorded for the polymer film covering the holographic strip. In cases where these simple tests fail, we have shown how an infrared microscope can be used to further differentiate genuine and forged banknotes by producing infrared maps of selected areas of the note contrasting inks with background paper.

Intersubjective decision-making for computer-aided forging technology design

Science.gov (United States)

Kanyukov, S. I.; Konovalov, A. V.; Muizemnek, O. Yu.

2017-12-01

We propose a concept of intersubjective decision-making for problems of open-die forging technology design. The intersubjective decisions are chosen from a set of feasible decisions using the fundamentals of the decision-making theory in fuzzy environment according to the Bellman-Zadeh scheme. We consider the formalization of subjective goals and the choice of membership functions for the decisions depending on subjective goals. We study the arrangement of these functions into an intersubjective membership function. The function is constructed for a resulting decision, which is chosen from a set of feasible decisions. The choice of the final intersubjective decision is discussed. All the issues are exemplified by a specific technological problem. The considered concept of solving technological problems under conditions of fuzzy goals allows one to choose the most efficient decisions from a set of feasible ones. These decisions correspond to the stated goals. The concept allows one to reduce human participation in automated design. This concept can be used to develop algorithms and design programs for forging numerous types of forged parts.

The relationship between UT reported size and actual size of the defects in rotor forgings

International Nuclear Information System (INIS)

Seong, Un Hak; Kim, Jeong Tae; Park, Yun Sik

2003-01-01

In order to evaluate the reliability of rotor forgings, it is very important to know the actual size of the defects in the rotor forgings. The determination of the defect size requires the accurate non-destructive measurement. However, there may be some differences between the reported size with the ultrasonic non-destructive testing method and the actual size of defects. These differences may be a severe cause of errors in evaluation of rotor forgings. So, the calculated size with 'Master Curve' considering safety factor, which is usually larger than the reported size, has been used in evaluation of rotor forgings. The relation between the EFBH (Equivalent Flat Bottom Hole) size measured by non-destructive method and the actual size by destructive method in many rotors manufactured at Doosan was investigated. In this investigation 'Master Curve' compensating the differences between UT reported size and actual size of defects in our rotor forgings was obtainable. The applicability of this 'Master Curve' as a way of calculating the actual defect size was also investigated. For the evaluation of rotor forgings, it is expected that this 'Master Curve' may be used to determine the accurate actual size of defects.

The relationship between UT reported size and actual size of the defects in rotor forgings

International Nuclear Information System (INIS)

Seong, Un Hak; Kim, Jeong Tae; Park, Yun Sik

2003-01-01

In order to evaluate the reliability of rotor forgings, it is very important to know the actual size of the defects in the rotor forgings. The determination of the defect size requires the accurate non-destructive measurement. However, there may be some difference between the reported size with ultrasonic non-destructive testing method and the actual size of defects. These differences may be a severe cause of errors in evaluation of rotor forgings. So, the calculated size with 'Master Curve' considering safety factor, which is usually larger than the reported size, has been used in evaluation of rotor forgings. The relation between the EFBH (Equivalent Flat Bottom Hole) size measured by non-destructive method and the actual size by destructive method in many rotors manufactured at Doosan was investigated. In this investigation, 'Master Curve' compensating the differences between UT reported size and actual size of defects in our rotor forgings was obtainable. The applicability of this 'Master Curve' as a way of calculating the actual defect size was also investigated. For the evaluation of rotor forgings, it is expected that this 'Master Curve' may be used to determine the accurate actual size of defects.

Fabrication and properties of Y-Ba-Cu-O high Tc superconductor by upset-forging method

International Nuclear Information System (INIS)

Chang, Ho Jung; Kang, Kae Myung; Song, Jin Tae

1990-01-01

YBa 2 Cu 3 O 7-x oxide superconductors was fabricated by sintering process and upset-forging method, respectively, and microstructures and conduction properties were compared. There was no difference in crystal structure the (001) x-ray reflection presumably due to preferred crystal orientation of the YBa 2 Cu 3 O 7-x superconductor. Furthermore, the grain size of the 123-phase increased as the reduction ratio became larger during the upset-forging. The critical temperature for zero resistivity of both samples was almost the same, i.e., about 90K. These results have demonstrated the potential of producing YBa 2 Cu 3 O 7-x superconducting wire or tape effectively using a upset-forging method. The critical current density of the upset-forged sample, however, was lower than that of the sintered one, which fact might be ascribed to microcrack formation during fast upset-forging. (Author)

Nodular cast iron and casting monitoring

Directory of Open Access Journals (Sweden)

S. Pietrowski

2008-10-01

Full Text Available In this paper quality monitoring of nodular cast iron and casting made of it is presented. A control system of initial liquid cast iron to spheroidization, after spheroidization and inoculation with using of TDA method was shown. An application of an ultrasonic method to assessment of the graphite form and the metal matrix microstructure of castings was investigated.

Nickel-base alloy forgings for advanced high temperature power plants

Energy Technology Data Exchange (ETDEWEB)

Donth, B.; Diwo, A.; Blaes, N.; Bokelmann, D. [Saarschmiede GmbH Freiformschmiede, Voelklingen (Germany)

2008-07-01

The strong efforts to reduce the CO{sub 2} emissions lead to the demand for improved thermal efficiency of coal fired power plants. An increased thermal efficiency can be realised by higher steam temperatures and pressures in the boiler and the turbine. The European development aims for steam temperatures of 700 C which requires the development and use of new materials and also associated process technology for large components. Temperatures of 700 C and above are too high for the application of ferritic steels and therefore only Nickel-Base Alloys can fulfill the required material properties. In particular the Nickel-Base Alloy A617 is the most candidate alloy on which was focused the investigation and development in several German and European programs during the last 10 years. The goal is to verify and improve the attainable material properties and ultrasonic detectability of large Alloy 617 forgings for turbine rotors and boiler parts. For many years Saarschmiede has been manufacturing nickel and cobalt alloys and is participating the research programs by developing the manufacturing routes for large turbine rotor forgings up to a maximum diameter of 1000 mm as well as for forged tubes and valve parts for the boiler side. The experiences in manufacturing and testing of very large forgings made from nickel base alloys for 700 C steam power plants are reported. (orig.)

Optimizing the Gating System for Steel Castings

Directory of Open Access Journals (Sweden)

Jan Jezierski

2018-04-01

Full Text Available The article presents the attempt to optimize a gating system to produce cast steel castings. It is based on John Campbell’s theory and presents the original results of computer modelling of typical and optimized gating systems for cast steel castings. The current state-of-the-art in cast steel casting foundry was compared with several proposals of optimization. The aim was to find a compromise between the best, theoretically proven gating system version, and a version that would be affordable in industrial conditions. The results show that it is possible to achieve a uniform and slow pouring process even for heavy castings to preserve their internal quality.

Structural changes of radial forging die surface during service under thermo-mechanical fatigue

International Nuclear Information System (INIS)

Nematzadeh, Fardin; Akbarpour, Mohammad Reza; Kokabi, Amir Hosein; Sadrnezhaad, Seyed Khatiboleslam

2009-01-01

Radial forging is one of the modern open die forging techniques and has a wide application in producing machine parts. During operation at high temperatures, severe temperature change associated with mechanical loads and the resultant wearing of the die surface lead to intense variation in strain on the die surface. Therefore, under this operating condition, thermo-mechanical fatigue (TMF) occurs on the surface of the radial forging die. TMF decreases the life of the die severely. In the present research, different layers were deposited on a 1.2714 steel die by SMAW and GTAW, with a weld wire of UDIMET 520. The microstructure of the radial forging die surface was investigated during welding and service using an optical microscope and scanning electron microscope. The results revealed that, after welding, the structure of the radial forging die surface includes the γ matrix with a homogeneous distribution of fine semi-spherical carbides. The weld structure consisted mostly of columnar dendrites with low grain boundaries. Also, microstructural investigation of the die surface during operation showed that the weld structure of the die surface has remained without any considerable change. Only dendrites were deformed and broken. Moreover, grain boundaries of the dendrites were revealed during service.

Identification of Forged Bank of England 20 Gbp Banknotes Using IR Spectroscopy

Science.gov (United States)

Sonnex, Emily

2014-06-01

Bank of England notes of 20 GBP denomination have been studied using infrared spectroscopy in order to generate a method to identify forged notes. A principal aim of this work was to develop a method so that a small, compact ATR FTIR instrument could be used by bank workers, police departments or others such as shop assistants to identify forged notes in a non-lab setting. The ease of use of the instrument is the key to this method, as well as the relatively low cost. The presence of a peak at 1400 wn from the blank paper section of a forged note proved to be a successful indicator of the note's illegality for the notes that we studied. Moreover, differences between the spectra of forged and genuine 20 GBP notes were observed in the ν(OH) (ca. 3500 wn), ν(C-H) (ca. 2900 wn) and ν(C=O) (ca. 1750 wn) regions of the IR spectrum recorded for the polymer film covering the holographic strip. In cases where these simple tests fail, we have shown how an infrared microscope can be used to further differentiate genuine and forged banknotes by producing infrared maps of selected areas of the note contrasting inks with background paper. Further to this, with an announcement by the Bank of England to produce polymer banknotes in the future, the work has been extended using Australian polymer banknotes to show that the method would be transferable.

The Forging of a White Gay Aesthetic at the Saint, 1980–84

Directory of Open Access Journals (Sweden)

Tim Lawrence

2011-06-01

Full Text Available Based on original interviews with key protagonists and documentary research, the article examines the way in which the DJs who worked at the Saint forged a white gay aesthetic across the first half of the 1980s. A private party located in the East Village, New York, the Saint attracted a privileged white male crowd, and this group's position within the emerging culture of neoliberalism, along with the deepening impact of the AIDS epidemic, encouraged its spinners to sever their ties with sounds that were associated with blackness. However, if Saint DJs rejected a high proportion of records that were being released by New York's independents, and also snubbed Chicago house when it broke in 1985, their forging of an aesthetic that emphasised seamless transitions, often between records that contained similar sonic qualities, preempted the style of mixing that would be popularised in house music culture.

Elliptic flow of charm and strange hadrons in high-multiplicity pPb collisions at $ {\\sqrt {\\smash [b]{s_{_{\\mathrm {NN}}}}}} = $ 8.16 TeV

