WorldWideScience

Sample records for canis familiaris dietary

  1. The help-seeking behaviour of dogs (Canis familiaris)

    OpenAIRE

    Brodd, Louise

    2014-01-01

    During domestication, the dog( Canis familiaris), have become skilful in understanding human communication and also in communicating with humans. The wolf ( Canis lupus), is not as skilled with this interspecific communication. When dogs are faced with an unsolvable problem, they seek help from human by e.g. gazing at them. This behaviour has been studied and both age and breed group differences have been showed. In this study, we presented dogs with a task that consisted of a solvable and un...

  2. Steroid hormones in blood plasma from Greenland sledge dogs (Canis familiaris) dietary exposed to organohalogen polutted minke whale (Balanenoptera acuterostrata) blubber

    DEFF Research Database (Denmark)

    Sonne, Christian; Dietz, Rune; Letcher, J.;

    2014-01-01

    conducted in Greenland sledge dogs (Canis familiaris) as a sentinel species for adverse effects on steroid homeostasis. The control and exposed groups were composed of four sister-bitches all fed pork fat (Suis suis) and organohalogen contaminated minke whale (Balaenoptera acutorostrata) blubber......Persistent organic pollutants such as polychlorinated biphenyls (PCB) are known to disrupt steroidogenesis and subsequent concentrations of circulating endogenous hormones. This is also suspected to occur in Arctic predatory species, such as polar bears (Ursus maritimus) and a study was therefore......, respectively, for 321–576 days. In the exposed group, this constituted a mean daily intake of 128 μg ∑PCBs (5 μg/kg/day). At the end of the study, organohalogen contaminant (OHC) were measured in adipose tissue and hormone levels in blood of sledge dogs. The hormones included 11 products of the steroidogenesis...

  3. Altered vitamin D status in liver tissue and blood plasma from Greenland sledge dogs (Canis familiaris) dietary exposed to organohalogen contaminated minke whale (Balaenoptera acuterostrata) blubber.

    Science.gov (United States)

    Sonne, Christian; Kirkegaard, Maja; Jakobsen, Jette; Jenssen, Bjørn Munro; Letcher, Robert J; Dietz, Rune

    2014-06-01

    This study compared vitamin D3 (vitD3) and 25-OH vitamin D3 (25OHD3) status in Greenland sledge dogs (Canis familiaris) given either minke whale (Balaenoptera acuterostrata) blubber high in organohalogen contaminants (OHCs) or clean porcine (Suis scrofa) fat for up to 636 days. A group of six exposed and six control sister bitches (maternal generation) and their three exposed and four control pups, respectively, were daily fed 112g whale blubber (193µg ∑PCB/day) or porcine fat (0.17µg ∑PCB/day). Mean level of ∑PCB in adipose tissue of exposed bitches and their pups was 3106 and 2670ng/g lw, respectively, which was significantly higher than the mean concentration of 53ng/g lw for all controls (peffects on immunity and reproduction and more focus should be conducted on this compound in Arctic wildlife. PMID:24725758

  4. Genetic analysis of prostatic diseases in canis familiaris

    OpenAIRE

    Magalhães, Joana Fernandes da Silva

    2014-01-01

    Dissertação de Mestrado em Genética Molecular Comparativa e Tecnológica A glândula prostática faz parte do sistema reprodutor masculino e pode ser afectada por várias condições incluindo a hiperplasia prostática benigna (HPB), o cancro da próstata (CaP), a prostatite e quistos. 0 cão (Canis familiaris) é considerado um bom modelo animal para o estudo destas doenças porque, para além das semelhanças morfológicas e funcionais entre as glândulas prostáticas do homem e do cão, estes animais de...

  5. Comprehension of human communicative signs in pet dogs (Canis familiaris).

    Science.gov (United States)

    Soproni, K; Miklósi, A; Topál, J; Csányi, V

    2001-06-01

    On the basis of a study by D. J. Povinelli, D. T. Bierschwale, and C. G. Cech (1999), the performance of family dogs (Canis familiaris) was examined in a 2-way food choice task in which 4 types of directional cues were given by the experimenter: pointing and gazing, head-nodding ("at target"), head turning above the correct container ("above target"), and glancing only ("eyes only"). The results showed that the performance of the dogs resembled more closely that of the children in D. J. Povinelli et al.'s study, in contrast to the chimpanzees' performance in the same study. It seems that dogs, like children, interpret the test situation as being a form of communication. The hypothesis is that this similarity is attributable to the social experience and acquired social routines in dogs because they spend more time in close contact with humans than apes do, and as a result dogs are probably more experienced in the recognition of human gestures. PMID:11459158

  6. Mating System of Free-Ranging Dogs (Canis familiaris

    Directory of Open Access Journals (Sweden)

    S. K. Pal

    2011-01-01

    Full Text Available Fourteen females belonging to five groups were selected for the study of mating system in free-ranging domestic dogs (Canis familiaris All the matings occurred between August and December with a peak in late monsoon months (September to November. Both males and females differed in their degree of attractiveness to the opposite sex. The duration of courting association increased with the number of courting males in an association. The females exhibited selectivity by readily permitting some males to mate and avoiding, or even attacking others, if they attempted to mount. Frequency of mounting in courting association increased with the number of males present. There was a positive correlation between the duration of courting association and the frequency of mounting. The young adult males were more likely to copulate successfully than the old adult males. There was a negative correlation between the number of males present in an association and the number of successful copulations. In this study, six types of mating (monogamy, polygyny, promiscuity, polyandry, opportunity and rape were recorded. Mean (±S.E. duration of copulatory ties was 25.65 (±1.43 min. Several natural factors influencing the duration of copulatory ties were identified.

  7. Breed Differences in Domestic Dogs' (Canis familiaris) Comprehension of Human Communicative Signals

    OpenAIRE

    Wobber, Victoria Elizabeth; Wrangham, Richard W.; Hare, Brian; Koler-Matznick, Janice; Tomasello, Michael

    2009-01-01

    Recent research suggests that some human-like social skills evolved in dogs (Canis familiaris) during domestication as an incidental by-product of selection for “tame” forms of behavior. It is still possible, however, that the social skills of certain dog breeds came under direct selection that led to further increases in social problem solving ability. To test this hypothesis, different breeds of domestic dogs were compared for their ability to use various human communicative behaviors to fi...

  8. Comparative NMR studies of diffusional water permeability of red blood cells from different species: XVI Dingo (Canis familiaris dingo) and dog (Canis familiaris).

    Science.gov (United States)

    Benga, Gheorghe; Chapman, Bogdan E; Matei, Horea; Cox, Guy C; Romeo, Tony; Mironescu, Eugen; Kuchel, Philip W

    2010-03-08

    As part of a programme of comparative measurements of Pd (diffusional water permeability) the RBCs (red blood cells) from dingo (Canis familiaris dingo) and greyhound dog (Canis familiaris) were studied. The morphologies of the dingo and greyhound RBCs [examined by light and SEM (scanning electron microscopy)] were found to be very similar, with regard to aspect ratio and size; the mean diameters were estimated to be the same (approximately 7.2 microm) for both dingo and greyhound RBCs. The water diffusional permeability was monitored by using an Mn2+-doping 1H NMR technique at 400 MHz. The Pd (cm/s) values of dingo and greyhound RBCs were similar: 6.5 x 10(-3) at 25 degrees C, 7.5 x 10(-3) at 30 degrees C, 10 x 10(-3) at 37 degrees C and 11.5 x 10(-3) at 42 degrees C. The inhibitory effect of a mercury-containing SH (sulfhydryl)-modifying reagent PCMBS (p-chloromercuribenzene sulfonate) was investigated. The maximal inhibition of dingo and greyhound RBCs was reached in 15-30 min at 37 degrees C with 2 mmol/l PCMBS. The values of maximal inhibition were in the range 72-74% when measured at 25 degrees C and 30 degrees C, and approximately 66% at 37 degrees C. The lowest value of Pd (corresponding to the basal permeability to water) was approximately 2-3 x 10(-3) cm/s in the temperature range 25-37 degrees C. The Ea,d (activation energy of water diffusion) was 25 kJ/mol for dingo RBC and 23 kJ/mol for greyhound RBCs. After incubation with PCMBS, the values of Ea,d increased, reaching 46-48 kJ/mol in the condition of maximal inhibition of water exchange. The electrophoretograms of membrane polypeptides of the dingo and greyhound RBCs were compared and seen to be very similar. We postulate that the RBC parameters reported in the present study are characteristic of all canine species and, in particular in the two cases presented here, these parameters have not been changed by the peculiar Australian habitat over the millennia (as in the case of the dingo) or over

  9. The Dogs of CA-SRI-2: Osteometry of Canis familiaris from Santa Rosa Island, California

    Directory of Open Access Journals (Sweden)

    Courtney Hofman

    2014-05-01

    Full Text Available Domesticated dogs (Canis familiaris are an important human companion around the world and have long been a focus of archaeological research. Osteometric analysis of six dogs from a Late Holocene Chumash village on Santa Rosa Island, California indicates that adults, juvenile/young adults, and a puppy were present. Similar to dogs on other Channel Islands, these dogs fall into the large Indian dog category, standing some 43-54 cm tall, with mesaticephalic or mild brachycephalic facial characteristics. No cutmarks were found on the bones, but one of the mandibles was burned. The CA-SRI-2 dogs appear to have eaten high trophic marine foods similar to what humans consumed, documenting the close bond between dogs and humans on the Channel Islands and broader North American Pacific Coast.

  10. The breakfast effect: dogs (Canis familiaris) search more accurately when they are less hungry.

    Science.gov (United States)

    Miller, Holly C; Bender, Charlotte

    2012-11-01

    We investigated whether the consumption of a morning meal (breakfast) by dogs (Canis familiaris) would affect search accuracy on a working memory task following the exertion of self-control. Dogs were tested either 30 or 90 min after consuming half of their daily resting energy requirements (RER). During testing dogs were initially required to sit still for 10 min before searching for hidden food in a visible displacement task. We found that 30 min following the consumption of breakfast, and 10 min after the behavioral inhibition task, dogs searched more accurately than they did in a fasted state. Similar differences were not observed when dogs were tested 90 min after meal consumption. This pattern of behavior suggests that breakfast enhanced search accuracy following a behavioral inhibition task by providing energy for cognitive processes, and that search accuracy decreased as a function of energy depletion. PMID:23032958

  11. Following human pointing: Where do dogs (Canis familiaris) look at to find food?

    Science.gov (United States)

    Carballo, Fabricio; Freidin, Esteban; Casanave, Emma; Bentosela, Mariana

    2016-07-01

    Domestic dogs (Canis familiaris) are notably skillful in following cues from people (e.g., pointing gestures). However, not much is known about the processing of information available during such tasks. We here focus on one of the earliest of such processes, namely attention. The goal of the present work was to describe variations in dogs' attention towards diverse targets while they solve an object choice task with human pointing. The direction of subjects' gaze was measured in the period comprising one second before and two seconds after the experimenter called the dog and simultaneously performed a static distal pointing gesture towards the correct bowl. We did two consecutive training phases: acquisition and extinction. Dogs spent more time watching the pointer than the pointing gesture itself and the correct than the incorrect bowl. Indeed, the time spent watching the correct bowl was the best predictor of correct choices across phases. We discuss the relevance of these findings for the process of local enhancement.

  12. Cooperation, leadership and numerical assessment of opponents in conflicts between groups of feral dogs (Canis lupus familiaris)

    OpenAIRE

    Bonanni, Roberto

    2009-01-01

    This thesis attempted to assess the adaptive value of the behaviour of feral dogs (Canis lupus familiaris) by using such species as a model for testing predictions based on evolutionary theories. In particular, the following topics concerning dogs’ behaviour were examined: intergroup agonistic behaviour in relation to numerical assessment of opponents, cooperative behaviour during intergroup conflicts and decision making processes during collective activity changes. The research focuse...

  13. Effect of training and familiarity on responsiveness to human cues in domestic dogs (Canis familiaris).

    Science.gov (United States)

    Cunningham, Clare L; Ramos, Mari F

    2014-05-01

    Domestic dogs (Canis familiaris) seem to possess an evolved competency to follow human-given cues, often out-performing their wild progenitor the wolf (Canis lupus) on cue-following tasks. However, domestication may not be solely responsible for the socio-cognitive skills of dogs, with ontogenetic experience also playing a role. This research evaluated the effects of intensive training on cue-following behaviour using an unreinforced object-choice paradigm. The responses of dogs that were trained to competitive levels were compared to those of pet dogs with only basic training, and dogs living in an animal shelter that demonstrated no or only rudimentary following of basic commands. Using a cue-following task where three types of cues were presented by familiar and unfamiliar human partners, the number of cues followed by each training group were recorded. All dogs found cues where gesture was combined with a congruent head and eye movement easier to follow than either gesture or eye gaze alone. Whether the cue-giver was familiar or not had a significant effect on number of cues followed in homed dogs, and the performance of shelter dogs was comparable to the other groups when faced with an unfamiliar cue-giver. Contrary to predictions, level of training did not improve performance on the cue-following task. This work does provide support for the presence of an evolved adaptation to exploit social cues provided by humans that can be augmented by familiarity with the cue giver. However, additional joint activity as experienced in an intensive training regime does not seem to increase accuracy in following human-given cues.

  14. Can domestic dogs (Canis familiaris) use referential emotional expressions to locate hidden food?

    Science.gov (United States)

    Buttelmann, David; Tomasello, Michael

    2013-01-01

    Although many studies have investigated domestic dogs' (Canis familiaris) use of human communicative cues, little is known about their use of humans' emotional expressions. We conducted a study following the general paradigm of Repacholi in Dev Psychol 34:1017-1025, (1998) and tested four breeds of dogs in the laboratory and another breed in the open air. In our study, a human reacted emotionally (happy, neutral or disgust) to the hidden contents of two boxes, after which the dog was then allowed to choose one of the boxes. Dogs tested in the laboratory distinguished between the most distinct of the expressed emotions (Happy-Disgust condition) by choosing appropriately, but performed at chance level when the two emotions were less distinct (Happy-Neutral condition). The breed tested in the open air passed both conditions, but this breed's differing testing setup might have been responsible for their success. Although without meaningful emotional expressions, when given a choice, these subjects chose randomly, their performance did not differ from that in the experimental conditions. Based on the findings revealed in the laboratory, we suggest that some domestic dogs recognize both the directedness and the valence of some human emotional expressions. PMID:22960805

  15. Does the nutrition profile of vitamins, fatty acids and microelements counteract the negative impact from organohalogen pollutants on bone mineral density in Greenland sledge dogs (Canis familiaris)?