CERN Document Server

Sirunyan, Albert M; CMS Collaboration; Adam, Wolfgang; Ambrogi, Federico; Asilar, Ece; Bergauer, Thomas; Brandstetter, Johannes; Brondolin, Erica; Dragicevic, Marko; Erö, Janos; Escalante Del Valle, Alberto; Flechl, Martin; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Hrubec, Josef; Jeitler, Manfred; Krammer, Natascha; Krätschmer, Ilse; Liko, Dietrich; Madlener, Thomas; Mikulec, Ivan; Rad, Navid; Rohringer, Herbert; Schieck, Jochen; Schöfbeck, Robert; Spanring, Markus; Spitzbart, Daniel; Taurok, Anton; Waltenberger, Wolfgang; Wittmann, Johannes; Wulz, Claudia-Elisabeth; Zarucki, Mateusz; Chekhovsky, Vladimir; Mossolov, Vladimir; Suarez Gonzalez, Juan; De Wolf, Eddi A; Di Croce, Davide; Janssen, Xavier; Lauwers, Jasper; Pieters, Maxim; Van De Klundert, Merijn; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Abu Zeid, Shimaa; Blekman, Freya; D'Hondt, Jorgen; De Bruyn, Isabelle; De Clercq, Jarne; Deroover, Kevin; Flouris, Giannis; Lontkovskyi, Denys; Lowette, Steven; Marchesini, Ivan; Moortgat, Seth; Moreels, Lieselotte; Python, Quentin; Skovpen, Kirill; Tavernier, Stefaan; Van Doninck, Walter; Van Mulders, Petra; Van Parijs, Isis; Beghin, Diego; Bilin, Bugra; Brun, Hugues; Clerbaux, Barbara; De Lentdecker, Gilles; Delannoy, Hugo; Dorney, Brian; Fasanella, Giuseppe; Favart, Laurent; Goldouzian, Reza; Grebenyuk, Anastasia; Kalsi, Amandeep Kaur; Lenzi, Thomas; Luetic, Jelena; Postiau, Nicolas; Starling, Elizabeth; Thomas, Laurent; Vander Velde, Catherine; Vanlaer, Pascal; Vannerom, David; Wang, Qun; Cornelis, Tom; Dobur, Didar; Fagot, Alexis; Gul, Muhammad; Khvastunov, Illia; Poyraz, Deniz; Roskas, Christos; Trocino, Daniele; Tytgat, Michael; Verbeke, Willem; Vermassen, Basile; Vit, Martina; Zaganidis, Nicolas; Bakhshiansohi, Hamed; Bondu, Olivier; Brochet, Sébastien; Bruno, Giacomo; Caputo, Claudio; David, Pieter; Delaere, Christophe; Delcourt, Martin; Francois, Brieuc; Giammanco, Andrea; Krintiras, Georgios; Lemaitre, Vincent; Magitteri, Alessio; Mertens, Alexandre; Musich, Marco; Piotrzkowski, Krzysztof; Saggio, Alessia; Vidal Marono, Miguel; Wertz, Sébastien; Zobec, Joze; Alves, Fábio Lúcio; Alves, Gilvan; Brito, Lucas; Correia Silva, Gilson; Hensel, Carsten; Moraes, Arthur; Pol, Maria Elena; Rebello Teles, Patricia; Belchior Batista Das Chagas, Ewerton; Carvalho, Wagner; Chinellato, Jose; Coelho, Eduardo; Melo Da Costa, Eliza; Da Silveira, Gustavo Gil; De Jesus Damiao, Dilson; De Oliveira Martins, Carley; Fonseca De Souza, Sandro; Malbouisson, Helena; Matos Figueiredo, Diego; Melo De Almeida, Miqueias; Mora Herrera, Clemencia; Mundim, Luiz; Nogima, Helio; Prado Da Silva, Wanda Lucia; Sanchez Rosas, Luis Junior; Santoro, Alberto; Sznajder, Andre; Thiel, Mauricio; Tonelli Manganote, Edmilson José; Torres Da Silva De Araujo, Felipe; Vilela Pereira, Antonio; Ahuja, Sudha; Bernardes, Cesar Augusto; Calligaris, Luigi; Tomei, Thiago; De Moraes Gregores, Eduardo; Mercadante, Pedro G; Novaes, Sergio F; Padula, Sandra; Romero Abad, David; Aleksandrov, Aleksandar; Hadjiiska, Roumyana; Iaydjiev, Plamen; Marinov, Andrey; Misheva, Milena; Rodozov, Mircho; Shopova, Mariana; Sultanov, Georgi; Dimitrov, Anton; Litov, Leander; Pavlov, Borislav; Petkov, Peicho; Fang, Wenxing; Gao, Xuyang; Yuan, Li; Ahmad, Muhammad; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Chen, Mingshui; Chen, Ye; Jiang, Chun-Hua; Leggat, Duncan; Liao, Hongbo; Liu, Zhenan; Romeo, Francesco; Shaheen, Sarmad Masood; Spiezia, Aniello; Tao, Junquan; Wang, Chunjie; Wang, Zheng; Yazgan, Efe; Zhang, Huaqiao; Zhao, Jingzhou; Ban, Yong; Chen, Geng; Li, Jing; Li, Linwei; Li, Qiang; Mao, Yajun; Qian, Si-Jin; Wang, Dayong; Xu, Zijun; Wang, Yi; Avila, Carlos; Cabrera, Andrés; Carrillo Montoya, Camilo Andres; Chaparro Sierra, Luisa Fernanda; Florez, Carlos; González Hernández, Carlos Felipe; Segura Delgado, Manuel Alejandro; Courbon, Benoit; Godinovic, Nikola; Lelas, Damir; Puljak, Ivica; Sculac, Toni; Antunovic, Zeljko; Kovac, Marko; Brigljevic, Vuko; Ferencek, Dinko; Kadija, Kreso; Mesic, Benjamin; Starodumov, Andrei; Susa, Tatjana; Ather, Mohsan Waseem; Attikis, Alexandros; Mavromanolakis, Georgios; Mousa, Jehad; Nicolaou, Charalambos; Ptochos, Fotios; Razis, Panos A; Rykaczewski, Hans; Finger, Miroslav; Finger Jr, Michael; Ayala, Edy; Carrera Jarrin, Edgar; Mahmoud, Mohammed; Mohammed, Yasser; Salama, Elsayed; Bhowmik, Sandeep; Carvalho Antunes De Oliveira, Alexandra; Dewanjee, Ram Krishna; Ehataht, Karl; Kadastik, Mario; Raidal, Martti; Veelken, Christian; Eerola, Paula; Kirschenmann, Henning; Pekkanen, Juska; Voutilainen, Mikko; Havukainen, Joona; Heikkilä, Jaana Kristiina; Jarvinen, Terhi; Karimäki, Veikko; Kinnunen, Ritva; Lampén, Tapio; Lassila-Perini, Kati; Laurila, Santeri; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Mäenpää, Teppo; Siikonen, Hannu; Tuominen, Eija; Tuominiemi, Jorma; Tuuva, Tuure; Besancon, Marc; Couderc, Fabrice; Dejardin, Marc; Denegri, Daniel; Faure, Jean-Louis; Ferri, Federico; Ganjour, Serguei; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Leloup, Clément; Locci, Elizabeth; Malcles, Julie; Negro, Giulia; Rander, John; Rosowsky, André; Sahin, Mehmet Özgür; Titov, Maksym; Abdulsalam, Abdulla; Amendola, Chiara; Antropov, Iurii; Beaudette, Florian; Busson, Philippe; Charlot, Claude; Granier de Cassagnac, Raphael; Kucher, Inna; Lisniak, Stanislav; Lobanov, Artur; Martin Blanco, Javier; Nguyen, Matthew; Ochando, Christophe; Ortona, Giacomo; Pigard, Philipp; Salerno, Roberto; Sauvan, Jean-Baptiste; Sirois, Yves; Stahl Leiton, Andre Govinda; Zabi, Alexandre; Zghiche, Amina; Agram, Jean-Laurent; Andrea, Jeremy; Bloch, Daniel; Brom, Jean-Marie; Chabert, Eric Christian; Cherepanov, Vladimir; Collard, Caroline; Conte, Eric; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Jansová, Markéta; Le Bihan, Anne-Catherine; Tonon, Nicolas; Van Hove, Pierre; Gadrat, Sébastien; Beauceron, Stephanie; Bernet, Colin; Boudoul, Gaelle; Chanon, Nicolas; Chierici, Roberto; Contardo, Didier; Depasse, Pierre; El Mamouni, Houmani; Fay, Jean; Finco, Linda; Gascon, Susan; Gouzevitch, Maxime; Grenier, Gérald; Ille, Bernard; Lagarde, Francois; Laktineh, Imad Baptiste; Lattaud, Hugues; Lethuillier, Morgan; Mirabito, Laurent; Pequegnot, Anne-Laure; Perries, Stephane; Popov, Andrey; Sordini, Viola; Vander Donckt, Muriel; Viret, Sébastien; Zhang, Sijing; Toriashvili, Tengizi; Tsamalaidze, Zviad; Autermann, Christian; Feld, Lutz; Kiesel, Maximilian Knut; Klein, Katja; Lipinski, Martin; Preuten, Marius; Rauch, Max Philip; Schomakers, Christian; Schulz, Johannes; Teroerde, Marius; Wittmer, Bruno; Zhukov, Valery; Albert, Andreas; Duchardt, Deborah; Endres, Matthias; Erdmann, Martin; Esch, Thomas; Fischer, Robert; Ghosh, Saranya; Güth, Andreas; Hebbeker, Thomas; Heidemann, Carsten; Hoepfner, Kerstin; Keller, Henning; Knutzen, Simon; Mastrolorenzo, Luca; Merschmeyer, Markus; Meyer, Arnd; Millet, Philipp; Mukherjee, Swagata; Pook, Tobias; Radziej, Markus; Reithler, Hans; Rieger, Marcel; Scheuch, Florian; Schmidt, Alexander; Teyssier, Daniel; Flügge, Günter; Hlushchenko, Olena; Kargoll, Bastian; Kress, Thomas; Künsken, Andreas; Müller, Thomas; Nehrkorn, Alexander; Nowack, Andreas; Pistone, Claudia; Pooth, Oliver; Sert, Hale; Stahl, Achim; Aldaya Martin, Maria; Arndt, Till; Asawatangtrakuldee, Chayanit; Babounikau, Illia; Beernaert, Kelly; Behnke, Olaf; Behrens, Ulf; Bermúdez Martínez, Armando; Bertsche, David; Bin Anuar, Afiq Aizuddin; Borras, Kerstin; Botta, Valeria; Campbell, Alan; Connor, Patrick; Contreras-Campana, Christian; Costanza, Francesco; Danilov, Vladyslav; De Wit, Adinda; Defranchis, Matteo Maria; Diez Pardos, Carmen; Domínguez Damiani, Daniela; Eckerlin, Guenter; Eichhorn, Thomas; Elwood, Adam; Eren, Engin; Gallo, Elisabetta; Geiser, Achim; Grados Luyando, Juan Manuel; Grohsjean, Alexander; Gunnellini, Paolo; Guthoff, Moritz; Haranko, Mykyta; Harb, Ali; Hauk, Johannes; Jung, Hannes; Kasemann, Matthias; Keaveney, James; Kleinwort, Claus; Knolle, Joscha; Krücker, Dirk; Lange, Wolfgang; Lelek, Aleksandra; Lenz, Teresa; Lipka, Katerina; Lohmann, Wolfgang; Mankel, Rainer; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Meyer, Mareike; Missiroli, Marino; Mittag, Gregor; Mnich, Joachim; Myronenko, Volodymyr; Pflitsch, Svenja Karen; Pitzl, Daniel; Raspereza, Alexei; Savitskyi, Mykola; Saxena, Pooja; Schütze, Paul; Schwanenberger, Christian; Shevchenko, Rostyslav; Singh, Akshansh; Stefaniuk, Nazar; Tholen, Heiner; Vagnerini, Antonio; Van Onsem, Gerrit Patrick; Walsh, Roberval; Wen, Yiwen; Wichmann, Katarzyna; Wissing, Christoph; Zenaiev, Oleksandr; Aggleton, Robin; Bein, Samuel; Benecke, Anna; Blobel, Volker; Centis Vignali, Matteo; Dreyer, Torben; Garutti, Erika; Gonzalez, Daniel; Haller, Johannes; Hinzmann, Andreas; Hoffmann, Malte; Karavdina, Anastasia; Kasieczka, Gregor; Klanner, Robert; Kogler, Roman; Kovalchuk, Nataliia; Kurz, Simon; Kutzner, Viktor; Lange, Johannes; Marconi, Daniele; Multhaup, Jens; Niedziela, Marek; Nowatschin, Dominik; Perieanu, Adrian; Reimers, Arne; Rieger, Oliver; Scharf, Christian; Schleper, Peter; Schumann, Svenja; Schwandt, Joern; Sonneveld, Jory; Stadie, Hartmut; Steinbrück, Georg; Stober, Fred-Markus Helmut; Stöver, Marc; Troendle, Daniel; Usai, Emanuele; Vanhoefer, Annika; Vormwald, Benedikt; Akbiyik, Melike; Barth, Christian; Baselga, Marta; Baur, Sebastian; Butz, Erik; Caspart, René; Chwalek, Thorsten; Colombo, Fabio; De Boer, Wim; Dierlamm, Alexander; Faltermann, Nils; Freund, Benedikt; Giffels, Manuel; Harrendorf, Marco Alexander; Hartmann, Frank; Heindl, Stefan Michael; Husemann, Ulrich; Kassel, Florian; Katkov, Igor; Kudella, Simon; Mildner, Hannes; Mitra, Soureek; Mozer, Matthias Ulrich; Müller, Thomas; Plagge, Michael; Quast, Gunter; Rabbertz, Klaus; Schröder, Matthias; Shvetsov, Ivan; Sieber, Georg; Simonis, Hans-Jürgen; Ulrich, Ralf; Wayand, Stefan; Weber, Marc; Weiler, Thomas; Williamson, Shawn; Wöhrmann, Clemens; Wolf, Roger; Anagnostou, Georgios; Daskalakis, Georgios; Geralis, Theodoros; Kyriakis, Aristotelis; Loukas, Demetrios; Paspalaki, Garyfallia; Topsis-Giotis, Iasonas; Karathanasis, George; Kesisoglou, Stilianos; Kontaxakis, Pantelis; Panagiotou, Apostolos; Saoulidou, Niki; Tziaferi, Eirini; Vellidis, Konstantinos; Kousouris, Konstantinos; Papakrivopoulos, Ioannis; Tsipolitis, Georgios; Evangelou, Ioannis; Foudas, Costas; Gianneios, Paraskevas; Katsoulis, Panagiotis; Kokkas, Panagiotis; Mallios, Stavros; Manthos, Nikolaos; Papadopoulos, Ioannis; Paradas, Evangelos; Strologas, John; Triantis, Frixos A; Tsitsonis, Dimitrios; Csanad, Mate; Filipovic, Nicolas; Major, Péter; Nagy, Marton Imre; Pasztor, Gabriella; Surányi, Olivér; Veres, Gabor Istvan; Bencze, Gyorgy; Hajdu, Csaba; Horvath, Dezso; Hunyadi, Ádám; Sikler, Ferenc; Veszpremi, Viktor; Vesztergombi, Gyorgy; Vámi, Tamás Álmos; Beni, Noemi; Czellar, Sandor; Karancsi, János; Makovec, Alajos; Molnar, Jozsef; Szillasi, Zoltan; Bartók, Márton; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Choudhury, Somnath; Komaragiri, Jyothsna Rani; Tiwari, Praveen Chandra; Bahinipati, Seema; Mal, Prolay; Mandal, Koushik; Nayak, Aruna; Sahoo, Deepak Kumar; Swain, Sanjay Kumar; Bansal, Sunil; Beri, Suman Bala; Bhatnagar, Vipin; Chauhan, Sushil; Chawla, Ridhi; Dhingra, Nitish; Gupta, Rajat; Kaur, Anterpreet; Kaur, Amandeep; Kaur, Manjit; Kaur, Sandeep; Kumar, Ramandeep; Kumari, Priyanka; Lohan, Manisha; Mehta, Ankita; Sandeep, Kaur; Sharma, Sandeep; Singh, Jasbir; Walia, Genius; Kumar, Ashok; Shah, Aashaq; Bhardwaj, Ashutosh; Choudhary, Brajesh C; Garg, Rocky Bala; Gola, Mohit; Keshri, Sumit; Malhotra, Shivali; Naimuddin, Md; Priyanka, Priyanka; Ranjan, Kirti; Sharma, Ramkrishna; Bhardwaj, Rishika; Bharti, Monika; Bhattacharya, Rajarshi; Bhattacharya, Satyaki; Bhawandeep, Bhawandeep; Bhowmik, Debabrata; Dey, Sourav; Dutt, Suneel; Dutta, Suchandra; Ghosh, Shamik; Mondal, Kuntal; Nandan, Saswati; Purohit, Arnab; Rout, Prasant Kumar; Roy, Ashim; Roy Chowdhury, Suvankar; Sarkar, Subir; Sharan, Manoj; Singh, Bipen; Thakur, Shalini; Behera, Prafulla Kumar; Chudasama, Ruchi; Dutta, Dipanwita; Jha, Vishwajeet; Kumar, Vineet; Netrakanti, Pawan Kumar; Pant, Lalit Mohan; Shukla, Prashant; Ravindra Kumar Verma, Ravindra; Aziz, Tariq; Bhat, Muzamil Ahmad; Dugad, Shashikant; Mohanty, Gagan Bihari; Sur, Nairit; Sutar, Bajrang; Banerjee, Sudeshna; Bhattacharya, Soham; Chatterjee, Suman; Das, Pallabi; Guchait, Monoranjan; Jain, Sandhya; Kumar, Sanjeev; Maity, Manas; Majumder, Gobinda; Mazumdar, Kajari; Sahoo, Niladribihari; Sarkar, Tanmay; Chauhan, Shubhanshu; Dube, Sourabh; Hegde, Vinay; Kapoor, Anshul; Kothekar, Kunal; Pandey, Shubham; Rane, Aditee; Sharma, Seema; Chenarani, Shirin; Eskandari Tadavani, Esmaeel; Etesami, Seyed Mohsen; Khakzad, Mohsen; Mohammadi Najafabadi, Mojtaba; Naseri, Mohsen; Rezaei Hosseinabadi, Ferdos; Safarzadeh, Batool; Zeinali, Maryam; Felcini, Marta; Grunewald, Martin; Abbrescia, Marcello; Calabria, Cesare; Colaleo, Anna; Creanza, Donato; Cristella, Leonardo; De Filippis, Nicola; De Palma, Mauro; Di Florio, Adriano; Errico, Filippo; Fiore, Luigi; Gelmi, Andrea; Iaselli, Giuseppe; Lezki, Samet; Maggi, Giorgio; Maggi, Marcello; Miniello, Giorgia; My, Salvatore; Nuzzo, Salvatore; Pompili, Alexis; Pugliese, Gabriella; Radogna, Raffaella; Ranieri, Antonio; Selvaggi, Giovanna; Sharma, Archana; Silvestris, Lucia; Venditti, Rosamaria; Verwilligen, Piet; Zito, Giuseppe; Abbiendi, Giovanni; Battilana, Carlo; Bonacorsi, Daniele; Borgonovi, Lisa; Braibant-Giacomelli, Sylvie; Brigliadori, Luca; Campanini, Renato; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Chhibra, Simranjit Singh; Codispoti, Giuseppe; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Giacomelli, Paolo; Grandi, Claudio; Guiducci, Luigi; Marcellini, Stefano; Masetti, Gianni; Montanari, Alessandro; Navarria, Francesco; Perrotta, Andrea; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gian Piero; Tosi, Nicolò; Albergo, Sebastiano; Di Mattia, Alessandro; Potenza, Renato; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Chatterjee, Kalyanmoy; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Latino, Giuseppe; Lenzi, Piergiulio; Meschini, Marco; Paoletti, Simone; Russo, Lorenzo; Sguazzoni, Giacomo; Strom, Derek; Viliani, Lorenzo; Benussi, Luigi; Bianco, Stefano; Fabbri, Franco; Piccolo, Davide; Primavera, Federica; Ferro, Fabrizio; Ravera, Fabio; Robutti, Enrico; Tosi, Silvano; Benaglia, Andrea; Beschi, Andrea; Brianza, Luca; Brivio, Francesco; Ciriolo, Vincenzo; Di Guida, Salvatore; Dinardo, Mauro Emanuele; Fiorendi, Sara; Gennai, Simone; Ghezzi, Alessio; Govoni, Pietro; Malberti, Martina; Malvezzi, Sandra; Massironi, Andrea; Menasce, Dario; Moroni, Luigi; Paganoni, Marco; Pedrini, Daniele; Ragazzi, Stefano; Tabarelli de Fatis, Tommaso; Buontempo, Salvatore; Cavallo, Nicola; Di Crescenzo, Antonia; Fabozzi, Francesco; Fienga, Francesco; Galati, Giuliana; Iorio, Alberto Orso Maria; Khan, Wajid Ali; Lista, Luca; Meola, Sabino; Paolucci, Pierluigi; Sciacca, Crisostomo; Voevodina, Elena; Azzi, Patrizia; Bacchetta, Nicola; Benato, Lisa; Bisello, Dario; Boletti, Alessio; Bragagnolo, Alberto; Carlin, Roberto; Checchia, Paolo; Dall'Osso, Martino; De Castro Manzano, Pablo; Dorigo, Tommaso; Dosselli, Umberto; Gasparini, Fabrizio; Gasparini, Ugo; Gozzelino, Andrea; Lacaprara, Stefano; Lujan, Paul; Margoni, Martino; Meneguzzo, Anna Teresa; Ronchese, Paolo; Rossin, Roberto; Simonetto, Franco; Tiko, Andres; Torassa, Ezio; Zanetti, Marco; Zotto, Pierluigi; Zumerle, Gianni; Braghieri, Alessandro; Magnani, Alice; Montagna, Paolo; Ratti, Sergio P; Re, Valerio; Ressegotti, Martina; Riccardi, Cristina; Salvini, Paola; Vai, Ilaria; Vitulo, Paolo; Alunni Solestizi, Luisa; Biasini, Maurizio; Bilei, Gian Mario; Cecchi, Claudia; Ciangottini, Diego; Fanò, Livio; Lariccia, Paolo; Manoni, Elisa; Mantovani, Giancarlo; Mariani, Valentina; Menichelli, Mauro; Rossi, Alessandro; Santocchia, Attilio; Spiga, Daniele; Androsov, Konstantin; Azzurri, Paolo; Bagliesi, Giuseppe; Bianchini, Lorenzo; Boccali, Tommaso; Borrello, Laura; Castaldi, Rino; Ciocci, Maria Agnese; Dell'Orso, Roberto; Fedi, Giacomo; Giannini, Leonardo; Giassi, Alessandro; Grippo, Maria Teresa; Ligabue, Franco; Manca, Elisabetta; Mandorli, Giulio; Messineo, Alberto; Palla, Fabrizio; Rizzi, Andrea; Spagnolo, Paolo; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; Cipriani, Marco; Daci, Nadir; Del Re, Daniele; Di Marco, Emanuele; Diemoz, Marcella; Gelli, Simone; Longo, Egidio; Marzocchi, Badder; Meridiani, Paolo; Organtini, Giovanni; Pandolfi, Francesco; Paramatti, Riccardo; Preiato, Federico; Rahatlou, Shahram; Rovelli, Chiara; Santanastasio, Francesco; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Bartosik, Nazar; Bellan, Riccardo; Biino, Cristina; Cartiglia, Nicolo; Cenna, Francesca; Cometti, Simona; Costa, Marco; Covarelli, Roberto; Demaria, Natale; Kiani, Bilal; Mariotti, Chiara; Maselli, Silvia; Migliore, Ernesto; Monaco, Vincenzo; Monteil, Ennio; Monteno, Marco; Obertino, Maria Margherita; Pacher, Luca; Pastrone, Nadia; Pelliccioni, Mario; Pinna Angioni, Gian Luca; Romero, Alessandra; Ruspa, Marta; Sacchi, Roberto; Shchelina, Ksenia; Sola, Valentina; Solano, Ada; Soldi, Dario; Staiano, Amedeo; Belforte, Stefano; Candelise, Vieri; Casarsa, Massimo; Cossutti, Fabio; Della Ricca, Giuseppe; Vazzoler, Federico; Zanetti, Anna; Kim, Dong Hee; Kim, Gui Nyun; Kim, Min Suk; Lee, Jeongeun; Lee, Sangeun; Lee, Seh Wook; Moon, Chang-Seong; Oh, Young Do; Sekmen, Sezen; Son, Dong-Chul; Yang, Yu Chul; Kim, Hyunchul; Moon, Dong Ho; Oh, Geonhee; Goh, Junghwan; Kim, Tae Jeong; Cho, Sungwoong; Choi, Suyong; Go, Yeonju; Gyun, Dooyeon; Ha, Seungkyu; Hong, Byung-Sik; Jo, Youngkwon; Lee, Kisoo; Lee, Kyong Sei; Lee, Songkyo; Lim, Jaehoon; Park, Sung Keun; Roh, Youn; Kim, Hyunsoo; Almond, John; Kim, Junho; Kim, Jae Sung; Lee, Haneol; Lee, Kyeongpil; Nam, Kyungwook; Oh, Sung Bin; Radburn-Smith, Benjamin Charles; Seo, Seon-hee; Yang, Unki; Yoo, Hwi Dong; Yu, Geum Bong; Kim, Hyunyong; Kim, Ji Hyun; Lee, Jason Sang Hun; Park, Inkyu; Choi, Young-Il; Hwang, Chanwook; Lee, Jongseok; Yu, Intae; Dudenas, Vytautas; Juodagalvis, Andrius; Vaitkus, Juozas; Ahmed, Ijaz; Ibrahim, Zainol Abidin; Md Ali, Mohd Adli Bin; Mohamad Idris, Faridah; Wan Abdullah, Wan Ahmad Tajuddin; Yusli, Mohd Nizam; Zolkapli, Zukhaimira; Reyes-Almanza, Rogelio; Ramirez-Sanchez, Gabriel; Duran-Osuna, Cecilia; Castilla-Valdez, Heriberto; De La Cruz-Burelo, Eduard; Heredia-De La Cruz, Ivan; Rabadán-Trejo, Raúl Iraq; Lopez-Fernandez, Ricardo; Mejia Guisao, Jhovanny; Sánchez Hernández, Alberto; Carrillo Moreno, Salvador; Oropeza Barrera, Cristina; Vazquez Valencia, Fabiola; Eysermans, Jan; Pedraza, Isabel; Salazar Ibarguen, Humberto Antonio; Uribe Estrada, Cecilia; Morelos Pineda, Antonio; Krofcheck, David; Bheesette, Srinidhi; Butler, Philip H; Ahmad, Ashfaq; Ahmad, Muhammad; Asghar, Muhammad Irfan; Hassan, Qamar; Hoorani, Hafeez R; Saddique, Asif; Shah, Mehar Ali; Shoaib, Muhammad; Waqas, Muhammad; Bialkowska, Helena; Bluj, Michal; Boimska, Bozena; Frueboes, Tomasz; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Szleper, Michal; Traczyk, Piotr; Zalewski, Piotr; Bunkowski, Karol; Byszuk, Adrian; Doroba, Krzysztof; Kalinowski, Artur; Konecki, Marcin; Krolikowski, Jan; Misiura, Maciej; Olszewski, Michal; Pyskir, Andrzej; Walczak, Marek; Bargassa, Pedrame; Beirão Da Cruz E Silva, Cristóvão; Di Francesco, Agostino; Faccioli, Pietro; Galinhas, Bruno; Gallinaro, Michele; Hollar, Jonathan; Leonardo, Nuno; Lloret Iglesias, Lara; Nemallapudi, Mythra Varun; Seixas, Joao; Strong, Giles; Toldaiev, Oleksii; Vadruccio, Daniele; Varela, Joao; Afanasiev, Serguei; Bunin, Pavel; Gavrilenko, Mikhail; Golutvin, Igor; Gorbunov, Ilya; Kamenev, Alexey; Karjavine, Vladimir; Lanev, Alexander; Malakhov, Alexander; Matveev, Viktor; Moisenz, Petr; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Shulha, Siarhei; Skatchkov, Nikolai; Smirnov, Vitaly; Voytishin, Nikolay; Zarubin, Anatoli; Golovtsov, Victor; Ivanov, Yury; Kim, Victor; Kuznetsova, Ekaterina; Levchenko, Petr; Murzin, Victor; Oreshkin, Vadim; Smirnov, Igor; Sosnov, Dmitry; Sulimov, Valentin; Uvarov, Lev; Vavilov, Sergey; Vorobyev, Alexey; Andreev, Yuri; Dermenev, Alexander; Gninenko, Sergei; Golubev, Nikolai; Karneyeu, Anton; Kirsanov, Mikhail; Krasnikov, Nikolai; Pashenkov, Anatoli; Tlisov, Danila; Toropin, Alexander; Epshteyn, Vladimir; Gavrilov, Vladimir; Lychkovskaya, Natalia; Popov, Vladimir; Pozdnyakov, Ivan; Safronov, Grigory; Spiridonov, Alexander; Stepennov, Anton; Stolin, Viatcheslav; Toms, Maria; Vlasov, Evgueni; Zhokin, Alexander; Aushev, Tagir; Bylinkin, Alexander; Chistov, Ruslan; Danilov, Mikhail; Parygin, Pavel; Philippov, Dmitry; Polikarpov, Sergey; Tarkovskii, Evgenii; Andreev, Vladimir; Azarkin, Maksim; Dremin, Igor; Kirakosyan, Martin; Rusakov, Sergey V; Terkulov, Adel; Baskakov, Alexey; Belyaev, Andrey; Boos, Edouard; Ershov, Alexander; Gribushin, Andrey; Kaminskiy, Alexandre; Kodolova, Olga; Korotkikh, Vladimir; Lokhtin, Igor; Miagkov, Igor; Obraztsov, Stepan; Petrushanko, Sergey; Savrin, Viktor; Snigirev, Alexander; Vardanyan, Irina; Blinov, Vladimir; Dimova, Tatyana; Kardapoltsev, Leonid; Shtol, Dmitry; Skovpen, Yuri; Azhgirey, Igor; Bayshev, Igor; Bitioukov, Sergei; Elumakhov, Dmitry; Godizov, Anton; Kachanov, Vassili; Kalinin, Alexey; Konstantinov, Dmitri; Mandrik, Petr; Petrov, Vladimir; Ryutin, Roman; Slabospitskii, Sergei; Sobol, Andrei; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Babaev, Anton; Baidali, Sergei; Adzic, Petar; Cirkovic, Predrag; Devetak, Damir; Dordevic, Milos; Milosevic, Jovan; Alcaraz Maestre, Juan; Bachiller, Irene; Barrio Luna, Mar; Brochero Cifuentes, Javier Andres; Cerrada, Marcos; Colino, Nicanor; De La Cruz, Begona; Delgado Peris, Antonio; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Flix, Jose; Fouz, Maria Cruz; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M; Josa, Maria Isabel; Moran, Dermot; Pérez-Calero Yzquierdo, Antonio María; Puerta Pelayo, Jesus; Redondo, Ignacio; Romero, Luciano; Senghi Soares, Mara; Triossi, Andrea; Álvarez Fernández, Adrian; Albajar, Carmen; de Trocóniz, Jorge F; Cuevas, Javier; Erice, Carlos; Fernandez Menendez, Javier; Folgueras, Santiago; Gonzalez Caballero, Isidro; González Fernández, Juan Rodrigo; Palencia Cortezon, Enrique; Rodríguez Bouza, Víctor; Sanchez Cruz, Sergio; Vischia, Pietro; Vizan Garcia, Jesus Manuel; Cabrillo, Iban Jose; Calderon, Alicia; Chazin Quero, Barbara; Duarte Campderros, Jordi; Fernandez, Marcos; Fernández Manteca, Pedro José; Garcia-Ferrero, Juan; García Alonso, Andrea; Gomez, Gervasio; Lopez Virto, Amparo; Marco, Jesus; Martinez Rivero, Celso; Martinez Ruiz del Arbol, Pablo; Matorras, Francisco; Piedra Gomez, Jonatan; Prieels, Cédric; Rodrigo, Teresa; Ruiz-Jimeno, Alberto; Scodellaro, Luca; Trevisani, Nicolò; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Akgun, Bora; Auffray, Etiennette; Baillon, Paul; Ball, Austin; Barney, David; Bendavid, Joshua; Bianco, Michele; Bocci, Andrea; Botta, Cristina; Camporesi, Tiziano; Cepeda, Maria; Cerminara, Gianluca; Chapon, Emilien; Chen, Yi; Cucciati, Giacomo; D'Enterria, David; Dabrowski, Anne; Daponte, Vincenzo; David Tinoco Mendes, Andre; De Roeck, Albert; Deelen, Nikkie; Dobson, Marc; Du Pree, Tristan; Dünser, Marc; Dupont, Niels; Elliott-Peisert, Anna; Everaerts, Pieter; Fallavollita, Francesco; Fasanella, Daniele; Franzoni, Giovanni; Fulcher, Jonathan; Funk, Wolfgang; Gigi, Dominique; Gilbert, Andrew; Gill, Karl; Glege, Frank; Gulhan, Doga; Hegeman, Jeroen; Innocente, Vincenzo; Jafari, Abideh; Janot, Patrick; Karacheban, Olena; Kieseler, Jan; Kornmayer, Andreas; Krammer, Manfred; Lange, Clemens; Lecoq, Paul; Lourenco, Carlos; Malgeri, Luca; Mannelli, Marcello; Meijers, Frans; Merlin, Jeremie Alexandre; Mersi, Stefano; Meschi, Emilio; Milenovic, Predrag; Moortgat, Filip; Mulders, Martijn; Ngadiuba, Jennifer; Orfanelli, Styliani; Orsini, Luciano; Pantaleo, Felice; Pape, Luc; Perez, Emmanuel; Peruzzi, Marco; Petrilli, Achille; Petrucciani, Giovanni; Pfeiffer, Andreas; Pierini, Maurizio; Pitters, Florian Michael; Rabady, Dinyar; Racz, Attila; Reis, Thomas; Rolandi, Gigi; Rovere, Marco; Sakulin, Hannes; Schäfer, Christoph; Schwick, Christoph; Seidel, Markus; Selvaggi, Michele; Sharma, Archana; Silva, Pedro; Sphicas, Paraskevas; Stakia, Anna; Steggemann, Jan; Tosi, Mia; Treille, Daniel; Tsirou, Andromachi; Veckalns, Viesturs; Zeuner, Wolfram Dietrich; Bertl, Willi; Caminada, Lea; Deiters, Konrad; Erdmann, Wolfram; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; Kotlinski, Danek; Langenegger, Urs; Rohe, Tilman; Wiederkehr, Stephan Albert; Backhaus, Malte; Bäni, Lukas; Berger, Pirmin; Chernyavskaya, Nadezda; Dissertori, Günther; Dittmar, Michael; Donegà, Mauro; Dorfer, Christian; Grab, Christoph; Heidegger, Constantin; Hits, Dmitry; Hoss, Jan; Klijnsma, Thomas; Lustermann, Werner; Manzoni, Riccardo Andrea; Marionneau, Matthieu; Meinhard, Maren Tabea; Meister, Daniel; Micheli, Francesco; Musella, Pasquale; Nessi-Tedaldi, Francesca; Pata, Joosep; Pauss, Felicitas; Perrin, Gaël; Perrozzi, Luca; Pigazzini, Simone; Quittnat, Milena; Reichmann, Michael; Ruini, Daniele; Sanz Becerra, Diego Alejandro; Schönenberger, Myriam; Shchutska, Lesya; Tavolaro, Vittorio Raoul; Theofilatos, Konstantinos; Vesterbacka Olsson, Minna Leonora; Wallny, Rainer; Zhu, De Hua; Aarrestad, Thea Klaeboe; Amsler, Claude; Brzhechko, Danyyl; Canelli, Maria Florencia; De Cosa, Annapaola; Del Burgo, Riccardo; Donato, Silvio; Galloni, Camilla; Hreus, Tomas; Kilminster, Benjamin; Neutelings, Izaak; Pinna, Deborah; Rauco, Giorgia; Robmann, Peter; Salerno, Daniel; Schweiger, Korbinian; Seitz, Claudia; Takahashi, Yuta; Zucchetta, Alberto; Chang, Yu-Hsiang; Cheng, Kai-yu; Doan, Thi Hien; Jain, Shilpi; Khurana, Raman; Kuo, Chia-Ming; Lin, Willis; Pozdnyakov, Andrey; Yu, Shin-Shan; Kumar, Arun; Chang, Paoti; Chao, Yuan; Chen, Kai-Feng; Chen, Po-Hsun; Hou, George Wei-Shu; Li, You-ying; Lu, Rong-Shyang; Paganis, Efstathios; Psallidas, Andreas; Steen, Arnaud; Tsai, Jui-fa; Asavapibhop, Burin; Srimanobhas, Norraphat; Suwonjandee, Narumon; Bat, Ayse; Boran, Fatma; Cerci, Salim; Damarseckin, Serdal; Demiroglu, Zuhal Seyma; Dozen, Candan; Dumanoglu, Isa; Girgis, Semiray; Gokbulut, Gul; Guler, Yalcin; Gurpinar, Emine; Hos, Ilknur; Kangal, Evrim Ersin; Kara, Ozgun; Kayis Topaksu, Aysel; Kiminsu, Ugur; Oglakci, Mehmet; Onengut, Gulsen; Ozdemir, Kadri; Ozturk, Sertac; Sunar Cerci, Deniz; Tali, Bayram; Tok, Ufuk Guney; Turkcapar, Semra; Zorbakir, Ibrahim Soner; Zorbilmez, Caglar; Isildak, Bora; Karapinar, Guler; Yalvac, Metin; Zeyrek, Mehmet; Atakisi, Ismail Okan; Gülmez, Erhan; Kaya, Mithat; Kaya, Ozlem; Tekten, Sevgi; Yetkin, Elif Asli; Agaras, Merve Nazlim; Atay, Serhat; Cakir, Altan; Cankocak, Kerem; Komurcu, Yildiray; Sen, Sercan; Grynyov, Boris; Levchuk, Leonid; Ball, Fionn; Beck, Lana; Brooke, James John; Burns, Douglas; Clement, Emyr; Cussans, David; Davignon, Olivier; Flacher, Henning; Goldstein, Joel; Heath, Greg P; Heath, Helen F; Kreczko, Lukasz; Newbold, Dave M; Paramesvaran, Sudarshan; Penning, Bjoern; Sakuma, Tai; Smith, Dominic; Smith, Vincent J; Taylor, Joseph; Titterton, Alexander; Belyaev, Alexander; Brew, Christopher; Brown, Robert M; Cieri, Davide; Cockerill, David JA; Coughlan, John A; Harder, Kristian; Harper, Sam; Linacre, Jacob; Olaiya, Emmanuel; Petyt, David; Shepherd-Themistocleous, Claire; Thea, Alessandro; Tomalin, Ian R; Williams, Thomas; Womersley, William John; Auzinger, Georg; Bainbridge, Robert; Bloch, Philippe; Borg, Johan; Breeze, Shane; Buchmuller, Oliver; Bundock, Aaron; Casasso, Stefano; Colling, David; Corpe, Louie; Dauncey, Paul; Davies, Gavin; Della Negra, Michel; Di Maria, Riccardo; Haddad, Yacine; Hall, Geoffrey; Iles, Gregory; James, Thomas; Komm, Matthias; Laner, Christian; Lyons, Louis; Magnan, Anne-Marie; Malik, Sarah; Martelli, Arabella; Nash, Jordan; Nikitenko, Alexander; Palladino, Vito; Pesaresi, Mark; Richards, Alexander; Rose, Andrew; Scott, Edward; Seez, Christopher; Shtipliyski, Antoni; Strebler, Thomas; Summers, Sioni; Tapper, Alexander; Uchida, Kirika; Virdee, Tejinder; Wardle, Nicholas; Winterbottom, Daniel; Wright, Jack; Zenz, Seth Conrad; Cole, Joanne; Hobson, Peter R; Khan, Akram; Kyberd, Paul; Mackay, Catherine Kirsty; Morton, Alexander; Reid, Ivan; Teodorescu, Liliana; Zahid, Sema; Call, Kenneth; Dittmann, Jay; Hatakeyama, Kenichi; Liu, Hongxuan; Madrid, Christopher; Mcmaster, Brooks; Pastika, Nathaniel; Smith, Caleb; Bartek, Rachel; Dominguez, Aaron; Buccilli, Andrew; Cooper, Seth; Henderson, Conor; Rumerio, Paolo; West, Christopher; Arcaro, Daniel; Bose, Tulika; Gastler, Daniel; Rankin, Dylan; Richardson, Clint; Rohlf, James; Sulak, Lawrence; Zou, David; Benelli, Gabriele; Coubez, Xavier; Cutts, David; Hadley, Mary; Hakala, John; Heintz, Ulrich; Hogan, Julie Managan; Kwok, Ka Hei Martin; Laird, Edward; Landsberg, Greg; Lee, Jangbae; Mao, Zaixing; Narain, Meenakshi; Pazzini, Jacopo; Piperov, Stefan; Sagir, Sinan; Syarif, Rizki; Yu, David; Band, Reyer; Brainerd, Christopher; Breedon, Richard; Burns, Dustin; Calderon De La Barca Sanchez, Manuel; Chertok, Maxwell; Conway, John; Conway, Rylan; Cox, Peter Timothy; Erbacher, Robin; Flores, Chad; Funk, Garrett; Ko, Winston; Kukral, Ota; Lander, Richard; Mclean, Christine; Mulhearn, Michael; Pellett, Dave; Pilot, Justin; Shalhout, Shalhout; Shi, Mengyao; Stolp, Dustin; Taylor, Devin; Tos, Kyle; Tripathi, Mani; Wang, Zhangqier; Zhang, Fengwangdong; Bachtis, Michail; Bravo, Cameron; Cousins, Robert; Dasgupta, Abhigyan; Florent, Alice; Hauser, Jay; Ignatenko, Mikhail; Mccoll, Nickolas; Regnard, Simon; Saltzberg, David; Schnaible, Christian; Valuev, Vyacheslav; Bouvier, Elvire; Burt, Kira; Clare, Robert; Gary, J William; Ghiasi Shirazi, Seyyed Mohammad Amin; Hanson, Gail; Karapostoli, Georgia; Kennedy, Elizabeth; Lacroix, Florent; Long, Owen Rosser; Olmedo Negrete, Manuel; Paneva, Mirena Ivova; Si, Weinan; Wang, Long; Wei, Hua; Wimpenny, Stephen; Yates, Brent; Branson, James G; Cittolin, Sergio; Derdzinski, Mark; Gerosa, Raffaele; Gilbert, Dylan; Hashemi, Bobak; Holzner, André; Klein, Daniel; Kole, Gouranga; Krutelyov, Vyacheslav; Letts, James; Masciovecchio, Mario; Olivito, Dominick; Padhi, Sanjay; Pieri, Marco; Sani, Matteo; Sharma, Vivek; Simon, Sean; Tadel, Matevz; Vartak, Adish; Wasserbaech, Steven; Wood, John; Würthwein, Frank; Yagil, Avraham; Zevi Della Porta, Giovanni; Amin, Nick; Bhandari, Rohan; Bradmiller-Feld, John; Campagnari, Claudio; Citron, Matthew; Dishaw, Adam; Dutta, Valentina; Franco Sevilla, Manuel; Gouskos, Loukas; Heller, Ryan; Incandela, Joe; Ovcharova, Ana; Qu, Huilin; Richman, Jeffrey; Stuart, David; Suarez, Indara; Wang, Sicheng; Yoo, Jaehyeok; Anderson, Dustin; Bornheim, Adolf; Lawhorn, Jay Mathew; Newman, Harvey B; Nguyen, Thong; Spiropulu, Maria; Vlimant, Jean-Roch; Wilkinson, Richard; Xie, Si; Zhang, Zhicai; Zhu, Ren-Yuan; Andrews, Michael Benjamin; Ferguson, Thomas; Mudholkar, Tanmay; Paulini, Manfred; Sun, Menglei; Vorobiev, Igor; Weinberg, Marc; Cumalat, John Perry; Ford, William T; Jensen, Frank; Johnson, Andrew; Krohn, Michael; Leontsinis, Stefanos; MacDonald, Emily; Mulholland, Troy; Stenson, Kevin; Ulmer, Keith; Wagner, Stephen Robert; Alexander, James; Chaves, Jorge; Cheng, Yangyang; Chu, Jennifer; Datta, Abhisek; Mcdermott, Kevin; Mirman, Nathan; Patterson, Juliet Ritchie; Quach, Dan; Rinkevicius, Aurelijus; Ryd, Anders; Skinnari, Louise; Soffi, Livia; Tan, Shao Min; Tao, Zhengcheng; Thom, Julia; Tucker, Jordan; Wittich, Peter; Zientek, Margaret; Abdullin, Salavat; Albrow, Michael; Alyari, Maral; Apollinari, Giorgio; Apresyan, Artur; Apyan, Aram; Banerjee, Sunanda; Bauerdick, Lothar AT; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C; Bolla, Gino; Burkett, Kevin; Butler, Joel Nathan; Canepa, Anadi; Cerati, Giuseppe Benedetto; Cheung, Harry; Chlebana, Frank; Cremonesi, Matteo; Duarte, Javier; Elvira, Victor Daniel; Freeman, Jim; Gecse, Zoltan; Gottschalk, Erik; Gray, Lindsey; Green, Dan; Grünendahl, Stefan; Gutsche, Oliver; Hanlon, Jim; Harris, Robert M; Hasegawa, Satoshi; Hirschauer, James; Hu, Zhen; Jayatilaka, Bodhitha; Jindariani, Sergo; Johnson, Marvin; Joshi, Umesh; Klima, Boaz; Kortelainen, Matti J; Kreis, Benjamin; Lammel, Stephan; Lincoln, Don; Lipton, Ron; Liu, Miaoyuan; Liu, Tiehui; Lykken, Joseph; Maeshima, Kaori; Marraffino, John Michael; Mason, David; McBride, Patricia; Merkel, Petra; Mrenna, Stephen; Nahn, Steve; O'Dell, Vivian; Pedro, Kevin; Prokofyev, Oleg; Rakness, Gregory; Ristori, Luciano; Savoy-Navarro, Aurore; Schneider, Basil; Sexton-Kennedy, Elizabeth; Soha, Aron; Spalding, William J; Spiegel, Leonard; Stoynev, Stoyan; Strait, James; Strobbe, Nadja; Taylor, Lucas; Tkaczyk, Slawek; Tran, Nhan Viet; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vernieri, Caterina; Verzocchi, Marco; Vidal, Richard; Wang, Michael; Weber, Hannsjoerg Artur; Whitbeck, Andrew; Acosta, Darin; Avery, Paul; Bortignon, Pierluigi; Bourilkov, Dimitri; Brinkerhoff, Andrew; Cadamuro, Luca; Carnes, Andrew; Carver, Matthew; Curry, David; Field, Richard D; Gleyzer, Sergei V; Joshi, Bhargav Madhusudan; Konigsberg, Jacobo; Korytov, Andrey; Ma, Peisen; Matchev, Konstantin; Mei, Hualin; Mitselmakher, Guenakh; Shi, Kun; Sperka, David; Wang, Jian; Wang, Sean-Jiun; Joshi, Yagya Raj; Linn, Stephan; Ackert, Andrew; Adams, Todd; Askew, Andrew; Hagopian, Sharon; Hagopian, Vasken; Johnson, Kurtis F; Kolberg, Ted; Martinez, German; Perry, Thomas; Prosper, Harrison; Saha, Anirban; Santra, Arka; Sharma, Varun; Yohay, Rachel; Baarmand, Marc M; Bhopatkar, Vallary; Colafranceschi, Stefano; Hohlmann, Marcus; Noonan, Daniel; Rahmani, Mehdi; Roy, Titas; Yumiceva, Francisco; Adams, Mark Raymond; Apanasevich, Leonard; Berry, Douglas; Betts, Russell Richard; Cavanaugh, Richard; Chen, Xuan; Dittmer, Susan; Evdokimov, Olga; Gerber, Cecilia Elena; Hangal, Dhanush Anil; Hofman, David Jonathan; Jung, Kurt; Kamin, Jason; Mills, Corrinne; Sandoval Gonzalez, Irving Daniel; Tonjes, Marguerite; Varelas, Nikos; Wang, Hui; Wu, Zhenbin; Zhang, Jingyu; Alhusseini, Mohammad; Bilki, Burak; Clarida, Warren; Dilsiz, Kamuran; Durgut, Süleyman; Gandrajula, Reddy Pratap; Haytmyradov, Maksat; Khristenko, Viktor; Merlo, Jean-Pierre; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Ogul, Hasan; Onel, Yasar; Ozok, Ferhat; Penzo, Aldo; Snyder, Christina; Tiras, Emrah; Wetzel, James; Blumenfeld, Barry; Cocoros, Alice; Eminizer, Nicholas; Fehling, David; Feng, Lei; Gritsan, Andrei; Hung, Wai Ting; Maksimovic, Petar; Roskes, Jeffrey; Sarica, Ulascan; Swartz, Morris; Xiao, Meng; You, Can; Al-bataineh, Ayman; Baringer, Philip; Bean, Alice; Boren, Samuel; Bowen, James; Castle, James; Khalil, Sadia; Kropivnitskaya, Anna; Majumder, Devdatta; Mcbrayer, William; Murray, Michael; Rogan, Christopher; Sanders, Stephen; Schmitz, Erich; Tapia Takaki, Daniel; Wang, Quan; Ivanov, Andrew; Kaadze, Ketino; Kim, Doyeong; Maravin, Yurii; Mendis, Dalath Rachitha; Mitchell, Tyler; Modak, Atanu; Mohammadi, Abdollah; Saini, Lovedeep Kaur; Skhirtladze, Nikoloz; Rebassoo, Finn; Wright, Douglas; Baden, Drew; Baron, Owen; Belloni, Alberto; Eno, Sarah Catherine; Feng, Yongbin; Ferraioli, Charles; Hadley, Nicholas John; Jabeen, Shabnam; Jeng, Geng-Yuan; Kellogg, Richard G; Kunkle, Joshua; Mignerey, Alice; Ricci-Tam, Francesca; Shin, Young Ho; Skuja, Andris; Tonwar, Suresh C; Wong, Kak; Abercrombie, Daniel; Allen, Brandon; Azzolini, Virginia; Barbieri, Richard; Baty, Austin; Bauer, Gerry; Bi, Ran; Brandt, Stephanie; Busza, Wit; Cali, Ivan Amos; D'Alfonso, Mariarosaria; Demiragli, Zeynep; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Harris, Philip; Hsu, Dylan; Hu, Miao; Iiyama, Yutaro; Innocenti, Gian Michele; Klute, Markus; Kovalskyi, Dmytro; Lee, Yen-Jie; Levin, Andrew; Luckey, Paul David; Maier, Benedikt; Marini, Andrea Carlo; Mcginn, Christopher; Mironov, Camelia; Narayanan, Siddharth; Niu, Xinmei; Paus, Christoph; Roland, Christof; Roland, Gunther; Stephans, George; Sumorok, Konstanty; Tatar, Kaya; Velicanu, Dragos; Wang, Jing; Wang, Ta-Wei; Wyslouch, Bolek; Zhaozhong, Shi; Benvenuti, Alberto; Chatterjee, Rajdeep Mohan; Evans, Andrew; Hansen, Peter; Kalafut, Sean; Kubota, Yuichi; Lesko, Zachary; Mans, Jeremy; Nourbakhsh, Shervin; Ruckstuhl, Nicole; Rusack, Roger; Turkewitz, Jared; Wadud, Mohammad Abrar; Acosta, John Gabriel; Oliveros, Sandra; Avdeeva, Ekaterina; Bloom, Kenneth; Claes, Daniel R; Fangmeier, Caleb; Golf, Frank; Gonzalez Suarez, Rebeca; Kamalieddin, Rami; Kravchenko, Ilya; Monroy, Jose; Siado, Joaquin Emilo; Snow, Gregory R; Stieger, Benjamin; Godshalk, Andrew; Harrington, Charles; Iashvili, Ia; Kharchilava, Avto; Nguyen, Duong; Parker, Ashley; Rappoccio, Salvatore; Roozbahani, Bahareh; Barberis, Emanuela; Freer, Chad; Hortiangtham, Apichart; Morse, David Michael; Orimoto, Toyoko; Teixeira De Lima, Rafael; Wamorkar, Tanvi; Wang, Bingran; Wisecarver, Andrew; Wood, Darien; Bhattacharya, Saptaparna; Charaf, Otman; Hahn, Kristan Allan; Mucia, Nicholas; Odell, Nathaniel; Schmitt, Michael Henry; Sung, Kevin; Trovato, Marco; Velasco, Mayda; Bucci, Rachael; Dev, Nabarun; Hildreth, Michael; Hurtado Anampa, Kenyi; Jessop, Colin; Karmgard, Daniel John; Kellams, Nathan; Lannon, Kevin; Li, Wenzhao; Loukas, Nikitas; Marinelli, Nancy; Meng, Fanbo; Mueller, Charles; Musienko, Yuri; Planer, Michael; Reinsvold, Allison; Ruchti, Randy; Siddireddy, Prasanna; Smith, Geoffrey; Taroni, Silvia; Wayne, Mitchell; Wightman, Andrew; Wolf, Matthias; Woodard, Anna; Alimena, Juliette; Antonelli, Louis; Bylsma, Ben; Durkin, Lloyd Stanley; Flowers, Sean; Francis, Brian; Hart, Andrew; Hill, Christopher; Ji, Weifeng; Ling, Ta-Yung; Luo, Wuming; Winer, Brian L; Wulsin, Howard Wells; Cooperstein, Stephane; Elmer, Peter; Hardenbrook, Joshua; Hebda, Philip; Higginbotham, Samuel; Kalogeropoulos, Alexis; Lange, David; Lucchini, Marco Toliman; Luo, Jingyu; Marlow, Daniel; Mei, Kelvin; Ojalvo, Isabel; Olsen, James; Palmer, Christopher; Piroué, Pierre; Salfeld-Nebgen, Jakob; Stickland, David; Tully, Christopher; Malik, Sudhir; Norberg, Scarlet; Barker, Anthony; Barnes, Virgil E; Gutay, Laszlo; Jones, Matthew; Jung, Andreas Werner; Khatiwada, Ajeeta; Mahakud, Bibhuprasad; Miller, David Harry; Neumeister, Norbert; Peng, Cheng-Chieh; Qiu, Hao; Schulte, Jan-Frederik; Sun, Jian; Wang, Fuqiang; Xiao, Rui; Xie, Wei; Cheng, Tongguang; Dolen, James; Parashar, Neeti; Chen, Zhenyu; Ecklund, Karl Matthew; Freed, Sarah; Geurts, Frank JM; Guilbaud, Maxime; Kilpatrick, Matthew; Li, Wei; Michlin, Benjamin; Padley, Brian Paul; Roberts, Jay; Rorie, Jamal; Shi, Wei; Tran, Benjamin; Tu, Zhoudunming; Zabel, James; Zhang, Aobo; Bodek, Arie; de Barbaro, Pawel; Demina, Regina; Duh, Yi-ting; Dulemba, Joseph Lynn; Fallon, Colin; Ferbel, Thomas; Galanti, Mario; Garcia-Bellido, Aran; Han, Jiyeon; Hindrichs, Otto; Khukhunaishvili, Aleko; Lo, Kin Ho; Tan, Ping; Taus, Rhys; Verzetti, Mauro; Agapitos, Antonis; Chou, John Paul; Gershtein, Yuri; Gómez Espinosa, Tirso Alejandro; Halkiadakis, Eva; Heindl, Maximilian; Hughes, Elliot; Kaplan, Steven; Kunnawalkam Elayavalli, Raghav; Kyriacou, Savvas; Lath, Amitabh; Montalvo, Roy; Nash, Kevin; Osherson, Marc; Saka, Halil; Salur, Sevil; Schnetzer, Steve; Sheffield, David; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Thomassen, Peter; Walker, Matthew; Delannoy, Andrés G; Heideman, Joseph; Riley, Grant; Rose, Keith; Spanier, Stefan; Thapa, Krishna; Bouhali, Othmane; Castaneda Hernandez, Alfredo; Celik, Ali; Dalchenko, Mykhailo; De Mattia, Marco; Delgado, Andrea; Dildick, Sven; Eusebi, Ricardo; Gilmore, Jason; Huang, Tao; Kamon, Teruki; Luo, Sifu; Mueller, Ryan; Pakhotin, Yuriy; Patel, Rishi; Perloff, Alexx; Perniè, Luca; Rathjens, Denis; Safonov, Alexei; Tatarinov, Aysen; Akchurin, Nural; Damgov, Jordan; De Guio, Federico; Dudero, Phillip Russell; Kunori, Shuichi; Lamichhane, Kamal; Lee, Sung Won; Mengke, Tielige; Muthumuni, Samila; Peltola, Timo; Undleeb, Sonaina; Volobouev, Igor; Wang, Zhixing; Greene, Senta; Gurrola, Alfredo; Janjam, Ravi; Johns, Willard; Maguire, Charles; Melo, Andrew; Ni, Hong; Padeken, Klaas; Ruiz Alvarez, José David; Sheldon, Paul; Tuo, Shengquan; Velkovska, Julia; Verweij, Marta; Xu, Qiao; Arenton, Michael Wayne; Barria, Patrizia; Cox, Bradley; Hirosky, Robert; Joyce, Matthew; Ledovskoy, Alexander; Li, Hengne; Neu, Christopher; Sinthuprasith, Tutanon; Wang, Yanchu; Wolfe, Evan; Xia, Fan; Harr, Robert; Karchin, Paul Edmund; Poudyal, Nabin; Sturdy, Jared; Thapa, Prakash; Zaleski, Shawn; Brodski, Michael; Buchanan, James; Caillol, Cécile; Carlsmith, Duncan; Dasu, Sridhara; Dodd, Laura; Duric, Senka; Gomber, Bhawna; Grothe, Monika; Herndon, Matthew; Hervé, Alain; Hussain, Usama; Klabbers, Pamela; Lanaro, Armando; Levine, Aaron; Long, Kenneth; Loveless, Richard; Ruggles, Tyler; Savin, Alexander; Smith, Nicholas; Smith, Wesley H; Woods, Nathaniel

2018-01-01

The elliptic azimuthal anisotropy coefficient ($v_2$) is measured for charm ($ {\\mathrm{D^0}} $) and strange ($ {\\mathrm{K^0_S}} $, $ \\Lambda $, $ \\Xi^-$, and $ \\Omega^-$) hadrons, using a data sample of pPb collisions collected by the CMS experiment, at a nucleon-nucleon center-of-mass energy ${\\sqrt {\\smash [b]{s_{_{\\mathrm {NN}}}}}} = $ 8.16 TeV. A significant positive $v_2$ signal from long-range azimuthal correlations is observed for all particle species in high-multiplicity pPb collisions. The measurement represents the first observation of possible long-range collectivity for open heavy flavor hadrons in small systems. The results suggest that charm quarks have a smaller $v_2$ than the lighter quarks, probably reflecting a weaker collective behavior. This effect is not seen in the larger PbPb collision system at ${\\sqrt {\\smash [b]{s_{_{\\mathrm {NN}}}}}} = $ 5.02 TeV, also presented.

Casting Technology.

Science.gov (United States)

Wright, Michael D.; And Others

1992-01-01

Three articles discuss (1) casting technology as it relates to industry, with comparisons of shell casting, shell molding, and die casting; (2) evaporative pattern casting for metals; and (3) high technological casting with silicone rubber. (JOW)

Manufacturing of Nanostructured Rings from Previously ECAE-Processed AA5083 Alloy by Isothermal Forging

Directory of Open Access Journals (Sweden)

C. J. Luis

2013-01-01

Full Text Available The manufacturing of a functional hollow mechanical element or ring of the AA5083 alloy previously equal channel angular extrusion (ECAE processed, which presents a submicrometric microstructure, is dealt with. For this purpose, the design of two isothermal forging dies (preform and final shape is carried out using the design of experiments (DOE methodology. Moreover, after manufacturing the dies and carrying out tests so as to achieve real rings, the mechanical properties of these rings are analysed as well as their microstructure. Furthermore, a comparison between the different forged rings is made from ECAE-processed material subjected to different heat treatments, previous to the forging stage. On the other hand, the ring forging process is modelled through the use of finite element simulation in order to improve the die design and to study the force required for the isothermal forging, the damage value, and the strain the material predeformed by ECAE has undergone. With this present research work, it is intended to improve the knowledge about the mechanical properties of nanostructured material and the applicability of this material to industrial processes that allow the manufacturing of functional parts.

Elliptic flow of charm and strange hadrons in high-multiplicity pPb collisions at $\\sqrt{s_{_{NN}}} = 8.16~\\mathrm{TeV}$

CERN Document Server

CMS Collaboration

2018-01-01

First measurements of the elliptic flow of prompt D$^{0}$ mesons in comparison to $\\mathrm{K^0_S}$, $\\Lambda$, $\\Xi^{-}$, and $\\Omega^{-}$ hadrons in pPb collisions at $\\sqrt{s_{_{NN}}} = 8.16~\\mathrm{TeV}$ are reported. The results are based on data collected by the CMS experiment at the LHC and are presented for particles at midrapidity with transverse momentum up to 8 GeV/c after correcting for the contribution of back-to-back jet correlations. The results are compared to PbPb collision data at $\\sqrt{s_{_{NN}}} = 5.02~\\mathrm{TeV}$ for $30-50\\%$ centrality. A significant elliptic flow ($v_2$) signal is observed for all particles, in very high-multiplicity ($\\sim 200$ charged particles) pPb events. When divided by the number of constituent quarks and studied as function of the transverse kinetic energy per quark, the D$^{0}$ $v_2$ values are observed to be significantly smaller than those of light flavor particles, an effect not observed in PbPb collisions. These results show a weaker collective flow assoc...

On the quench sensitivity of 7010 aluminum alloy forgings in the overaged condition

Energy Technology Data Exchange (ETDEWEB)

Tiryakioğlu, Murat, E-mail: m.tiryakioglu@unf.edu [School of Engineering, University of North Florida, Jacksonville, FL 32224 (United States); Robinson, Jeremy S. [Department of Mechanical, Aeronautical and Biomedical Engineering, University of Limerick, Limerick (Ireland); Eason, Paul D. [School of Engineering, University of North Florida, Jacksonville, FL 32224 (United States)

2014-11-17

The quench sensitivity of an overaged 7010 alloy forging was characterized by tensile and Vickers hardness tests, as well as scanning electron microscopy. Longitudinal tensile specimens, excised from a rectilinear open die forging were cooled from the solution treatment temperature following thirty-two different cooling paths including interrupted and delayed quenches. SEM analysis of the microstructure showed that quench precipitates were (i) Al{sub 2}CuMg (S) which nucleated heterogeneously on grain boundaries and (ii) Mg(Zn,Cu,Al){sub 2} (η) on grain boundaries, dispersoid bands, subgrain boundaries as well as in the aluminum matrix. The quench sensitivity of the alloy's yield strength and Vickers hardness was modeled simultaneously by quadruple-C curves, using an improved methodology for Quench Factor Analysis. The four C-curves used in the model represented loss of solute by (i) precipitation of S on grain boundaries, and precipitation of η (ii) on grain boundaries and dispersoid bands, (iii) on subgrain boundaries and (iv) in the matrix. The model yielded coefficient of determination (R{sup 2}) values of 0.967 and 0.974 for yield strength and Vickers hardness, respectively. The model and the implications of the results are discussed in this paper.

Prospective evaluation of the diagnostic value of sensitive KIT D816V mutation analysis of blood in adults with suspected systemic mastocytosis

DEFF Research Database (Denmark)

Kielsgaard Kristensen, Thomas; Vestergaard, H; Bindslev-Jensen, C

2017-01-01

BACKGROUND: Sensitive KIT D816V mutation analysis of blood has been proposed to guide bone marrow (BM) investigation in suspected systemic mastocytosis (SM). The aim of this prospective study was for the first time to compare the D816V status of the "screening blood sample" used to guide BM biopsy...... in suspected SM to the outcome of the subsequent BM investigation. METHODS: Fifty-eight adult patients with suspected SM were included. The outcome of sensitive KIT D816V analysis of blood was compared to the result of the BM investigation. RESULTS: Screening blood samples from 44 of 58 patients tested D816V...... patients did not fulfill any diagnostic SM criteria (excluding tryptase criterion). Of the 48 SM patients, 90% tested D816V-positive. Thirteen SM patients presented with Hymenoptera venom-induced anaphylaxis, no skin lesions, and baseline serum tryptase ≤20 ng/mL. Of these, 92% tested D816V...

Piping equipment; Materiel petrole

Energy Technology Data Exchange (ETDEWEB)

NONE

2001-07-01

This 'blue bible' of the perfect piping-man appeals to end-users of industrial facilities of the petroleum and chemical industries (purchase services, standardization, new works, maintenance) but also to pipe-makers and hollow-ware makers. It describes the characteristics of materials (carbon steels, stainless steels, alloyed steels, special alloys) and the dimensions of pipe elements: pipes, welding fittings, flanges, sealing products, forged steel fittings, forged steel valves, cast steel valves, ASTM standards, industrial valves. (J.S.)