    DEFF Research Database (Denmark)

    Sonne, Christian; Rigét, Frank F; Beck Jensen, Jens-Erik;

    2008-01-01

    There is a great need for understanding the impact from dietary OHCs (organohalogen compounds) on bone mineral composition - and thereby osteoporosis - in especially arctic wildlife such as polar bears (Ursus maritimus) as well as humans. For that purpose, we measured BMD (bone mineral density......) by DXA scanning (g/cm(-2)) in 15 age and weight normalized sledge dog (Canis familiaris) bitches and their 26 pups divided into a control group (n=26) given 50-200 g/day clean pork (Suis scrofa) fat and a treated group (n=15) given 50-200 g/day OHC polluted minke whale (Balaenoptera acutorostrata...... an impact on BMD using the present time frame and OHC concentrations (threshold levels not reached), or the difference in food composition (mainly vitamins and n3 fatty acids) conceal the potential OHC impact on BMD. Such information is important when evaluating the positive and negative health consequences...

  16. Does the nutrition profile of vitamins, fatty acids and microelements counteract the negative impact from organohalogen pollutants on bone mineral density in Greenland sledge dogs (Canis familiaris)?

    DEFF Research Database (Denmark)

    Sonne, Christian; Riget, Frank F.; Jensen, Jens-Erik Beck;

    2008-01-01

    There is a great need for understanding the impact from dietary OHCs (organohalogen compounds) on bone mineral composition - and thereby osteoporosis - in especially arctic wildlife such as polar bears (Ursus maritimus) as well as humans. For that purpose, we measured BMD (bone mineral density......) by DXA scanning (g/cm(-2)) in 15 age and weight normalized sledge dog (Canis familiaris) bitches and their 26 pups divided into a control group (n = 26) given 50-200 g/day clean pork (Suis scrofa) fat and a treated group (n = 15) given 50-200 g/day OHC polluted minke whale (Balaenoptera acutorostrata...... using the present time frame and OHC concentrations (threshold levels not reached), or the difference in food composition (mainly vitamins and n3 fatty acids) conceal the potential OHC impact on BMD. Such information is important when evaluating the positive and negative health consequences from eating...

  17. Organohalogens in A Whale-Blubber-Supplemented Diet Affects Hepatic Retinol and Renal Tocopherol Concentrations in Greenland Sled Dogs (Canis familiaris)

    DEFF Research Database (Denmark)

    Kirkegaard, M.; Sonne, C.; Jakobsen, Jette;

    2010-01-01

    The aim of this study was to examine the plasma, liver, and kidney status of vitamin A (retinol) and vitamin E (-tocopherol) in two groups of Greenland sled dogs (Canis familiaris), with a total number of 16 bitches and 8 pups. The dogs were fed either minke whale (Balaenoptera acuterostrata...... polychlorinated biphenyls [PCB]). Retinol was approximately 18% and -tocopherol 22% higher in the diet of the exposed dogs compared to controls. In adipose tissue, mean of sigma OHC was 92 ng/g lipid weight (lw) and 5005 ng/g lw for all control (n = 12) and exposed dogs (n = 10), respectively. Hepatic retinol...... observed between kidney retinol and sigma-chlordane-related compounds (sigma CHL) and dieldrin concentrations. Hepatic -tocopherol concentrations were significantly lower in exposed compared to controls, most likely due to a combination by OHC exposure and high dietary intake of unsaturated fatty acids...

  18. Effects of the Dog-Human Relationship on Problem-Solving Strategies in the Domestic Dog (Canis familiaris)

    OpenAIRE

    Cook, Amy

    2013-01-01

    Dogs (Canis familiaris) are strongly responsive to human influence in general, and they also readily form preferences for specific humans, yet these lines of inquiry have not often been combined. The goal of this dissertation was to advance a more specific theory regarding the nature of the dog-human bond - that it is one characterized by dependency - and to investigate whether such bonds would influence dogs to use social strategies to solve non-social problems.In Chapter 1, I describe the f...

  19. Alfaxalone Anaesthesia Facilitates Electrophysiological Recordings of Nociceptive Withdrawal Reflexes in Dogs (Canis familiaris.

    Directory of Open Access Journals (Sweden)

    James Hunt

    Full Text Available Naturally occurring canine osteoarthritis represents a welfare issue for affected dogs (Canis familiaris, but is also considered very similar to human osteoarthritis and has therefore been proposed as a model of disease in humans. Central sensitisation is recognized in human osteoarthritis sufferers but identification in dogs is challenging. Electromyographic measurement of responses to nociceptive stimulation represents a potential means of investigating alterations in central nociceptive processing, and has been evaluated in conscious experimental dogs, but is likely to be aversive. Development of a suitable anaesthetic protocol in experimental dogs, which facilitated electrophysiological nociceptive withdrawal reflex assessment, may increase the acceptability of using the technique in owned dogs with naturally occurring osteoarthritis. Seven purpose bred male hound dogs underwent electromyographic recording sessions in each of three states: acepromazine sedation, alfaxalone sedation, and alfaxalone anaesthesia. Electromyographic responses to escalating mechanical and electrical, and repeated electrical, stimuli were recorded. Subsequently the integral of both early and late rectified responses was calculated. Natural logarithms of the integral values were analysed within and between the three states using multi level modeling. Alfaxalone increased nociceptive thresholds and decreased the magnitude of recorded responses, but characteristics of increasing responses with increasing stimulus magnitude were preserved. Behavioural signs of anxiety were noted in two out of seven dogs during recordings in the acepromazine sedated state. There were few significant differences in response magnitude or nociceptive threshold between the two alfaxalone states. Following acepromazine premedication, induction of anaesthesia with 1-2 mg kg-1 alfaxalone, followed by a continuous rate infusion in the range 0.075-0.1 mg kg-1 min-1 produced suitable conditions

  20. Alfaxalone Anaesthesia Facilitates Electrophysiological Recordings of Nociceptive Withdrawal Reflexes in Dogs (Canis familiaris).

    Science.gov (United States)

    Hunt, James; Murrell, Jo; Knazovicky, David; Harris, John; Kelly, Sara; Knowles, Toby G; Lascelles, B Duncan X

    2016-01-01

    Naturally occurring canine osteoarthritis represents a welfare issue for affected dogs (Canis familiaris), but is also considered very similar to human osteoarthritis and has therefore been proposed as a model of disease in humans. Central sensitisation is recognized in human osteoarthritis sufferers but identification in dogs is challenging. Electromyographic measurement of responses to nociceptive stimulation represents a potential means of investigating alterations in central nociceptive processing, and has been evaluated in conscious experimental dogs, but is likely to be aversive. Development of a suitable anaesthetic protocol in experimental dogs, which facilitated electrophysiological nociceptive withdrawal reflex assessment, may increase the acceptability of using the technique in owned dogs with naturally occurring osteoarthritis. Seven purpose bred male hound dogs underwent electromyographic recording sessions in each of three states: acepromazine sedation, alfaxalone sedation, and alfaxalone anaesthesia. Electromyographic responses to escalating mechanical and electrical, and repeated electrical, stimuli were recorded. Subsequently the integral of both early and late rectified responses was calculated. Natural logarithms of the integral values were analysed within and between the three states using multi level modeling. Alfaxalone increased nociceptive thresholds and decreased the magnitude of recorded responses, but characteristics of increasing responses with increasing stimulus magnitude were preserved. Behavioural signs of anxiety were noted in two out of seven dogs during recordings in the acepromazine sedated state. There were few significant differences in response magnitude or nociceptive threshold between the two alfaxalone states. Following acepromazine premedication, induction of anaesthesia with 1-2 mg kg-1 alfaxalone, followed by a continuous rate infusion in the range 0.075-0.1 mg kg-1 min-1 produced suitable conditions to enable assessment

  1. The effect of oxytocin on biological motion perception in dogs (Canis familiaris).

    Science.gov (United States)

    Kovács, Krisztina; Kis, Anna; Kanizsár, Orsolya; Hernádi, Anna; Gácsi, Márta; Topál, József

    2016-05-01

    Recent studies have shown that the neuropeptide oxytocin is involved in the regulation of several complex human social behaviours. There is, however, little research on the effect of oxytocin on basic mechanisms underlying human sociality, such as the perception of biological motion. In the present study, we investigated the effect of oxytocin on biological motion perception in dogs (Canis familiaris), a species adapted to the human social environment and thus widely used to model many aspects of human social behaviour. In a within-subjects design, dogs (N = 39), after having received either oxytocin or placebo treatment, were presented with 2D projection of a moving point-light human figure and the inverted and scrambled version of the same movie. Heart rate (HR) and heart rate variability (HRV) were measured as physiological responses, and behavioural response was evaluated by observing dogs' looking time. Subjects were also rated on the personality traits of Neuroticism and Agreeableness by their owners. As expected, placebo-pretreated (control) dogs showed a spontaneous preference for the biological motion pattern; however, there was no such preference after oxytocin pretreatment. Furthermore, following the oxytocin pretreatment female subjects looked more at the moving point-light figure than males. The individual variations along the dimensions of Agreeableness and Neuroticism also modulated dogs' behaviour. Furthermore, HR and HRV measures were affected by oxytocin treatment and in turn played a role in subjects' looking behaviour. We discuss how these findings contribute to our understanding of the neurohormonal regulatory mechanisms of human (and non-human) social skills. PMID:26742930

  2. Alfaxalone Anaesthesia Facilitates Electrophysiological Recordings of Nociceptive Withdrawal Reflexes in Dogs (Canis familiaris).

    Science.gov (United States)

    Hunt, James; Murrell, Jo; Knazovicky, David; Harris, John; Kelly, Sara; Knowles, Toby G; Lascelles, B Duncan X

    2016-01-01

    Naturally occurring canine osteoarthritis represents a welfare issue for affected dogs (Canis familiaris), but is also considered very similar to human osteoarthritis and has therefore been proposed as a model of disease in humans. Central sensitisation is recognized in human osteoarthritis sufferers but identification in dogs is challenging. Electromyographic measurement of responses to nociceptive stimulation represents a potential means of investigating alterations in central nociceptive processing, and has been evaluated in conscious experimental dogs, but is likely to be aversive. Development of a suitable anaesthetic protocol in experimental dogs, which facilitated electrophysiological nociceptive withdrawal reflex assessment, may increase the acceptability of using the technique in owned dogs with naturally occurring osteoarthritis. Seven purpose bred male hound dogs underwent electromyographic recording sessions in each of three states: acepromazine sedation, alfaxalone sedation, and alfaxalone anaesthesia. Electromyographic responses to escalating mechanical and electrical, and repeated electrical, stimuli were recorded. Subsequently the integral of both early and late rectified responses was calculated. Natural logarithms of the integral values were analysed within and between the three states using multi level modeling. Alfaxalone increased nociceptive thresholds and decreased the magnitude of recorded responses, but characteristics of increasing responses with increasing stimulus magnitude were preserved. Behavioural signs of anxiety were noted in two out of seven dogs during recordings in the acepromazine sedated state. There were few significant differences in response magnitude or nociceptive threshold between the two alfaxalone states. Following acepromazine premedication, induction of anaesthesia with 1-2 mg kg-1 alfaxalone, followed by a continuous rate infusion in the range 0.075-0.1 mg kg-1 min-1 produced suitable conditions to enable assessment

  3. Diagnóstico histopatológico de arterioesclerosis en perros (Canis lupus familiaris

    Directory of Open Access Journals (Sweden)

    Héctor Rubén Ávila Adarme

    2016-06-01

    Full Text Available La arterioesclerosis es el endurecimiento de las arterias debido a cambios en las estructuras histológicas de la pared vascular, como hipertrofia muscular, tejido conectivo, depósito de calcio, lípidos, etc. La ateroesclerosis se caracteriza por la formación de placas fibrosas en la íntima, que a menudo tiene un núcleo central rico en lípidos; esta patología es el tipo más común de arterioesclerosis en la especie humana y, por lo tanto, de gran importancia para su estudio. Algunos autores reportan que la arterioesclerosis es común, pero de poca importancia en animales domésticos; además encasillan al perro (Canis lupus familiaris como aterorresistente. Sin embargo, en la actualidad son varios los reportes de lesiones vasculares similares a las observadas en humanos, que están relacionadas con la estrecha convivencia en su papel de mascota. Por tanto, la presente investigación se enfoca en la búsqueda y descripción de lesiones histopatológicas concernientes a arterioesclerosis en perros, mediante un estudio retrospectivo de la casuística del Laboratorio de Patología Veterinaria de la Universidad Nacional de Colombia. Después de revisar los informes de necropsia e histopatología, se seleccionaron 52 casos de perros que reportaban uno o varios factores predisponentes para el desarrollo de arterioesclerosis; las láminas histopatológicas fueron inicialmente evaluadas con la tinción de hematoxilina y eosina y se capturaron fotomicrografías de utilidad para futuras investigaciones. En 23 de los 52 casos seleccionados se observaron diferentes características de lesiones relacionadas con esta entidad, como vacuolas translúcidas, paredes de aspecto hialino, proliferación de tejido muscular o conectivo y deposiciones de mineral y pigmentos. Adicionalmente, en algunos casos se utilizó la coloración tricrómica de Masson para confirmar la presencia de tejido conectivo y muscular. Por último, se plantearon hipótesis sobre la

  4. Enteric Parasitic in canines (Canis familiaris in the urban area of Coroico, Nor Yungas department of La Paz Bolivia

    Directory of Open Access Journals (Sweden)

    Llanos Mariana

    2010-10-01

    Full Text Available A wide variety species of intestinal protozoa and helminthes are pathogen for the domestic animals. Between April and November 2009, a study was done with the purpose of determining the enteric parasitic infection in dogs (Cannis familiaris, 96 dogs (58 males and 38 females with owner of 10 species, one hybrid, eight age groups in two seasons of the urban area of the Coroico town, Nor Yungas, department of La Paz, Bolivia. The coproparasitology diagnostic was made by direct examination, with the Willis-Molloy flotation simple technique with a solution oversaturated of sodium chloride. It was detected one or more species of helminthes and protozoa, was used the chi-square and descriptive method for the statistical analysis. The results were: from the 96 sampled dogs, in 87% is present at less one type of parasitic shape, were identify: Ancylostoma spp, Toxocara canis, Strogyloides spp, Giardia spp, Isospora canis, Trichuris vulpis, Ancylostoma spp/Uncinaria spp and Dipylidium caninum. The evaluation by season show a (p ≤ 0,05 for the Giardia spp. In a humidity season, but not for a dry season, the rest of parasites can be found in both seasons. By sex in a humidity season T.canis in females 43% and 22% in males, in dry season by sex was found T.vulpis in female with a high frequency (p ≤ 0,05, the rest of parasites do not show statistic differences in both seasons. By age in dry season T. canis and Stronyiloides sp. prevails 1-24 months and 49-72 months respectively, in a humidity season T. canis prevails in the same age (p ≤ 0,05. By race in dry season Ancylostoma spp Uncinaria spp prevails in the race Pekingese, in humidity season Strongyloides sp prevails in the Cocker race. Prevail in both seasons A. canis y T. canis. In relation to the mono-parasitism and multi-parasitism, was viewed, in both seasons the dogs multi-parasitism are more than the mono-parasitism.