Annealing behavior of a cast Mg-Gd-Y-Zr alloy with necklace fine grains developed under hot deformation

Energy Technology Data Exchange (ETDEWEB)

Yang, Yi [Educational Key Laboratory of Nonferrous Metal Materials Science and Engineering, School of Materials Science and Engineering, Central South University, Changsha 410083 (China); Yang, Xuyue, E-mail: yangxuyue@mail.csu.edu.cn [Educational Key Laboratory of Nonferrous Metal Materials Science and Engineering, School of Materials Science and Engineering, Central South University, Changsha 410083 (China); Nonferrous Metal Oriented Advanced Structural Materials and Manufacturing Cooperative Innovation Center, Central South University, Changsha 410083 (China); Xiao, Zhenyu; Zhang, Duxiu [Educational Key Laboratory of Nonferrous Metal Materials Science and Engineering, School of Materials Science and Engineering, Central South University, Changsha 410083 (China); Wang, Jun [Institute for Frontier Materials, Deakin University, Geelong, VIC 3216 (Australia); Sakai, Taku [UEC Tokyo (The University of Electro-Communications), Chofu, Tokyo 182-8585 (Japan)

2017-03-14

The microstructure and texture development of a cast Mg-Gd-Y-Zr alloy during hot deformation and subsequent annealing were investigated by optical microscopy (OM) and electron backscattered diffraction (EBSD) technology. Initial microstructures with partially and fully developed new fine grains (NFGs), separately attended by continuous or interrupted hot forging, were various mixed grain structures composed of NFGs in necklace and retained coarse grains. It is shown that, during annealing, the development of grain size can be divided into three stages: i.e. an incubation of grain growth, a rapid coarsening and a normal grain growth. After a long time annealing of over 10{sup 4} ks at 693 K, the average grain size for samples continuous compressed to ε=1.2 and those interrupted compressed to ε=1.6 were close. Moreover, orientations of such strain-induced fine grains were relatively randomly distributed, leading to a weakened basal texture, while the basal plane of retained coarse grains were perpendicular to the forging direction. Such texture even became weaker during subsequent annealing. The results show that the development of necklace NFGs during hot deformation can be effective for homogeneous grain refinement under subsequent annealing.

[A method of temperature measurement for hot forging with surface oxide based on infrared spectroscopy].

Science.gov (United States)

Zhang, Yu-cun; Qi, Yan-de; Fu, Xian-bin

2012-05-01

High temperature large forging is covered with a thick oxide during forging. It leads to a big measurement data error. In this paper, a method of measuring temperature based on infrared spectroscopy is presented. It can effectively eliminate the influence of surface oxide on the measurement of temperature. The method can measure the surface temperature and emissivity of the oxide directly using the infrared spectrum. The infrared spectrum is radiated from surface oxide of forging. Then it can derive the real temperature of hot forging covered with the oxide using the heat exchange equation. In order to greatly restrain interference spectroscopy through included in the received infrared radiation spectrum, three interference filter system was proposed, and a group of optimal gap parameter values using spectral simulation were obtained. The precision of temperature measurement was improved. The experimental results show that the method can accurately measure the surface temperature of high temperature forging covered with oxide. It meets the requirements of measurement accuracy, and the temperature measurement method is feasible according to the experiment result.

Modelling and Testing of Friction in Forging

DEFF Research Database (Denmark)

Bay, Niels

2007-01-01

Knowledge about friction is still limited in forging. The theoretical models applied presently for process analysis are not satisfactory compared to the advanced and detailed studies possible to carry out by plastic FEM analyses and more refined models have to be based on experimental testing...

Forging Inclusive Solutions: Experiential Earth Charter Education

Science.gov (United States)

Hill, Linda D.

2010-01-01

Forging Inclusive Solutions describes the aims, methodology and outcomes of Inclusive Leadership Adventures, an experiential education curriculum for exploring the Earth Charter. Experiential education builds meaningful relationships, skills, awareness and an inclusive community based on the Earth Charter principles. When we meet people where they…

Spray cast Al-Si base alloys for stiffness and fatigue strength requirements

International Nuclear Information System (INIS)

Courbiere, M.; Mocellin, A.

1993-01-01

Hypereutectic AlSiFe spray-cast alloys exhibit properties similar to those of metal-matrix composite (MMC's) : high Young's modulus and a low coefficient of thermal expansion. These physical properties can be adjusted by changing the Si content of the alloy. The refinement of the microstructure is produced by formation of a large amount of nuclei in the spray. Consolidation done by extrusion (bars, tubes or profiles) and/or forging leads to high mechanical properties, especially very good dynamic properties. High fatigue properties coupled with high modulus, good high temperature behaviour and low thermal expansion, allow their use for applications in the automotive industry. In opposition to MMC's, these materials present the advantage of easy recycling and easy machinability as it is the case for the conventional AlSi alloys. The low oxygen content allows quality joining with conventional arc welding techniques. (orig.)

Influence of Casting Defects on S- N Fatigue Behavior of Ni-Al Bronze

Science.gov (United States)

Sarkar, Aritra; Chakrabarti, Abhishek; Nagesha, A.; Saravanan, T.; Arunmuthu, K.; Sandhya, R.; Philip, John; Mathew, M. D.; Jayakumar, T.

2015-02-01

Nickel-aluminum bronze (NAB) alloys have been used extensively in marine applications such as propellers, couplings, pump casings, and pump impellers due to their good mechanical properties such as tensile strength, creep resistance, and corrosion resistance. However, there have been several instances of in-service failure of the alloy due to high cycle fatigue (HCF). The present paper aims at characterizing the casting defects in this alloy through X-ray radiography and X-ray computed tomography into distinct defect groups having particular defect size and location. HCF tests were carried out on each defect group of as-cast NAB at room temperature by varying the mean stress. A significant decrease in the HCF life was observed with an increase in the tensile mean stress, irrespective of the defect size. Further, a considerable drop in the HCF life was observed with an increase in the size of defects and proximity of the defects to the surface. However, the surface proximity indicated by location of the defect in the sample was seen to override the influence of defect size and maximum cyclic stress. This leads to huge scatter in S- N curve. For a detailed quantitative analysis of defect size and location, an empirical model is developed which was able to minimize the scatter to a significant extent. Further, a concept of critical distance is proposed, beyond which the defect would not have a deleterious consequence on the fatigue behavior. Such an approach was found to be suitable for generating S- N curves for cast NAB.

Inclusive J/$\\psi$ production at forward and backward rapidity in p-Pb collisions at $\\sqrt{s_{NN}}$ = 8.16 TeV

CERN Document Server

Acharya, Shreyasi; The ALICE collaboration; Adamova, Dagmar; Adolfsson, Jonatan; Aggarwal, Madan Mohan; Aglieri Rinella, Gianluca; Agnello, Michelangelo; Agrawal, Neelima; Ahammed, Zubayer; Ahn, Sang Un; Aiola, Salvatore; Akindinov, Alexander; Al-turany, Mohammad; Alam, Sk Noor; Silva De Albuquerque, Danilo; Aleksandrov, Dmitry; Alessandro, Bruno; Alfaro Molina, Jose Ruben; Ali, Yasir; Alici, Andrea; Alkin, Anton; Alme, Johan; Alt, Torsten; Altenkamper, Lucas; Altsybeev, Igor; Andrei, Cristian; Andreou, Dimitra; Andrews, Harry Arthur; Andronic, Anton; Angeletti, Massimo; Anguelov, Venelin; Anson, Christopher Daniel; Anticic, Tome; Antinori, Federico; Antonioli, Pietro; Anwar, Rafay; Apadula, Nicole; Aphecetche, Laurent Bernard; Appelshaeuser, Harald; Arcelli, Silvia; Arnaldi, Roberta; Arnold, Oliver Werner; Arsene, Ionut Cristian; Arslandok, Mesut; Audurier, Benjamin; Augustinus, Andre; Averbeck, Ralf Peter; Azmi, Mohd Danish; Badala, Angela; Baek, Yong Wook; Bagnasco, Stefano; Bailhache, Raphaelle Marie; Bala, Renu; Baldisseri, Alberto; Ball, Markus; Baral, Rama Chandra; Barbano, Anastasia Maria; Barbera, Roberto; Barile, Francesco; Barioglio, Luca; Barnafoldi, Gergely Gabor; Barnby, Lee Stuart; Ramillien Barret, Valerie; Bartalini, Paolo; Barth, Klaus; Bartsch, Esther; Bastid, Nicole; Basu, Sumit; Batigne, Guillaume; Batyunya, Boris; Batzing, Paul Christoph; Bazo Alba, Jose Luis; Bearden, Ian Gardner; Beck, Hans; Bedda, Cristina; Behera, Nirbhay Kumar; Belikov, Iouri; Bellini, Francesca; Bello Martinez, Hector; Bellwied, Rene; Espinoza Beltran, Lucina Gabriela; Belyaev, Vladimir; Bencedi, Gyula; Beole, Stefania; Bercuci, Alexandru; Berdnikov, Yaroslav; Berenyi, Daniel; Bertens, Redmer Alexander; Berzano, Dario; Betev, Latchezar; Bhaduri, Partha Pratim; Bhasin, Anju; Bhat, Inayat Rasool; Bhatt, Himani; Bhattacharjee, Buddhadeb; Bhom, Jihyun; Bianchi, Antonio; Bianchi, Livio; Bianchi, Nicola; Bielcik, Jaroslav; Bielcikova, Jana; Bilandzic, Ante; Biro, Gabor; Biswas, Rathijit; Biswas, Saikat; Blair, Justin Thomas; Blau, Dmitry; Blume, Christoph; Boca, Gianluigi; Bock, Friederike; Bogdanov, Alexey; Boldizsar, Laszlo; Bombara, Marek; Bonomi, Germano; Bonora, Matthias; Borel, Herve; Borissov, Alexander; Borri, Marcello; Botta, Elena; Bourjau, Christian; Bratrud, Lars; Braun-munzinger, Peter; Bregant, Marco; Broker, Theo Alexander; Broz, Michal; Brucken, Erik Jens; Bruna, Elena; Bruno, Giuseppe Eugenio; Budnikov, Dmitry; Buesching, Henner; Bufalino, Stefania; Buhler, Paul; Buncic, Predrag; Busch, Oliver; Buthelezi, Edith Zinhle; Bashir Butt, Jamila; Buxton, Jesse Thomas; Cabala, Jan; Caffarri, Davide; Caines, Helen Louise; Caliva, Alberto; Calvo Villar, Ernesto; Soto Camacho, Rabi; Camerini, Paolo; Capon, Aaron Allan; Carena, Francesco; Carena, Wisla; Carnesecchi, Francesca; Castillo Castellanos, Javier Ernesto; Castro, Andrew John; Casula, Ester Anna Rita; Ceballos Sanchez, Cesar; Chandra, Sinjini; Chang, Beomsu; Chang, Wan; Chapeland, Sylvain; Chartier, Marielle; Chattopadhyay, Subhasis; Chattopadhyay, Sukalyan; Chauvin, Alex; Cheshkov, Cvetan Valeriev; Cheynis, Brigitte; Chibante Barroso, Vasco Miguel; Dobrigkeit Chinellato, David; Cho, Soyeon; Chochula, Peter; Chowdhury, Tasnuva; Christakoglou, Panagiotis; Christensen, Christian Holm; Christiansen, Peter; Chujo, Tatsuya; Chung, Suh-urk; Cicalo, Corrado; Cifarelli, Luisa; Cindolo, Federico; Cleymans, Jean Willy Andre; Colamaria, Fabio Filippo; Colella, Domenico; Collu, Alberto; Colocci, Manuel; Concas, Matteo; Conesa Balbastre, Gustavo; Conesa Del Valle, Zaida; Contreras Nuno, Jesus Guillermo; Cormier, Thomas Michael; Corrales Morales, Yasser; Cortese, Pietro; Cosentino, Mauro Rogerio; Costa, Filippo; Costanza, Susanna; Crkovska, Jana; Crochet, Philippe; Cuautle Flores, Eleazar; Cunqueiro Mendez, Leticia; Dahms, Torsten; Dainese, Andrea; Dani, Sanskruti; Danisch, Meike Charlotte; Danu, Andrea; Das, Debasish; Das, Indranil; Das, Supriya; Dash, Ajay Kumar; Dash, Sadhana; De, Sudipan; De Caro, Annalisa; De Cataldo, Giacinto; De Conti, Camila; De Cuveland, Jan; De Falco, Alessandro; De Gruttola, Daniele; De Marco, Nora; De Pasquale, Salvatore; Derradi De Souza, Rafael; Franz Degenhardt, Hermann; Deisting, Alexander; Deloff, Andrzej; Delsanto, Silvia; Deplano, Caterina; Dhankher, Preeti; Di Bari, Domenico; Di Mauro, Antonio; Di Ruzza, Benedetto; Arteche Diaz, Raul; Dietel, Thomas; Dillenseger, Pascal; Ding, Yanchun; Divia, Roberto; Djuvsland, Oeystein; Dobrin, Alexandru Florin; Domenicis Gimenez, Diogenes; Donigus, Benjamin; Dordic, Olja; Van Doremalen, Lennart Vincent; Dubey, Anand Kumar; Dubla, Andrea; Ducroux, Laurent; Dudi, Sandeep; Duggal, Ashpreet Kaur; Dukhishyam, Mallick; Dupieux, Pascal; Ehlers Iii, Raymond James; Elia, Domenico; Endress, Eric; Engel, Heiko; Epple, Eliane; Erazmus, Barbara Ewa; Erhardt, Filip; Ersdal, Magnus Rentsch; Espagnon, Bruno; Eulisse, Giulio; Eum, Jongsik; Evans, David; Evdokimov, Sergey; Fabbietti, Laura; Faggin, Mattia; Faivre, Julien; Fantoni, Alessandra; Fasel, Markus; Feldkamp, Linus; Feliciello, Alessandro; Feofilov, Grigorii; Fernandez Tellez, Arturo; Ferretti, Alessandro; Festanti, Andrea; Feuillard, Victor Jose Gaston; Figiel, Jan; Araujo Silva Figueredo, Marcel; Filchagin, Sergey; Finogeev, Dmitry; Fionda, Fiorella; Fiorenza, Gabriele; Flor, Fernando; Floris, Michele; Foertsch, Siegfried Valentin; Foka, Panagiota; Fokin, Sergey; Fragiacomo, Enrico; Francescon, Andrea; Francisco, Audrey; Frankenfeld, Ulrich Michael; Fronze, Gabriele Gaetano; Fuchs, Ulrich; Furget, Christophe; Furs, Artur; Fusco Girard, Mario; Gaardhoeje, Jens Joergen; Gagliardi, Martino; Gago Medina, Alberto Martin; Gajdosova, Katarina; Gallio, Mauro; Duarte Galvan, Carlos; Ganoti, Paraskevi; Garabatos Cuadrado, Jose; Garcia-solis, Edmundo Javier; Garg, Kunal; Gargiulo, Corrado; Gasik, Piotr Jan; Gauger, Erin Frances; De Leone Gay, Maria Beatriz; Germain, Marie; Ghosh, Jhuma; Ghosh, Premomoy; Ghosh, Sanjay Kumar; Gianotti, Paola; Giubellino, Paolo; Giubilato, Piero; Glassel, Peter; Gomez Coral, Diego Mauricio; Gomez Ramirez, Andres; Gonzalez, Victor; Gonzalez Zamora, Pedro; Gorbunov, Sergey; Gorlich, Lidia Maria; Gotovac, Sven; Grabski, Varlen; Graczykowski, Lukasz Kamil; Graham, Katie Leanne; Greiner, Leo Clifford; Grelli, Alessandro; Grigoras, Costin; Grigoryev, Vladislav; Grigoryan, Ara; Grigoryan, Smbat; Gronefeld, Julius Maximilian; Grosa, Fabrizio; Grosse-oetringhaus, Jan Fiete; Grosso, Raffaele; Guernane, Rachid; Guerzoni, Barbara; Guittiere, Manuel; Gulbrandsen, Kristjan Herlache; Gunji, Taku; Gupta, Anik; Gupta, Ramni; Bautista Guzman, Irais; Haake, Rudiger; Habib, Michael Karim; Hadjidakis, Cynthia Marie; Hamagaki, Hideki; Hamar, Gergoe; Hamid, Mohammed; Hamon, Julien Charles; Hannigan, Ryan; Haque, Md Rihan; Harris, John William; Harton, Austin Vincent; Hassan, Hadi; Hatzifotiadou, Despina; Hayashi, Shinichi; Heckel, Stefan Thomas; Hellbar, Ernst; Helstrup, Haavard; Herghelegiu, Andrei Ionut; Gonzalez Hernandez, Emma; Herrera Corral, Gerardo Antonio; Herrmann, Florian; Hetland, Kristin Fanebust; Hilden, Timo Eero; Hillemanns, Hartmut; Hills, Christopher; Hippolyte, Boris; Hohlweger, Bernhard; Horak, David; Hornung, Sebastian; Hosokawa, Ritsuya; Hota, Jyotishree; Hristov, Peter Zahariev; Huang, Chun-lu; Hughes, Charles; Huhn, Patrick; Humanic, Thomas; Hushnud, Hushnud; Hussain, Nur; Hussain, Tahir; Hutter, Dirk; Hwang, Dae Sung; Iddon, James Philip; Iga Buitron, Sergio Arturo; Ilkaev, Radiy; Inaba, Motoi; Ippolitov, Mikhail; Islam, Md Samsul; Ivanov, Marian; Ivanov, Vladimir; Izucheev, Vladimir; Jacak, Barbara; Jacazio, Nicolo; Jacobs, Peter Martin; Jadhav, Manoj Bhanudas; Jadlovska, Slavka; Jadlovsky, Jan; Jaelani, Syaefudin; Jahnke, Cristiane; Jakubowska, Monika Joanna; Janik, Malgorzata Anna; Jena, Chitrasen; Jercic, Marko; Jimenez Bustamante, Raul Tonatiuh; Jin, Muqing; Jones, Peter Graham; Jusko, Anton; Kalinak, Peter; Kalweit, Alexander Philipp; Kang, Ju Hwan; Kaplin, Vladimir; Kar, Somnath; Karasu Uysal, Ayben; Karavichev, Oleg; Karavicheva, Tatiana; Karczmarczyk, Przemyslaw; Karpechev, Evgeny; Kebschull, Udo Wolfgang; Keidel, Ralf; Keijdener, Darius Laurens; Keil, Markus; Ketzer, Bernhard Franz; Khabanova, Zhanna; Khan, Ahsan Mehmood; Khan, Shaista; Khan, Shuaib Ahmad; Khanzadeev, Alexei; Kharlov, Yury; Khatun, Anisa; Khuntia, Arvind; Kielbowicz, Miroslaw Marek; Kileng, Bjarte; Kim, Byungchul; Kim, Daehyeok; Kim, Dong Jo; Kim, Eun Joo; Kim, Hyeonjoong; Kim, Jinsook; Kim, Jiyoung; Kim, Minjung; Kim, Se Yong; Kim, Taejun; Kim, Taesoo; Kirsch, Stefan; Kisel, Ivan; Kiselev, Sergey; Kisiel, Adam Ryszard; Klay, Jennifer Lynn; Klein, Carsten; Klein, Jochen; Klein-boesing, Christian; Klewin, Sebastian; Kluge, Alexander; Knichel, Michael Linus; Knospe, Anders Garritt; Kobdaj, Chinorat; Varga-kofarago, Monika; Kohler, Markus Konrad; Kollegger, Thorsten; Kondratyeva, Natalia; Kondratyuk, Evgeny; Konevskikh, Artem; Konyushikhin, Maxim; Kovalenko, Oleksandr; Kovalenko, Vladimir; Kowalski, Marek; Kralik, Ivan; Kravcakova, Adela; Kreis, Lukas; Krivda, Marian; Krizek, Filip; Kruger, Mario; Kryshen, Evgeny; Krzewicki, Mikolaj; Kubera, Andrew Michael; Kucera, Vit; Kuhn, Christian Claude; Kuijer, Paulus Gerardus; Kumar, Jitendra; Kumar, Lokesh; Kumar, Shyam; Kundu, Sourav; Kurashvili, Podist; Kurepin, Alexander; Kurepin, Alexey; Kuryakin, Alexey; Kushpil, Svetlana; Kweon, Min Jung; Kwon, Youngil; La Pointe, Sarah Louise; La Rocca, Paola; Lai, Yue Shi; Lakomov, Igor; Langoy, Rune; Lapidus, Kirill; Lara Martinez, Camilo Ernesto; Lardeux, Antoine Xavier; Larionov, Pavel; Laudi, Elisa; Lavicka, Roman; Lea, Ramona; Leardini, Lucia; Lee, Seongjoo; Lehas, Fatiha; Lehner, Sebastian; Lehrbach, Johannes; Lemmon, Roy Crawford; Leon Monzon, Ildefonso; Levai, Peter; Li, Xiaomei; Li, Xing Long; Lien, Jorgen Andre; Lietava, Roman; Lim, Bong-hwi; Lindal, Svein; Lindenstruth, Volker; Lindsay, Scott William; Lippmann, Christian; Lisa, Michael Annan; Litichevskyi, Vladyslav; Liu, Alwina; Ljunggren, Hans Martin; Llope, William; Lodato, Davide Francesco; Loginov, Vitaly; Loizides, Constantinos; Loncar, Petra; Lopez, Xavier Bernard; Lopez Torres, Ernesto; Lowe, Andrew John; Luettig, Philipp Johannes; Luhder, Jens Robert; Lunardon, Marcello; Luparello, Grazia; Lupi, Matteo; Maevskaya, Alla; Mager, Magnus; Mahmood, Sohail Musa; Maire, Antonin; Majka, Richard Daniel; Malaev, Mikhail; Malik, Qasim Waheed; Malinina, Liudmila; Mal'kevich, Dmitry; Malzacher, Peter; Mamonov, Alexander; Manko, Vladislav; Manso, Franck; Manzari, Vito; Mao, Yaxian; Marchisone, Massimiliano; Mares, Jiri; Margagliotti, Giacomo Vito; Margotti, Anselmo; Margutti, Jacopo; Marin, Ana Maria; Markert, Christina; Marquard, Marco; Martin, Nicole Alice; Martinengo, Paolo; Martinez, Jacobb Lee; Martinez Hernandez, Mario Ivan; Martinez-garcia, Gines; Martinez Pedreira, Miguel; Masciocchi, Silvia; Masera, Massimo; Masoni, Alberto; Massacrier, Laure Marie; Masson, Erwann; Mastroserio, Annalisa; Mathis, Andreas Michael; Toledo Matuoka, Paula Fernanda; Matyja, Adam Tomasz; Mayer, Christoph; Mazzilli, Marianna; Mazzoni, Alessandra Maria; Meddi, Franco; Melikyan, Yuri; Menchaca-rocha, Arturo Alejandro; Meninno, Elisa; Mercado-perez, Jorge; Meres, Michal; Soncco Meza, Carlos; Mhlanga, Sibaliso; Miake, Yasuo; Micheletti, Luca; Mieskolainen, Matti Mikael; Mihaylov, Dimitar Lubomirov; Mikhaylov, Konstantin; Mischke, Andre; Mishra, Aditya Nath; Miskowiec, Dariusz Czeslaw; Mitra, Jubin; Mitu, Ciprian Mihai; Mohammadi, Naghmeh; Mohanty, Auro Prasad; Mohanty, Bedangadas; Khan, Mohammed Mohisin; Moreira De Godoy, Denise Aparecida; Perez Moreno, Luis Alberto; Moretto, Sandra; Morreale, Astrid; Morsch, Andreas; Muccifora, Valeria; Mudnic, Eugen; Muhlheim, Daniel Michael; Muhuri, Sanjib; Mukherjee, Maitreyee; Mulligan, James Declan; Gameiro Munhoz, Marcelo; Munning, Konstantin; Arratia Munoz, Miguel Ignacio; Munzer, Robert Helmut; Murakami, Hikari; Murray, Sean; Musa, Luciano; Musinsky, Jan; Myers, Corey James; Myrcha, Julian Wojciech; Naik, Bharati; Nair, Rahul; Nandi, Basanta Kumar; Nania, Rosario; Nappi, Eugenio; Narayan, Amrendra; Naru, Muhammad Umair; Nassirpour, Adrian Fereydon; Ferreira Natal Da Luz, Pedro Hugo; Nattrass, Christine; Rosado Navarro, Sebastian; Nayak, Kishora; Nayak, Ranjit; Nayak, Tapan Kumar; Nazarenko, Sergey; Negrao De Oliveira, Renato Aparecido; Nellen, Lukas; Nesbo, Simon Voigt; Neskovic, Gvozden; Ng, Fabian; Nicassio, Maria; Niedziela, Jeremi; Nielsen, Borge Svane; Nikolaev, Sergey; Nikulin, Sergey; Nikulin, Vladimir; Noferini, Francesco; Nomokonov, Petr; Nooren, Gerardus; Cabanillas Noris, Juan Carlos; Norman, Jaime; Nyanin, Alexander; Nystrand, Joakim Ingemar; Oh, Hoonjung; Ohlson, Alice Elisabeth; Oleniacz, Janusz; Oliveira Da Silva, Antonio Carlos; Oliver, Michael Henry; Onderwaater, Jacobus; Oppedisano, Chiara; Orava, Risto; Oravec, Matej; Ortiz Velasquez, Antonio; Oskarsson, Anders Nils Erik; Otwinowski, Jacek Tomasz; Oyama, Ken; Pachmayer, Yvonne Chiara; Pacik, Vojtech; Pagano, Davide; Paic, Guy; Palni, Prabhakar; Pan, Jinjin; Pandey, Ashutosh Kumar; Panebianco, Stefano; Papikyan, Vardanush; Pareek, Pooja; Park, Jonghan; Parkkila, Jasper Elias; Parmar, Sonia; Passfeld, Annika; Pathak, Surya Prakash; Patra, Rajendra Nath; Paul, Biswarup; Pei, Hua; Peitzmann, Thomas; Peng, Xinye; Pereira, Luis Gustavo; Pereira Da Costa, Hugo Denis Antonio; Peresunko, Dmitry Yurevich; Perez Lezama, Edgar; Peskov, Vladimir; Pestov, Yury; Petracek, Vojtech; Petrovici, Mihai; Petta, Catia; Peretti Pezzi, Rafael; Piano, Stefano; Pikna, Miroslav; Pillot, Philippe; Ozelin De Lima Pimentel, Lais; Pinazza, Ombretta; Pinsky, Lawrence; Pisano, Silvia; Piyarathna, Danthasinghe; Ploskon, Mateusz Andrzej; Planinic, Mirko; Pliquett, Fabian; Pluta, Jan Marian; Pochybova, Sona; Podesta Lerma, Pedro Luis Manuel; Poghosyan, Martin; Polishchuk, Boris; Poljak, Nikola; Poonsawat, Wanchaloem; Pop, Amalia; Poppenborg, Hendrik; Porteboeuf, Sarah Julie; Pozdniakov, Valeriy; Prasad, Sidharth Kumar; Preghenella, Roberto; Prino, Francesco; Pruneau, Claude Andre; Pshenichnov, Igor; Puccio, Maximiliano; Punin, Valery; Putschke, Jorn Henning; Raha, Sibaji; Rajput, Sonia; Rak, Jan; Rakotozafindrabe, Andry Malala; Ramello, Luciano; Rami, Fouad; Raniwala, Rashmi; Raniwala, Sudhir; Rasanen, Sami Sakari; Rascanu, Bogdan Theodor; Ratza, Viktor; Ravasenga, Ivan; Read, Kenneth Francis; Redlich, Krzysztof; Rehman, Attiq Ur; Reichelt, Patrick Simon; Reidt, Felix; Ren, Xiaowen; Renfordt, Rainer Arno Ernst; Reshetin, Andrey; Revol, Jean-pierre; Reygers, Klaus Johannes; Riabov, Viktor; Richert, Tuva Ora Herenui; Richter, Matthias Rudolph; Riedler, Petra; Riegler, Werner; Riggi, Francesco; Ristea, Catalin-lucian; Rode, Sudhir Pandurang; Rodriguez Cahuantzi, Mario; Roeed, Ketil; Rogalev, Roman; Rogochaya, Elena; Rohr, David Michael; Roehrich, Dieter; Rokita, Przemyslaw Stefan; Ronchetti, Federico; Dominguez Rosas, Edgar; Roslon, Krystian; Rosnet, Philippe; Rossi, Andrea; Rotondi, Alberto; Roukoutakis, Filimon; Roy, Christelle Sophie; Roy, Pradip Kumar; Vazquez Rueda, Omar; Rui, Rinaldo; Rumyantsev, Boris; Rustamov, Anar; Ryabinkin, Evgeny; Ryabov, Yury; Rybicki, Andrzej; Saarinen, Sampo; Sadhu, Samrangy; Sadovskiy, Sergey; Safarik, Karel; Saha, Sumit Kumar; Sahoo, Baidyanath; Sahoo, Pragati; Sahoo, Raghunath; Sahoo, Sarita; Sahu, Pradip Kumar; Saini, Jogender; Sakai, Shingo; Saleh, Mohammad Ahmad; Sambyal, Sanjeev Singh; Samsonov, Vladimir; Sandoval, Andres; Sarkar, Amal; Sarkar, Debojit; Sarkar, Nachiketa; Sarma, Pranjal; Sas, Mike Henry Petrus; Scapparone, Eugenio; Scarlassara, Fernando; Schaefer, Brennan; Scheid, Horst Sebastian; Schiaua, Claudiu Cornel; Schicker, Rainer Martin; Schmidt, Christian Joachim; Schmidt, Hans Rudolf; Schmidt, Marten Ole; Schmidt, Martin; Schmidt, Nicolas Vincent; Schukraft, Jurgen; Schutz, Yves Roland; Schwarz, Kilian Eberhard; Schweda, Kai Oliver; Scioli, Gilda; Scomparin, Enrico; Sefcik, Michal; Seger, Janet Elizabeth; Sekiguchi, Yuko; Sekihata, Daiki; Selyuzhenkov, Ilya; Senosi, Kgotlaesele; Senyukov, Serhiy; Serradilla Rodriguez, Eulogio; Sett, Priyanka; Sevcenco, Adrian; Shabanov, Arseniy; Shabetai, Alexandre; Shahoyan, Ruben; Shaikh, Wadut; Shangaraev, Artem; Sharma, Anjali; Sharma, Ankita; Sharma, Meenakshi; Sharma, Natasha; Sheikh, Ashik Ikbal; Shigaki, Kenta; Shimomura, Maya; Shirinkin, Sergey; Shou, Qiye; Shtejer Diaz, Katherin; Sibiryak, Yury; Siddhanta, Sabyasachi; Sielewicz, Krzysztof Marek; Siemiarczuk, Teodor; Silvermyr, David Olle Rickard; Simatovic, Goran; Simonetti, Giuseppe; Singaraju, Rama Narayana; Singh, Ranbir; Singh, Randhir; Singhal, Vikas; Sarkar - Sinha, Tinku; Sitar, Branislav; Sitta, Mario; Skaali, Bernhard; Slupecki, Maciej; Smirnov, Nikolai; Snellings, Raimond; Snellman, Tomas Wilhelm; Song, Jihye; Soramel, Francesca; Sorensen, Soren Pontoppidan; Sozzi, Federica; Sputowska, Iwona Anna; Stachel, Johanna; Stan, Ionel; Stankus, Paul; Stenlund, Evert Anders; Stocco, Diego; Storetvedt, Maksim Melnik; Strmen, Peter; Alarcon Do Passo Suaide, Alexandre; Sugitate, Toru; Suire, Christophe Pierre; Suleymanov, Mais Kazim Oglu; Suljic, Miljenko; Sultanov, Rishat; Sumbera, Michal; Sumowidagdo, Suharyo; Suzuki, Ken; Swain, Sagarika; Szabo, Alexander; Szarka, Imrich; Tabassam, Uzma; Takahashi, Jun; Tambave, Ganesh Jagannath; Tanaka, Naoto; Tarhini, Mohamad; Tariq, Mohammad; Tarzila, Madalina-gabriela; Tauro, Arturo; Tejeda Munoz, Guillermo; Telesca, Adriana; Terrevoli, Cristina; Teyssier, Boris; Thakur, Dhananjaya; Thakur, Sanchari; Thomas, Deepa; Thoresen, Freja; Tieulent, Raphael Noel; Tikhonov, Anatoly; Timmins, Anthony Robert; Toia, Alberica; Topilskaya, Nataliya; Toppi, Marco; Rojas Torres, Solangel; Tripathy, Sushanta; Trogolo, Stefano; Trombetta, Giuseppe; Tropp, Lukas; Trubnikov, Victor; Trzaska, Wladyslaw Henryk; Trzcinski, Tomasz Piotr; Trzeciak, Barbara Antonina; Tsuji, Tomoya; Tumkin, Alexandr; Turrisi, Rosario; Tveter, Trine Spedstad; Ullaland, Kjetil; Umaka, Ejiro Naomi; Uras, Antonio; Usai, Gianluca; Utrobicic, Antonija; Vala, Martin; Van Hoorne, Jacobus Willem; Van Leeuwen, Marco; Vande Vyvre, Pierre; Varga, Dezso; Diozcora Vargas Trevino, Aurora; Vargyas, Marton; Varma, Raghava; Vasileiou, Maria; Vasiliev, Andrey; Vauthier, Astrid; Vazquez Doce, Oton; Vechernin, Vladimir; Veen, Annelies Marianne; Vercellin, Ermanno; Vergara Limon, Sergio; Vermunt, Luuk; Vernet, Renaud; Vertesi, Robert; Vickovic, Linda; Viinikainen, Jussi Samuli; Vilakazi, Zabulon; Villalobos Baillie, Orlando; Villatoro Tello, Abraham; Vinogradov, Alexander; Virgili, Tiziano; Vislavicius, Vytautas; Vodopyanov, Alexander; Volkl, Martin Andreas; Voloshin, Kirill; Voloshin, Sergey; Volpe, Giacomo; Von Haller, Barthelemy; Vorobyev, Ivan; Voscek, Dominik; Vranic, Danilo; Vrlakova, Janka; Wagner, Boris; Wang, Hongkai; Wang, Mengliang; Watanabe, Yosuke; Weber, Michael; Weber, Steffen Georg; Wegrzynek, Adam; Weiser, Dennis Franz; Wenzel, Sandro Christian; Wessels, Johannes Peter; Westerhoff, Uwe; Whitehead, Andile Mothegi; Wiechula, Jens; Wikne, Jon; Wilk, Grzegorz Andrzej; Wilkinson, Jeremy John; Willems, Guido Alexander; Williams, Crispin; Willsher, Emily; Windelband, Bernd Stefan; Witt, William Edward; Xu, Ran; Yalcin, Serpil; Yamakawa, Kosei; Yano, Satoshi; Yin, Zhongbao; Yokoyama, Hiroki; Yoo, In-kwon; Yoon, Jin Hee; Yurchenko, Volodymyr; Zaccolo, Valentina; Zaman, Ali; Zampolli, Chiara; Correa Zanoli, Henrique Jose; Zardoshti, Nima; Zarochentsev, Andrey; Zavada, Petr; Zavyalov, Nikolay; Zbroszczyk, Hanna Paulina; Zhalov, Mikhail; Zhang, Xiaoming; Zhang, Yonghong; Zhang, Zuman; Zhao, Chengxin; Zherebchevskii, Vladimir; Zhigareva, Natalia; Zhou, Daicui; Zhou, You; Zhou, Zhuo; Zhu, Hongsheng; Zhu, Jianhui; Zhu, Ya; Zichichi, Antonino; Zimmermann, Markus Bernhard; Zinovjev, Gennady; Zmeskal, Johann; Zou, Shuguang

2018-01-01

Inclusive J/$\\psi$ production is studied in p-Pb interactions at a centre-of-mass energy per nucleon-nucleon collision $\\sqrt{s_{NN}}$ = 8.16 TeV, using the ALICE detector at the CERN LHC. The J/$\\psi$ meson is reconstructed, via its decay to a muon pair, in the centre-of-mass rapidity intervals 2.03 < $y_{cms}$ < 3.53 and −4.46 < $y_{cms}$ < −2.96, where positive and negative $y_{cms}$ refer to the p-going and Pb-going direction, respectively. The transverse momentum coverage is $p_{T}$ < 20 GeV/$c$. In this paper, $y_{cms}$- and $p_{T}$-differential cross sections for inclusive J/$\\psi$ production are presented, and the corresponding nuclear modification factors RpPb are shown. Forward results show a suppression of the J/ψ yield with respect to pp collisions, concentrated in the region $p_{T}$ $\\lesssim$ 5 GeV/$c$. At backward rapidity no significant suppression is observed. The results are compared to previous measurements by ALICE in p-Pb collisions at $\\sqrt{s_{NN}}$ = 5.02 TeV and to...

Finite element analysis for temperature distributions in a cold forging

International Nuclear Information System (INIS)

Kim, Dong Bum; Lee, In Hwan; Cho, Hae Yong; Kim, Sung Wook; Song, In Chul; Jeon, Byung Cheol

2013-01-01

In this research, the finite element method is utilized to predict the temperature distributions in a cold-forging process for a cambolt. The cambolt is mainly used as a part of a suspension system of a vehicle. The cambolt has an off-centered lobe that manipulates the vertical position of the knuckle and wheel to a slight degree. The cambolt requires certain mechanical properties, such as strength and endurance limits. Moreover, temperature is also an important factor to realize mass production and improve efficiency. However, direct measurement of temperature in a forging process is infeasible with existing technology; therefore, there is a critical need for a new technique. Accordingly, in this study, a thermo-coupled finite element method is developed for predicting the temperature distribution. The rate of energy conversion to heat for the workpiece material is determined, and the temperature distribution is analyzed throughout the forging process for a cambolt. The temperatures associated with different punch speeds are also studied, as well as the relationships between load, temperature, and punch speed. Experimental verification of the technique is presented.