  5. First evidence of hybridization between golden jackal (Canis aureus) and domestic dog (Canis familiaris) as revealed by genetic markers

    OpenAIRE

    Galov, Ana; Fabbri, Elena; Caniglia, Romolo; Arbanasić, Haidi; Lapalombella, Silvana; Florijančić, Tihomir; Bošković, Ivica; Galaverni, Marco; Randi, Ettore

    2015-01-01

    Interspecific hybridization is relatively frequent in nature and numerous cases of hybridization between wild canids and domestic dogs have been recorded. However, hybrids between golden jackals (Canis aureus) and other canids have not been described before. In this study, we combined the use of biparental (15 autosomal microsatellites and three major histocompatibility complex (MHC) loci) and uniparental (mtDNA control region and a Y-linked Zfy intron) genetic markers to assess the admixed o...

  6. Coyote (Canis latrans) and domestic dog (Canis familiaris) mortality and morbidity due to a Karenia brevis red tide in the Gulf of Mexico.

    Science.gov (United States)

    Castle, Kevin T; Flewelling, Leanne J; Bryan, John; Kramer, Adam; Lindsay, James; Nevada, Cheyenne; Stablein, Wade; Wong, David; Landsberg, Jan H

    2013-10-01

    In October 2009, during a Karenia brevis red tide along the Texas coast, millions of dead fish washed ashore along the 113-km length of Padre Island National Seashore (PAIS). Between November 2009 and January 2010, at least 12 coyotes (Canis latrans) and three domestic dogs (Canis familiaris) died or were euthanized at PAIS or local veterinary clinics because of illness suspected to be related to the red tide. Another red tide event occurred during autumn 2011 and, although fewer dead fish were observed relative to the 2009 event, coyotes again were affected. Staff at PAIS submitted carcasses of four coyotes and one domestic dog from November 2009 to February 2010 and six coyotes from October to November 2011 for necropsy and ancillary testing. High levels of brevetoxins (PbTxs) were measured by enzyme-linked immunosorbent assay in seven of the coyotes and the dog, with concentrations up to 634 ng PbTx-3 eq/g in stomach contents, 545 ng PbTx-3 eq/g in liver, 195 ng PbTx-3 eq/g in kidney, and 106 ng PbTx-3 eq/mL in urine samples. Based on red tide presence, clinical signs, and postmortem findings, brevetoxicosis caused by presumptive ingestion of toxic dead fish was the likely cause of canid deaths at PAIS. These findings represent the first confirmed report of terrestrial mammalian wildlife mortalities related to a K. brevis bloom. The implications for red tide impacts on terrestrial wildlife populations are a potentially significant but relatively undocumented phenomenon.

  7. Who are the real bird brains? Qualitative differences in behavioral flexibility between dogs (Canis familiaris) and pigeons (Columba livia).

    Science.gov (United States)

    Laude, Jennifer R; Pattison, Kristina F; Rayburn-Reeves, Rebecca M; Michler, Daniel M; Zentall, Thomas R

    2016-01-01

    Pigeons given a simultaneous spatial discrimination reversal, in which a single reversal occurs at the midpoint of each session, consistently show anticipation prior to the reversal as well as perseveration after the reversal, suggesting that they use a less effective cue (time or trial number into the session) than what would be optimal to maximize reinforcement (local feedback from the most recent trials). In contrast, rats (Rattus norvegicus) and humans show near-optimal reversal learning on this task. To determine whether this is a general characteristic of mammals, in the present research, pigeons (Columba livia) and dogs (Canis familiaris) were tested with a simultaneous spatial discrimination mid-session reversal. Overall, dogs performed the task more poorly than pigeons. Interestingly, both pigeons and dogs employed what resembled a timing strategy. However, dogs showed greater perseverative errors, suggesting that they may have relatively poorer working memory and inhibitory control with this task. The greater efficiency shown by pigeons with this task suggests they are better able to time and use the feedback from their preceding choice as the basis of their future choice, highlighting what may be a qualitative difference between the species.

  8. Physiologically-based pharmacokinetic modelling of distribution, bioaccumulation and excretion of POPs in Greenland sledge dogs (Canis familiaris).

    Science.gov (United States)

    Sonne, Christian; Gustavson, Kim; Letcher, Robert J; Dietz, Rune

    2015-10-01

    We used PBPK (physiologically-based pharmacokinetic) modelling to investigate distribution, bioaccumulation and excretion of the seven POPs (persistent organic pollutants) CB-99, CB-153, HCB, oxychlordane, p,p'-DDE, BDE-47 and BDE-99 in 4 adult captive Greenland sledge dog (Canis familiaris) bitches fed minke whale (Balaenoptera acuterostrata) blubber for 500-635 days. The PBPK modelled POP concentrations in adipose tissue, liver, kidney and plasma were mostly within a factor 2 of actual measured tissue levels even for those at the lower concentration end. The excretion route for oxychlordane and CB-153 was modelled to be via faeces while lung alveolar excretion dominated for BDE-47, BDE-99, HCB, p,p'-DDE and CB-99. Furthermore the model suggested the retained mass of POPs after 500 and 635 days of exposure, respectively, to be relatively low despite these POPs being highly recalcitrant. The retention increased in the following order (% of total intake); p,p'-DDE (1%)tool in risk assessment of POPs in arctic mammals. PMID:26210746

  9. First evidence of hybridization between golden jackal (Canis aureus) and domestic dog (Canis familiaris) as revealed by genetic markers

    Science.gov (United States)

    Fabbri, Elena; Caniglia, Romolo; Arbanasić, Haidi; Lapalombella, Silvana; Florijančić, Tihomir; Bošković, Ivica; Galaverni, Marco

    2015-01-01

    Interspecific hybridization is relatively frequent in nature and numerous cases of hybridization between wild canids and domestic dogs have been recorded. However, hybrids between golden jackals (Canis aureus) and other canids have not been described before. In this study, we combined the use of biparental (15 autosomal microsatellites and three major histocompatibility complex (MHC) loci) and uniparental (mtDNA control region and a Y-linked Zfy intron) genetic markers to assess the admixed origin of three wild-living canids showing anomalous phenotypic traits. Results indicated that these canids were hybrids between golden jackals and domestic dogs. One of them was a backcross to jackal and another one was a backcross to dog, confirming that golden jackal–domestic dog hybrids are fertile. The uniparental markers showed that the direction of hybridization, namely females of the wild species hybridizing with male domestic dogs, was common to most cases of canid hybridization. A melanistic 3bp-deletion at the K locus (β-defensin CDB103 gene), that was absent in reference golden jackal samples, but was found in a backcross to jackal with anomalous black coat, suggested its introgression from dogs via hybridization. Moreover, we demonstrated that MHC sequences, although rarely used as markers of hybridization, can be also suitable for the identification of hybrids, as long as haplotypes are exclusive for the parental species. PMID:27019731

  10. First evidence of hybridization between golden jackal (Canis aureus) and domestic dog (Canis familiaris) as revealed by genetic markers.