Finite element analysis for temperature distributions in a cold forging

Energy Technology Data Exchange (ETDEWEB)

Kim, Dong Bum; Lee, In Hwan; Cho, Hae Yong [Chungbuk National University, Cheongju (Korea, Republic of); Kim, Sung Wook [Yanbian National University, Yanbian (China); Song, In Chul; Jeon, Byung Cheol [Sunil dyfas, Jincheon (Korea, Republic of)

2013-10-15

In this research, the finite element method is utilized to predict the temperature distributions in a cold-forging process for a cambolt. The cambolt is mainly used as a part of a suspension system of a vehicle. The cambolt has an off-centered lobe that manipulates the vertical position of the knuckle and wheel to a slight degree. The cambolt requires certain mechanical properties, such as strength and endurance limits. Moreover, temperature is also an important factor to realize mass production and improve efficiency. However, direct measurement of temperature in a forging process is infeasible with existing technology; therefore, there is a critical need for a new technique. Accordingly, in this study, a thermo-coupled finite element method is developed for predicting the temperature distribution. The rate of energy conversion to heat for the workpiece material is determined, and the temperature distribution is analyzed throughout the forging process for a cambolt. The temperatures associated with different punch speeds are also studied, as well as the relationships between load, temperature, and punch speed. Experimental verification of the technique is presented.

Updates on EPA’s High-Throughput Exposure Forecast (ExpoCast) Research Project (CPCP)

Science.gov (United States)

Recent research advances by the ORD ExpoCast project (CSS Rapid Exposure and Dosimetry) are presented to the computational toxicology community in the context of prioritizing chemicals on a risk-basis using joint ExpoCast and ToxCast predictions. Recent publications by Wambaugh e...

A material based approach to creating wear resistant surfaces for hot forging

Science.gov (United States)

Babu, Sailesh

Tools and dies used in metal forming are characterized by extremely high temperatures at the interface, high local pressures and large metal to metal sliding. These harsh conditions result in accelerated wear of tooling. Lubrication of tools, done to improve metal flow drastically quenches the surface layers of the tools and compounds the tool failure problem. This phenomenon becomes a serious issue when parts forged at complex and are expected to meet tight tolerances. Unpredictable and hence uncontrolled wear and degradation of tooling result in poor part quality and premature tool failure that result in high scrap, shop downtime, poor efficiency and high cost. The objective of this dissertation is to develop a computer-based methodology for analyzing the requirements hot forging tooling to resist wear and plastic deformation and wear and predicting life cycle of forge tooling. Development of such is a system is complicated by the fact that wear and degradation of tooling is influenced by not only the die material used but also numerous process controls like lubricant, dilution ratio, forging temperature, equipment used, tool geometries among others. Phenomenological models available u1 the literature give us a good thumb rule to selecting materials but do not provide a way to evaluate pits performance in field. Once a material is chosen, there are no proven approaches to create surfaces out of these materials. Coating approaches like PVD and CVD cannot generate thick coatings necessary to withstand the conditions under hot forging. Welding cannot generate complex surfaces without several secondary operations like heat treating and machining. If careful procedures are not followed, welds crack and seldom survive forging loads. There is a strong need for an approach to selectively, reliably and precisely deposit material of choice reliably on an existing surface which exhibit not only good tribological properties but also good adhesion to the substrate

KIT D816V mutation-positive cell fractions in lesional skin biopsies from adults with systemic mastocytosis

DEFF Research Database (Denmark)

Kielsgaard Kristensen, Thomas; Broesby-Olsen, Sigurd; Vestergaard, Hanne

2013-01-01

Most adults with systemic mastocytosis (SM) carry the somatic KIT D816V mutation, but the occurrence of the mutation in lesional skin remains to be characterized.......Most adults with systemic mastocytosis (SM) carry the somatic KIT D816V mutation, but the occurrence of the mutation in lesional skin remains to be characterized....

Effect of raw materials and hardening process on hardness of manually forged knife

Science.gov (United States)

Balkhaya, Suwarno

2017-06-01

Knives are normally made by forging process either using a machine or traditional method by means of hammering process. This present work was conducted to study the effects of steel raw materials and hardening process on the hardness of manually forged knives. The knife samples were made by traditional hammering (forging) process done by local blacksmith. Afterward, the samples were heat treated with two different hardening procedures, the first was based on the blacksmith procedure and the second was systematically done at the laboratory. The forging was done in the temperature ranged between 900-950°C, while the final temperature ranged between 650-675°C. The results showed that knives made of spring steel and heat treated in simulated condition at the laboratory obtained higher level of hardness, i.e. 62 HRC. In general, knives heat treated by local blacksmith had lower level of hardness that those obtained from simulated condition. Therefore, we concluded that the traditional knife quality in term of hardness can be improved by optimizing the heat treatment schedule.

Fabrication Improvement of Cold Forging Hexagonal Nuts by Computational Analysis and Experiment Verification

Directory of Open Access Journals (Sweden)

Shao-Yi Hsia

2015-01-01

Full Text Available Cold forging has played a critical role in fasteners and has been applied to the automobile industry, construction industry, aerospace industry, and living products so that cold forging presents the opportunities for manufacturing more products. By using computer simulation, this study attempts to analyze the process of creating machine parts, such as hexagonal nuts. The DEFORM-3D forming software is applied to analyze the process at various stages in the computer simulation, and the compression test is also used for the flow stress equation in order to compare the differences between the experimental results and the equation that is built into the computer simulation software. At the same time, the metallography and hardness of experiments are utilized to understand the cold forging characteristics of hexagonal nuts. The research results would benefit machinery businesses to realize the forging load and forming conditions at various stages before the fastener formation. In addition to planning proper die design and production, the quality of the produced hexagonal nuts would be more stable to promote industrial competitiveness.

Solidification and casting

CERN Document Server

Cantor, Brian

2002-01-01

INDUSTRIAL PERSPECTIVEDirect chillcasting of aluminium alloysContinuous casting of aluminium alloysContinuous casting of steelsCastings in the automotive industryCast aluminium-silicon piston alloysMODELLING AND SIMULATIONModelling direct chill castingMold filling simulation of die castingThe ten casting rulesGrain selection in single crystal superalloy castingsDefects in aluminium shape castingPattern formation during solidificationPeritectic solidificationSTRUCTURE AND DEFECTSHetergeneous nucleation in aluminium alloysCo

Influence of the Constitutive Flow Law in FEM Simulation of the Radial Forging Process

Directory of Open Access Journals (Sweden)

Olivier Pantalé

2013-01-01

Full Text Available Radial forging is a widely used forming process for manufacturing hollow products in transport industry. As the deformation of the workpiece, during the process, is a consequence of a large number of high-speed strokes, the Johnson-Cook constitutive law (taking into account the strain rate seems to be well adapted for representing the material behavior even if the process is performed under cold conditions. But numerous contributions concerning radial forging analysis, in the literature, are based on a simple elastic-plastic formulation. As far as we know, this assumption has yet not been validated for the radial forging process. Because of the importance of the flow law in the effectiveness of the model, our purpose in this paper is to analyze the influence of the use of an elastic-viscoplastic formulation instead of an elastic-plastic one for modeling the cold radial forging process. In this paper we have selected two different laws for the simulations: the Johnson-Cook and the Ludwik ones, and we have compared the results in terms of forging force, product's thickness, strains, stresses, and CPU time. For the presented study we use an AISI 4140 steel, and we denote a fairly good agreement between the results obtained using both laws.

Sensitive KIT D816V mutation analysis of blood as a diagnostic test in mastocytosis

DEFF Research Database (Denmark)

Kielsgaard Kristensen, Thomas; Vestergaard, Hanne; Bindslev-Jensen, Carsten

2014-01-01

The recent progress in sensitive KIT D816V mutation analysis suggests that mutation analysis of peripheral blood (PB) represents a promising diagnostic test in mastocytosis. However, there is a need for systematic assessment of the analytical sensitivity and specificity of the approach in order...... to establish its value in clinical use. We therefore evaluated sensitive KIT D816V mutation analysis of PB as a diagnostic test in an entire case-series of adults with mastocytosis. We demonstrate for the first time that by using a sufficiently sensitive KIT D816V mutation analysis, it is possible to detect...... the mutation in PB in nearly all adult mastocytosis patients. The mutation was detected in PB in 78 of 83 systemic mastocytosis (94%) and 3 of 4 cutaneous mastocytosis patients (75%). The test was 100% specific as determined by analysis of clinically relevant control patients who all tested negative. Mutation...

Evaluation of porosity in Al alloy die castings

Directory of Open Access Journals (Sweden)

M. Říhová

2012-01-01

Full Text Available Mechanical properties of an Al-alloy die casting depend significantly on its structural properties. Porosity in Al-alloy castings is one of the most frequent causes of waste castings. Gas pores are responsible for impaired mechanical-technological properties of cast materials. On the basis of a complex evaluation of experiments conducted on AlSi9Cu3 alloy samples taken from the upper engine block which was die- cast with and without local squeeze casting it can be said that castings manufactured without squeeze casting exhibit maximum porosity in the longitudinal section. The area without local squeeze casting exhibits a certain reduction in mechanical properties and porosity increased to as much as 5%. However, this still meets the norms set by SKODA AUTO a.s.

Self-adaptive multimethod optimization applied to a tailored heating forging process

Science.gov (United States)

Baldan, M.; Steinberg, T.; Baake, E.

2018-05-01

The presented paper describes an innovative self-adaptive multi-objective optimization code. Investigation goals concern proving the superiority of this code compared to NGSA-II and applying it to an inductor’s design case study addressed to a “tailored” heating forging application. The choice of the frequency and the heating time are followed by the determination of the turns number and their positions. Finally, a straightforward optimization is performed in order to minimize energy consumption using “optimal control”.

Bainite obtaining in cast iron with carbides castings

Directory of Open Access Journals (Sweden)

S. Pietrowski

2010-01-01

Full Text Available In these paper the possibility of upper and lower bainite obtaining in cast iron with carbides castings are presented. Conditions, when in cast iron with carbides castings during continuous free air cooling austenite transformation to upper bainite or its mixture with lower bainte proceeds, have been given. A mechanism of this transformation has been given, Si, Ni, Mn and Mo distribution in the eutectic cell has been tested and hardness of tested castings has been determined.

Comparison of marginal accuracy of castings fabricated by conventional casting technique and accelerated casting technique: an in vitro study.

Science.gov (United States)

Reddy, S Srikanth; Revathi, Kakkirala; Reddy, S Kranthikumar

2013-01-01

Conventional casting technique is time consuming when compared to accelerated casting technique. In this study, marginal accuracy of castings fabricated using accelerated and conventional casting technique was compared. 20 wax patterns were fabricated and the marginal discrepancy between the die and patterns were measured using Optical stereomicroscope. Ten wax patterns were used for Conventional casting and the rest for Accelerated casting. A Nickel-Chromium alloy was used for the casting. The castings were measured for marginal discrepancies and compared. Castings fabricated using Conventional casting technique showed less vertical marginal discrepancy than the castings fabricated by Accelerated casting technique. The values were statistically highly significant. Conventional casting technique produced better marginal accuracy when compared to Accelerated casting. The vertical marginal discrepancy produced by the Accelerated casting technique was well within the maximum clinical tolerance limits. Accelerated casting technique can be used to save lab time to fabricate clinical crowns with acceptable vertical marginal discrepancy.

Tailorable Burning Behavior of Ti14 Alloy by Controlling Semi-Solid Forging Temperature.

Science.gov (United States)

Chen, Yongnan; Yang, Wenqing; Zhan, Haifei; Zhang, Fengying; Huo, Yazhou; Zhao, Yongqing; Song, Xuding; Gu, Yuantong

2016-08-16

Semi-solid processing (SSP) is a popular near-net-shape forming technology for metals, while its application is still limited in titanium alloy mainly due to its low formability. Recent works showed that SSP could effectively enhance the formability and mechanical properties of titanium alloys. The processing parameters such as temperature and forging rate/ratio, are directly correlated with the microstructure, which endow the alloy with different chemical and physical properties. Specifically, as a key structural material for the advanced aero-engine, the burn resistant performance is a crucial requirement for the burn resistant titanium alloy. Thus, this work aims to assess the burning behavior of Ti14, a kind of burn resistant alloy, as forged at different semi-solid forging temperatures. The burning characteristics of the alloy are analyzed by a series of burning tests with different burning durations, velocities, and microstructures of burned sample. The results showed that the burning process is highly dependent on the forging temperature, due to the fact that higher temperatures would result in more Ti₂Cu precipitate within grain and along grain boundaries. Such a microstructure hinders the transport of oxygen in the stable burning stage through the formation of a kind of oxygen isolation Cu-enriched layer under the burn product zone. This work suggests that the burning resistance of the alloy can be effectively tuned by controlling the temperature during the semi-solid forging process.

Melting and casting of FeAl-based cast alloy

Energy Technology Data Exchange (ETDEWEB)

Sikka, V.K. [Oak Ridge National Lab., TN (United States); Wilkening, D. [Columbia Falls Aluminum Co., Columbia Falls, MT (United States); Liebetrau, J.; Mackey, B. [AFFCO, L.L.C., Anaconda, MT (United States)

1998-11-01

The FeAl-based intermetallic alloys are of great interest because of their low density, low raw material cost, and excellent resistance to high-temperature oxidation, sulfidation, carburization, and molten salts. The applications based on these unique properties of FeAl require methods to melt and cast these alloys into complex-shaped castings and centrifugal cast tubes. This paper addresses the melting-related issues and the effect of chemistry on the microstructure and hardness of castings. It is concluded that the use of the Exo-Melt{trademark} process for melting and the proper selection of the aluminum melt stock can result in porosity-free castings. The FeAl alloys can be melted and cast from the virgin and revert stock. A large variation in carbon content of the alloys is possible before the precipitation of graphite flakes occurs. Titanium is a very potent addition to refine the grain size of castings. A range of complex sand castings and two different sizes of centrifugal cast tubes of the alloy have already been cast.

On the domestically-made heavy forging for reactor pressure vessels of PWR nuclear power plant

International Nuclear Information System (INIS)

Pan Xiren; Zhang Chen.

1988-01-01

The present situation of the foreign heavy forgings for nuclear reactor pressure vessels and the heavy forgings condition which is used for the Qinshan 300MWe nuclear power plant are described. Some opinions of domestic products is proposed

Forged HITEMAL: Al-based MMCs strengthened with nanometric thick Al{sub 2}O{sub 3} skeleton

Energy Technology Data Exchange (ETDEWEB)

Balog, Martin, E-mail: ummsbama@savba.sk [Institute of Materials and Machine Mechanics, Slovak Academy of Sciences, Racianska 75, 83102 Bratislava (Slovakia); Krizik, Peter; Nosko, Martin; Hajovska, Zuzana [Institute of Materials and Machine Mechanics, Slovak Academy of Sciences, Racianska 75, 83102 Bratislava (Slovakia); Victoria Castro Riglos, Maria [Centro Atómico Bariloche, Av. Bustillo 9.500, 8400 Bariloche, Río Negro (Argentina); Rajner, Walter [New Materials Development GmbH, Römerstrasse 28, 83410 Laufen, Leobendorf (Germany); Liu, De-Shin [National Chung Cheng University, 168 University Rd., Min-Hsiung, 62102 Chia-Yi, Taiwan (China); Simancik, Frantisek [Institute of Materials and Machine Mechanics, Slovak Academy of Sciences, Racianska 75, 83102 Bratislava (Slovakia)

2014-09-08

Bulk Al–Al{sub 2}O{sub 3} metal matrix composites (MMCs) named HITEMAL (high temperature aluminum) were fabricated in situ by forging compaction of five different types of gas-atomized commercial purity Al powders with a mean particle size in the range of 1–9 µm. As-forged HITEMAL consisted of (sub)micrometric Al grains (matrix) decorated with nanometric thick amorphous Al{sub 2}O{sub 3} (a-Al{sub 2}O{sub 3}) skeleton. Low-angle grain boundaries (LAGBs) free of Al{sub 2}O{sub 3} were located in the Al grain interior. The Al grain size and the portion of LAGBs increased with the increase in the relative powder surface area. As-forged HITEMAL shows excellent thermal stability up to 400 °C for 24 h. Annealing at temperatures ≥450 °C led to crystallization and morphological transformation from a-Al{sub 2}O{sub 3} skeleton to nanometric γ-Al{sub 2}O{sub 3} particles. Owing to the pinning effect of Al{sub 2}O{sub 3} phase, no Al grain growth took place during annealing up to 500 °C. HITEMAL showed attractive mechanical properties especially when tested at 300 °C (yield strength up to 220 MPa, Young's modulus up to 58 GPa). Despite the presence of a nearly continuous a-Al{sub 2}O{sub 3} skeleton along adjacent Al grains, forged HITEMAL materials had reasonable room temperature elongation of 7–26%. HITEMAL's elongation decreased as the Al grain size decreased and with increased testing temperature. The loss in elongation (uniform and total) was attributed to the inhomogeneous flow, which occurred due to high densities of high angle grain boundaries (dislocation sinks) and small content of LAGBs. The strength of HITEMAL stemmed from grain boundary mediated strengthening mechanisms. The results showed a positive deviation from the Hall–Petch plot, which is typical behavior of ultrafine-grained metals. Transformation of a-Al{sub 2}O{sub 3} skeleton to γ-Al{sub 2}O{sub 3} particles led to deterioration of the HITEMAL strength and Young's modulus.

Backward can extrusion with conical,rotating punch as a cold forging tribology test

DEFF Research Database (Denmark)

Ceron, Ermanno; Bay, Niels; Tetsuo, A.

2011-01-01

with an analysis of the sliding velocity distribution along the punch nose. The latter is determined by FE analysis of the test. Results show friction stress for unalloyed low C-steel provided with different types of lubricants, e.g. phosphate coating plus soap, phosphate coating plus MoS2 and single bathe...... lubrication with PULS. The new test is so severe, that it is possible to break down the best lubrication systems for cold forging, such as phosphate coating plus soap and MoS2....

THE FORMING OF MAGNESIUM ALLOY FORGINGS FOR AIRCRAFT AND AUTOMOTIVE APPLICATIONS

Directory of Open Access Journals (Sweden)

Anna Dziubińska

2016-09-01

Full Text Available The paper presents the theoretical and technological aspects of forming magnesium alloy parts for aircraft and automotive applications. The main applications of magnesium alloys in the aircraft and automotive industries are discussed. In addition, the forging technology for magnesium alloys is generally described, with a particular emphasis on wrought alloys. A brief outline of the state of the art in the forging of magnesium alloys is given based on a survey of the specialist literature and the results of previous research by the authors.

Adapted diffusion processes for effective forging dies

Science.gov (United States)

Paschke, H.; Nienhaus, A.; Brunotte, K.; Petersen, T.; Siegmund, M.; Lippold, L.; Weber, M.; Mejauschek, M.; Landgraf, P.; Braeuer, G.; Behrens, B.-A.; Lampke, T.

2018-05-01

Hot forging is an effective production method producing safety relevant parts with excellent mechanical properties. The economic efficiency directly depends on the occurring wear of the tools, which limits service lifetime. Several approaches of the presenting research group aim at minimizing the wear caused by interacting mechanical and thermal loads by using enhanced nitriding technology. Thus, by modifying the surface zone layer it is possible to create a resistance against thermal softening provoking plastic deformation and pronounced abrasive wear. As a disadvantage, intensely nitrided surfaces may possibly include the risk of increased crack sensitivity and therefore feature the chipping of material at the treated surface. Recent projects (evaluated in several industrial applications) show the high technological potential of adapted treatments: A first approach evaluated localized treatments by preventing areas from nitrogen diffusion with applied pastes or other coverages. Now, further ideas are to use this principle to structure the surface with differently designed patterns generating smaller ductile zones beneath nitrided ones. The selection of suitable designs is subject to certain geo-metrical requirements though. The intention of this approach is to prevent the formation and propagation of cracks under thermal shock conditions. Analytical characterization methods for crack sensitivity of surface zone layers and an accurate system of testing rigs for thermal shock conditions verified the treatment concepts. Additionally, serial forging tests using adapted testing geometries and finally, tests in the industrial production field were performed. Besides stabilizing the service lifetime and decreasing specific wear mechanisms caused by thermal influences, the crack behavior was influenced positively. This leads to a higher efficiency of the industrial production process and enables higher output in forging campaigns of industrial partners.

Manufacturing and material properties of forgings for reactor pressure vessel of high temperature engineering test reactor

International Nuclear Information System (INIS)

Sato, I.; Suzuki, K.

1994-01-01

For the reactor pressure vessel (RPV) of high temperature engineering test reactor (HTTR) which has been developed by Japan Atomic Energy Research Institute (JAERI), 2 1/4Cr-1Mo steel is used first in the world. Material confirmation test has been carried out to demonstrate good applicability of forged low Si 2 1/4Cr-1Mo steel to the RPV of HTTR. Recently, JSW has succeeded in the manufacturing of large size ring forgings and large size forged cover dome integrated with nozzles for stand pipe for the RPV. This paper describes the results of the material confirmation test as well as the manufacturing and material properties of the large forged cover dome integrated with nozzles for stand pipe. (orig.)

Electro sinter forging of titanium disks

DEFF Research Database (Denmark)

Cannella, Emanuele; Nielsen, Chris Valentin; Bay, Niels Oluf

by measuring the electrical resistance during the sintering process [5], since low electrical resistance corresponds to high density. It is, however, necessary to be aware that increased temperature, on the other hand, increases the resistance. SEM micrographs and Computed Tomography (CT) are carried out......Electro sinter forging (ESF) is a new sintering process based on the principle of electrical Joule heating. In the present work, middle frequency direct current (MFDC) was flowing through the powder compact, which was under mechanical pressure. The main parameters are the high electrical current......, up to 10 kA, and the low voltage, 1-2 V, resulting in heat generation in the powder. Figure 1 shows the experimental setup. The punches were made of a conductive material; namely a copper alloy. The die, which has to be electrically insulating, was made of alumina. The ESF process takes 3-4s...

Austempered ductile iron (ADI) for railroad wheels : final report.

Science.gov (United States)

2017-01-31

The purpose of this project is to investigate the potential for austempered ductile iron (ADI) to be used as an alternative material for the production of rail wheels, which are currently cast or forged steel which is commonly heat treated. ADI has s...

Forging a unique nursing partnership with China.

Science.gov (United States)

Munn, Flavia

2017-07-12

When members of a London nursing faculty forged a learning partnership with a Chinese counterpart they likely did not expect to be discussing the benefits of using Florence Nightingale lamps to decorate hospital walls. But there is nothing ordinary about the collaboration between King's College London and Nanjing Health School.

Modelling of Damage During Hot Forging of Ingots

DEFF Research Database (Denmark)

Christiansen, Peter; Hattel, Jesper Henri; Bay, Niels

2013-01-01

Ductile damage modelling in the ingot forging process is discussed. Advantages and disadvantages of both coupled and uncoupled ductile damage models are presented. Some uncoupled damage models are examined in greater detail regarding their applicability to different processes, where hydrostatic...

Forged hollows (alloy 617) for PNP-hot gas collectors

International Nuclear Information System (INIS)

Hofmann, F.

1984-01-01

When the partners in the PNP-Project decided to manufacture components, such as gas collectors, from material of type alloy 617, the problem arose that required semi-fabricated products, especially forged hollows weighing several tons each, were not available. As VDM (Vereinigte Deutsche Metallwerke AG) had already experience in production of other semi-fabricated products of this alloy, attempts were made based on this knowledge, to develop manufacturing methods for forged hollows. The aim was to produce hollows as long as possible, and to keep the welding cost minimum. Welded seams are always critical during fabrication, as well as during later inspection under actual operating conditions. The three stage plan used to perform the above task illustrates the development aims is described

Production of a 304 stainless steel nuclear reactor forging from a very large electroslag refined ingot

International Nuclear Information System (INIS)

Watkins, E.J.; Tihansky, E.L.

1986-01-01

A four-loop, upper barrel flange forging for a nuclear reactor was produced from what the authors believe to be the largest 304H grade stainless steel electroslag refined (ESR) ingot ever refined. The ingot was refined in a 1524-mm-diameter, ingot withdrawal-type ESR furnace using a lime-bearing slag, low-frequency a-c power, and dry air protection. Five electrodes were remelted in order to produce the desired ingot weight. The ingot was subsequently forged in a five-step operation on a 6800-metric-ton press to produce the desired barrel flange configuration. Testing of the finished machined forging revealed excellent tensile ductility, excellent ultrasonic penetrability, and good chemical uniformity with no macrosegregation. Overall quality was judged to be superior to previously produced, conventionally melted forgings

Highlight: Forging the new Indonesia-Canada partnership | CRDI ...

International Development Research Centre (IDRC) Digital Library (Canada)

15 avr. 2016 ... Canada's Centre for International Governance Innovation and Indonesia's Centre for Strategic and International Studies organized the Indonesia-Canada Bilateral Forum, Innovation and Change: Forging the New Indonesia-Canada Partnership. IDRC co-sponsored the meeting, held May 26-27, 2015.

Manufacturing involving forging of multiple objects in contact

DEFF Research Database (Denmark)

Nielsen, Chris Valentin; Zhang, W.; Martins, P.A.F.

and dissimilar materials. While being plastically deformed against each other under increasing forging load, the parts dynamically develop their mutual contact interfaces. Comparisons of the final geometry as well as force-displacement curves are evaluated. The potential of simulated applications are discussed...

Morphology and Precipitation Kinetics of MnS in Low-Carbon Steel During Thin Slab Continuous Casting Process

Institute of Scientific and Technical Information of China (English)

YU Hao; KANG Yong-lin; ZHAO Zheng-zhi; SUN Hao

2006-01-01

The morphology of manganese sulfide formed during thin slab continuous casting process in low-carbon steel produced by compact strip production (CSP) technique was investigated. Using transmission electron microscopy analysis, it was seen that a majority of manganese sulfides precipitated at austenite grain boundaries, the morphologies of which were spherical or close to the spherical shape and the size of MnS precipitates ranged from 30 nm to 100 nm. A mathematical model of the manganese sulfide precipitation in this process was developed based on classical nucleation theory. Under the given conditions, the starting and finishing precipitation temperatures of MnS in the continuous casting thin slab of the studied low-carbon steel are 1 189 ℃ and 1 171 ℃, respectively, and the average diameter of MnS precipitates is about 48 nm within this precipitation temperature range. The influences of chemical components and thermo-mechanical processing conditions on the precipitation behavior of MnS in the same process were also discussed.

Friction and wear in hot forging of steels

International Nuclear Information System (INIS)

Daouben, E.; Dubar, L.; Dubar, M.; Deltombe, R.; Dubois, A.; Truong-Dinh, N.; Lazzarotto, L.

2007-01-01

In the field of hot forging of steels, the mastering of wear phenomena enables to save cost production, especially concerning tools. Surfaces of tools are protected thanks to graphite. The existing lubrication processes are not very well known: amount and quality of lubricant, lubrication techniques have to be strongly optimized to delay wear phenomena occurrence. This optimization is linked with hot forging processes, the lubricant layers must be tested according to representative friction conditions. This paper presents the first part of a global study focused on wear phenomena encountered in hot forging of steels. The goal is the identification of reliable parameters, in order to bring knowledge and models of wear. A prototype testing stand developed in the authors' laboratory is involved in this experimental analysis. This test is called Warm and Hot Upsetting Sliding Test (WHUST). The stand is composed of a heating induction system and a servo-hydraulic system. Workpieces taken from production can be heated until 1200 deg. C. A nitrided contactor representing the tool is heated at 200 deg. C. The contactor is then coated with graphite and rubs against the workpiece, leaving a residual track on it. Friction coefficient and surface parameters on the contactor and the workpiece are the most representative test results. The surface parameters are mainly the sliding length before defects occurrence, and the amplitude of surface profile of the contactor. The developed methodology will be first presented followed by the different parts of the experimental prototype. The results of experiment show clearly different levels of performance according to different lubricants

High coercivity microcrystalline Nd-rich Nd–Fe–Co–Al–B bulk magnets prepared by direct copper mold casting

Energy Technology Data Exchange (ETDEWEB)

Zhao, L.Z.; Hong, Y. [School of Materials Science and Engineering, South China University of Technology, Guangzhou 510640 (China); Fang, X.G. [Institute for Advanced Materials and Laboratory of Quantum Engineering and Quantum Materials, South China Normal University, Guangzhou 510640 (China); Qiu, Z.G.; Zhong, X.C. [School of Materials Science and Engineering, South China University of Technology, Guangzhou 510640 (China); Gao, X.S. [Institute for Advanced Materials and Laboratory of Quantum Engineering and Quantum Materials, South China Normal University, Guangzhou 510640 (China); Liu, Z.W., E-mail: zwliu@scut.edu.cn [School of Materials Science and Engineering, South China University of Technology, Guangzhou 510640 (China)

2016-06-15

High coercivity Nd{sub 25}Fe{sub 40}Co{sub 20}Al{sub 15−x}B{sub x} (x=7–15) hard magnets were prepared by a simple process of injection casting. Different from many previous investigations on nanocomposite compositions, the magnets in this work contain hard magnetic Nd{sub 2}(FeCoAl){sub 14}B, Nd-rich, and Nd{sub 1+ε}(FeCo){sub 4}B{sub 4} phases. The magnetic properties, phase evolution, and microstructure of the as-cast and annealed magnets were investigated. As the boron content increased from 7 to 11 at%, the intrinsic coercivity H{sub cj} of the as-cast magnet increased from 816 to 1140 kA/m. The magnets annealed at 750 °C have shown more regular and smaller grains than the as-cast alloys, especially for the x=11 alloy. The high intrinsic coercivities for the annealed alloys with x=8~11 result from the presence of small-sized grains in the microstructure. The highest H{sub cj} of 1427 kA/m was obtained for the heat treated alloy with x=10. This work provides an alternative approach for preparing fully dense Nd-rich bulk hard magnets with relatively good properties. - Highlights: • 2 mm hard magnetic Nd{sub 25}Fe{sub 40}Co{sub 20}Al{sub 15−x}B{sub x} rods were prepared by direct casting. • High coercivity of 1.78 T was achieved in x=11 sample after heat treatment. • Small grains are responsible for the significant increase in H{sub C} after annealing. • Nd{sub 2}Fe{sub 14}B grains with two different sizes lead to two-step demagnetization process.

Superplastic forging nitride ceramics

Science.gov (United States)

Panda, P.C.; Seydel, E.R.; Raj, R.

1988-03-22

A process is disclosed for preparing silicon nitride ceramic parts which are relatively flaw free and which need little or no machining, said process comprising the steps of: (a) preparing a starting powder by wet or dry mixing ingredients comprising by weight from about 70% to about 99% silicon nitride, from about 1% to about 30% of liquid phase forming additive and from 1% to about 7% free silicon; (b) cold pressing to obtain a preform of green density ranging from about 30% to about 75% of theoretical density; (c) sintering at atmospheric pressure in a nitrogen atmosphere at a temperature ranging from about 1,400 C to about 2,200 C to obtain a density which ranges from about 50% to about 100% of theoretical density and which is higher than said preform green density, and (d) press forging workpiece resulting from step (c) by isothermally uniaxially pressing said workpiece in an open die without initial contact between said workpiece and die wall perpendicular to the direction of pressing and so that pressed workpiece does not contact die wall perpendicular to the direction of pressing, to substantially final shape in a nitrogen atmosphere utilizing a temperature within the range of from about 1,400 C to essentially 1,750 C and strain rate within the range of about 10[sup [minus]7] to about 10[sup [minus]1] seconds[sup [minus]1], the temperature and strain rate being such that surface cracks do not occur, said pressing being carried out to obtain a shear deformation greater than 30% whereby superplastic forging is effected.

Targeted ultradeep next-generation sequencing as a method for KIT D816V mutation analysis in mastocytosis

DEFF Research Database (Denmark)

Kielsgaard Kristensen, Thomas; Broesby-Olsen, Sigurd; Vestergaard, Hanne

2016-01-01

mutation levels. In this study, we established an NGS-based KIT mutation analysis and analyzed the sensitivity of D816V detection using the Ion Torrent platform. Eighty-two individual NGS analyses were included in the study. All samples were also analyzed using highly sensitive KIT D816V mutation...

Fibreglass Total Contact Casting, Removable Cast Walkers, and Irremovable Cast Walkers to Treat Diabetic Neuropathic Foot Ulcers: A Health Technology Assessment

Science.gov (United States)

Costa, Vania; Tu, Hong Anh; Wells, David; Weir, Mark; Holubowich, Corinne; Walter, Melissa

2017-01-01

Background Diabetic neuropathic foot ulcers are a risk factor for lower leg amputation. Many experts recommend offloading with fibreglass total contact casting, removable cast walkers, and irremovable cast walkers as a way to treat these ulcers. Methods We completed a health technology assessment, which included an evaluation of clinical benefits and harms, value for money, and patient preferences for offloading devices. We performed a systematic literature search on August 17, 2016, to identify randomized controlled trials that compared fibreglass total contact casting, removable cast walkers, and irremovable cast walkers with other treatments (offloading or non-offloading) in patients with diabetic neuropathic foot ulcers. We developed a decision-analytic model to assess the cost-effectiveness of fibreglass total contact casting, removable cast walkers, and irremovable cast walkers, and we conducted a 5-year budget impact analysis. Finally, we interviewed people with diabetes who had lived experience with foot ulcers, asking them about the different offloading devices and the factors that influenced their treatment choices. Results We identified 13 randomized controlled trials. The evidence suggests that total contact casting, removable cast walkers, and irremovable cast walkers are beneficial in the treatment of neuropathic, noninfected foot ulcers in patients with diabetes but without severe peripheral arterial disease. Compared to removable cast walkers, ulcer healing was improved with total contact casting (moderate quality evidence; risk difference 0.17 [95% confidence interval 0.00–0.33]) and irremovable cast walkers (low quality evidence; risk difference 0.21 [95% confidence interval 0.01–0.40]). We found no difference in ulcer healing between total contact casting and irremovable cast walkers (low quality evidence; risk difference 0.02 [95% confidence interval −0.11–0.14]). The economic analysis showed that total contact casting and irremovable

strength and ductility of forged 1200 aluminum alloy reinforced

African Journals Online (AJOL)

eobe

duced cylindrical shape samples, which were homogenized at 420 ... and properties of deformed materials depend on other factors ... after the surfaces were ground with emery paper of ... Figure 2: Maximum elongation of forged and annealed.

Current steel forgings and their properties for steam generator of nuclear power plant

Energy Technology Data Exchange (ETDEWEB)

Sasaki, Tomoharu; Murai, Etsuo; Sato, Ikuo [Japan Steel Works Ltd., Muroran, Hokkaido (Japan). Muroran Plant; Suzuki, Kimiaki; Kusuhashi, Mikio; Tsukada, Hisashi [Japan Steel Works Ltd., Tokyo (Japan)

2001-06-01

On the steel forging (SF) elements for steam generator (SG) of the pressurized water type light water reactor (PWR), from a viewpoint of upgrading in their improvements of design and materials, here were described on three materials such as integrated steel forgings, high strength steel forgings, and vacuum carbon deoxidisation (VCD) steel forgings. On production of SG, by using the integrated SF, not only structural soundness of SG is upgraded, but also inspections containing inspections under production and usage become easier, to bring minimization of maintenance inspection and reduction of exposure under operation. And, in order to reduce weight of SG and upgrade seismic resistance, SA508, a Cl.3a high strength SF (620 MPa class in tensile strength) is used for some nuclear plants. Here were introduced material properties of this SF and described its chemical components and heat treatment condition. And, as a method to reduce macro- and micro-segregation of materials and to upgrade homogeneity of material property, a method combined deoxidisation of steel due to carbon monoxide reaction with crystal grain minimization due to addition of aluminum was investigated. In addition, properties of a low Si-SA508 Cl.3 steel using this method was compared with that of usual SA508 Cl.3 steel. (G.K.)

Qualitative Research of AZ31 Magnesium Alloy Aircraft Brackets Produced by a New Forging Method

Directory of Open Access Journals (Sweden)

Dziubińska A.

2016-06-01

Full Text Available The paper reports a selection of numerical and experimental results of a new closed-die forging method for producing AZ31 magnesium alloy aircraft brackets with one rib. The numerical modelling of the new forming process was performed by the finite element method.The distributions of stresses, strains, temperature and forces were examined. The numerical results confirmed that the forgings produced by the new forming method are correct. For this reason, the new forming process was verified experimentally. The experimental results showed good agreement with the numerical results. The produced forgings of AZ31 magnesium alloy aircraft brackets with one rib were then subjected to qualitative tests.

Evaluation of intergranular corrosion rate and microstructure of forged 316L round bar

International Nuclear Information System (INIS)

Lim, H. K.; Kim, Y. S.

2009-01-01

When austenitic stainless steels are heat treated in the range of 500∼850 .deg. C, the alloys are sensitized due to the formation of chromium carbide at grain boundaries and then intergranular corrosion occurs. This paper aims to evaluate the intergranular corrosion rate and microstructural change of forged 316L stainless steel. To analyze the microstructure by forging conditions, ferrite phase, sigma phase, intergranular precipitation were observed. In order to evaluate the intergranular corrosion rate. Huey test was performed by ASTM A262. On the base of microstructural observation, ferrite and sigma phases were not detected, and also intergranular precipitation was not revealed in optical microscopic observation. By ASTM A262 Practice A, step structure was shown in all forging conditions. Intergranular corrosion rate gradually increased by Huey test periods but average corrosion rate was under 0.03 mm/month

Evaluation of intergranular corrosion rate and microstructure of forged 316L round bar

Energy Technology Data Exchange (ETDEWEB)

Lim, H. K.; Kim, Y. S. [Andong National University, Andong (Korea, Republic of)

2009-12-15

When austenitic stainless steels are heat treated in the range of 500{approx}850 .deg. C, the alloys are sensitized due to the formation of chromium carbide at grain boundaries and then intergranular corrosion occurs. This paper aims to evaluate the intergranular corrosion rate and microstructural change of forged 316L stainless steel. To analyze the microstructure by forging conditions, ferrite phase, sigma phase, intergranular precipitation were observed. In order to evaluate the intergranular corrosion rate. Huey test was performed by ASTM A262. On the base of microstructural observation, ferrite and sigma phases were not detected, and also intergranular precipitation was not revealed in optical microscopic observation. By ASTM A262 Practice A, step structure was shown in all forging conditions. Intergranular corrosion rate gradually increased by Huey test periods but average corrosion rate was under 0.03 mm/month.