    Science.gov (United States)

    Galov, Ana; Fabbri, Elena; Caniglia, Romolo; Arbanasić, Haidi; Lapalombella, Silvana; Florijančić, Tihomir; Bošković, Ivica; Galaverni, Marco; Randi, Ettore

    2015-12-01

    Interspecific hybridization is relatively frequent in nature and numerous cases of hybridization between wild canids and domestic dogs have been recorded. However, hybrids between golden jackals (Canis aureus) and other canids have not been described before. In this study, we combined the use of biparental (15 autosomal microsatellites and three major histocompatibility complex (MHC) loci) and uniparental (mtDNA control region and a Y-linked Zfy intron) genetic markers to assess the admixed origin of three wild-living canids showing anomalous phenotypic traits. Results indicated that these canids were hybrids between golden jackals and domestic dogs. One of them was a backcross to jackal and another one was a backcross to dog, confirming that golden jackal-domestic dog hybrids are fertile. The uniparental markers showed that the direction of hybridization, namely females of the wild species hybridizing with male domestic dogs, was common to most cases of canid hybridization. A melanistic 3bp-deletion at the K locus (β-defensin CDB103 gene), that was absent in reference golden jackal samples, but was found in a backcross to jackal with anomalous black coat, suggested its introgression from dogs via hybridization. Moreover, we demonstrated that MHC sequences, although rarely used as markers of hybridization, can be also suitable for the identification of hybrids, as long as haplotypes are exclusive for the parental species. PMID:27019731

  11. Helminths parasites of stray dogs (Canis lupus familiaris from Cuiabá, Midwestern of Brazil

    Directory of Open Access Journals (Sweden)

    Dirceu Guilherme de Souza Ramos

    2015-04-01

    Full Text Available Helminths cause respiratory and gastrointestinal infections in animals, especially in neonates and young animals. Some species of helminth parasites of domestic animals have zoonotic potential, becoming a public health problem, especially when combined with lack of information about the population of these zoonosis and lack of control over of their hosts. This study aimed to identify and quantify the species of helminths from dogs that are not domiciled in the region of Cuiabá, in the Midwest region of Brazil. A total of 100 animals, from the Center for Zoonosis Control of Cuiabá were euthanized and necropsied for helminth searching. Overall 8,217 helminths were found in 85 animals identified in six species: Ancylostoma caninum, Ancylostoma. braziliense, Trichuris vulpis, Toxocara canis, Dirofilaria immitis and Dipylidium caninum. It was evidenced the wide distribution of helminths pathogenic to domestic dogs and especially with zoonotic potential as A. caninum, T. canis, D. caninum and D. immitis. The presence of D. immitis is an important finding, since it is a potentially zoonotic agent, however, this finding is considered sporadic.

  12. Can Sleep and Resting Behaviours Be Used as Indicators of Welfare in Shelter Dogs (Canis lupus familiaris)?

    Science.gov (United States)

    Owczarczak-Garstecka, Sara C.; Burman, Oliver H. P.

    2016-01-01

    Previous research on humans and animals suggests that the analysis of sleep patterns may reliably inform us about welfare status, but little research of this kind has been carried out for non-human animals in an applied context. This study explored the use of sleep and resting behaviour as indicators of welfare by describing the activity patterns of dogs (Canis lupus familiaris) housed in rescue shelters, and comparing their sleep patterns to other behavioural and cognitive measures of welfare. Sleep and activity patterns were observed over five non-consecutive days in a population of 15 dogs. Subsequently, the characteristics of sleep and resting behaviour were described and the impact of activity on patterns of sleep and resting behaviour analysed. Shelter dogs slept for 2.8% of the day, 14.3% less than previously reported and experienced less sleep fragmentation at night (32 sleep bouts). There were no statistically significant relationships between behaviours exhibited during the day and sleep behaviour. A higher proportion of daytime resting behaviour was significantly associated with a positive judgement bias, less repetitive behaviour and increased time spent coded as ‘relaxed’ across days by shelter staff. These results suggest that, in the context of a busy shelter environment, the ability to rest more during the day could be a sign of improved welfare. Considering the non-linear relationship between sleep and welfare in humans, the relationship between sleep and behavioural indicators of welfare, including judgement bias, in shelter dogs may be more complex than this study could detect. PMID:27732667

  13. Expression of Doublecortin (DCX)in Young Canis Familiaris Brain%微管相关蛋白在幼犬脑组织的表达

    Institute of Scientific and Technical Information of China (English)

    李明; 高俊彦; 吴海平; 李建忠; 武志兵; 刘学敏

    2015-01-01

    目的::探讨微管相关蛋白(Doublecortin)在幼犬脑组织不同部位的表达,进一步研究出生后家犬神经发生和神经元迁移机制。方法:4只出生后幼犬给以正常饮食饲养2周,4%多聚甲醛溶液灌注取脑,通过免疫组织化学方法检测微管蛋白在幼犬脑皮层、室管膜下区、白质和海马的分布表达情况,观察不同部位新生神经元的形态和突起的伸展走行分布。结果:微管蛋白在脑皮层、室管膜下区、白质和海马均有分布,室管膜下区和海马齿状回表达最高,神经元突起表达明显,伸展方向较为一致,朝向大脑皮层。脑皮层第Ⅱ层以下层面均有表达。结论:家犬出生后早期脑组织仍有新生神经元产生,神经元生发区位于室管膜下区和海马齿状回,室管膜下区和齿状回新生神经元在迁移的过程中分化成熟,最终迁移至脑皮层,完成神经系统发育。%Objective:To study the expression of Doublecortin in the brain of young canis familiaris,and further explore the neurogenesis and neuron migration mechanisms of canis familiaris at early stage.Methods:4 postnatal young canis familiaris were fed with normal diet for 2 weeks.The brains were extracted by 4% paraformaldehyde solution perfusion.The expression and distribution of Doublecortin in cerebral cortex,subependymal zone,brain white matter and dentate gyrus were detected by immunohistochemistry;the morphology and distribution of newly-born neurons and neurite were observed in different brain regions.Results:Doublecortin are expressed in cerebral cortex,subependymal zone,brain white matter and dentate gyrus;the highest expression level appeared in subependymal zone and dentate gyrus.Neurite were dis-tinctively stained,and stretched consistently to the cerebral cortex.Doublecortin were expressed extensively in layerⅡand below the layerⅡof the cerebral cortex.Conclusion:At the postnatal early stage,abundant newly-born neurons still

  14. Electrochemistry of Canis familiaris cytochrome P450 2D15 with gold nanoparticles: An alternative to animal testing in drug discovery.