Numerical simulation of the dynamic recrystallization behaviour in hot precision forging helical gears

Directory of Open Access Journals (Sweden)

Feng Wei

2015-01-01

Full Text Available In hot precision forging helical gears, the dynamic recrystallization phenomena will occur, which affect the microstructure of the formed part and in turn decide their mechanical properties. To investigate the effect of deformation temperature on the dynamic recrystallization in hot precision forging helical gears, a three dimensional (3D finite element (FE model was created by coupling the thermo-mechanical model with the microstructure evolution model developed based on the hot compressive experimental data of 20CrMnTiH steel. The hot precision forging process was simulated and the effect laws of the deformation temperature on the microstructure evolution the formed part were investigated. The results show that the dynamic recrystallization volume fraction and the average grain sizes increased with the increasing deformation temperature and the higher deformation temperature is beneficial to dynamic recrystallization and grain refinement.

The effects of composition and thermal path on hot ductility of forging steels

Science.gov (United States)

Connolly, Brendan M.

This work examines the effects of composition and thermal path on the hot ductility of several forging steels with varied aluminum and nitrogen content. The primary mechanisms and controlling factors related to hot ductility are identified with a focus on the role of precipitates and segregation. The unique thermal paths and solidification structures of large cross-section forging ingots are discussed. Hot ductility testing is performed in a manner that approximates industrial conditions experienced by large cross-section forging ingots. A computer model for precipitation of aluminum nitride and vanadium nitride in austenite is presented. Industrial material is examined for comparison to experimental findings. It is found that increased aluminum and nitrogen content coarsens the as-solidified structure. The combined effects of microsegregation and uphill diffusion during deformation allow for carbide precipitation at prior austenite grain boundaries which reduces the hot ductility.

Determination of D816V mutation in the c-kIt gene in the Slovenian patients with acute myeloid leukemia and systemic mastocytosis

Directory of Open Access Journals (Sweden)

Martina Fink

2012-12-01

Full Text Available Background: D816V mutation in the C-KIT gene is present in more than 90 % of patients with systemic mastocytosis (SM and 2–7 % of patients with acute myeloid leukemia (AML. D816V mutation is caused by the substitution of adenine with thymine at 2447 nucleotide sequence in the C-KIT gene. This nucleotide substitution causes the replacment of aspartate acid by valine at codon 816 of the KIT protein. KIT protein with D816V mutation acts as constitutively active tyrosine kinase that promotes cell proliferation and inhibits apoptosis. The purpose of our study was to determine the incidence of D816V mutation in the C-KIT gene in Slovenian patients with AML and in patients with suspected systemic mastocytosis. Patients and methods: In the retrospective study, 71 patients with AML and 25 patients with suspected systemic mastocytosis were included. D816V mutation in the C-KIT gene was determined by polymerase chain reaction (PCR and the resulting PCR products were analyzed by agarose gel electrophoresis. Results: D816V mutation in KIT protein was determined in 7 % of patients with AML and in 32 % patients with suspected systemic mastocytosis. Conclusions: Identification of D816V mutation in the C-KIT gene must always be performed in patients with suspected systemic mastocytosis. The determination of this mutation contributes to the diagnosis and treatment selection. The finding of D816V mutation in the C-KIT gene in patients with AML and concomitant genetic modifications RUNX-RUNX1T1 (typical translocation t(8; 21 (q22, q22 or CBFB-MYH11, which is the result of inversion on chromosome 16–(inv (16 (p13, q22, however, indicates a faster, more aggressive course of the disease and predicts a worse outcome. The finding of the mutation in other patients with AML may indicate the presence of concomitant AML and SM, which was not found in our patients.

Ultrasonic phased arrays for nondestructive inspection of forgings

International Nuclear Information System (INIS)

Wuestenberg, H.; Rotter, B.; Klanke, H.P.; Harbecke, D.

1993-01-01

Ultrasonic examinations on large forgings like rotor shafts for turbines or components for nuclear reactors are carried out at various manufacturing stages and during in-service inspections. During the manufacture, most of the inspections are carried out manually. Special in-service conditions, such as those at nuclear pressure vessels, have resulted in the development of mechanized scanning equipment. Ultrasonic probes have improved, and well-adapted sound fields and pulse shapes and based on special imaging procedures for the representation of the reportable reflectors have been applied. Since the geometry of many forgings requires the use of a multitude of angles for the inspections in-service and during manufacture, phased-array probes can be used successfully. The main advantages of the phased-array concept, e.g. the generation of a multitude of angles with the typical increase of redundancy in detection and quantitative evaluation and the possibility to produce pictures of defect situations, will be described in this contribution

The CAST Time Projection Chamber

CERN Document Server

Autiero, D.; Carmona, J.M.; Cebrian, S.; Chesi, E.; Davenport, M.; Delattre, M.; Di Lella, L.; Formenti, F.; Irastorza, I.G.; Gomez, H.; Hasinoff, M.; Lakic, B.; Luzon, G.; Morales, J.; Musa, L.; Ortiz, A.; Placci, A.; Rodriguez, A.; Ruz, J.; Villar, J.A.; Zioutas, K.

2007-01-01

One of the three X-ray detectors of the CAST experiment searching for solar axions is a Time Projection Chamber (TPC) with a multi-wire proportional counter (MWPC) as a readout structure. Its design has been optimized to provide high sensitivity to the detection of the low intensity X-ray signal expected in the CAST experiment. A low hardware threshold of 0.8 keV is safely set during normal data taking periods, and the overall efficiency for the detection of photons coming from conversion of solar axions is 62 %. Shielding has been installed around the detector, lowering the background level to 4.10 x 10^-5 counts/cm^2/s/keV between 1 and 10 keV. During phase I of the CAST experiment the TPC has provided robust and stable operation, thus contributing with a competitive result to the overall CAST limit on axion-photon coupling and mass.

30 CFR 816.15 - Casing and sealing of drilled holes: Permanent.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Casing and sealing of drilled holes: Permanent...-SURFACE MINING ACTIVITIES § 816.15 Casing and sealing of drilled holes: Permanent. When no longer needed... exploration hole, other drilled hole or borehole, well, and other exposed underground opening shall be capped...

30 CFR 816.73 - Disposal of excess spoil: Durable rock fills.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Disposal of excess spoil: Durable rock fills...-SURFACE MINING ACTIVITIES § 816.73 Disposal of excess spoil: Durable rock fills. The regulatory authority may approve the alternative method of disposal of excess durable rock spoil by gravity placement in...

Numerical modeling of axi-symmetrical cold forging process by ``Pseudo Inverse Approach''

Science.gov (United States)

Halouani, A.; Li, Y. M.; Abbes, B.; Guo, Y. Q.

2011-05-01

The incremental approach is widely used for the forging process modeling, it gives good strain and stress estimation, but it is time consuming. A fast Inverse Approach (IA) has been developed for the axi-symmetric cold forging modeling [1-2]. This approach exploits maximum the knowledge of the final part's shape and the assumptions of proportional loading and simplified tool actions make the IA simulation very fast. The IA is proved very useful for the tool design and optimization because of its rapidity and good strain estimation. However, the assumptions mentioned above cannot provide good stress estimation because of neglecting the loading history. A new approach called "Pseudo Inverse Approach" (PIA) was proposed by Batoz, Guo et al.. [3] for the sheet forming modeling, which keeps the IA's advantages but gives good stress estimation by taking into consideration the loading history. Our aim is to adapt the PIA for the cold forging modeling in this paper. The main developments in PIA are resumed as follows: A few intermediate configurations are generated for the given tools' positions to consider the deformation history; the strain increment is calculated by the inverse method between the previous and actual configurations. An incremental algorithm of the plastic integration is used in PIA instead of the total constitutive law used in the IA. An example is used to show the effectiveness and limitations of the PIA for the cold forging process modeling.

The Investigations of Friction under Die Surface Vibration in Cold Forging Process

DEFF Research Database (Denmark)

Jinming, Sha

investigation, and the second stage is to design and manufacture a more practical tool system which can be used to forging some industrial components with larger capacity. The high performance and power piezoelectric actuator stack as the vibration source will be used for designing the vibration system in order...... to 50% with vibration being applied in forming process. Furthermore, by using finite element method, a series of the simulations of the cold forging process under die surface excitation have been implemented in order to further understand the influence of vibration on friction, especially the influence...

Control of cast iron and casts manufacturing by Inmold method

Directory of Open Access Journals (Sweden)

S. Pietrowski

2009-07-01

Full Text Available In this paper the usability of cast iron spheroidizing process in mould control by ATD method as well as by ultrasonic method were presented. Structure of instrumentation needed for control form performance of cast iron spheroidizing by Inmold method was illustrated. Author, pointed out that amount of magnesium master alloy should obtain 0,8 ÷ 1,0% of mass in form at all. Such quantity of preliminary alloy assure of obtain of nodular graphite in cast iron. In consequence of this, is reduce the cast iron liquidus temperature and decrease of recalescence temperature of graphite-eutectic crystallization in compare with initial cast iron. Control of casts can be carried out by ultrasonic method. In plain cast iron, ferritic-pearlitic microstructure is obtaining. Additives of 1,5% Cu ensure pearlitic structure.

Performance Assessment Method for a Forged Fingerprint Detection Algorithm

Science.gov (United States)

Shin, Yong Nyuo; Jun, In-Kyung; Kim, Hyun; Shin, Woochang

The threat of invasion of privacy and of the illegal appropriation of information both increase with the expansion of the biometrics service environment to open systems. However, while certificates or smart cards can easily be cancelled and reissued if found to be missing, there is no way to recover the unique biometric information of an individual following a security breach. With the recognition that this threat factor may disrupt the large-scale civil service operations approaching implementation, such as electronic ID cards and e-Government systems, many agencies and vendors around the world continue to develop forged fingerprint detection technology, but no objective performance assessment method has, to date, been reported. Therefore, in this paper, we propose a methodology designed to evaluate the objective performance of the forged fingerprint detection technology that is currently attracting a great deal of attention.

Plane strain forging of a niobium micro-alloyed steel

International Nuclear Information System (INIS)

Balancin, O.; Ferran L, G.; Rio de Janeiro Univ.

1984-01-01

Various termomechanical treatments were carried out on a niobium micro-alloyed steel and a low carbon steel as reference material, using an apparatus for hot phane strain forging. Control of processing variables and the presence of niobium strongly modify the austenite microstructure, which upon decomposition produces various phases such as polygonal and acicular ferrite and martensite, alone or together in variable proportions. Corresponding to this diversity of structures there is a wide variation in mechanical properties at room temperature: the initial yield point varies from 310 to 650 MPa and the reduction of area in uniaxial tension from 82 to 57% for the niobium steel. These results show that hot forging a niobium micro-alloyed steel may be a suitable manufacturing process for satisfying a wide range of specifications in a final product with low equivalent carbon. (Author) [pt

Design of a forging processing route for a gas turbine compressor disc in IMI 834

International Nuclear Information System (INIS)

Clark, G.S.

1993-01-01

The microstructure in all parts of a modern gas turbine compressor disc must be carefully controlled to give the optimum balance for resistance to creep and fatigue. This is particularly true for advanced titanium alloys such as IMI834. Dynamic recrystallisation during high temperature deformation and static recrystallisation and grain growth during heat treatment, all have a profound effect on the grain structure of the disc. These processes are affected by temperature, rate of deformation and various microstructural features. These may include the size and volume fraction of primary alpha particles and current beta grain size. The construction of a computer model to simulate the forging process must therefore take all these factors into account to fully simulate the mechanical and microstructural behaviour of the material during processing. This requires a complete characterisation of the material to formulate mechanical and microstructural constitutive equations for use in a visco-plastic finite element forging model. Similarly the forging equipment must be fully characterised so that forging processes can be accurately simulated. (orig.)

Near-liquidus forging, partial remelting and thixoforging of an AZ91D + Y magnesium alloy

International Nuclear Information System (INIS)

Zhao Zude; Chen Qiang; Hu Chuankai; Huang Shuhai; Wang Yuanqing

2009-01-01

A new route, near-liquidus forging plus partial remelting, has been developed for obtaining globular microstructures. Firstly, a material is formed by near-liquidus forging for obtaining a fine dendritic microstructure. Globular microstructure can be produced by reheating the material into the semi-solid temperature range for a period of time. In this paper, an AZ91D alloy with the addition of yttrium was prepared by near-liquidus forging. Microstructure evolution during partial remelting was studied at temperatures and for times. Tensile mechanical properties of thixoforged components were also determined. It is shown that the fine dendritic structure firstly evolves into a blocky structure during partial remelting. With prolonged holding time, the blocky structure disintegrates into polygonal solid particles. Prolonging time and increasing temperature promote a faster spheroidization. Good mechanical properties are obtained for the thixoforged AZ91D alloy with the addition of yttrium prepared by near-liquidus forging, with a yield strength of 160.9 MPa and a ultimate tensile strength of 301.7 MPa and a elongation to fracture of 9.734%.

The casting of western sculpture during the XIXth century: sand casting versus lost wax casting

NARCIS (Netherlands)

Beentjes, T.P.C.

2014-01-01

This paper will discuss research into bronze casting techniques as practiced during the XIXth and early XXth century. Both natural sand casting (fonte au sable naturel) and lost wax casting (fonte à la cire perdue) were employed during this period and sometimes rivalled for commissions. Before the

Current forgings and their properties for steam generator of nuclear plant

International Nuclear Information System (INIS)

Tsukada, Hisashi; Suzuki, Komei; Kusuhashi, Mikio; Sato, Ikuo

1997-01-01

Current steel forgings for steam generator (SG) of PWR plant are reviewed in the aspect of design and material improvement. The following three items are introduced. The use of integral type steel forgings for the fabrication of steam generator enhances the structural integrity and makes easier fabrication and inspection including in-service inspection. The following examples of current integral type forgings developed by the Japan Steel Works, Ltd. (JSW) are introduced: (1) primary head integrated with nozzles, manways and supports; (2) steam drum head integrated with nozzle and handhole; (3) conical shell integrated with cylindrical sections and handholes. In order to decrease the weight of steam generator, the high strength materials such as SA508, Cl.3a steel have been adopted in some cases. The properties of this steel are introduced and the chemistry and heat treatment condition are discussed. As one of the methods to minimize the macro- and micro-segregations, the use of vacuum carbon deoxidation (VCD), i.e. deoxidization of steel by gaseous CO reaction, with addition of Al for grain refining was investigated. The properties of SA508, Cl.3 steels with Low Si content are compared with those of conventional one

Current forgings and their properties for steam generator of nuclear plant

Energy Technology Data Exchange (ETDEWEB)

Tsukada, Hisashi; Suzuki, Komei; Kusuhashi, Mikio; Sato, Ikuo [Japan Steel Works Ltd., Muroran (Japan)

1997-12-31

Current steel forgings for steam generator (SG) of PWR plant are reviewed in the aspect of design and material improvement. The following three items are introduced. The use of integral type steel forgings for the fabrication of steam generator enhances the structural integrity and makes easier fabrication and inspection including in-service inspection. The following examples of current integral type forgings developed by the Japan Steel Works, Ltd. (JSW) are introduced: (1) primary head integrated with nozzles, manways and supports; (2) steam drum head integrated with nozzle and handhole; (3) conical shell integrated with cylindrical sections and handholes. In order to decrease the weight of steam generator, the high strength materials such as SA508, Cl.3a steel have been adopted in some cases. The properties of this steel are introduced and the chemistry and heat treatment condition are discussed. As one of the methods to minimize the macro- and micro-segregations, the use of vacuum carbon deoxidation (VCD), i.e. deoxidization of steel by gaseous CO reaction, with addition of Al for grain refining was investigated. The properties of SA508, Cl.3 steels with Low Si content are compared with those of conventional one.

Void consolidation during open-die forging for ultralarge rotor shafts. (1. Formulation of void-closing behavior)

International Nuclear Information System (INIS)

Ono, Shin-ichi; Minami, Katsuyuki; Ochiai, Tomoyuki; Iwadate, Tadao; Nakata, Shin-ichi.

1995-01-01

Open-die forging experiments using different die geometries under hot isothermal conditions and three-dimensional simulations using rigid-plastic finite-element method were performed to formulate a void-closing behavior using only two factors; the integral of hydrostatic stress and the equivalent strain. First, upsetting, side-upsetting and V-shape die cogging of several cylinders with a spherical void at the center are carried out and the information on the void volume reduction is obtained. Seconds, the same forgings, but without voids is treated numerically and the development of stress and strain at the location of voids is investigated. Then, by combining these results, and using regression analysis, it is found that the void volume reduction is expressed as a polynomial function of the two factors. When the polynomial function is used, various forging methods can be evaluated quantitatively in terms of void-closing behavior. Therefore it is beneficial to optimize the forging process for a large rotor shaft. (author)

The CAST time projection chamber

International Nuclear Information System (INIS)

Autiero, D; Beltran, B; Carmona, J M; Cebrian, S; Chesi, E; Davenport, M; Delattre, M; Di Lella, L; Formenti, F; Irastorza, I G; Gomez, H; Hasinoff, M; Lakic, B; Luzon, G; Morales, J; Musa, L; Ortiz, A; Placci, A; Rodrigurez, A; Ruz, J; Villar, J A; Zioutas, K

2007-01-01

One of the three x-ray detectors of the CERN Axion Solar Telescope (CAST) experiment searching for solar axions is a time projection chamber (TPC) with a multi-wire proportional counter (MWPC) as a readout structure. Its design has been optimized to provide high sensitivity to the detection of the low intensity x-ray signal expected in the CAST experiment. A low hardware threshold of 0.8 keV is set to a safe level during normal data taking periods, and the overall efficiency for the detection of photons coming from conversion of solar axions is 62%. Shielding has been installed around the detector, lowering the background level to 4.10 x 10 -5 counts cm -2 s -1 keV -1 between 1 and 10 keV. During phase I of the CAST experiment the TPC has provided robust and stable operation, thus contributing with a competitive result to the overall CAST limit on axion-photon coupling and mass

Analysis of hot rolling and hot forging effects on mechanical properties and microstructure of ZrNbMoGe alloy

International Nuclear Information System (INIS)

AH Ismoyo; Parikin; Bandriyana

2014-01-01

Research on formation technique by a combined method of rolling and forging has been carried out in order to improve the mechanical properties of ZrNbMoGe alloy to be used as fuel cladding in NPP (Nuclear Power Plant) application. The effects of rolling and forging were analyzed several tests. The tests were conducted for zirconium alloy specimen with a composition of (in % wt.) 97% Zr, 0,5% Mo, 2% Nb and 0,5% Ge, where the specimen was melted with an arc-furnace. The hot rolling and forging were conducted at 900 °C and 950 °C respectively. Hardness test was carried out by using a microhardness testing machine, while microstructure examination and crystal structure analysis were conducted with an optical microscope and an X-ray diffractometer. The results show that the hardness of the alloy increase from 141.21 HV (starting material) to 210.47 HV (hot rolled material) and 365.75 HV (hot forged material). Texturing phenomenon is clearly figured on the microstructure due to hot rolling and forging process. Analysis by diffractogram also indicates that the hot rolling and forging process has influence on the crystal orientation of dominant preferred direction in the reflection plane of (10ī1), recorded from the rise of intensity counting from about 2500 to 3000. In summary, hot forging and rolling process can change the mechanical properties (hardness and texture) and microstructure of materials. (author)

Report on results of current and future metal casting

International Nuclear Information System (INIS)

Unal, Cetin; Carlson, Neil N.

2015-01-01

New modeling capabilities needed to simulate the casting of metallic fuels are added to Truchas code. In this report we summarize improvements we made in FY2015 in three areas; (1) Analysis of new casting experiments conducted with BCS and EFL designs, (2) the simulation of INL's U-Zr casting experiments with Flow3D computer program, (3) the implementation of surface tension model into Truchas for unstructured mesh required to run U-Zr casting.

76 FR 52313 - Heavy Forged Hand Tools (i.e., Axes & Adzes, Bars & Wedges, Hammers & Sledges, and Picks...

Science.gov (United States)

2011-08-22

... DEPARTMENT OF COMMERCE International Trade Administration [A-570-803] Heavy Forged Hand Tools (i.e... Administration, Department of Commerce. SUMMARY: As a result of the determinations by the Department of Commerce... on heavy forged hand tools (i.e., [[Page 52314

Casting defects and fatigue behaviour of ductile cast iron for wind turbine components: A comprehensive study

Energy Technology Data Exchange (ETDEWEB)

Haerkegaard, G. [Norwegian University of Science and Technology, Dept. of Engineering Design and Materials, Trondheim (Norway); Shirani, M.

2011-12-15

Two types of EN-GJS-400-18-LT ductile cast iron were investigated in this research, clean baseline material in the shape of castings with different thicknesses and also defective material from a rejected wind turbine hub. P-S-N curves for baseline EN-GJS-400-18-LT specimens with different dimensions and from castings with different thicknesses at different load ratios were established. Geometrical size effect, technological size effects and mean stress effect on fatigue strength of baseline EN-GJS-400-18-LT were evaluated. Fatigue strength of baseline EN-GJS-400-18-LT was compared with that of defective material from the rejected hub. The effect of defects type, shape, size and position on fatigue strength of this material was evaluated. The hypothesis that the endurance observed in an S-N test can be predicted based on the analysis of crack growth from casting defects through defect-free 'base' material was tested for the analyzed defective material. 3D X-ray computed tomography was use to detect defects in defective specimens and find the defect size distribution. The obtained defect size distribution for the defective material was used in random defect analysis to establish the scatter of fatigue life for defective specimens. Finally both safe-life design and damage tolerant design of wind turbine castings were analyzed and compared. (Copyright copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

Determining casting defects in near-net shape casting aluminum parts by computed tomography

Science.gov (United States)

Li, Jiehua; Oberdorfer, Bernd; Habe, Daniel; Schumacher, Peter

2018-03-01

Three types of near-net shape casting aluminum parts were investigated by computed tomography to determine casting defects and evaluate quality. The first, second, and third parts were produced by low-pressure die casting (Al-12Si-0.8Cu-0.5Fe-0.9Mg-0.7Ni-0.2Zn alloy), die casting (A356, Al-7Si-0.3Mg), and semi-solid casting (A356, Al-7Si-0.3Mg), respectively. Unlike die casting (second part), low-pressure die casting (first part) significantly reduced the formation of casting defects (i.e., porosity) due to its smooth filling and solidification under pressure. No significant casting defect was observed in the third part, and this absence of defects indicates that semi-solid casting could produce high-quality near-net shape casting aluminum parts. Moreover, casting defects were mostly distributed along the eutectic grain boundaries. This finding reveals that refinement of eutectic grains is necessary to optimize the distribution of casting defects and reduce their size. This investigation demonstrated that computed tomography is an efficient method to determine casting defects in near-net shape casting aluminum parts.

Shape optimization of metal forming and forging products using the stress equivalent static loads calculated from a virtual model

International Nuclear Information System (INIS)

Jang, Hwan Hak; Jeong, Seong Beom; Park, Gyung Jin

2012-01-01

A shape optimization is proposed to obtain the desired final shape of forming and forging products in the manufacturing process. The final shape of a forming product depends on the shape parameters of the initial blank shape. The final shape of a forging product depends on the shape parameters of the billet shape. Shape optimization can be used to determine the shape of the blank and billet to obtain the appropriate final forming and forging products. The equivalent static loads method for non linear static response structural optimization (ESLSO) is used to perform metal forming and forging optimization since nonlinear dynamic analysis is required. Stress equivalent static loads (stress ESLs) are newly defined using a virtual model by redefining the value of the material properties. The examples in this paper show that optimization using the stress ESLs is quite useful and the final shapes of a forming and forging products are identical to the desired shapes

Family Health and Financial Literacy--Forging the Connection

Science.gov (United States)

Braun, Bonnie; Kim, Jinhee; Anderson, Elaine A.

2009-01-01

Families are at-risk of or experiencing a diminished quality of living and life in current economic times and difficult decisions are required. Health and financial literacy are the basis for wise personal and public decision making. Family and consumer sciences (FCS) professionals can forge connections between health and financial literacy to…

Forge, Arquillian, Swarm and Spring Boot: All play and no effort makes Simon a productive boy

CERN Multimedia

CERN. Geneva

2017-01-01

During this live coding session, Simon will shine some light on a range productivity tools that make software development a pleasure rather than a chore. Simon will live code 2 applications; a Java EE application, with JBoss Forge which uses JPA, Bean Validation, REST and Angular. We’ll test this application using Arquillian from within JBoss Forge. We’ll also show how a Java EE microservice can be developed in Forge and run using JBoss Swarm. The second application will be developed on Spring Boot and using JRebel we’ll rapidly develop and run a Spring application. Attendees will learn how to write code productively using tools designed for developers.

Optimization of the Hot Forging Processing Parameters for Powder Metallurgy Fe-Cu-C Connecting Rods Based on Finite Element Simulation

Science.gov (United States)

Li, Fengxian; Yi, Jianhong; Eckert, Jürgen

2017-12-01

Powder forged connecting rods have the problem of non-uniform density distributions because of their complex geometric shape. The densification behaviors of powder metallurgy (PM) connecting rod preforms during hot forging processes play a significant role in optimizing the connecting rod quality. The deformation behaviors of a connecting rod preform, a Fe-3Cu-0.5C (wt pct) alloy compacted and sintered by the powder metallurgy route (PM Fe-Cu-C), were investigated using the finite element method, while damage and friction behaviors of the material were considered in the complicated forging process. The calculated results agree well with the experimental results. The relationship between the processing parameters of hot forging and the relative density of the connecting rod was revealed. The results showed that the relative density of the hot forged connecting rod at the central shank changed significantly compared with the relative density at the big end and at the small end. Moreover, the relative density of the connecting rod was sensitive to the processing parameters such as the forging velocity and the initial density of the preform. The optimum forging processing parameters were determined and presented by using an orthogonal design method. This work suggests that the processing parameters can be optimized to prepare a connecting rod with uniform density distribution and can help to better meet the requirements of the connecting rod industry.

Maintenance system improvement in cast iron foundry

Directory of Open Access Journals (Sweden)

S. Kukla

2011-07-01

Full Text Available The work presents the issue of technical equipment management in an iron foundry basing on the assumptions of the TPM system (Total Productive Maintenance. Exploitation analysis of automatic casting lines has been carried out and their work’s influence on the whole production system’s functioning has been researched. Within maintenance system improvement, implementation of autonomic service and planned lines’ review have been proposed in order to minimize the time of breakdown stoppages. The SMED method was used to optimize changeover time, and the OEE (Overall Equipment Effectiveness was applied to evaluate the level of resources usage before and after implementing changes. Further, the influence of the maintenance strategy of casting devices’ efficiency on own costs of casting manufac- ture was estimated.

Influence of Solution Treatment Temperature on Microstructural Properties of an Industrially Forged UNS S32750/1.4410/F53 Super Duplex Stainless Steel (SDSS Alloy

Directory of Open Access Journals (Sweden)

Vasile Dănuț Cojocaru

2017-06-01

Full Text Available In this present study, the influence of solution annealing temperature on microstructural properties of a forged Super Duplex Stainless Steel (SDSS was investigated by SEM-BSE (Scanning Electron Microscopy-Backscattered Electrons and SEM-EBSD (Scanning Electron Microscopy-Electron Backscatter Diffraction techniques. A brief solution treatment was applied to the forged super duplex alloy, at different temperatures between 800 °C and 1100 °C, with a constant holding time of 0.6 ks (10 min. Microstructural characteristics such as nature, weight fraction, distribution and morphology of constituent phases, average grain-size and grain misorientation were analysed in relation to the solution annealing temperature. Experimental results have shown that the constituent phases in the SDSS alloy are δ-Fe, γ-Fe and σ (Cr-Fe and that their properties are influenced by the solution treatment temperature. SEM examinations revealed microstructural modifications induced by the Cr rich precipitates along the δ/γ and δ/δ grain boundaries, which may significantly affect the toughness and the corrosion resistance of the alloy. Solution annealing at 1100 °C led to complete dissolution of σ (Cr-Fe phase, the microstructure being formed of primary δ-Fe and γ-Fe. The orientation relationship between δ/δ, γ/γ and δ/γ grains was determined by electron back scattering diffraction (EBSD. Both primary constituent phase’s microhardness and global microhardness were determined.

Forming of Hollow Shaft Forging From Titanium Alloy Ti6Al4V by Means of Rotary Compression

Directory of Open Access Journals (Sweden)

Tomczak J.

2015-04-01

Full Text Available This paper presents chosen results of theoretical-experimental works concerning forming of hollow shafts forgings from titanium alloys, which are applied in aviation industry. At the first stage of conducted analysis, the forging forming process was modeled by means of finite element method. Calculations were made using software Simufact Forming. On the basis of performed simulations optimal parameters of rotary compression process were determined. Next, experimental tests of forging forming in laboratory conditions were made. For the research needs, a forging aggregate, designed by the Authors, was used. Conducted research works confirmed the possibility of metal forming (by means of rotary compression of hollow shafts from hard workable titanium alloys. Numerous advantages of rotary compression process, make it attractive both for low series production (aircraft industry and for mass production (automotive industry.

Transmission electron microscopy of Ti-12Mo-13Nb Alloy aged after heat forging; Microscopia eletronica de transmissao da liga Ti-12Mo-13Nb envelhecida apos forjamento a quente

Energy Technology Data Exchange (ETDEWEB)

Oliveira, Nathalia Rodrigues [Centro Universitario de Volta Redonda (UNIFOA), Volta Redonda, RJ (Brazil); Baldan, Renato [Universidade de Sao Paulo (USP), Lorena, SP (Brazil). Escola de Engenharia; Nunes, Carlos Angelo; Mei, Paulo Roberto [Universidade Estadual de Campinas (UNICAMP), Campinas, SP (Brazil); Gabriel, Sinara Borborema [Universidade Federal do Rio de Janeiro (UFRJ), Rio de Janeiro, RJ (Brazil)

2014-06-15

Metastable β-Ti alloys possess mechanical properties, in particular a elastic modulus that depends not only on its composition but also the applied thermomechanical treatments. These alloys require high mechanical strength and a low Young’s modulus to avoid stress shielding. Preliminary studies on the development of Ti- 13Nb-12Mo alloy showed than the better properties were obtained at aged at 500 ° C / 24 h after cold forging , whose microstructure consisted of bimodal α phase in the β matrix. In this work, Ti-12Mo-13Nb alloy was heat forged and aged at 500 deg C for 24h and the microstructure was analyzed by employing X-ray diffraction and transmission electron microscopy. According to the results, while the cold forging resulted in bimodal α phase in the β matrix, hot forging resulted in a fine and homogeneous α phase in the β matrix. (author)

Marginal Accuracy of Castings Fabricated with Ringless Casting Investment System and Metal Ring Casting Investment System: A Comparative Study.

Science.gov (United States)

Kalavathi, M; Sachin, Bhuvana; Prasanna, B G; Shreeharsha, T V; Praveen, B; Ragher, Mallikarjuna

2016-02-01

The thermal expansion of the investment can be restricted by the metal casting ring because the thermal expansion of the ring is less than that of the investment. The ringless casting procedure is in use in clinical dentistry, though there is little scientific data to support its use in fixed partial dentures. In this study, marginal discrepancy of castings produced with the ringless casting technique and the conventional technique using the metal rings were compared. A total of 30 wax patterns were fabricated directly on a metal die. Optical stereomicroscope was used to measure the marginal discrepancy between the metal die and wax patterns. A total of 15 castings were invested using Bellavest T phosphate-bonded investment with the ringless technique and 15 were invested with the same investment with a metal ring; 30 castings were produced using a nickel-chromium ceramo-metal alloy. The internal surface of the castings was not modified and seated with finger pressure. The vertical marginal discrepancy was measured using an optical stereomicroscope at a magnification of 100x. The data obtained were statistically analyzed using students t-test (paired t-test and unpaired t-test). The castings of the ringless technique provided less vertical marginal discrepancy (240.56 ± 45.81 μ) than the castings produced with the conventional metal ring technique (281.98± 53.05 μ). The difference was statistically significant. The ringless casting technique had produced better marginal accuracy compared with conventional casting technique. Ringless casting system can be used routinely for clinical purpose.

UK's Brexit battle casts shadow over funding for international fusion projects

International Nuclear Information System (INIS)

Shepherd, John

2017-01-01

The ramifications of Brexit - the UK's decision to leave the European Union - have continued to send shockwaves through the nuclear energy community, since I explained in this column recently that the move also means withdrawing from the Euratom Treaty. Now the UK's divorce from the EU is posing a threat that could deal a major blow to international efforts in fusion research. In fact, confusing signals from the UK have cast doubt on future funding and support for two key areas of world fusion cooperation: the Oxfordshire-based Joint European Torus (Jet) programme and the International Thermonuclear Experimental Reactor (Iter) project at Cadarache in France.

UK's Brexit battle casts shadow over funding for international fusion projects

Energy Technology Data Exchange (ETDEWEB)

Shepherd, John [nuclear 24, Redditch (United Kingdom)

2017-04-15

The ramifications of Brexit - the UK's decision to leave the European Union - have continued to send shockwaves through the nuclear energy community, since I explained in this column recently that the move also means withdrawing from the Euratom Treaty. Now the UK's divorce from the EU is posing a threat that could deal a major blow to international efforts in fusion research. In fact, confusing signals from the UK have cast doubt on future funding and support for two key areas of world fusion cooperation: the Oxfordshire-based Joint European Torus (Jet) programme and the International Thermonuclear Experimental Reactor (Iter) project at Cadarache in France.

Development of forging technology for PWR primary piping

International Nuclear Information System (INIS)

Morin, F.; Badeau, J.P.; Lambs, R.

1996-01-01

The purpose of this presentation is to give information on the changes in the design and manufacture of Primary Piping for electronuclear boilers of the Pressurized Water Reactor type (PWR) which has resulted in the making of one-piece forged lines including stub pipes and arcs. The optimization of these items is aimed at improving the life of the new power stations as well as guaranteeing their safety, while reducing inspection and maintenance requirements in service. The demonstration of the manufacturing feasibility has just been completed. It has taken material form in the installation, on the CIVAUX 1 section, of the first one-piece cold leg in the world. It will shortly be followed by the installation on the CIVAUX 2 section of a complete loop of bent forged pipes. Therefore, this new know-how is going to be incorporated in the French Rules (RCC-M) and can be directly taken into consideration both in the next work to be done and in the design and definition of a future nuclear reactor

The effect of strain distribution on microstructural developments during forging in a newly developed nickel base superalloy

Energy Technology Data Exchange (ETDEWEB)

Buckingham, R.C. [Institute of Structural Materials, Swansea University, Bay Campus, Fabian Way, Swansea SA1 8EN (United Kingdom); Argyrakis, C.; Hardy, M.C. [Rolls-Royce plc, PO Box 31, Derby DE24 8BJ (United Kingdom); Birosca, S., E-mail: 522042@swansea.ac.uk [Institute of Structural Materials, Swansea University, Bay Campus, Fabian Way, Swansea SA1 8EN (United Kingdom)

2016-01-27

In the current study, the effect of strain distribution in a simple forging geometry on the propensity for recrystallization, and its impact on mechanical properties has been investigated in a newly developed experimental nickel-based superalloy. The new alloy was produced via a Powder Metallurgy (PM) route and was subsequently Hot Isostatic Processed (HIP), isothermally forged, and heat treated to produce a coarse grain microstructure with average grain size of 23–32 μm. The alloy was examined by means of Electron Back-Scatter Diffraction (EBSD) to characterise the microstructural features such as grain orientation and morphology, grain boundary characteristics and the identification of potential Prior Particle Boundaries (PPBs) throughout each stage of the processing route. Results at the central region of the cross-section plane parallel to the loading direction showed significant microstructural differences across the forging depth. This microstructural variation was found to be highly dependent on the value of local strain imparted during forging such that areas of low effective strain showed partial recrystallisation and a necklace grain structure was observed following heat treatment. Meanwhile, a fully recrystallised microstructure with no PPBs was observed in the areas of high strain values, in the central region of the forging.

Travelling Through Caste

OpenAIRE

Kumar, Raj

2016-01-01

With its peculiar caste system, India is considered the most stratified of all known societies in human history. This system is ‘peculiar’ as it divides human beings into higher and lower castes and this division is backed by certain religious sanctions based on the sociological concepts of ‘purity’ and ‘pollution’. While the higher caste is associated with ‘purity’, the lower caste is associated with ‘pollution’. The people of the lower castes are not allowed to undertake religious journeys ...

30 CFR 816.13 - Casing and sealing of drilled holes: General requirements.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Casing and sealing of drilled holes: General...-SURFACE MINING ACTIVITIES § 816.13 Casing and sealing of drilled holes: General requirements. Each exploration hole, other drill or borehole, well, or other exposed underground opening shall be cased, sealed...

Caste and power

DEFF Research Database (Denmark)

Roy, Dayabati

2011-01-01

This paper explores the institution of caste and its operation in a micro-level village setting of West Bengal, an Indian state, where state politics at grass roots level is vibrant with functioning local self-government and entrenched political parties. This ethnographic study reveals that caste...... relations and caste identities have overarching dimensions in the day-to-day politics of the study villages. Though caste almost ceases to operate in relation to strict religious strictures, under economic compulsion the division of labour largely coincides with caste division. In the cultural......–ideological field, the concept of caste-hierarchy seems to continue as an influencing factor, even in the operation of leftist politics....