    Science.gov (United States)

    Rua, Francesco; Sadeghi, Sheila J; Castrignanò, Silvia; Valetti, Francesca; Gilardi, Gianfranco

    2015-10-01

    This work reports for the first time the direct electron transfer of the Canis familiaris cytochrome P450 2D15 on glassy carbon electrodes to provide an analytical tool as an alternative to P450 animal testing in the drug discovery process. Cytochrome P450 2D15, that corresponds to the human homologue P450 2D6, was recombinantly expressed in Escherichia coli and entrapped on glassy carbon electrodes (GC) either with the cationic polymer polydiallyldimethylammonium chloride (PDDA) or in the presence of gold nanoparticles (AuNPs). Reversible electrochemical signals of P450 2D15 were observed with calculated midpoint potentials (E1/2) of −191 ± 5 and −233 ± 4 mV vs. Ag/AgCl for GC/PDDA/2D15 and GC/AuNPs/2D15, respectively. These experiments were then followed by the electro-catalytic activity of the immobilized enzyme in the presence of metoprolol. The latter drug is a beta-blocker used for the treatment of hypertension and is a specific marker of the human P450 2D6 activity. Electrocatalysis data showed that only in the presence of AuNps the expected α-hydroxy-metoprolol product was present as shown by HPLC. The successful immobilization of the electroactive C. familiaris cytochrome P450 2D15 on electrode surfaces addresses the ever increasing demand of developing alternative in vitromethods for amore detailed study of animal P450 enzymes' metabolism, reducing the number of animals sacrificed in preclinical tests. PMID:26092534

  15. Electrochemistry of Canis familiaris cytochrome P450 2D15 with gold nanoparticles: An alternative to animal testing in drug discovery.

    Science.gov (United States)

    Rua, Francesco; Sadeghi, Sheila J; Castrignanò, Silvia; Valetti, Francesca; Gilardi, Gianfranco

    2015-10-01

    This work reports for the first time the direct electron transfer of the Canis familiaris cytochrome P450 2D15 on glassy carbon electrodes to provide an analytical tool as an alternative to P450 animal testing in the drug discovery process. Cytochrome P450 2D15, that corresponds to the human homologue P450 2D6, was recombinantly expressed in Escherichia coli and entrapped on glassy carbon electrodes (GC) either with the cationic polymer polydiallyldimethylammonium chloride (PDDA) or in the presence of gold nanoparticles (AuNPs). Reversible electrochemical signals of P450 2D15 were observed with calculated midpoint potentials (E1/2) of −191 ± 5 and −233 ± 4 mV vs. Ag/AgCl for GC/PDDA/2D15 and GC/AuNPs/2D15, respectively. These experiments were then followed by the electro-catalytic activity of the immobilized enzyme in the presence of metoprolol. The latter drug is a beta-blocker used for the treatment of hypertension and is a specific marker of the human P450 2D6 activity. Electrocatalysis data showed that only in the presence of AuNps the expected α-hydroxy-metoprolol product was present as shown by HPLC. The successful immobilization of the electroactive C. familiaris cytochrome P450 2D15 on electrode surfaces addresses the ever increasing demand of developing alternative in vitromethods for amore detailed study of animal P450 enzymes' metabolism, reducing the number of animals sacrificed in preclinical tests.

  16. Point Topography and Within-Session Learning Are Important Predictors of Pet Dogs’ (Canis lupus familiaris Performance on Human Guided Tasks

    Directory of Open Access Journals (Sweden)

    Dorey, Nicole R.

    2013-07-01

    Full Text Available Pet domestic dogs (Canis lupus familiaris are generally considered successful on object choice tasks, reliably following human points to a target. However, defining the specific topography of the point types utilized and assessing the potential for dogs to generalize their responses across similar point types has received little attention. In Experiment 1, we assessed pet dogs’ performance on an object choice task utilizing nine different point types that varied across the dimensions of movement, duration, and distance. These dimensions reliably predicted the performance of pet dogs on this task. In Experiment 2, pet dogs presented with nine different point types in the order of increasing difficulty performed better on more difficult point types than both naive dogs and dogs experiencing the nine points in the order of decreasing difficulty. In Experiment 3, we manipulated the attentional state of the experimenter (as in perspective taking studies and found that human orientation was not a strong predictor of performance on pointing tasks. The results of this study indicate that dogs do not reliably follow all point types without additional training or experience. Furthermore, dogs appear to continuously learn about the dimensions of human points, adjusting their behavior accordingly, even over the course of experimental testing. These findings bring claims of pet dogs’ spontaneous success on pointing tasks into question. The ability to learn about, and respond flexibly to, human gestures may benefit pet dogs living in human homes more than a spontaneous responsiveness to specific gesture types.

  17. Sarcocystis caninum and Sarcocystis svanai n. spp. (Apicomplexa: Sarcocystidae) Associated with Severe Myositis and Hepatitis in the Domestic Dog (Canis familiaris).

    Science.gov (United States)

    Dubey, Jitender P; Sykes, Jane E; Shelton, G Diane; Sharp, Nick; Verma, Shiv K; Calero-Bernal, Rafael; Viviano, Jenifer; Sundar, Natarajan; Khan, Asis; Grigg, Michael E

    2015-01-01

    There are several reports of Sarcocystis sarcocysts in muscles of dogs, but these species have not been named. Additionally, there are two reports of Sarcocystis neurona in dogs. Here, we propose two new names, Sarcocystis caninum, and Sarcocystis svanai for sarcocysts associated with clinical muscular sarcocystosis in four domestic dogs (Canis familiaris), one each from Montana and Colorado in the USA, and two from British Columbia, Canada. Only the sarcocyst stage was identified. Most of the sarcocysts identified were S. caninum. Sarcocysts were studied using light microscopy, transmission electron microscopy (TEM), and polymerase chain reaction. Based on collective results two new species, S. caninum and S. svanai were designated. Sarcocystis caninum and S. svanai were structurally distinct. Sarcocystis caninum sarcocysts were up to 1.2 mm long and up to 75 μm wide. By light microscopy, the sarcocyst wall was relatively thin and smooth. By TEM, the sarcocyst wall was "type 9", 1-2 μm thick, and contained villar protrusions that lacked microtubules. Bradyzoites in sections were 7-9 μm long. Sarcocysts of S. svanai were few and were identified by TEM. Sarcocystis svanai sarcocysts were "type 1", thin walled (< 0.5 μm), and the wall lacked villar protrusions but had tiny blebs that did not invaginate. DNA was extracted either from infected frozen muscle biopsies or formalin-fixed paraffin-embedded sections. Dogs were either singly infected with S. caninum or multiply co-infected with S. caninum and S. svanai (the result of a mixed infection) based on multilocus DNA sequencing and morphology. BLASTn analysis established that the sarcocysts identified in these dogs were similar to, but not identical to Sarcocystis canis or Sarcocystis arctosi, parasites found to infect polar bears (Ursus maritimus) or brown bears (Ursus arctosi), respectively. However, the S. caninum sequence showed 100% identify over the 18S rRNA region sequenced to that of S. arctica, a

  18. Biomarkers in Canis lupus familiaris

    OpenAIRE

    Fernandes, Mónica Figueiredo

    2014-01-01

    Introdução- Os animais de companhia como o cão desempenham hoje um papel a nível familiar e social importante podendo atuar como agentes em programas terapêuticos e de socorrismo. A qualidade de vida dos animais de companhia e o correspondente impacto na saúde pública pode beneficiar com o diagnóstico precoce e a intervenção terapêutica adequada. Com a evolução das abordagens Ómicas, nomeadamente dos estudos de proteómica foi gerado um grande volume de dados que retratam ...

  19. Dietary Habits of the Golden Jackal (Canis aureus L.) in the Eastern Croatia

    OpenAIRE

    Ivica Bošković; Marcela Šperanda; Tihomir Florijančić; Nikica Šprem; Siniša Ozimec; Dražen Degmečić; Dinko Jelkić

    2013-01-01

    In the past fifteen years, a considerable increase in size of the golden jackal (Canis aureus) population has been recorded in the eastern part of Croatia. Dietary habits have been determined in the period 2008-2011 by analysing the content of 238 stomachs. Golden jackal is typical omnivorous and opportunistic forager which consumes easiest accessible food, according to season and habitat, primary animal food, such as carcasses, rodents and meat waste. Parts of big game animals were found con...