77 FR 39997 - Heavy Forged Hand Tools, Finished or Unfinished, With or Without Handles From the People's...

Science.gov (United States)

2012-07-06

... DEPARTMENT OF COMMERCE International Trade Administration [A-570-803] Heavy Forged Hand Tools...) (Diamond Sawblades), the Department is notifying the public that the final judgment in this case is not in... review on heavy forged hand tools, finished or unfinished, with or without handles from the People's...

Standard specification for titanium and titanium alloy forgings

International Nuclear Information System (INIS)

Anon.

1975-01-01

Standards are given for the purchase, manufacture, product testing and certification, packaging, and marketing of annealed Ti and Ti-alloy forgings. The specifications apply to the following Ti alloys: 6Al-Ti-4V, 5Al-Ti-2.5 Sn, and Ti + Pd. Acceptable values for the chemical requirements, product analysis limits, and tensile requirements are tabulated

Concept of a Prestressed Cast Iron Pressure Vessel for a Modular High Temperature Reactor

International Nuclear Information System (INIS)

Steinwarz, Wolfgang; Bounin, Dieter

2014-01-01

High Temperature Reactors (HTR) are representing one of the most interesting solutions for the upcoming generation of nuclear technology, especially with view to their inherent safety characteristics. To complete the safety concept of such plants already in the first phase of the technical development, Prestressed Cast Iron Pressure Vessels (PCIV) instead of the established forged steel reactor pressure vessels have been considered under the aspect of safety against bursting. A longterm research and development work, mainly performed in Germany, showed the excellent features of this technical solution. Diverse prototypic vessels were tested and officially proven. Design studies confirmed the feasibility of such a vessel concept also for Light Water Reactor types, too. The main concept elements of such a burst-proof vessel are: Strength and tightness functions are structurally separated. The tensile forces are carried by the prestressing systems consisting of a large number of independent wires. Compressive forces are applied to the vessel walls and heads. These are segmented into blocks of ductile cast iron. All cast iron blocks are prestressed to high levels of compression. The sealing function is assigned to a steel liner fixed to the cast iron blocks. The prestressing system is designed for an ultimate pressure of 2.3 times the design pressure. The prestress of the lids is designed for gapping at a much smaller pressure. Therefore, a drop of pressure will always occur before loss of strength (“leakage before failure”). In addition to these safety features further technical as well as economic aspects generate favorable assessment criteria: high design flexibility, feasibility of large vessel diameters; advantageous conditions for transport, assembly and decommissioning due to the segmented construction; advantage of workshop manufacturing; high-level quality control of components. Nowadays, considering the globally newly standardized safety requirements

Multi-objective optimization of die geometry in ingot forging

DEFF Research Database (Denmark)

Christiansen, Peter; Martins, Paulo A.F.; Bay, Niels

2014-01-01

The soundness of an ingot after hot forging with different V-shaped lower dies is evaluated using finite element simulations.Two different modelling approaches that make use of uncoupled ductile damage and coupled ductile damage based on porousplasticity are employed. It is shown that the two...

Technological Aspects of Low-Alloyed Cast Steel Massive Casting Manufacturing

Directory of Open Access Journals (Sweden)

Szajnara J.

2013-12-01

Full Text Available In the paper authors have undertaken the attempt of explaining the causes of cracks net occurrence on a massive 3-ton cast steel casting with complex geometry. Material used for casting manufacturing was the low-alloyed cast steel with increased wear resistance modified with vanadium and titanium. The studies included the primary and secondary crystallization analysis with use of TDA and the qualitative and quantitative analysis of non-metallic inclusions.

Microstructure evolution of superalloy for large exhaust valve during hot forging

International Nuclear Information System (INIS)

Jeong, H.S.; Cho, J.R.; Park, H.C.

2004-01-01

The nickel-based alloy Nimonic 80A possesses strength, and corrosion, creep and oxidation resistance at high temperature. These products are used for aerospace, marine engineering and power generation, etc. The control of forging parameters such as strain, strain rate, temperature and holding time is important because the microstructure change in hot working affects the mechanical properties. It is necessary to understand the microstructure variation evolution. The microstructure change evolution occurs by recovery, recrystallization and grain growth phenomena. The dynamic recrystallization evolution has been studied in the temperature range 950-1250 deg. C and strain rate range 0.05-5s-1 using hot compression tests. The metadynamic recrystallization and grain growth evolution has been studied in the temperature range 950-1250 deg. C and strain rate range 0.05, 5s-1, holding time range 5, 10, 100, 600 sec using hot compression tests. Modeling equations are developed to represent the flow curve, recrystallized grain size, recrystallized fraction and grain growth phenomena by various tests. Parameters of modeling equation are expressed as a function of the Zener-Hollomon parameter. The modeling equation for grain growth is expressed as a function of initial grain size and holding time. The developed modeling equation was combined with thermo-viscoplastic finite element modeling to predict various microstructure change evolution during thermo mechanical processing. The predicted grain size in developed FE simulation results is compared with results obtained in various tests. In order to obtain a final microstructure and good mechanical properties in forging, the FEM would become a useful tool in the simulation of the microstructure development

The labor/land ratio and India's caste system

OpenAIRE

Duleep, Harriet

2012-01-01

This paper proposes that India’s caste system and involuntary labor were joint responses by a nonworking landowning class to a low labor/land ratio in which the rules of the caste system supported the institution of involuntary labor. The hypothesis is tested in two ways: longitudinally, with data from ancient religious texts, and cross-sectionally, with twentieth-century statistics on regional population/land ratios linked to anthropological measures of caste-system rigidity. Both the longit...

Reducing the Incidence of Cast-related Skin Complications in Children Treated With Cast Immobilization.

Science.gov (United States)

Difazio, Rachel L; Harris, Marie; Feldman, Lanna; Mahan, Susan T

2017-12-01

Cast immobilization remains the mainstay of pediatric orthopaedic care, yet little is known about the incidence of cast-related skin complications in children treated with cast immobilization. The purposes of this quality improvement project were to: (1) establish a baseline rate of cast-related skin complications in children treated with cast immobilization, (2) identify trends in children who experienced cast-related skin complications, (3) design an intervention aimed at decreasing the rate of cast-related skin complications, and (4) determine the effectiveness of the intervention. A prospective interrupted time-series design was used to determine the incidence of cast-related skin complications overtime and compare the rates of skin complications before and after an intervention designed to decrease the incidence of cast-related heel complications. All consecutive patients who were treated with cast immobilization from September 2012 to September 2014 were included. A cast-related skin complications data collection tool was used to capture all cast-related skin complications. A high rate of heel events was noted in our preliminary analysis and an intervention was designed to decrease the rate of cast-related skin complications, including the addition of padding during casting and respective provider education. The estimated cast-related skin events rate for all patients was 8.9 per 1000 casts applied. The rate for the total preintervention sample was 13.6 per 1000 casts which decreased to 6.6 in the postintervention sample. When examining the heel-only group, the rate was 17.1 per 1000 lower extremity casts applied in the preintervention group and 6.8 in the postintervention group. Incorporating padding to the heel of lower extremity cast was an effective intervention in decreasing the incidence of cast-related skin complications in patients treated with cast immobilization. Level II.

The evolution of microtexture and macrotexture during subtransus forging of Ti-10V-2Fe-3Al

International Nuclear Information System (INIS)

Raghunathan, S.L.; Dashwood, R.J.; Jackson, M.; Vogel, S.C.; Dye, D.

2008-01-01

The macrotextures and microtextures produced during α+β forging of Ti-10V-2Fe-3Al were characterised using neutron, in situ synchrotron X-ray and ex situ electron backscatter diffraction (EBSD). The EBSD analysis showed that the measured misorientation distributions at a strain of 0.8 and strain rates of 0.1 and 0.01s -1 were similar, with an average misorientation of 2.2 deg. During forging, the moderate cube macrotexture inherited from the parent material was converted into a moderate fibre texture, with the major change occurring between strains of 0.4 and 0.6. The synchrotron diffraction studies allowed the orientation evolution of individual grains to be characterised. At the highest strain rate of 0.1s -1 , this indicated a change in behaviour from dispersion of the crystal mosaic (peak angular spread) at low strains, to convergence of the crystal mosaic at larger strains. At lower strain rates, only convergence of the crystal mosaic was observed. It is suggested that these results indicate a change in mechanism between deformation-controlled behaviour during the early stages of deformation and a strain rate of 0.1s -1 and diffusional, recovery-controlled behaviour at lower strain rates and higher strains

Lipofection of siRNA into bovine 8-16-cell stage embryos using zona removal and the well-of-the-well culture system.

Science.gov (United States)

Ikeda, Shuntaro; Sugimoto, Miki; Kume, Shinichi

2018-04-13

Bovine preimplantation embryos exhibit dramatic biological changes between before and after the 8-16-cell stage. Here we report a simple lipofection method to transfect siRNA into bovine 8-16-cell stage embryos using zona removal and the well-of-the-well (WOW) culture system. Bovine one-cell embryos produced in vitro were freed from the zona pellucida and cultured up to the 8-16-cell stage in WOW dishes. The 8-16-cell embryos were lipofected with siRNA and the transfection efficiency was assessed at 48 h of transfection. Lipofection with a red fluorescent non-targeting siRNA revealed the importance of zona removal for transfection of siRNA into embryos. Using this method, we knocked down the methionine adenosyltransferase 2A (MAT2A) gene, achieving a significant reduction in MAT2A expression (P lipofection', may be useful to analyze gene functions in bovine preimplantation embryos without expensive equipment and skill-intensive techniques.

30 CFR 816.87 - Coal mine waste: Burning and burned waste utilization.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Coal mine waste: Burning and burned waste...-SURFACE MINING ACTIVITIES § 816.87 Coal mine waste: Burning and burned waste utilization. (a) Coal mine... extinguishing operations. (b) No burning or burned coal mine waste shall be removed from a permitted disposal...

Reengineering of Permanent Mould Casting with Lean Manufacturing Methods

Directory of Open Access Journals (Sweden)

R. Władysiak

2007-07-01

Full Text Available At the work were introduced main areas of production system project of casts produced in permanent moulds, that constitutes reengineering of conventional production system according to Lean Manufacturing (LM methods. New resolution of cooling of dies with water mist was shown to casting of car wheels made from aluminium alloys in low pressure casting process. It was implemented as a part of goal-oriented project in R.H. Alurad Sp.z o.o. in Gorzyce. Its using intensifies solidification and self-cooling of casts shortening the time of casting cycle by the 30%. It was described reorganizing casting stations into multi-machines cells production and the process of their fast tool’s exchange with applying the SMED method. A project of the system was described controlling the production of the foundry with the computer aided light Kanban system. A visualization of the process was shown the production of casts with use the value stream mapping method. They proved that applying casting new method in the technology and LM methods allowed to eliminate down-times, to reduce the level of stocks, to increase the productivity and the flow of the castings production.

The effects of thermomechanical history on the microstructure of a nickel-base superalloy during forging

Energy Technology Data Exchange (ETDEWEB)

Gardner, S., E-mail: 485354@swansea.ac.uk [College of Engineering, Bay Campus, Swansea University, Swansea SA1 8EN (United Kingdom); Li, W. [Rolls-Royce plc, PO Box 31, Derby DE24 8BJ (United Kingdom); Coleman, M. [College of Engineering, Bay Campus, Swansea University, Swansea SA1 8EN (United Kingdom); Johnston, R., E-mail: r.johnston@swansea.ac.uk [College of Engineering, Bay Campus, Swansea University, Swansea SA1 8EN (United Kingdom)

2016-06-21

The effect of thermo-mechanical history on hot compression behaviour and resulting microstructures of a nickel base superalloy is presented. Hot compression tests were carried out on HAYNES® 282® specimens to varying strains from 0.1 to 0.8. Both single pass and multi-pass tests were completed. 60 min inter-pass times were utilized to accurately replicate industrial forging practices. The effect of dynamic, metadynamic and static recrystallization during inter-pass times on flow stress was investigated. The resulting microstructures were analysed using scanning electron, optical microscopy and EBSD to relate grain size and homogeneity with flow stress data. The study showed a negligible difference between multi-pass and single pass tests for strain increments above 0.2. Therefore, when modelling similar low strain and strain rate forging processes in HAYNES® 282®, previous forging steps can be ignored.

31 CFR 370.40 - Can I be held accountable if my negligence contributes to a forged signature?

Science.gov (United States)

2010-07-01

... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Can I be held accountable if my negligence contributes to a forged signature? 370.40 Section 370.40 Money and Finance: Treasury Regulations... if my negligence contributes to a forged signature? (a) General. If your failure to exercise ordinary...

Sensitivity Analysis of Oxide Scale Influence on General Carbon Steels during Hot Forging

Directory of Open Access Journals (Sweden)

Bernd-Arno Behrens

2018-02-01

Full Text Available Increasing product requirements have made numerical simulation into a vital tool for the time- and cost-efficient process design. In order to accurately model hot forging processes with finite, element-based numerical methods, reliable models are required, which take the material behaviour, surface phenomena of die and workpiece, and machine kinematics into account. In hot forging processes, the surface properties are strongly affected by the growth of oxide scale, which influences the material flow, friction, and product quality of the finished component. The influence of different carbon contents on material behaviour is investigated by considering three different steel grades (C15, C45, and C60. For a general description of the material behaviour, an empirical approach is used to implement mathematical functions for expressing the relationship between flow stress and dominant influence variables like alloying elements, initial microstructure, and reheating mode. The deformation behaviour of oxide scale is separately modelled for each component with parameterized flow curves. The main focus of this work lies in the consideration of different materials as well as the calculation and assignment of their material properties in dependence on current process parameters by application of subroutines. The validated model is used to carry out the influence of various oxide scale parameters, like the scale thickness and the composition, on the hot forging process. Therefore, selected parameters have been varied within a numerical sensitivity analysis. The results show a strong influence of oxide scale on the friction behaviour as well as on the material flow during hot forging.

A new Friction and Lubrication Test for Cold Forging

DEFF Research Database (Denmark)

Bay, Niels; Wibom, Ole; Aalborg Nielsen, J

1995-01-01

This paper presents a new friction and lubrication test for cold forging. The test allows controlled variation of the surface expansion in the range 0-2000%, the tool temperature in the range 20-270°C and the sliding length between 0 and infinite. Friction is decreasing with increasing temperature...

Investigating the effect of variable gutter technique as a novel method on vertical flow of material in closed die forging processes

Energy Technology Data Exchange (ETDEWEB)

Pourbashiri, M.; Sedighi, M. [Iran University, Tehran (Iran, Islamic Republic of)

2016-04-15

Recently, Variable gutter technique has been introduced as a novel method in order to reduce waste materials in closed-die forging processes. In this paper, the capability of this method is investigated for a family of forged parts that the vertical flow of material is the last stage of forming process. As a case study, using the variable gutter technique, the amount of waste material is decreased about 50% for a sample forged part with a local rising. The results of FVM simulations and experiments confirmed the effectiveness of the variable gutter technique in such forging processes. The vertical flow of material in the die cavity (h parameter), as a criterion, for different gutter width and thickness dimensions was examined by FVM simulations. The results shown that the gutter thickness has more effect on vertical flow of material than the gutter width. By decreasing the gutter thickness and increasing the gutter width, the amount of vertical flow of material is increased about 120% and 29%, respectively. Finally, A/H ratio (A = Max width of sectional area of a forged part, H = Max height of a forged part) is proposed as shape complexity factor of a forged part. The results of FVM simulations are indicated that for the ratio of A/H > 2, the variable gutter thickness technique is more effective and can be successfully used to reduce the amount of waste materials.

Application of directional solidification ingot (LSD) in forging of PWR reactor vessel heads

International Nuclear Information System (INIS)

Benhamou, C.; Poitrault, I.

1985-09-01

Creusot-Loire Industrie uses this type of ingot for manufacture of Framatome 1300 and 1450 MW 4-loop PWR reactor vessel heads. This type of ingot offers a number advantages: improved internal soundness; greater chemical, structural and mechanical homogeneity of the finished part; simplified forging process. After a brief description of the pouring and solidification processes, this paper presents an analysis of the results of examinations performed on the prototype forging, as well as review of results obtained during industrial fabrication of dished heads from LSD ingots. The advantages of the LSD ingot over conventional ingots are discussed in conclusion

Effect of cast steel production metallurgy on the emergence of casting defects

Directory of Open Access Journals (Sweden)

L. Čamek

2016-10-01

Full Text Available The paper documents metallurgical possibilities of high alloy cast steel production in open induction medium frequency furnaces and an electric arc furnace in a gravity die casting foundry. The observation was focused on the emergence of gas defects in steel castings. The content of gases achieved during the metallurgical processes was evaluated for every unit of the production equipment and the casting ladle before casting into disposable sand moulds. The sand mould area was considered to be constant. The aim was to evaluate the current metallurgical possibilities of affecting the content of gases in high alloy cast steel in the current technical conditions of the foundry.

SPRAY CASTING

OpenAIRE

SALAMCI, Elmas

2010-01-01

ABSTRACT This paper is designed to provide a basic review of spray casting. A brief overview of the historical development of spray  casting and the description of plant and equipment have been given. Following metallurgical characteristics of spray formed alloys, process parameters and solidification mechanism of spray deposition have been discussed in detail. Finally, microstructure and mechanical properties of the selected spray cast Al-Zn-Mg-Cu alloys have been presented and comp...

Effect of nonmetallic inclusions on anisotropy of ductility in 35KhN3MFA steel forgings

International Nuclear Information System (INIS)

Shtremel', M.A.; Yavojskij, V.I.; Volkov, V.A.; Chursin, G.M.; Chukhlov, V.I.; Fetisov, G.I.; Mochalin, N.K.; Smol'yaninov, L.V.

1980-01-01

Characteristics of nonmetaltic inclusions and anizotropy of ductility and of impuct strength of forgings of the 35KhN3MFA steel are compared at different variants of melting and outer-furnace treatment. It is shown that method of melting rugulates anisotropy of ductility primarily through deformability of large inclusions during forging. Deformability of inclusions considerably changes due to introduction of silicocalcium in iron mold [ru

Filter effectiveness in the manufacture of high-chromium steel castings

Directory of Open Access Journals (Sweden)

M. Garbiak

2011-01-01

Full Text Available The paper presents the results of studies on the application of ceramic filters in the manufacture of cast hearth plates at the WestPomeranian University of Technology in Szczecin. Castings were poured from the heat-resistant G-X40CrNiSi27-4 cast steel in greensand moulds. The development of casting manufacturing technology included the following studies: analysis of the causes of nonmetallicinclusions in high-chromium alloys, computer simulation of mould filling with liquid metal using standard gating systems without filters and new systems with the built-in filter, making pilot castings, quantitative determination of the content of non-metallicinclusions, determination of the oxygen and nitrogen content, and evaluation of the extent of occurrence of the raw casting s urfacedefects. As a result of the conducted studies and analyses, the quality of produced castings was improved, mainly through the reducedcontent of non-metallic inclusions and better raw casting surface quality.

Development of production technology and investigation of quality for forged-welded turbine rotors of steel 25Kh2NVFA

International Nuclear Information System (INIS)

Borisov, I.A.; Merinov, G.N.; Slezkina, E.V.

1997-01-01

A study was made into mechanical properties and microstructure of turbine rotor components manufactured by forging and heat treated under various conditions. It is revealed that the optimal heat treatment of forgings must include double quenching with subsequent tempering at 630-640 deg C for 10-20 h. Forged and welded rotors should be tempered at 620-630 deg C for 50-100 h. Microscopic examination and mechanical tests showed that low alloy steel 25Kh2NMF can be successfully used for manufacturing rotors of high-, medium-and low-heat turbines

Development of SiC Nanoparticles and Second Phases Synergistically Reinforced Mg-Based Composites Processed by Multi-Pass Forging with Varying Temperatures

Directory of Open Access Journals (Sweden)

Kaibo Nie

2018-01-01

Full Text Available In this study, SiC nanoparticles were added into matrix alloy through a combination of semisolid stirring and ultrasonic vibration while dynamic precipitation of second phases was obtained through multi-pass forging with varying temperatures. During single-pass forging of the present composite, as the deformation temperature increased, the extent of recrystallization increased, and grains were refined due to the inhibition effect of the increasing amount of dispersed SiC nanoparticles. A small amount of twins within the SiC nanoparticle dense zone could be found while the precipitated phases of Mg17Al12 in long strips and deformation bands with high density dislocations were formed in the particle sparse zone after single-pass forging at 350 °C. This indicated that the particle sparse zone was mainly deformed by dislocation slip while the nanoparticle dense zone may have been deformed by twinning. The yield strength and ultimate tensile strength of the composites were gradually enhanced through increasing the single-pass forging temperature from 300 °C to 400 °C, which demonstrated that initial high forging temperature contributed to the improvement of the mechanical properties. During multi-pass forging with varying temperatures, the grain size of the composite was gradually decreased while the grain size distribution tended to be uniform with reducing the deformation temperature and extending the forging passes. In addition, the amount of precipitated second phases was significantly increased compared with that after multi-pass forging under a constant temperature. The improvement in the yield strength of the developed composite was related to grain refinement strengthening and Orowan strengthening resulting from synergistical effect of the externally applied SiC nanoparticles and internally precipitated second phases.

TECHNOLOGICAL PARAMETERS OF SLUGS CASTING OF GREY CAST IRON BY FROSTING

Directory of Open Access Journals (Sweden)

E. I. Marukovich

2009-01-01

Full Text Available The relation of geometrical parametres of casting with technological ones is shown. The monogram for definition of basic technological parametres of obtaining of castings by the method of continuously-cyclic iterative casting by freezing-up is presented.

Strain gauges′s analysis on implant-retained prosthesis′ cast accuracy

Directory of Open Access Journals (Sweden)

Mariana A Rodrigues

2014-01-01

Conclusions: The splinting technique was considered to be as efficient as the conventional technique. The strain gauge methodology was accurate for strain measurements and cast distortion evaluation. There was no correlation between strain and marginal misfit.

Colour Metallography of Cast Iron - Chapter 3: Spheroidal Graphite Cast Iron (Ⅳ

Directory of Open Access Journals (Sweden)

Zhou Jiyang

2010-11-01

Full Text Available Cast iron, as a traditional metal material, has advantages of low total cost, good castability and machinability, good wear resistance and low notch sensitivity, and is still facing tough challenge in quality, property and variety of types etc. Experts and engineers studying and producing iron castings all around world extremely concern this serious challenge. Over more than 30 years, a great of research work has been carried out on how to further improve its property, expand its application and combine cast iron technology with some hi-techs (for example, computer technology. Nevertheless, cast iron is a multi-element and multi-phase alloy and has complex and variety of structures and still has great development potential in structure and property. For further studying and developing cast iron, theoretical research work is important promise, and the study on solidification process and control mechanism of graphite morphology is fundamental for improving property of cast iron and developing new type of cast iron. Metallography of cast iron normally includes two sections: liquid phase transformation and solid phase transformation. The book, Colour Metallography of Cast Iron, uses colour metallography technique to study solidification structures of cast irons: graphite, carbides, austenite and eutectics; and focuses on solidification processes. With progress of modern solidification theory, the control of material solidification process becomes important measure for improving traditional materials and developing new materials. Solidification structure not only influences mechanical and physical properties of cast iron, but also affects its internal quality. The book uses a large amount of colour photos to describe the formation of solidification structures and their relations. Crystallization phenomena, which cannot be displayed with traditional metallography, are presented and more phase transformation information is obtained from these colour

Colour Metallography of Cast Iron - Chapter 3: Spheroidal Graphite Cast Iron (Ⅰ

Directory of Open Access Journals (Sweden)

Zhou Jiyang

2010-02-01

Full Text Available Cast iron, as a traditional metal material, has advantages of low total cost, good castability and machinability, good wear resistance and low notch sensitivity, and is still facing tough challenge in quality, property and variety of types etc. Experts and engineers studying and producing iron castings all around world extremely concern this serious challenge. Over more than 30 years, a great of research work has been carried out on how to further improve its property, expand its application and combine cast iron technology with some hi-techs (for example, computer technology. Nevertheless, cast iron is a multi-element and multi-phase alloy and has complex and variety of structures and still has great development potential in structure and property. For further studying and developing cast iron, theoretical research work is important promise, and the study on solidification process and control mechanism of graphite morphology is fundamental for improving property of cast iron and developing new type of cast iron. Metallography of cast iron normally includes two sections: liquid phase transformation and solid phase transformation. The book, Colour Metallography of Cast Iron, uses colour metallography technique to study solidification structures of cast irons: graphite, carbides, austenite and eutectics; and focuses on solidification processes. With progress of modern solidification theory, the control of material solidification process becomes important measure for improving traditional materials and developing new materials. Solidification structure not only influences mechanical and physical properties of cast iron, but also affects its internal quality. The book uses a large amount of colour photos to describe the formation of solidification structures and their relations. Crystallization phenomena, which cannot be displayed with traditional metallography, are presented and more phase transformation information is obtained from these colour

Colour Metallography of Cast Iron - Chapter 4: Vermicular Graphite Cast Iron (Ⅱ

Directory of Open Access Journals (Sweden)

Zhou Jiyang

2011-05-01

Full Text Available Cast iron, as a traditional metal material, has advantages of low total cost, good castability and machinability, good wear resistance and low notch sensitivity, and is still facing tough challenge in quality, property and variety of types etc. Experts and engineers studying and producing iron castings all around world extremely concern this serious challenge. Over more than 30 years, a great of research work has been carried out on how to further improve its property, expand its application and combine cast iron technology with some hi-techs (for example, computer technology. Nevertheless, cast iron is a multi-element and multi-phase alloy and has complex and variety of structures and still has great development potential in structure and property. For further studying and developing cast iron, theoretical research work is important promise, and the study on solidification process and control mechanism of graphite morphology is fundamental for improving property of cast iron and developing new type of cast iron. Metallography of cast iron normally includes two sections: liquid phase transformation and solid phase transformation. The book, Colour Metallography of Cast Iron, uses colour metallography technique to study solidification structures of cast irons: graphite, carbides, austenite and eutectics; and focuses on solidification processes. With progress of modern solidification theory, the control of material solidification process becomes important measure for improving traditional materials and developing new materials. Solidification structure not only influences mechanical and physical properties of cast iron, but also affects its internal quality. The book uses a large amount of colour photos to describe the formation of solidification structures and their relations. Crystallization phenomena, which cannot be displayed with traditional metallography, are presented and more phase transformation information is obtained from these colour

Review of the continuous casting of steel by strip casting technology. Twin roll method system

International Nuclear Information System (INIS)

Ibarrondo, I.

2008-01-01

In order to compete in the future steel market and to maintain market share, the steel makers will need to use new efficient technologies capable of supplying steel strip products of high quality at low cost. In this way, the strip casting technology by twin rol method is one of the most important research are in the iron and steel industry today. This review makes a general description of the strip casting technology as well as its different steps, such us; metal delivery and casting, solidification process, hot rolling reduction step, etc. Through mathematical and physical models, the influence on microstructure texture surface quality and mechanical properties of the materials obtained by this method are described as a function of processing parameters, specially the roughness of the rolls. the manufacturing of carbon, stainless and electrical steels involves smaller capital and operating cost, lower gas emissions, and an opportunity to create new grades due to a faster solidification rate that leads to a different solidification structures. In sight of all this it is likely that Strip Casting technology will make a profound impact on the manufacturing landscape of the 21 s t century. (Author) 177 refs

The structure of abrasion-resisting castings made of chromium cast iron

Directory of Open Access Journals (Sweden)

D. Kopyciński

2011-01-01

Full Text Available In this study presents the analyse of chrome iron cast structure (as-cast condition which are used in rugged conditions abrasion-percussive and high temperature. While producing the casts of chrome iron major influence has been preserve the structure of technologi cal process parameters. The addition to Fe-C-Cr alloy Ni, Mo or Cu and then proper heat treatment leads to the improvement of functional and mechanical cast qualities. Then it is possible to develop high mechanical properties which are recommended by PN-EN12513. As can it be seen from the above research silicon is an adverse chemical element in this kind of alloy cast iron. However, the reason of cracksappearing in chrome iron casts are phosphorus eutectic microareas. When the compound of Si and P reach the critical point, described inPN-88/H-83144 outdated standard, the microareas might appear.

The deformation of wax patterns and castings in investment casting technology

Directory of Open Access Journals (Sweden)

A. Herman

2012-01-01

Full Text Available The dimensional accuracy of the final casting of Inconel alloy 738 LC is affected by many aspects. One of them is the choice of method and time of cooling wax model for precision investment casting. The main objective was to study the initial deformation of the complex shape of the casting of the rotor blades. Various approaches have been tested for cooling wax pattern. When wax models are cooling on the air, without clamping in jig for cooling, deviations from the ideal shape of the casting are very noticeable (up to 8 mm and most are in extreme positions of the model. When blade is cooled in fixing jig in water environment, the resulting deviations compared with cooling in air are significantly larger, sometimes up to 10 mm. This itself does not mean that the final shape of the casting is dimensionally more accurate with usage of wax models, which have deviations from the ideal position smaller. Another deformation occurs when shell mould is produced around wax pattern and furthermore deformations emerge while casting of blade is cooling. This paper demonstrates first steps in describing complex process of deformations of Inconel alloy blades produced with investment casting technology by comparing results from thermal imagery, simulations in foundry simulation software ProCAST 2010 and measurements from CNC scanning system Carl Zeiss MC 850. Conclusions are so far not groundbreaking, but it seems deformations of wax pattern and deformations of castings do in some cases cancel each other by having opposite directions. Describing entirely whole process of deformations will help increase precision of blade castings so that models at the beginning and blades in the end are the same.

ToxCast/ToxRefDB

Data.gov (United States)

U.S. Environmental Protection Agency — ToxCast is used as a cost-effective approach for efficiently prioritizing the toxicity testing of thousands of chemicals. It uses data from state-of-the-art high...

Army Combat Medic Resilience: The Process of Forging Loyalty.

Science.gov (United States)

Abraham, Preetha A; Russell, Dale W; Huffman, Sarah; Deuster, Patricia; Gibbons, Susanne W

2018-03-01

This study presents a grounded theory analysis of in-depth interviews of United States Army Combat Medics (CMs) who had served in Iraq and/or Afghanistan. The study explores how 17 CMs nominated by their peers as resilient cope with military stressors in order to identify the factors that enable them to thrive amidst harsh conditions. Four distinct categories of characteristics unique to this group emerged: (1) social bonding, (2) readiness, (3) dual loyalty as performance, and (4) leader by example. Forging loyalty underpins these characteristics and represents the main process used by resilient CMs and comprised three behavior patterns: (1) commitment to the family, (2) commitment to the military mission, and (3) commitment to their guiding religious and spiritual beliefs. Prominent behavioral tendencies of forging loyalty likely developed during childhood and re-enforced by families, friends, and other role models. Based on the findings, new training and education efforts should focus on developing positive emotional, environmental, and social resources to enhance the health and well-being of service members and their families.

Slip cast coating of alumina crucibles

International Nuclear Information System (INIS)

Haroun, N.A.; El-Masry, M.A.A.

1980-01-01

The development of a process for coating alumina crucibles with MgO protective coat in a two-step slip casting operation is described. The best milling conditions for the alumina used were wet ball milling for 24 hr. MgO had to be calcined at 1200 0 C to minimize hydration. Optimum slip casting conditions for alumina and magnesia were found to be L/S I and pH 3-6 or 9-II for the former, and L/S 3 (alcohol) and pH 8.5-10 for the latter. Sintering of Al 2 O 3 and MgO in the temperature range 1150-500 0 C was investigated. Additions of NiO and MgO lowered the sintered densities at lower temperatures but improved the densification at 1500 0 C. Near theoretical density Al 2 O 3 and MgO crucibles were obtained. A two-step slip casting technique was developed to coat Al 2 O 3 with MgO. Certain slow firing schedules could eliminate the otherwise observed coat-crucible separation and cracks. (author)

Effects of boron additions and solutionizing treatments on microstructures and ductility of forged Ti–6Al–4V alloys

International Nuclear Information System (INIS)

Luan, J.H.; Jiao, Z.B.; Chen, G.; Liu, C.T.

2015-01-01

Highlights: • Proper boron additions and heat-treatments improve the ductility of Ti64 alloys. • Coarse TiB precipitates embrittle the Ti64 alloys causing ductility loss. • Modified Ti64 forged alloys with high strength and high ductility are developed. - Abstract: The effects of boron additions on the microstructure and mechanical properties of forged Ti–6Al–4V alloys in different heat-treatment conditions have been characterized by both experimental studies and thermodynamic calculations. The results indicate a combination of proper post-forging treatments and B additions are helpful for control of the prior-β grain size and the volume fraction of α phase, thereby tuning the ductility of the forged Ti–6Al–4V alloys. However, the B-containing alloys exhibit a significant drop in ductility if the solutionizing temperature is too high, and this embrittlement is mainly due to the coarsening of brittle TiB borides. The mechanism in this case is due to the cleavage fracture of TiB rather than its debonding with the matrix, as indicated by the observation of the aligned TiB borides on the matching areas of both halves of the fracture surfaces. Thus, the TiB size and orientation, the prior-β grain size, and the volume fraction of the α phase all play important roles in controlling the mechanical properties of the forged Ti–6Al–4V alloys. The current findings shed light on the composition–microstructure–ductility relationship in the forged Ti–6Al–4V alloys

Effects of boron additions and solutionizing treatments on microstructures and ductility of forged Ti–6Al–4V alloys

Energy Technology Data Exchange (ETDEWEB)

Luan, J.H.; Jiao, Z.B. [Center for Advanced Structural Materials, Department of Mechanical and Biomedical Engineering, College of Science and Engineering, City University of Hong Kong, Hong Kong (China); Chen, G. [Engineering Research Center of Materials Behavior and Design, Ministry of Education, Nanjing University of Science and Technology, Nanjing 210094 (China); Liu, C.T., E-mail: chainliu@cityu.edu.hk [Center for Advanced Structural Materials, Department of Mechanical and Biomedical Engineering, College of Science and Engineering, City University of Hong Kong, Hong Kong (China)

2015-03-05

Highlights: • Proper boron additions and heat-treatments improve the ductility of Ti64 alloys. • Coarse TiB precipitates embrittle the Ti64 alloys causing ductility loss. • Modified Ti64 forged alloys with high strength and high ductility are developed. - Abstract: The effects of boron additions on the microstructure and mechanical properties of forged Ti–6Al–4V alloys in different heat-treatment conditions have been characterized by both experimental studies and thermodynamic calculations. The results indicate a combination of proper post-forging treatments and B additions are helpful for control of the prior-β grain size and the volume fraction of α phase, thereby tuning the ductility of the forged Ti–6Al–4V alloys. However, the B-containing alloys exhibit a significant drop in ductility if the solutionizing temperature is too high, and this embrittlement is mainly due to the coarsening of brittle TiB borides. The mechanism in this case is due to the cleavage fracture of TiB rather than its debonding with the matrix, as indicated by the observation of the aligned TiB borides on the matching areas of both halves of the fracture surfaces. Thus, the TiB size and orientation, the prior-β grain size, and the volume fraction of the α phase all play important roles in controlling the mechanical properties of the forged Ti–6Al–4V alloys. The current findings shed light on the composition–microstructure–ductility relationship in the forged Ti–6Al–4V alloys.

The development of reactor vessel internal heavy forging for 1000 MW pressurized-water reactor nuclear power plant

International Nuclear Information System (INIS)

Zhang Zhifeng; Chen Yongbo; Ding Xiuping; Zhang Lingfang

2012-01-01

This Paper introduced the development of Reactor Vessel Internal (RVI) heavy forgings for 1000 MW Pressurized Water Reactor (PWR) nuclear power plant, analyzed the manufacture difficulties and technical countermeasures. The testing result of the product indicated that the performance of RVI heavy forgings manufactured by Shanghai Heavy Machinery Plant Ld. (SHMP) is outstanding and entirely satisfy the technical requirements for RVI product. (authors)

Direct Cast U-6Nb – 2017 Progress on Cylindrical Castings

Energy Technology Data Exchange (ETDEWEB)

Aikin, Jr., Robert M. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

2017-10-04

This report describes work to further develop a sound technical basis and best practices for mold design and process parameters for the Direct Casting of U-6wt%Nb components. One major challenge to the production of U-6Nb components is the propensity for niobium segregation during casting and solidification. This is especially true for cylindrical castings where the vertical side walls allow flotation of Nb resulting in severe inverse macrosegregation. In this work, a small (120 mm diameter by 180 mm tall) and large cylinder (250 mm diameter by 310 mm tall) are examined with a focus on reducing, or eliminating, niobium segregation. It is demonstrated that counter gravity casting (top-to-bottom solidification) can be used to minimize segregation in the small cylinder. Attempts to counter gravity cast the large cylinder were unsuccessful, in large part due to size limitations of the current furnace. A path forward for casting of the large cylinders is discussed.

Dalit women in India: at the crossroads of gender, class, and caste

OpenAIRE

Sabharwal, Nidhi Sadana; Sonalkar, Wandana

2015-01-01

As the lowest in the caste hierarchy, Dalits in Indian society have historically suffered caste-based social exclusion from economic, civil, cultural, and political rights. Women from this community suffer from not only discrimination based on their gender but also caste identity and consequent economic deprivation. Dalit women constituted about 16.60 percent of India’s female population in 2011. Dalit women’s problems encompass not only gender and economic deprivation but also discrimination...

Anodization of cast aluminium alloys produced by different casting methods

Directory of Open Access Journals (Sweden)

K. Labisz

2008-08-01

Full Text Available In this paper the usability of two casting methods, of sand and high pressure cast for the anodization of AlSi12 and AlSi9Cu3 aluminium cast alloys was investigated. With defined anodization parameters like electrolyte composition and temperature, current type and value a anodic alumina surface layer was produced. The quality, size and properties of the anodic layer was investigated after the anodization of the chosen aluminium cast alloys. The Alumina layer was observed used light microscope, also the mechanical properties were measured as well the abrasive wear test was made with using ABR-8251 equipment. The researches included analyze of the influence of chemical composition, geometry and roughness of anodic layer obtained on aluminum casts. Conducted investigations shows the areas of later researches, especially in the direction of the possible, next optimization anodization process of aluminum casting alloys, for example in the range of raising resistance on corrosion to achieve a suitable anodic surface layer on elements for increasing applications in the aggressive environment for example as materials on working building constructions, elements in electronics and construction parts in air and automotive industry.

Correlation function measurement of uranium casting driven by tagged DT neutrons

International Nuclear Information System (INIS)

Li Jiansheng; Ye Cenming; Xie Wenxiong; Huang Po; Zeng Liheng; Jin Yu; Xie Qilin; Zhang Yi

2013-01-01

Background: In the nuclear disarmament process, the measurement and verification of uranium casting in sealed container are important to process control and treaty implementation. It is a difficult and hot problem to verify uranium casting in a sealed metal container, due to the weak intensity of neutron and gamma rays of uranium. Purpose: We want to measure the correlation functions of different casting in uranium casting verifications. Methods: Two BC501 scintillation detectors are placed outside the tagged neutron cone and in opposite position. The α detector forms the first channel pulse signal, while the two BC501 scintillation detectors form the second and third channel pulse signals. Those three pulsed time series are recorded by high speed acquisition system. The correlation functions between these signals are calculated by the time series. Results: Putting the two BC501 detectors into the tagged neutron cone, the time of flight for the 14 MeV neutron is measured. The FWHM in TOF spectrum is 2.0 ns. Putting the two BC501 detectors outside the tagged neutron cone, the correlation functions measured by high speed acquisition system and MCA are consistent. The spontaneous neutron decay constants of the castings are measured by γ rays. The decay constant of 6.5 kg Pb component is 184 μs -1 . The decay constants of 4 kg and 15 kg HEU casting are 210 μs -1 and 128 μs -1 , respectively. The correlation functions C 12 (τ), C 13 (τ) and C 23 (τ) are acquired. In C 12 (C), the γ ray peak coming from the inelastic reaction of 14-MeV neutrons with the casting is 5.0 ns before the neutron peak of fission chain. This time difference can estimate the casting position in container. The integrations of the C 12 (τ), C 13 (τ) and C 23 (τ) increase with the casting mass. The C 23 (τ) values of Pb component and DU casting are far less than the values of HEU casting. The C 23 (τ) integration of Pb component is 3.0% comparing with 15-kg HEU casting, while the

ExpoCast: Exposure Science for Prioritization and Toxicity Testing (S)

Science.gov (United States)

The US EPA is completing the Phase I pilot for a chemical prioritization research program, called ToxCast. Here EPA is developing methods for using computational chemistry, high-throughput screening, and toxicogenomic technologies to predict potential toxicity and prioritize limi...

Research and development of basic technologies for next generation industries, 'high-performance crystalline controlled alloy'. Evaluation on final research and development (final report); Jisedai sangyo kiban gijutsu kenkyu kaihatsu. Koseino kessho seigyo gokin (saishu kenkyu kaihatsu hyoka 2)

Energy Technology Data Exchange (ETDEWEB)

NONE

1989-05-01

A proposal was given on a new processing process to use Ni-group super alloy, and elucidation was given on super plasticity phenomenon by using non-destructive tests. The Ni-group super heat-resistant alloy Mod. IN-100 subjected to different preforms by means of extrusion was given a super plasticity test at 1,050 degrees C to derive total elongation and 'm' value. As a result, it was disclosed that a material annealed for one hour at 1,070 degrees C after extrusion of 70% at 1,100 degrees C possesses the maximum 'm' value in the vicinity of 2.0 times 10{sup -2}s{sup -1}. The largest key to the new processing method is to improve the nature of the material, in which the plasticity manifestation velocity is accelerated by ten times to the order of 10{sup -2}s{sup -1} as described above. In addition, forging of IN-100 was made possible by using the ordinary forging equipment with the use of two-fold measures. The measures consist of maintaining temperature of IN-100 during casting by heating the die material to about 600 degrees C, rather than keeping it at a constant temperature, and then packing IN-100 in S35C steel material to accommodate the temperature decrease during casting inside the S35C pack. Thus, a processing method was made practical, eliminating need of the forging process to compress and solidify powder itself, that is the extrusion process. (NEDO)

Research and development of basic technologies for next generation industries, 'high-performance crystalline controlled alloy'. Evaluation on final research and development (final report); Jisedai sangyo kiban gijutsu kenkyu kaihatsu. Koseino kessho seigyo gokin (saishu kenkyu kaihatsu hyoka 2)

Energy Technology Data Exchange (ETDEWEB)

NONE

1989-05-01

A proposal was given on a new processing process to use Ni-group super alloy, and elucidation was given on super plasticity phenomenon by using non-destructive tests. The Ni-group super heat-resistant alloy Mod. IN-100 subjected to different preforms by means of extrusion was given a super plasticity test at 1,050 degrees C to derive total elongation and 'm' value. As a result, it was disclosed that a material annealed for one hour at 1,070 degrees C after extrusion of 70% at 1,100 degrees C possesses the maximum 'm' value in the vicinity of 2.0 times 10{sup -2}s{sup -1}. The largest key to the new processing method is to improve the nature of the material, in which the plasticity manifestation velocity is accelerated by ten times to the order of 10{sup -2}s{sup -1} as described above. In addition, forging of IN-100 was made possible by using the ordinary forging equipment with the use of two-fold measures. The measures consist of maintaining temperature of IN-100 during casting by heating the die material to about 600 degrees C, rather than keeping it at a constant temperature, and then packing IN-100 in S35C steel material to accommodate the temperature decrease during casting inside the S35C pack. Thus, a processing method was made practical, eliminating need of the forging process to compress and solidify powder itself, that is the extrusion process. (NEDO)

Influence of the coating process on the tribological conditions during cold forging with a MoS2 based lubricant

Science.gov (United States)

Lorenz, Robby; Hagenah, Hinnerk; Merklein, Marion

2018-05-01

Cold forging processes such as forward rod extrusion can be used to produce high quality components like connection rods, shafts and gears. The main advantages of these extruded components are sufficient surface quality, work hardening, compressive residual stresses and fatigue strength. Since one technical disadvantage of extruded components lies in the achievable tolerance classes, the improvement of these should be of crucial importance. For instance, the attainable workpiece accuracy and component quality can be influenced by adapting the tribological system in such a way that the resulting friction is specifically controlled in order to improve component forming. Lubricant modification is one practical way of adapting the tribological system to the requirements of the forming process. An industrial established and highly efficient lubricant system is the application of a zinc-phosphate conversion layer with a molybdenum disulfide-based lubricant. While offering many advantages, its tribological conditions seem to depend strongly on the layer weight and the application strategy. These parameters and the respective interdependencies have not been sufficiently investigated yet. In order to examine this, the tribological conditions depending on the layer weight are analyzed in greater detail using the Ring-Compression-Test (RCT). This tribometer provides a comparative representation of the forming conditions during cold forging. Furthermore, a potential dependency between the tribological conditions and two different coating techniques is analyzed. The latter are represented by the industrial standards dipping and dip-drumming.

Multipass forging of Inconel 718 in the delta-Supersolvus domain: assessing and modeling microstructure evolution

Directory of Open Access Journals (Sweden)

Zouari Meriem

2014-01-01

Full Text Available This work is focused on the evolution of the microstructure of Inconel 718 during multi-pass forging processes. During the forming process, the material is subjected to several physical phenomena such as work-hardening, recovery, recrystallization and grain growth. In this work, transformation kinetics are modeled in the δ-Supersolvus domain (T>Tsolvus where the alloy is single-phase, all the alloying elements being dissolved into the FCC matrix. Torsion tests were used to simulate the forging process and recrystallization kinetics was modeled using a discontinuous dynamic recrystallization (DDRX two-site mean field model. The microstructure evolution under hot forging conditions is predicted in both dynamic and post-dynamic regimes based on the initial distribution of grain size and the evolution of dislocation density distribution during each step of the process. The model predicts recrystallization kinetics, recrystallized grain size distribution and stress–strain curve for different thermo-mechanical conditions and makes the connection between dynamic and post-dynamic regimes.

Effect of Friction on Barreling during cold Upset Forging of Aluminium 6082 Alloy Solid cylinders

Science.gov (United States)

Priyadarshini, Amrita; Kiran, C. P.; Suresh, K.

2018-03-01

Friction is one of the significant factors in forging operations since it affects metal flow in the die, forming load, strain distribution, tool and die life, surface quality of the product etc. In upset forging, the frictional forces at the die-workpiece interface oppose the outward flow of the material due to which the specimen develops a barrel shape. As a result, the deformation becomes non-uniform or inhomogeneous which is undesirable. Barreling can be reduced by applying effective lubricant on the surface of the platens. The objective of the present work is to study experimentally the effect of various frictional conditions (dry, grease, mineral oil) on barreling during upset forging of aluminum 6082 solid cylinders of different aspect ratio (length/diameter: 0.5, 0.75, 1). The friction coefficients are determined using the ring compression test. Curvature of barrel is determined based on the assumption that the curvature of the barrel follows the geometry of circular arc.

Dimensional control of die castings

Science.gov (United States)

Karve, Aniruddha Ajit

The demand for net shape die castings, which require little or no machining, is steadily increasing. Stringent customer requirements are forcing die casters to deliver high quality castings in increasingly short lead times. Dimensional conformance to customer specifications is an inherent part of die casting quality. The dimensional attributes of a die casting are essentially dependent upon many factors--the quality of the die and the degree of control over the process variables being the two major sources of dimensional error in die castings. This study focused on investigating the nature and the causes of dimensional error in die castings. The two major components of dimensional error i.e., dimensional variability and die allowance were studied. The major effort of this study was to qualitatively and quantitatively study the effects of casting geometry and process variables on die casting dimensional variability and die allowance. This was accomplished by detailed dimensional data collection at production die casting sites. Robust feature characterization schemes were developed to describe complex casting geometry in quantitative terms. Empirical modeling was utilized to quantify the effects of the casting variables on dimensional variability and die allowance for die casting features. A number of casting geometry and process variables were found to affect dimensional variability in die castings. The dimensional variability was evaluated by comparisons with current published dimensional tolerance standards. The casting geometry was found to play a significant role in influencing the die allowance of the features measured. The predictive models developed for dimensional variability and die allowance were evaluated to test their effectiveness. Finally, the relative impact of all the components of dimensional error in die castings was put into perspective, and general guidelines for effective dimensional control in the die casting plant were laid out. The results of

A multi-scale approach for high cycle anisotropic fatigue resistance: Application to forged components

International Nuclear Information System (INIS)

Milesi, M.; Chastel, Y.; Hachem, E.; Bernacki, M.; Loge, R.E.; Bouchard, P.O.

2010-01-01

Forged components exhibit good mechanical strength, particularly in terms of high cycle fatigue properties. This is due to the specific microstructure resulting from large plastic deformation as in a forging process. The goal of this study is to account for critical phenomena such as the anisotropy of the fatigue resistance in order to perform high cycle fatigue simulations on industrial forged components. Standard high cycle fatigue criteria usually give good results for isotropic behaviors but are not suitable for components with anisotropic features. The aim is to represent explicitly this anisotropy at a lower scale compared to the process scale and determined local coefficients needed to simulate a real case. We developed a multi-scale approach by considering the statistical morphology and mechanical characteristics of the microstructure to represent explicitly each element. From stochastic experimental data, realistic microstructures were reconstructed in order to perform high cycle fatigue simulations on it with different orientations. The meshing was improved by a local refinement of each interface and simulations were performed on each representative elementary volume. The local mechanical anisotropy is taken into account through the distribution of particles. Fatigue parameters identified at the microscale can then be used at the macroscale on the forged component. The linkage of these data and the process scale is the fiber vector and the deformation state, used to calculate global mechanical anisotropy. Numerical results reveal an expected behavior compared to experimental tendencies. We proved numerically the dependence of the anisotropy direction and the deformation state on the endurance limit evolution.

Environmentally Benign Lubricant Systems For Cold, Warm And Hot Forging

DEFF Research Database (Denmark)

Bay, Niels

2010-01-01

paper gives an overview of these efforts substituting environmentally hazardous lubricants in cold, warm and hot forging. The paper is an extract of the keynote paper [3] written by the author together with eight co-authors referring to collected papers and other information from more than 30 different...

Influence of Cooling Conditions on a Slab’s Chill Zone Formation During Continuous Casting of Steel

Directory of Open Access Journals (Sweden)

Drożdż P.

2017-06-01

Full Text Available The cooling conditions of a slab during continuous casting of steel have an impact on the crystalline structure formation. Numerical methods allow real processes to be modelled. Professional computer programs are available on the market, so the results of their simulations allow us to understand the processes that occur during the casting and solidification of the slab. The study attempts to evaluate the impact of the intensity of the secondary cooling on the chilled zone size. The calculations show the differences in the structure of a slab cast with various speeds while maintaining industrial cooling parameters during operation of a continuous casting machine.

ASSESSMENT OF RANGES OF POSSIBLE CHANGE OF TEMPORARY RESISTANCE OF CAST IRON WITH LAMELLAR AND FLAKED GRAPHITE ON THEIR HARDNESS

Directory of Open Access Journals (Sweden)

S. G. Sandomirskii

2017-01-01

Full Text Available The analysis of ranges of possible change of temporary resistance of sB of castings from ductile and gray cast iron is carried out. The analytical description of ranges of change of sВ depending on casting BH hardness is developed. It is shown that the range of change of sВ of pig-iron castings, wider in comparison with steel, with the measured hardness of BH is caused variations of forms and the amount of graphite inclusions at the considered classes of cast iron and influence of thickness of a wall of casting from gray cast iron on dependence of sВ (HB. The result is intended for determination of the guaranteed casting size sВ without her destruction, when there is no information on sВ of check test pieces.

arXiv Top-quark pair production cross sections at NNLO+NNLL in pPb collisions at $\\sqrt{s_{NN}}$ = 8.16 TeV

CERN Document Server

d'Enterria, David

Total and fiducial top pair ($t\\bar{t}$) production cross sections in proton-lead (pPb) collisions at $\\sqrt{s_{NN}}$ = 8.16 TeV are computed at next-to-next-to-leading-order (NNLO) accuracy including next-to-next-to-leading-log (NNLL) gluon resummation, using the CT14 and CT10 proton parton distribution functions (PDF), and the EPPS16 and EPS09 nuclear PDF parametrizations for the lead ion. The total cross sections amount to $\\sigma(pPb\\to t\\bar{t}+X) = 59.0 \\pm 5.3$(CT14+EPPS16)$\\,^{+1.6}_{-2.1}$(scale) nb, and $57.5 \\pm \\,^{+4.3}_{-3.3}$(CT10+EPS09)$\\,^{+1.5}_{-2.0}$(scale) nb, with small modifications with respect to the result computed using the free proton PDF alone. The normalized ratio of pPb to pp cross sections (nuclear modification factor) is $R_{pPb} = 1.04 \\,^{\\pm 0.07(EPPS16)}_{\\pm0.03(EPS09)}$. In the lepton+jets decay mode, $t\\bar{t} \\to b\\bar{b} W(\\ell\

Forging New, Non-traditional Partnerships Among Physicists, Teachers and Students

Energy Technology Data Exchange (ETDEWEB)

Bardeen, Marjorie [Fermilab; Adams, Mark [Illinois U., Chicago; Wayne, Mitchell [Notre Dame U.; Karmgard, Dan [Notre Dame U.; Goussiou, Anna [Washington U., Seattle

2017-05-02

The QuarkNet collaboration has forged new, nontraditional relationships among particle physicists, high school teachers and their students. QuarkNet provides professional development for teachers and creates opportunities for teachers and students to engage in particle physics data investigations and join research teams. Embedded in the U.S. particle research community, QuarkNet leverages the nature of particle physics research—the long duration of the experiments with extensive lead times, construction periods, and data collection and analysis periods. QuarkNet is patterned after the large collaborations with a central management infrastructure and a distributed workload across university- and lab-based research groups. We describe the important benefits of the QuarkNet outreach program that flow to university faculty and present successful strategies that others can adapt for use in their countries.

CASTING IMPROVEMENT BASED ON METAHEURISTIC OPTIMIZATION AND NUMERICAL SIMULATION

Directory of Open Access Journals (Sweden)

Radomir Radiša

2017-12-01

Full Text Available This paper presents the use of metaheuristic optimization techniques to support the improvement of casting process. Genetic algorithm (GA, Ant Colony Optimization (ACO, Simulated annealing (SA and Particle Swarm Optimization (PSO have been considered as optimization tools to define the geometry of the casting part’s feeder. The proposed methodology has been demonstrated in the design of the feeder for casting Pelton turbine bucket. The results of the optimization are dimensional characteristics of the feeder, and the best result from all the implemented optimization processes has been adopted. Numerical simulation has been used to verify the validity of the presented design methodology and the feeding system optimization in the casting system of the Pelton turbine bucket.

CAST Status Report to the SPSC for the 123rd Meeting

CERN Document Server

Desch, K

2016-01-01

After the successful 2015 data taking with Micromegas detectors, targeting solar axion search, and with an InGrid detector, targeting solar chameleon search, CAST has started on its new 2016-2018 program which has been presented to SPSC at the 119th meeting in October 2015. This program extends the physics goals of CAST towards the search for solar chameleons using a force sensor (KWISP) and towards the search for relic axions using a microwave cavity inserted into the CAST magnet (CAST-CAPP). The search for solar chameleons and other axion-like particles was continued with a significantly upgraded InGrid detector. The new experiments make use different elements of the unique CAST infrastructure (KWISP: Abrixas XRT and sun pointing capability of CAST, CAST-CAPP: high magnetic dipole field), while the InGrid detector exploits all of CAST´s features (Abrixas XRT, high magnetic dipole field, sun pointing). All three experiments within CAST have made significant progress in exploring these new approaches in 2016...

Development of a forging technology for the production of high-pressure compressor blades from γ-titanium aluminide. Project C: production of primary wrought material for the forging of turbine blades from gamma-TiAl and their microstructural optimization. Final report

International Nuclear Information System (INIS)

Appel, F.; Oehring, M.; Lorenz, U.; Wagner, R.

1999-01-01

By the development of a new canning technique which resulted in an effective thermal isolation of can and billet the flow stress mismatch of can and billet material could be minimized, which allowed crack-free and uniform extrusion. Using this technique which has been applied for patent hot extrusion is an effective and matured working method for ingot material. It allows to produce fine-grained and almost fully recrystallized material with increased workability as has been found by the determination of the forging window as well as by the successful forging of more than 200 compressor blades by the project partner Thyssen Umformtechnik. By forging under suited conditions also a microstructural homogenization is achieved in comparison to extruded material. (orig.)

A friction model for cold forging of aluminum, steel and stainless steel provided with conversion coating and solid film lubricant

DEFF Research Database (Denmark)

Bay, Niels; Eriksen, Morten; Tan, Xincai

2011-01-01

Adopting a simulative tribology test system for cold forging the friction stress for aluminum, steel and stainless steel provided with typical lubricants for cold forging has been determined for varying normal pressure, surface expansion, sliding length and tool/work piece interface temperature...

Developments of New Lubricants for Cold Forging of Stainless Steel

DEFF Research Database (Denmark)

Steenberg, Thomas; Christensen, Erik; Olesen, P.

1997-01-01

Two new lubricant systems for cold forging of stainless steel have been developed. The main component of these systems are FeCl3 and ZnCa2(PO4)2, respectively. Both lubricant systems have been tested using a backward extrusion test. The results show excellent lubricating properties with respect...

THE INFLUENCE OF CHEMICAL COMPOSITION OF HIGH-CHROMIUM CAST IRONS ON THE MACHINABILITY

Directory of Open Access Journals (Sweden)

V. V. Netrebko

2016-02-01

Full Text Available Purpose. This research is aimed to obtain the regression dependence of the machinability on the chemical composition of pig iron (C, Cr, Mn and Ni in cast state. Methodology. The method of active experiment planning was used to build a mathematical model. Cast irons of composition 1.09…3.91 % С; 11.43…25.57 % Cr; 0.6…5.4 % Mn; 0.19…3.01 % Ni were studied. Cutting tools with plates 10х10 mm out of ВК8 according to State Standard 19051-80 were used for turning. Cutting modes: cutting depth – 0.8 mm, longitudinal feed – 0.15 mm/rot., spindle’s rotation frequency during turning – 200…360 rot./min. Lubricating and cooling liquids were not applied. Evaluation of iron workability was produced by determining the linear tool flank wear per unit length of the cutting path. Findings. Mathematically probabilistic equation of the regression dependence of the cutting tool’s wear on the C, Cr, Mn and Ni content in the machined cast iron were obtained. It was established that with the increase of Cr content in the cast iron to 14.8 % the cutting tool’s wear decreased as a result of formation of carbide eutectic which destroyed the doped ledeburite continuous frame. Further increase of chromium content promoted appearing of chromic carbides with high microhardness which considerably increased the tool’s wear. The conducted research shown that the minimum cutting tool’s wear 0,18 mkm/m was observed during the machining of cast iron containing: 1.09 % C, 14.8 % Cr, 2.3 % Mn and 1.2 % Ni; and the maximum wear is 48,96 mkm/m – when the content was: 3.91 % C, 11.43 % Cr, 5.4 % Mn and 0.19 % Ni. The tool’s wear reached 47.61 mkm/m during the treatment of cast iron containing 3.91 % C, 25.57 % Cr, 5.4 % Mn and 0.19 % Ni. Originality. Mathematically probabilistic model of the dependence of the cutting tool’s wear on the C, Cr, Mn and Ni content in the machined cast iron has been elaborated by the author. Practical value. The model

Production of spheroidal graphite cast iron (S. G. Iron) for an automobile brake drum

International Nuclear Information System (INIS)

Butt, M.T.Z.; Aziz, S.

2005-01-01

The role of automobile industry for any country has a great importance. Break drum is one of the essential parts of automobile car and its local casting is required in order to achieve the target for automobile industry because it has special significance. Break drum being the important constituent of the system of an automobile requires a great degree of accuracy and reliability. S. G. Iron is preferred because of its mechanical properties i.e., higher strength modulus, impact resistance and ductility along with excellent machinability and manufacturing ease. (author)

Compound cast product and method for producing a compound cast product

Science.gov (United States)

Meyer, Thomas N.; Viswanathan, Srinath

2002-09-17

A compound cast product is formed in a casting mold (14) having a mold cavity (16) sized and shaped to form the cast product. A plurality of injectors (24) is supported from a bottom side (26) of the casting mold (14). The injectors (24) are in fluid communication with the mold cavity (16) through the bottom side (26) of the casting mold (14). A molten material holder furnace (12) is located beneath the casting mold (14). The holder furnace (12) defines molten material receiving chambers (36) configured to separately contain supplies of two different molten materials (37, 38). The holder furnace (12) is positioned such that the injectors (24) extend downward into the receiving chamber (36). The receiving chamber (36) is separated into at least two different flow circuits (51, 52). A first molten material (37) is received in a first flow circuit (51), and a second molten material (38) is received into a second flow circuit (52). The first and second molten materials (37, 38) are injected into the mold cavity (16) by the injectors (24) acting against the force of gravity. The injectors (24) are positioned such that the first and second molten materials (37, 38) are injected into different areas of the mold cavity (16). The molten materials (37, 38) are allowed to solidify and the resulting compound cast product is removed from the mold cavity (16).

Multi-layers castings

Directory of Open Access Journals (Sweden)

J. Szajnar

2010-01-01

Full Text Available In paper is presented the possibility of making of multi-layers cast steel castings in result of connection of casting and welding coating technologies. First layer was composite surface layer on the basis of Fe-Cr-C alloy, which was put directly in founding process of cast carbon steel 200–450 with use of preparation of mould cavity method. Second layer were padding welds, which were put with use of TIG – Tungsten Inert Gas surfacing by welding technology with filler on Ni matrix, Ni and Co matrix with wolfram carbides WC and on the basis on Fe-Cr-C alloy, which has the same chemical composition with alloy, which was used for making of composite surface layer. Usability for industrial applications of surface layers of castings were estimated by criterion of hardness and abrasive wear resistance of type metal-mineral.

Computer Simulation of Microsegregation of Sulphur and Manganese and Formation of MnS Inclusions while Casting Rail Steel

Directory of Open Access Journals (Sweden)

Kalisz D.

2016-12-01

Full Text Available The quality of rail steel is conditioned by its high mechanic qualities, which greatly depend on the presence of undesired nonmetallic inclusions. The paper is devoted to the segregation of components, mainly sulphur, and the formation of manganese sulphide in the process of steel solidification, at the casting rate of 100 and 500 K/min. Sulphur is a steel component which disadvantageously influences its numerous parameters. The oxide-sulphide and sulphide precipitations cause cracks and lower the strength of the material. This phenomenon was modeled with the use of author’s computer program based on Matsumiya interdendritic microsegregation model. The main assumptions of this model and thermodynamic conditions of inclusion formation during casting of steel are discussed in this paper. Two cases were analyzed: in the first one the MnS was assumed to form a pure and constant compound, whereas in the other one the manganese sulfide was precipitated as a component of a liquid oxide solution, and its activity was lower than unity. The final conclusion is that chemical composition of steel is the major parameter deciding about the formation of MnS inclusions.

Qualification of laser based additive production for manufacturing of forging Tools

Directory of Open Access Journals (Sweden)

Junker Daniel

2015-01-01

Full Text Available Mass customization leads to very short product life cycles, so the costs of a tool have to be amortized with a low number of workpieces. Especially for highly loaded tools, like those for forging, that leads to expensive products. Therefore more economical production processes for tool manufacturing have to be investigated. As laser additive manufacturing is already used for the production of moulds for injection moulding, this technology maybe could also improve the forging tool production. Within this paper laser metal deposition, which is industrially used for tool repair, will be investigated for the use in tool manufacturing. Therefore a mechanical characterization of parts built with different laser process parameters out of the hot work tool steel 1.2709 is made by upsetting tests and hardness measurements. So the influence of the additive manufacturing process on the hardness distribution is analysed.

The coarsening effect of SA508-3 steel used as heavy forgings material

Directory of Open Access Journals (Sweden)

Dingqian Dong

2015-01-01

Full Text Available SA508Gr.3 steel is popularly used to produce core unit of nuclear power reactors due to its outstanding ability of anti-neutron irradiation and good fracture toughness. The forging process takes important role in manufacturing to refine the grain size and improve the material properties. But due to their huge size, heavy forgings cannot be cooled down quickly, and the refined grains usually have long time to grow in high temperature conditions. If the forging process is not adequately scheduled or implemented, very large grains up to millimetres in size may be found in this steel and cannot be eliminated in the subsequent heat treatment. To fix the condition which may causes the coarsening of the steel, hot upsetting experiments in the industrial production environment were performed under different working conditions and the corresponding grain sizes were measured and analysed. The observation showed that the grain will abnormally grow if the deformation is less than a critical value. The strain energy takes a critical role in the grain evolution. If dynamic recrystallization consumes the strain energy as much as possible, the normal grains will be obtained. While if not, the stored strain energy will promote abnormal growth of the grains.

Spall behavior of cast iron with varying microstructures

Energy Technology Data Exchange (ETDEWEB)

Plume, Gifford; Rousseau, Carl-Ernst, E-mail: rousseau@uri.edu [Mechanical Engineering, University of Rhode Island, 92 Upper College Rd., Kingston, Rhode Island 02881 (United States)

2014-07-21

The spall strength of cast iron with varying microstructures has been investigated using plate impact at moderate speed. Stress history measurements were made with manganin stress gauges embedded between the back face of the specimen and a low impedance polycarbonate backing. Five separate cast irons were tested. Four of these consisted of gray cast iron with graphite in flake form, with three classified as Type VII A2 and the fourth containing a bimodal distribution of Types VII A4 and VII D8. The fifth casting consisted of ductile cast iron with graphite in nodular form, classified as Type I, size class 5. The spall strength for the Type VII A2 gray cast irons varied between 40 and 370 MPa, and that of the additional gray cast iron, between 410 and 490 MPa. The spall strength of the ductile cast iron fell within the range of 0.94–1.2 GPa. It is shown that the spall strength is linked to the damage level at the spall plane, where an increased level of tensile stress is required to generate higher levels of damage. Post mortem analysis was performed on the recovered samples, revealing the graphite phase to be the primary factor governing the spall fracture of cast irons, where crack nucleation is directly correlated to the debonding of graphite from the metal matrix. The average length of graphite found within a casting is linked to the material's strength, where strength increases as a function of decreasing length. The morphology and mean free path of graphite precipitates further govern the subsequent coalescence of initiated cracks to form a complete fracture plane. In cases where graphite spacing is large, increased energy level is required to complete the fracture process. A secondary factor governing the spall fracture of cast irons has also been linked to the microstructure of the metal matrix, with pearlite yielding higher spall strengths than free ferrite.

Streptococcus mutans attachment on a cast titanium surface

Directory of Open Access Journals (Sweden)

Sicknan Soares da Rocha

2009-03-01

Full Text Available This study examined by means of scanning electron microscopy (SEM, the attachment of Streptococcus mutans and the corrosion of cast commercially pure titanium, used in dental dentures. The sample discs were cast in commercially pure titanium using the vacuum-pressure machine (Rematitan System. The surfaces of each metal were ground and polished with sandpaper (#300-4000 and alumina paste (0.3 µm. The roughness of the surface (Ra was measured using the Surfcorder rugosimeter SE 1700. Four coupons were inserted separately into Falcon tubes contained Mueller Hinton broth inoculated with S. mutans ATCC 25175 (10(9 cuf and incubated at 37 °C. The culture medium was changed every three days during a 365-day period, after which the falcons were prepared for observations by SEM. The mean Ra value of CP Ti was 0.1527 µm. After S. mutans biofilm removal, pits of corrosion were observed. Despite the low roughness, S. mutans attachment and biofilm formation was observed, which induced a surface corrosion of the cast pure titanium.

Repetitive forging (RF) using inclined punches as a new bulk severe plastic deformation method

Energy Technology Data Exchange (ETDEWEB)

Babaei, A. [Department of Mechanical Engineering, University College of Engineering, University of Tehran, Tehran 11155-4563 (Iran, Islamic Republic of); Faraji, G., E-mail: ghfaraji@ut.ac.ir [Department of Mechanical Engineering, University College of Engineering, University of Tehran, Tehran 11155-4563 (Iran, Islamic Republic of); Department of Engineering Design and Manufacture, University of Malaya, 50603 Kuala Lumpur (Malaysia); Mashhadi, M.M. [Department of Mechanical Engineering, University College of Engineering, University of Tehran, Tehran 11155-4563 (Iran, Islamic Republic of); Hamdi, M. [Department of Engineering Design and Manufacture, University of Malaya, 50603 Kuala Lumpur (Malaysia)

2012-12-15

A new bulk severe plastic deformation method based on repetitive forging (RF) using inclined punches is proposed. This process consists of two half cycles. In the first half cycle, a square cross section deforms to parallelogram by forging with two inclined punches, and the parallelogram cross section is forged back to square using two flat punches in the second half cycle. This method was applied to commercially pure copper and significant grain refinement was achieved after four passes of RF. The results showed that significant improvement in the mechanical properties was obtained. Notable increase of yield and ultimate strengths corresponding to 358 MPa and 381 MPa after four passes of RF from the initial values of 121 MPa and 230.5 MPa is detectable. Microhardness increases to about 100 Hv after four passes of RF from the initial value of 53 Hv. Finite element (FE) results illustrate that RF is able to impose extremely high plastic strains to the materials. In the RF process, the processed samples have the same dimensions and geometry as those of the initial sample without any waste material and there is no need for back pressure.

Wear Improvement of Tools in the Cold Forging Process for Long Hex Flange Nuts.

Science.gov (United States)

Hsia, Shao-Yi; Shih, Po-Yueh

2015-09-25

Cold forging has played a critical role in fasteners and has been widely used in automotive production, manufacturing, aviation and 3C (Computer, Communication, and Consumer electronics). Despite its extensive use in fastener forming and die design, operator experience and trial and error make it subjective and unreliable owing to the difficulty of controlling the development schedule. This study used finite element analysis to establish and simulate wear in automotive repair fastener manufacturing dies based on actual process conditions. The places on a die that wore most quickly were forecast, with the stress levels obtained being substituted into the Archard equation to calculate die wear. A 19.87% improvement in wear optimization occurred by applying the Taguchi quality method to the new design. Additionally, a comparison of actual manufacturing data to simulations revealed a nut forging size error within 2%, thereby demonstrating the accuracy of this theoretical analysis. Finally, SEM micrographs of the worn surfaces on the upper punch indicate that the primary wear mechanism on the cold forging die for long hex flange nuts was adhesive wear. The results can simplify the development schedule, reduce the number of trials and further enhance production quality and die life.

Influence of sulphur and phosphorus impurities on ductility of 25Kh2NMFA steel during forging

International Nuclear Information System (INIS)

Onishchenko, A.K.

1989-01-01

Using cylindrical samples of the 25Kh2NMFA steel with sulfur and phosphorus content in the range of 0.001-0.030%, tensile test with the rate of deformation 10 -3 s -1 at the temperatures of 800-1200 deg C has been conducted. Analysis of fracture foci and plasticity diagrams has shown, that to ensure ductility during forging and high mechanical properties, the content of sulfur and phosphorus impurities in the 25Kh2NMFA steel must not exceed 0.015%

76 FR 8773 - Forged Stainless Steel Flanges From India and Taiwan

Science.gov (United States)

2011-02-15

... INTERNATIONAL TRADE COMMISSION [Investigation Nos. 731-TA-639 and 640 (Third Review)] Forged Stainless Steel Flanges From India and Taiwan AGENCY: United States International Trade Commission. ACTION... Taiwan would be likely to lead to continuation or recurrence of material injury. On January 31, 2011, the...

A Probabilistic Analysis of the Nxt Forging Algorithm

Directory of Open Access Journals (Sweden)

Serguei Popov

2016-12-01

Full Text Available We discuss the forging algorithm of Nxt from a probabilistic point of view, and obtain explicit formulas and estimates for several important quantities, such as the probability that an account generates a block, the length of the longest sequence of consecutive blocks generated by one account, and the probability that one concurrent blockchain wins over an- other one. Also, we discuss some attack vectors related to splitting an account into many smaller ones.

The Simulation and Analysis of the Closed Die Hot Forging Process by A Computer Simulation Method

Directory of Open Access Journals (Sweden)

Dipakkumar Gohil

2012-06-01

Full Text Available The objective of this research work is to study the variation of various parameters such as stress, strain, temperature, force, etc. during the closed die hot forging process. A computer simulation modeling approach has been adopted to transform the theoretical aspects in to a computer algorithm which would be used to simulate and analyze the closed die hot forging process. For the purpose of process study, the entire deformation process has been divided in to finite number of steps appropriately and then the output values have been computed at each deformation step. The results of simulation have been graphically represented and suitable corrective measures are also recommended, if the simulation results do not agree with the theoretical values. This computer simulation approach would significantly improve the productivity and reduce the energy consumption of the overall process for the components which are manufactured by the closed die forging process and contribute towards the efforts in reducing the global warming.

Evaluation of Accelerated Graphitic Corrosion Test of Gray Cast Iron

International Nuclear Information System (INIS)

Kim, Jeong Hyeon; Hong, Jong Dae; Chang Heui; Na, Kyung Hwan; Lee, Jae Gon

2011-01-01

In operating nuclear power plants, gray cast iron is commonly used as materials for various non-safety system components including pipes in fire water system, valve bodies, bonnets, and pump castings. In such locations, operating condition does not require alloy steels with excellent mechanical properties. But, a few corrosion related degradation, or graphitic corrosion is frequently occurred to gray cast iron during the long-term operation in nuclear power plant. Graphitic corrosion is selective leaching of iron from gray cast iron, where iron gets removed and graphite grains remain intact. In U.S.A., one-time visual inspection and hardness measurement are required from regulatory body to detect the graphitic corrosion for the life extension evaluation of the operating nuclear power plant. In this study, experiments were conducted to make accelerated graphitic corrosion of gray cast iron using electrochemical method, and hardness was measured for the specimens to establish the correlation between degree of graphitic corrosion and surface hardness of gray cast iron

Study of Bending Fatigue Properties of Al-Si Cast Alloy

Directory of Open Access Journals (Sweden)

Tillová E.

2017-09-01

Full Text Available Fatigue properties of casting Al-alloys are very sensitive to the microstructural features of the alloy (e.g. size and morphology of the eutectic Si, secondary dendrite arm spacing - SDAS, intermetallics, grain size and casting defects (porosity and oxides. Experimental study of bending fatigue properties of secondary cast alloys have shown that: fatigue tests up to 106-107cycles show mean fatigue limits of approx. 30-49 MPa (AlSi9Cu3 alloy - as cast state, approx. 65-76 MPa (AlSi9Cu3 alloy after solution treatment and 60-70 MPa (self-hardened AlZn10Si8Mg alloy in the tested casting condition; whenever large pore is present at or near the specimen’s surface, it will be the dominant cause of fatigue crack initiation; in the absence of large casting defects, the influence of microstructural features (Si morphology; Fe-rich phases on the fatigue performance becomes more pronounced.

Accuracy of single-abutment digital cast obtained using intraoral and cast scanners.

Science.gov (United States)

Lee, Jae-Jun; Jeong, Ii-Do; Park, Jin-Young; Jeon, Jin-Hun; Kim, Ji-Hwan; Kim, Woong-Chul

2017-02-01

Scanners are frequently used in the fabrication of dental prostheses. However, the accuracy of these scanners is variable, and little information is available. The purpose of this in vitro study was to compare the accuracy of cast scanners with that of intraoral scanners by using different image impression techniques. A poly(methyl methacrylate) master model was fabricated to replicate a maxillary first molar single-abutment tooth model. The master model was scanned with an accurate engineering scanner to obtain a true value (n=1) and with 2 intraoral scanners (CEREC Bluecam and CEREC Omnicam; n=6 each). The cast scanner scanned the master model and duplicated the dental stone cast from the master model (n=6). The trueness and precision of the data were measured using a 3-dimensional analysis program. The Kruskal-Wallis test was used to compare the different sets of scanning data, followed by a post hoc Mann-Whitney U test with a significance level modified by Bonferroni correction (α/6=.0083). The type 1 error level (α) was set at .05. The trueness value (root mean square: mean ±standard deviation) was 17.5 ±1.8 μm for the Bluecam, 13.8 ±1.4 μm for the Omnicam, 17.4 ±1.7 μm for cast scanner 1, and 12.3 ±0.1 μm for cast scanner 2. The differences between the Bluecam and the cast scanner 1 and between the Omnicam and the cast scanner 2 were not statistically significant (P>.0083), but a statistically significant difference was found between all the other pairs (POmnicam, 9.2 ±1.2 μm for cast scanner 1, and 6.9 ±2.6 μm for cast scanner 2. The differences between Bluecam and Omnicam and between Omnicam and cast scanner 1 were not statistically significant (P>.0083), but there was a statistically significant difference between all the other pairs (POmnicam in video image impression had better trueness than a cast scanner but with a similar level of precision. Copyright © 2016 Editorial Council for the Journal of Prosthetic Dentistry. Published by

Forging Consensus for Implementing Youth Socialization Policy in Northwest China

Science.gov (United States)

Fairbrother, Gregory P.

2011-01-01

The goal of this article is to examine how the provincial education media in China play a role of forging consensus among local actors responsible for the implementation of new centrally-promulgated youth socialization policy. In doing so, it also explores the tension among three of the Chinese state's claims to legitimacy: economic development,…

Quality improvement of steel cast-welded constructions

Directory of Open Access Journals (Sweden)

Аркадій Васильович Лоза

2017-06-01

Full Text Available Among the various types of metallurgical equipment there are structures which are welded compounds of a cast base and additional elements produced by casting or any other means. Such structures are called cast-welded constructions. Besides new working properties such constructions appear to be more efficient and provide better durability as compared to the similar structures produced by other industrial means. Meanwhile the advantages of the technology are not used in full. One reason is low quality of the compound products caused by lack of proper preparation of the elements to be welded and poor quality of the welds themselves. In the article the methods of quality production and the maintenance of steel cast-welded constructions have been considered. A ladle of a blast-furnace slag car is used as the subject of investigation and further testing of the mentioned above technologies. The ladle is a cast product. Under operating conditions, the ladle undergoes mechanical and thermal load, which results in deformation of its sides that deflect inside. To prevent the deflection stiffening ribs are welded onto the outer surface of the ladle. However, there may be casting defects in the base metal that could reduce the durability of the welds. It has been proved that welds on the unprepared cast base of the steel product cannot guarantee the combination’s durability and reliability. To prevent the influence of the casting defects it has been recommended to cover the base metal with one more metal layer before welding the elements on. Two-layer surfacing provides best result as the first layer serves for the weld penetration of the casting defects since this layer has a significant share of base metal therefore it is less malleable; the second layer is necessary for making the layer viscous enough. The viscous layer ensures the absence of sharp transition from the deposited metal to the base metal and increases the crack resistance of the weld. In

Large forging manufacturing process

Science.gov (United States)

Thamboo, Samuel V.; Yang, Ling

2002-01-01

A process for forging large components of Alloy 718 material so that the components do not exhibit abnormal grain growth includes the steps of: a) providing a billet with an average grain size between ASTM 0 and ASTM 3; b) heating the billet to a temperature of between 1750.degree. F. and 1800.degree. F.; c) upsetting the billet to obtain a component part with a minimum strain of 0.125 in at least selected areas of the part; d) reheating the component part to a temperature between 1750.degree. F. and 1800.degree. F.; e) upsetting the component part to a final configuration such that said selected areas receive no strains between 0.01 and 0.125; f) solution treating the component part at a temperature of between 1725.degree. F. and 1750.degree. F.; and g) aging the component part over predetermined times at different temperatures. A modified process achieves abnormal grain growth in selected areas of a component where desirable.

Clean Metal Casting

Energy Technology Data Exchange (ETDEWEB)

Makhlouf M. Makhlouf; Diran Apelian

2002-02-05

The objective of this project is to develop a technology for clean metal processing that is capable of consistently providing a metal cleanliness level that is fit for a given application. The program has five tasks: Development of melt cleanliness assessment technology, development of melt contamination avoidance technology, development of high temperature phase separation technology, establishment of a correlation between the level of melt cleanliness and as cast mechanical properties, and transfer of technology to the industrial sector. Within the context of the first task, WPI has developed a standardized Reduced Pressure Test that has been endorsed by AFS as a recommended practice. In addition, within the context of task1, WPI has developed a melt cleanliness sensor based on the principles of electromagnetic separation. An industrial partner is commercializing the sensor. Within the context of the second task, WPI has developed environmentally friendly fluxes that do not contain fluorine. Within the context of the third task, WPI modeled the process of rotary degassing and verified the model predictions with experimental data. This model may be used to optimize the performance of industrial rotary degassers. Within the context of the fourth task, WPI has correlated the level of melt cleanliness at various foundries, including a sand casting foundry, a permanent mold casting foundry, and a die casting foundry, to the casting process and the resultant mechanical properties. This is useful in tailoring the melt cleansing operations at foundries to the particular casting process and the desired properties of cast components.

INFLUENCE OF ANNEALING ON HARDNESS OF Cr-Mn-Ni CAST IRONS

Directory of Open Access Journals (Sweden)

V. V. Netrebko

2015-01-01

Full Text Available The necessary level of material’s hardness is determined by the exploitation conditions and presence of technological operations during manufacturing of articles. Mechanical edge cutting machining of wear resistant materials is impeded because of their high hardness. It is recommended to apply annealing in order to decrease hardness and improve machinability. The purpose of the work consisted in obtaining of regression dependences of cast iron’s macrohardness on its chemical content after annealing at 730 °С. With the use of mathematical experimental design the regression dependences of cast iron’s macrohardness and structural components’ microhardness on С, Cr, Mn, Ni content have been established. The minimal hardness of 27,6 HRC after annealing at 730 °С is obtained in the cast iron containing: 3,9% С; 11,4% Cr; 0,6% Mn; 0,2% Ni. The maximal hardness of 70,4 HRC is obtained when the content is as follows: 1,1% С; 25,6% Cr; 5,4% Mn; 3,0% Ni. Annealing at 730 °С decreases the cast irons’ hardness containing the minimal amount of Cr, Mn and Ni. Annealing at 730 °С is recommended for cast irons alloyed by Mn and Ni for increasing of hardness.

Fatigue properties of high-strength materials used in cold-forging tools

DEFF Research Database (Denmark)

Brøndsted, P.; Skov-Hansen, P.

1998-01-01

In the present work classical analytical models are used to describe the static stress–strain curves, low-cycle fatigue properties and fatigue crack growth behaviour of high-strength materials for use in tools for metal-forming processes such as cold forging and extrusion. The paper describes the...

75 FR 67110 - Forged Stainless Steel Flanges From India and Taiwan

Science.gov (United States)

2010-11-01

... Stainless Steel Flanges From India and Taiwan AGENCY: United States International Trade Commission. ACTION... India and Taiwan. SUMMARY: The Commission hereby gives notice that it has instituted reviews pursuant to... the antidumping duty orders on forged stainless steel flanges from India and Taiwan would be likely to...

Plastic flow and microstructure of cast nickel aluminides at 1273 K

Science.gov (United States)

Schneibel, J. H.; Porter, W. D.; Horton, J. A.

1987-12-01

Chill-cast nickel aluminides based on Ni3Al were compression-tested in vacuum at 1273 K at strain rates ranging from 10-5 s-1 to 10-1 s-1. As the strain rate increases, the propensity for intergranular cracking increases. The ductile-to-brittle transition strain rate (DBTS) of as-cast Ni-22.5Al-0.5Hf-0.1B (at. pct) is approximately 10-1 s-1. Homogenization lowers this value by three orders of magnitude, to 10-4 s-1 (a homogenized specimen disintegrated completely at a rate of 10-3 s-1). The fine-grained structure of the as-cast alloy plays an important role in its relatively high DBTS. A hafnium-free alloy, Ni-24A1-0.1B, on the other hand, shows only a weak dependence of the DBTS on prior homogenization, and possible reasons for this finding are discussed.

Medium carbon vanadium steels for closed die forging; Acos de medio carbono microligados ao vanadio para forjaria em matriz fechada

Energy Technology Data Exchange (ETDEWEB)

Jeszensky, Gabor; Plaut, Ronald Lesley

1994-12-31

This work analyses the medium carbon micro alloyed vanadium potential for closed die forged production. The steels reach the mechanical resistance requests during cooling after forging, eliminating the subsequent thermal treatment. Those steels also present good fatigue resistance and machinability. The industrial scale experiments are also reported 16 refs., 21 figs.

A coupled thermo-mechanical pseudo inverse approach for preform design in forging

Science.gov (United States)

Thomas, Anoop Ebey; Abbes, Boussad; Li, Yu Ming; Abbes, Fazilay; Guo, Ying-Qiao; Duval, Jean-Louis

2017-10-01

Hot forging is a process used to form difficult to form materials as well as to achieve complex geometries. This is possible due to the reduction of yield stress at high temperatures and a subsequent increase in formability. Numerical methods have been used to predict the material yield and the stress/strain states of the final product. Pseudo Inverse Approach (PIA) developed in the context of cold forming provides a quick estimate of the stress and strain fields in the final product for a given initial shape. In this paper, PIA is extended to include the thermal effects on the forging process. A Johnson-Cook thermo-viscoplastic material law is considered and a staggered scheme is employed for the coupling between the mechanical and thermal problems. The results are compared with available commercial codes to show the efficiency and the limitations of PIA.

Caste System

OpenAIRE

Hoff, Karla

2016-01-01

In standard economics, individuals are rational actors and economic forces undermine institutions that impose large inefficiencies. The persistence of the caste system is evidence of the need for psychologically more realistic models of decision-making in economics. The caste system divides South Asian society into hereditary groups whose lowest ranks are represented as innately polluted. ...

Improved detection of the KIT D816V mutation in patients with systemic mastocytosis using a quantitative and highly sensitive real-time qPCR assay

DEFF Research Database (Denmark)

Kielsgaard Kristensen, Thomas; Vestergaard, Hanne; Møller, Michael Boe

2011-01-01

The vast majority of patients with systemic mastocytosis (SM) carry the somatic D816V mutation in the KIT gene. The KIT D816V mutation is one of the minor criteria for a diagnosis of SM according to the 2008 World Health Organization classification of myeloproliferative neoplasms. In the present ...

Fiber laser cladding of nickel-based alloy on cast iron

Energy Technology Data Exchange (ETDEWEB)

Arias-González, F., E-mail: felipeag@uvigo.es [Applied Physics Dpt., University of Vigo, EEI, Lagoas-Marcosende, Vigo E-36310 (Spain); Val, J. del [Applied Physics Dpt., University of Vigo, EEI, Lagoas-Marcosende, Vigo E-36310 (Spain); Comesaña, R. [Materials Engineering, Applied Mechanics and Construction Dpt., University of Vigo, EEI, Lagoas-Marcosende, Vigo E-36310 (Spain); Penide, J.; Lusquiños, F.; Quintero, F.; Riveiro, A.; Boutinguiza, M.; Pou, J. [Applied Physics Dpt., University of Vigo, EEI, Lagoas-Marcosende, Vigo E-36310 (Spain)

2016-06-30

Highlights: • Fiber laser cladding of Ni-based alloy on cast iron was experimentally studied. • Two different types of cast iron have been analyzed: gray and ductile cast iron. • Suitable processing parameters to generate a Ni-based coating were determined. • Dilution is higher in gray cast iron samples than in ductile cast iron. • Ni-based coating presents higher hardness than cast iron but similar Young's modulus. - Abstract: Gray cast iron is a ferrous alloy characterized by a carbon-rich phase in form of lamellar graphite in an iron matrix while ductile cast iron presents a carbon-rich phase in form of spheroidal graphite. Graphite presents a higher laser beam absorption than iron matrix and its morphology has also a strong influence on thermal conductivity of the material. The laser cladding process of cast iron is complicated by its heterogeneous microstructure which generates non-homogeneous thermal fields. In this research work, a comparison between different types of cast iron substrates (with different graphite morphology) has been carried out to analyze its impact on the process results. A fiber laser was used to generate a NiCrBSi coating over flat substrates of gray cast iron (EN-GJL-250) and nodular cast iron (EN-GJS-400-15). The relationship between processing parameters (laser irradiance and scanning speed) and geometry of a single laser track was examined. Moreover, microstructure and composition were studied by Scanning Electron Microscopy (SEM), Energy Dispersive X-Ray Spectroscopy (EDS) and X-Ray Diffraction (XRD). The hardness and elastic modulus were analyzed by means of micro- and nanoindentation. A hardfacing coating was generated by fiber laser cladding. Suitable processing parameters to generate the Ni-based alloy coating were determined. For the same processing parameters, gray cast iron samples present higher dilution than cast iron samples. The elastic modulus is similar for the coating and the substrate, while the Ni

CAST reaches milestone but keeps on searching

CERN Multimedia

CERN Courier (september 2011 issue)

2011-01-01

After eight years of searching for the emission of a dark matter candidate particle, the axion, from the Sun, the CERN Axion Solar Telescope (CAST) has fulfilled its original physics programme.   Members of the CAST collaboration in July, together with dipole-based helioscope. CAST, the world’s most sensitive axion helioscope, points a recycled prototype LHC dipole magnet at the Sun at dawn and dusk, looking for the conversion of axions to X-rays. It incorporates four state-of-the-art X-ray detectors: three Micromegas detectors and a pn-CCD imaging camera attached to a focusing X-ray telescope that was recovered from the German space programme (see CERN Courier April 2010).  Over the years, CAST has operated with the magnet bores - the location of the axion conversion - in different conditions: first in vacuum, covering axion masses up to 20 meV/c2, and then with a buffer gas (4He and later 3He) at various densities, finally reaching the goal of 1.17 eV/c2 on 22 ...

Probing eV-scale axions with CAST

CERN Document Server

Ruz, J

2009-01-01

CAST (CERN Axion Solar Telescope) is a helioscope looking for axions coming from the solar core to the Earth. The experiment, located at CERN, is based on the Primakoff effect and uses a magnetic field of 9 Tesla provided by a decommissioned LHC magnet. CAST is able to follow the Sun during sunrise and sunset having four X-ray detectors mounted on both ends of the magnet to look for photons from axion-to-photon conversions. During its First Phase, which concluded in 2004, CAST searched for axions with masses up to 0.02 eV. By using a buffer gas the coherence needed to scan for axions with masses up to 1.20 eV is re-established in CAST’s Second Phase. This technique enables the experiment to study the theoretical regions for axions. During the years 2005 and 2006, the use of 4He has already enabled the search for axions with masses up to 0.39 eV. Up to present time, CAST has upgraded its experimental setup to operate with 3He in the magnetic field.

Optimum back-pressure forging using servo die cushion

OpenAIRE

Kawamoto, Kiichiro; Yoneyama, Takeshi; Okada, Masato; Kitayama, Satoshi; Chikahisa, Junpei

2014-01-01

This study focused on utilizing a servo die cushion (in conjunction with a servo press) as a "back-pressure load generator," to determine its effect on shape accuracy of the formed part and total forming load in forward extrusion during cold forging. The effect of back-pressure load application was confirmed in experiments, and the optimum setting pattern of back-pressure load was considered to minimize both shape accuracy of the formed part and back-pressure energy, which was representative ...

Fatigue behavior of rolled and forged tungsten at 25°, 280° and 480 °C

International Nuclear Information System (INIS)

Habainy, J.; Iyengar, S.; Lee, Y.; Dai, Y.

2015-01-01

Pure tungsten has been chosen as the target material at the European Spallation Source facility in Lund. Calculations show that the target temperature can reach 500 °C momentarily during the spallation process, leading to thermal fatigue. Target life estimations require fatigue data at different temperatures and this work focuses on generating such data for pure, unirradiated, rolled and forged tungsten in the range 25°–480 °C. For specimens oriented in the rolling direction, tensile tests at room temperature indicated Young's modulus values in the range 320–390 GPa, low levels of plasticity (<0.23%) and UTS values in the range 397 MPa (unpolished) and 705 MPa (Polished). UTS for forged specimens were around 500 MPa. Stress-controlled fatigue tests were conducted in the tensile regime, with a runout limit of 2 × 10"6 cycles. At 25 °C, unpolished specimens had fatigue limits of 150 MPa (rolling and transverse direction), and 175 MPa (forged). For polished specimens in the rolling direction, fatigue limits were higher at 237.5 MPa (25 °C) and 252.5 MPa (280 °C). The forged specimens showed slightly better fatigue properties and marginal cyclic hardening at 480 °C. - Highlights: • Stress & strain-controlled fatigue tests on pure tungsten at 25°, 280° & 480 °C. • Unirradiated, rolled and forged specimens in polished and unpolished condition. • Min. tensile strength (MPa): 397 (25 °C), 472 (280 °C) and 363 (480 °C). • Min. endurance limit (MPa): 137.5 (25 °C), 250 (280 °C) and 150 (480 °C). • Marginal cyclic hardening observed at 480 °C.

Gating Systems for Sizeable Castings from Al Alloys Cast into Ceramic Moulds

Directory of Open Access Journals (Sweden)

I. Stachovec

2012-04-01

Full Text Available In contrast to casting to conventional non-reusable “sand” moulds, for which calculating technique for an optimum design of the gating system is comparatively well-developed, a trial-and-error method is applied mostly for casting to ceramic shell moulds made by the investment casting technology. A technologist selects from gating systems of several types (that are standardized by the foundry mostly on the basis of experience. However, this approach is not sustainable with ever growing demands on quality of castings and also the economy of their fabrication as well as with new types of complex sizeable castings introduced to the production gradually (by new customers from the aircraft industry above all any more. The simulation software may be used as a possible tool for making the process of optimising gating systems more effective.

Diffusion of C and Cr During Creation of Surface Layer on Cast Steel Casting

Directory of Open Access Journals (Sweden)

Szajnar J.

2014-10-01

Full Text Available In paper a method of improvement in utility properties of unalloyed cast steel casting in result of diffusion of C and Cr in process of creation of surface layer is presented. The aim of paper was determination of diffusion range of basic elements of alloyed surface layer. Moreover a quantitative analysis of carbides phase strengthens alloyed surface layer of casting was carried out. The results of studies shown that important factors of surface layer creation are maximal temperature Tmax on granular insert – cast steel boundary dependent of pouring temperature, granularity Zw of Fe-Cr-C alloy insert and thickness of casting wall gśo. On the basis of obtained results was affirmed that with increase of thickness of casting wall increases range of diffusion in solid state in Fe-Cr-C grains and in liquid state. Moreover the range of Tmax = 13001500oC favours creation of the proper alloyed surface layers on cast steel.

2006 Land and Maritime Supply Chains Business Conference and Exhibition

Science.gov (United States)

2006-08-30

Clifford G. Scott, SC, USN, Unit Chief, Electronics Division Ms. Arretta Griffi th, Procurement Support Assistant (OA) Ms. Shelly Jenkins, Customer Account...Business Systems Modernization............715 DLA - Casting and Forging.................................712 DLA - Defense Distribution Center (DDC...219 Kovatch Castings , Inc.....................................409 Lambda Supply Corp......................................103 Lockheed

Best possible heat treatment of steel SA 336 F22 for the production of forged shells with heavy walls

International Nuclear Information System (INIS)

Badeau, J.P.; Poitrault, I.S.; De Badereau, A.; Blondeau, R.P.

1986-01-01

The manufacturing of thick-wall components, such as shells, for petrochemical reactors normally requires the 2.25Cr-1Mo(SA 336 F22) steel. This paper deals with: 1. Experienced difficulties in producing thick-wall forgings up to a thickness of 500 mm with standard 2.25Cr-1Mo steel. 2. The solutions offered by Le Creusot Heavy Forge. The studies discussed are: (1) the effect of the structure; (2) the effect of the chemical composition on hardenability and temper embrittlement in steel making; and (3) the effect of austenitization conditions. Some examples concerning industrial forgings are presented, among them: 1. The manufacturing of shells for the petrochemical industry. 2. A thick-wall shell from a 146-metric ton hollow ingot

Multiscale modeling for the prediction of casting defects in investment cast aluminum alloys

International Nuclear Information System (INIS)

Hamilton, R.W.; See, D.; Butler, S.; Lee, P.D.

2003-01-01

Macroscopic modeling of heat transfer and fluid flow is now routinely used for the prediction of macroscopic defects in castings, while microscopic models are used to investigate the effects of alloy changes on typical microstructures. By combining these two levels of modeling it is possible to simulate the casting process over a wider range of spatial and temporal scales. This paper presents a multiscale model where micromodels for dendrite arm spacing and microporosity are incorporated into a macromodel of heat transfer and in order to predict the as cast microstructure and prevalence of microscopic defects, specifically porosity. The approach is applied to aluminum alloy (L169) investment castings. The models are compared with results obtained by optical image analysis of prepared slices, and X-ray tomography of volume samples from the experiments. Multiscale modeling is shown to provide the designer with a useful tool to improve the properties of the final casting by testing how altering the casting process affects the final microstructure including porosity

PROCESSING OF CONCENTRATED AQUEOUS ZIRCONIA-BIOGLASS SLIPS BY SLIP CASTING

Directory of Open Access Journals (Sweden)

Beltina Leon

2017-03-01

Full Text Available 3 mol% yttria-partially stabilized zirconia (Y-TZP powder and a sol-gel derived CaO- P₂O₅- SiO₂ (64S bioglass, were used to produce Y-TZP- bioglass slip cast compacts. The rheological properties of concentrated aqueous Y-TZP- 64S suspensions prepared with two different glass contents: 10.5 vol% and 19.9 vol%, and ammonium polyacrylate (NH₄PA as dispersant, were investigated and compared with those of Y-TZP. The density of green cast samples was related to the degree of slip dispersion. The substitution of Y-TZP by 64S glass in the mixtures resulted in greater adsorption of NH₄PA; however, the viscosity and yield stress values of Y-TZP-64S slips were higher than those of Y-TZP ones for the solid loadings studied. The increase in the glass content from 10.5 to 19.9 vol% increased the viscosity and yield stress values. The presence of 64S glass in the mixtures resulted in a less dense packing of cast samples.

[The surface roughness analysis of the titanium casting founding by a new titanium casting investment material].

Science.gov (United States)

Liang, Qin-ye; Wu, Xia-yi; Lin, Xue-feng

2012-04-01

To investigate the surface roughness property of the titanium castings cast in a new investment for titanium casting. Six wax patterns (20 mm × 20 mm × 0.5 mm) were invested using two investments: three in a new titanium investment material and three in the control material (Rematitan Plus). Six titanium specimens were obtained by conventional casting. After casting, surface roughness of the specimens were evaluated with a surface profilometer. The surface roughness of the specimens cast in new titanium investment material was (1.72 ± 0.08) µm, which was much smaller than that from Rematitan Plus [(1.91 ± 0.15) µm, P cast using these two investment materials are both smooth enough to fulfill the demand of the titanium precision-casting for prosthodontic clinical use.

Examination and Elimination of Defects in Cone Casting Made of Ductile Cast Iron

Directory of Open Access Journals (Sweden)

Guzik E.

2013-12-01

Full Text Available In the scope of existing cooperation with the Foundry of Cast Iron ZM “WSK Rzeszów” Ltd. there was carried out research work of microstructure and mechanical properties in the walls of a cone casting made of ductile cast iron. The particular attention was being put to the search of the potential brittle phases which have deleterious effect on ductility and dynamic properties of highly strained use of the casting prone to the potential risk of cracks during the highly strained use.

Computer-aided control of high-quality cast iron

Directory of Open Access Journals (Sweden)

S. Pietrowski

2008-04-01

Full Text Available The study discusses the possibility of control of the high-quality grey cast iron and ductile iron using the author’s genuine computer programs. The programs have been developed with the help of algorithms based on statistical relationships that are said to exist between the characteristic parameters of DTA curves and properties, like Rp0,2, Rm, A5 and HB. It has been proved that the spheroidisation and inoculation treatment of cast iron changes in an important way the characteristic parameters of DTA curves, thus enabling a control of these operations as regards their correctness and effectiveness, along with the related changes in microstructure and mechanical properties of cast iron. Moreover, some examples of statistical relationships existing between the typical properties of ductile iron and its control process were given for cases of the melts consistent and inconsistent with the adopted technology.A test stand for control of the high-quality cast iron and respective melts has been schematically depicted.

Evolution of the Ultrasonic Inspection of Heavy Rotor Forgings Over the Last Decades

Science.gov (United States)

Zimmer, A.; Vrana, J.; Meiser, J.; Maximini, W.; Blaes, N.

2010-02-01

All types of heavy forgings that are used in energy machine industry, rotor shafts as well as discs, retaining rings or tie bolts are subject to extensive nondestructive inspections before they are delivered to the customer. Due to the availability of the parts in simple shapes, these forgings are very well suited for full volmetric inspections using ultrasound. In the beginning, these inspections were carried out manually, using straight beam probes and analogue equipment. Higher requirements in reliability, efficiency, safety and power output in the machines have lead to higher requirements for the ultrasonic inspection in the form of more scanning directions, higher sensitivity demands and improved documentation means. This and the increasing use of high alloy materials for ever growing parts, increase the need for more and more sophisticated methods for testing the forgings. Angle scans and sizing technologies like DGS have been implemented, and for more than 15 years now, mechanized and automated inspections have gained importance since they allow better documentation as well as easier evaluation of the recorded data using different views (B- C- or D-Scans), projections or tomography views. The latest major development has been the availability of phased array probes to increase the flexibility of the inspection systems. Many results of the ongoing research in ultrasonic's have not been implemented yet. Today's availability of fast computers, large and fast data storages allows saving RF inspection data and applying sophisticated signal processing methods. For example linear diffraction tomography methods like SAFT offer tools for 3D reconstruction of inspection data, simplifying sizing and locating of defects as well as for improving signal to noise ratios. While such methods are already applied in medical ultrasonic's, they are still to be implemented in the steel industry. This paper describes the development of the ultrasonic inspection of heavy forgings

Colour Metallography of Cast Iron

Directory of Open Access Journals (Sweden)

Zhou Jiyang

2009-05-01

Full Text Available Cast iron, as a traditional metal material, has advantages of low total cost, good castability and machinability, good wear resistance and low notch sensitivity, and is still facing tough challenge in quality, property and variety of types etc. Experts and engineers studying and producing iron castings all around world extremely concern this serious challenge. Over more than 30 years, a great of research work has been carried out on how to further improve its property, expand its application and combine cast iron technology with some hi-techs (for example, computer technology. Nevertheless, cast iron is a multi-element and multi-phase alloy and has complex and variety of structures and still has great development potential in structure and property. For further studying and developing cast iron, theoretical research work is important promise, and the study on solidification process and control mechanism of graphite morphology is fundamental for improving property of cast iron and developing new type of cast iron.Metallography of cast iron normally includes two sections: liquid phase transformation and solid phase transformation. The book, Colour Metallography of Cast Iron , uses colour metallography technique to study solidification structures of cast irons: graphite, carbides, austenite and eutectics; and focuses on solidification processes. With progress of modern solidification theory, the control of material solidification process becomes important measure for improving traditionalmaterials and developing new materials. Solidification structure not only influences mechanical and physical properties of cast iron, but also affects its internal quality. The book uses a large amount of colour photos to describe the formation of solidification structures and their relations. Crystallization phenomena, which cannot be displayed with traditional metallography, are presented and more phase transformation information is obtained from these colour

Metallurgy of steels for PWR pressure vessels

Energy Technology Data Exchange (ETDEWEB)

Kepka, M; Mocek, J; Barackova, L [Skoda, Plzen (Czechoslovakia)

1980-09-01

A survey and the chemical compositions are presented of reactor pressure vessel steels. The metallurgy is described of steel making for pressure vessels in Japan and the USSR. Both acidic and alkaline open-hearth steel is used for the manufacture of ingots. The leading world manufacturers of forging ingots for pressure vessels, however, exclusively use electric steel. Vacuum casting techniques are exclusively used. Experience is shown gained with the introduction of the manufacture of forging ingots for pressure vessels at SKODA, Plzen. The metallurgical procedure was tested utilizing alkaline open hearths, electric arc furnaces and facilities for vacuum casting of steel. Pure charge raw materials should be used for securing high steel purity. Prior to forging pressure vessel rings, not only should sufficiently big bottoms and heads be removed but also the ingot middle part should be scrapped showing higher contents of impurities and nonhomogeneous structure.

Engine piston assembly and forged piston member therefor having a cooling recess

Energy Technology Data Exchange (ETDEWEB)

Cooper, B.C.; Erickson, K.L.; Green, J.A.; Nyez, D.S.

1989-09-19

This patent describes a forged steel piston member for reciprocating movement in an engine. It comprises: an upper portion of substantially cylindrical shape and having a central axis, a top surface, a tubular wall depending from the top surface and having a peripheral groove adapted to receive a sealing ring, a lower end surface, and an inwardly facing wall surface extending upwardly from the lower end surface. The upper portion further includes an outwardly facing wall surface spaced radially inwardly from the inwardly facing wall surface and a downwardly facing transition portion blendingly associated with the inwardly and outwardly facing wall surfaces to collectively define an annular cooling recess, the transition portion being elevational spaced a relatively short distance from the top surface; and the inwardly facing wall surface being a machined surface of revolution about the central axis integral or one-piece forging.

FE-simulation of hot forging with an integrated heat treatment with the objective of residual stress prediction

Science.gov (United States)

Behrens, Bernd-Arno; Chugreeva, Anna; Chugreev, Alexander

2018-05-01

Hot forming as a coupled thermo-mechanical process comprises numerous material phenomena with a corresponding impact on the material behavior during and after the forming process as well as on the final component performance. In this context, a realistic FE-simulation requires reliable mathematical models as well as detailed thermo-mechanical material data. This paper presents experimental and numerical results focused on the FE-based simulation of a hot forging process with a subsequent heat treatment step aiming at the prediction of the final mechanical properties and residual stress state in the forged component made of low alloy CrMo-steel DIN 42CrMo4. For this purpose, hot forging experiments of connecting rod geometry with a corresponding metallographic analysis and x-ray residual stress measurements have been carried out. For the coupled thermo-mechanical-metallurgical FE-simulations, a special user-defined material model based on the additive strain decomposition method and implemented in Simufact Forming via MSC.Marc solver features has been used.

Multiscale modelling applied to the virtual processing of a PMMC automotive component

International Nuclear Information System (INIS)

Hamilton, R.W.; Youssef, Y.; Dashwood, R.J.; Lee, P.D.

2002-01-01

A novel processing route was developed to produce automotive parts using an aluminium TiB 2 composite by casting to near-net-shape, and then one-step forging. The composite was formed by a salt reaction in the molten alloy, resulting in well distributed, sub micron-sized particles of TiB 2 . This process offers the benefits of reduced cost and improved properties. Using a suspension part as a case study, both experimental and simulation results are presented. The accelerated implementation of this route was facilitated by linked casting and forged software. Constitutive equations and microstructural models were developed to account for the influence of the particulate addition. (author)

Development of modified route for fabrication of Zr-2.5Nb alloy pressure tubes

International Nuclear Information System (INIS)

Saibaba, N.; Hemantha Rao, G.V.S.; Phani Babu, C.; Jha, S.K.; Ganesha, G.N.; Ramana Rao, S.V.; Kumar Vaibhaw; Dey, G.K.; Srivastava, D.; Neogy, S.; Mani Krishna, K.V.

2013-01-01

Different fabrication trials involving the variation in three important manufacturing stages of Zr-2.5%Nb pressure tube were partially undetaken. The variations were with respect of mode of breaking the cast structure of the ingot (forging vs extrution), ratio of hot extrusion and number of stages of subsequent cold work to produce the finished tube. It was observed that forging process resulted in superior performance in breaking the cast structure. Higher extrusion ratios resulted in more favorable texture and microstrucutre. Continuity of the beta phase in the final microstructure was observed to be more in case of route involving single cold work subsequent to hot extrusion. (author)

Study of microstructure, texture and mechanical properties of Zr–2.5Nb alloy pressure tubes fabricated with different processing routes

International Nuclear Information System (INIS)

Saibaba, N.; Vaibhaw, Kumar; Neogy, S.; Mani Krishna, K.V.; Jha, S.K.; Phani Babu, C.; Ramana Rao, S.V.; Srivastava, D.; Dey, G.K.

2013-01-01

Different fabrication trials involving the variation in three important stages of Zr–2.5Nb pressure tube were undertaken. The variations were with respect to the mode of breaking the cast structure of the ingot (forging vs extrusion), the hot extrusion ratio and the number of subsequent cold work stages to produce the finished tube. It was observed that the forging process resulted in superior performance in breaking the cast structure. Higher extrusion ratios resulted in more favorable texture and microstructure. More continuity of the beta phase was observed in the final microstructure for the route involving the single cold work step subsequent to hot extrusion

Applying RP-FDM Technology to Produce Prototype Castings Using the Investment Casting Method

Directory of Open Access Journals (Sweden)

M. Macků

2012-09-01

Full Text Available The research focused on the production of prototype castings, which is mapped out starting from the drawing documentation up to theproduction of the casting itself. The FDM method was applied for the production of the 3D pattern. Its main objective was to find out whatdimensional changes happened during individual production stages, starting from the 3D pattern printing through a silicon mouldproduction, wax patterns casting, making shells, melting out wax from shells and drying, up to the production of the final casting itself.Five measurements of determined dimensions were made during the production, which were processed and evaluated mathematically.A determination of shrinkage and a proposal of measures to maintain the dimensional stability of the final casting so as to meetrequirements specified by a customer were the results.

Babbitt Casting and Babbitt Spraying Processes Case Study

OpenAIRE

M. Jalali Azizpour; S.Norouzi H. Mohammadi Majd

2011-01-01

In this paper, the babbitting of a bearing in boiler feed pump of an electromotor has been studied. These bearings have an important role in reducing the shut down times in the pumps, compressors and turbines. The most conventional method in babbitting is casting as a melting method. The comparison between thermal spray and casting methods in babbitting shows that the thermal spraying babbitt layer has better performance and tribological behavior. The metallurgical and tribological analysis s...

Study on antioxidant experiment on forged steel tube sheet and tube hole for steam generator

International Nuclear Information System (INIS)

Zong Hai; Wang Detai; Ding Yang

2012-01-01

Antioxidant experiment on forged steel tube sheet and tube hole for steam generator was studied and the influence of different simulated heat treatments on the antioxidant performance of tube sheet and tube hole was made. The influence of different antioxidant methods on the size of tube hole was drawn. Furthermore, the change of size and weight of 18MnD5 forged steel tube sheet on the condition of different simulated heat treatments was also studied. The analytical results have proved reference information for the use of 18MnD5 material and for key processes of processing tube hole and wearing and expanding U-style tube. (authors)

Temperature measurement during solidification of thin wall ductile cast iron. Part 2: Numerical simulations

DEFF Research Database (Denmark)

Pedersen, Karl Martin; Tiedje, Niels Skat

2008-01-01

Temperature measurements in castings are carried out with thermocouples (TC’s), which are inserted in the melt. The TC influence solidification of the casting, especially in thin wall castings where the heat content of the melt is small compared to the cooling power of the TC. A numerical analysi...

Casting of microstructured shark skin surfaces and possible applications on aluminum casting parts

Directory of Open Access Journals (Sweden)

Todor Ivanov

2011-02-01

Full Text Available Within the project Functional Surfaces via Micro- and Nanoscaled Structures?which is part of the Cluster of Excellence 揑ntegrative Production Technology?established and financed by the German Research Foundation (DFG, an investment casting process to produce 3-dimensional functional surfaces down to a structural size of 1 μm on near-net-shape-casting parts has been developed. The common way to realize functional microstructures on metallic surfaces is to use laser ablation, electro discharge machining or micro milling. The handicap of these processes is their limited productivity. The approach of this project to raise the efficiency is to use the investment casting process to replicate microstructured surfaces by moulding from a laser-microstructured grand master pattern. The main research objective deals with the investigation of the single process steps of the investment casting process with regard to the moulding accuracy. Actual results concerning making of the wax pattern, suitability of ceramic mould and core materials for casting of an AlSi7Mg0.3 alloy as well as the knock-out behavior of the shells are presented. By using of the example of an intake manifold of a gasoline race car engine, a technical shark skin surface has been realized to reduce the drag of the intake air. The intake manifold consists of an air-restrictor with a defined inner diameter which is microstructured with technical shark skin riblets. For this reason the inner diameter cannot be drilled after casting and demands a very high accuracy of the casting part. A technology for the fabrication and demoulding of accurate microstructured castings are shown. Shrinkage factors of different moulding steps of the macroscopic casting part as well as the microscopic riblet structure have been examined as well.

Social Work and Engineering Collaboration: Forging Innovative Global Community Development Education

Science.gov (United States)

Gilbert, Dorie J.

2014-01-01

Interdisciplinary programs in schools of social work are growing in scope and number. This article reports on collaboration between a school of social work and a school of engineering, which is forging a new area of interdisciplinary education. The program engages social work students working alongside engineering students in a team approach to…

Forgings made of austenitic chromium-nickel steels for the low temperature range

International Nuclear Information System (INIS)

Gruendler, O.; Schwarz, W.; Koren, M.

1981-01-01

The authors discuss the low temperature application of austenitic chromium-nickel steels for energy production and process techniques. Material requirements are presented, and the behaviour, mechanical and physical properties of such steels are discussed. The manufacture of forgings is considered and test results presented. (Auth.)