  20. Effects of glutamine combined with panthenol on intestinal injury in burned canis familiaris%谷氨酰胺联合泛醇对烧伤家犬肠道损伤的影响及机制研究

    Institute of Scientific and Technical Information of China (English)

    王裴; 赵云; 戚华兵; 彭曦; 尤忠义; 汪仕良

    2012-01-01

    目的 观察应用谷氨酰胺、泛醇及其复方制剂对减轻烧伤家犬肠道损伤的疗效并探讨其机制.方法 采用30%体表面积Ⅲ度烧伤家犬模型,动物随机分为正常对照、烧伤对照、泛醇、谷氨酰胺、泛醇+谷氨酰胺5个组,每组6只家犬,观察伤后7 d各组动物肠道损伤和修复指标.结果 烧伤家犬乙酰胆碱、肠黏膜蛋白含量明显降低,血浆二胺氯化酶(DAO)含量和损伤指数则明显增高(P<0.05),给予谷氨酰胺、泛醇以及复方药物均可明减轻烧伤后肠道损伤,降低血浆DAO活性和黏膜损伤指数(P<0.05);给予泛醇则能明显增加乙酰胆碱合成.与单方组相比,复方制剂组上述各项指标均明显优于单方组.结论 烧伤后肠道损伤明显,给予谷氨酰胺能明显减轻肠道损伤,给予泛醇能明显促进乙酰胆碱合成,促进胃肠运动,复方制剂疗效明显优于单方.%Objective To observe the effects of glutamine , panthenol and its compound preparation on lessening intestinal injury in burned canis familiaris . Methods Thirty canis familiaris were randomly divided into five groups , i. e. normal control ( C) group, burn control (B) group, glutamine group , panthenol group and its compound preparation group. Burned canis familiaris were inflicted with 30% TBSA full thickness burn injury. Observe the intestinal injury and repair post burn 7 d. Results After burn injury , the activity of plasma diamine oxidase (DAO) , intestine mucosal damage index were significantly higher , and the contents of intestine mucosal protein and plasma acetylcholine were remarkable decrease than those of C group (P < 0. 05 ). Compare with B group , the activity of plasma DAO, intestine mucosal damage index were markedly decreased in glutamine group , and the plasma acetylcholine contents was significantly increased in panthenol group . Compare with simple recipe group , there were more conspicuous therapeutic effect on compound preparation

  1. Prvky chování vlka (Canis lupus) ve vztahu k prvkům chování německého ovčáka (Canis lupus f. familiaris).

    OpenAIRE

    ZUNKOVÁ, Karolína

    2012-01-01

    The aim of my study was to compare similarities and differences in behavior among the general wolf (Canis lupus) and German Shepherd dog. My thesis is recherche. Behavior data and a comparison I gained from the literature and created questionnaires designed for breeders of German shepherds dogs. The available sources indicated that the differences between the general behavior of the wolf and German shepherd dog are given by the German Shepherd Dog domestication , environment and human impact ...

  2. Dietary Habits of the Golden Jackal (Canis aureus L. in the Eastern Croatia

    Directory of Open Access Journals (Sweden)

    Ivica Bošković

    2013-09-01

    Full Text Available In the past fifteen years, a considerable increase in size of the golden jackal (Canis aureus population has been recorded in the eastern part of Croatia. Dietary habits have been determined in the period 2008-2011 by analysing the content of 238 stomachs. Golden jackal is typical omnivorous and opportunistic forager which consumes easiest accessible food, according to season and habitat, primary animal food, such as carcasses, rodents and meat waste. Parts of big game animals were found consumed in the period of main hunting season during the winter. Small animals were frequently present in the diet during the spring and summer, in the season of breeding and cub-rearing. Meat waste originated from livestock has been consumed periodically, during the pig slaughtering season at rural households. Plant material occurred occasionally in diet of the golden jackal, depending on time of crop harvest or ripening of fruits. There is no conflict between golden jackal and sectors of livestock and agriculture in the eastern Croatia.

  3. Do dogs (Canis lupus familiaris) prefer family?

    Science.gov (United States)

    Hamilton, Jennifer; Vonk, Jennifer

    2015-10-01

    Kin recognition requires the ability to discriminate between one's own genetic relatives and non-relatives. There are two mechanisms that aid in kin discrimination: phenotype matching and familiarity. Dogs may be a good model for assessing these mechanisms as dogs are a promiscuous social species with a keen sense of smell. Domestic dogs of both sexes were presented with two scents (close kin, distant-kin) and preference was assessed through three measures (latency to approach, number of visits, time spent). Experiment 1 explored the possibility of phenotype matching as subjects had no contact with sires, whose scent was presented alongside a control male's scent. Experiment 2 explored recognition of siblings raised with the subjects and then separated at seven weeks of age. Whereas female dogs in this experiment did not show a statistically significant preference, male dogs showed a preference for distant-kin when presented with sire and female sibling samples.

  4. Isolation of viable neospora caninum from brains of wild gray wolves (canis lupus)

    Science.gov (United States)

    Neospora caninum is a common cause of abortion in cattle worldwide. Canids, including the dog and the dingo (Canis familiaris), the coyote (Canis latrans), and the gray wolf (Canis lupus) are its definitive hosts, but also can act as intermediate hosts by harbor tissue stages of the parasite that ca...

  5. Population genetic structure of gray wolves (Canis lupus) in a marine archipelago suggests island-mainland differentiation consistent with dietary niche

    DEFF Research Database (Denmark)

    Stronen, Astrid Vik; Navid, Erin L; Quinn, Michael S;

    2014-01-01

    Background Emerging evidence suggests that ecological heterogeneity across space can influence the genetic structure of populations, including that of long-distance dispersers such as large carnivores. On the central coast of British Columbia, Canada, wolf (Canis lupus L., 1758) dietary niche and......) might contribute to genetic differentiation. Accordingly, this working hypothesis presents an exciting avenue for future research where marine resources or other components of ecological heterogeneity are present.......Background Emerging evidence suggests that ecological heterogeneity across space can influence the genetic structure of populations, including that of long-distance dispersers such as large carnivores. On the central coast of British Columbia, Canada, wolf (Canis lupus L., 1758) dietary niche...... and parasite prevalence data indicate strong ecological divergence between marine-oriented wolves inhabiting islands and individuals on the coastal mainland that interact primarily with terrestrial prey. Local holders of traditional ecological knowledge, who distinguish between mainland and island wolf forms...

  6. Effects of long-term dietary exposure to organohalogen contaminants on vitamin and hormonestatus in the Greenland Sledge dog (Canis familiaris)

    DEFF Research Database (Denmark)

    Kirkegaard, Maja

    The known overall dynamics of vitamin and endocrine disruption from organohalogen contaminants (OHCs) continue to be challenged by the constant change in complex mixtures of environmental chemical pollutants, as human desire to innovate continue. There is a great need for understanding threshold...... conducted on Greenland sledge dogs. This aimed at exploring how a diet rich in OHCs affects vitamin and hormone status in Arctic top predator mammals. The dogs were supplemented with fat containing high (exposed group: minke whale blubber) or low (control group: porcine fat) amounts of OHCs, polyunsaturated...

  7. Altered vitamin D status in liver tissue and blood plasma from Greenland sledge dogs (Canis familiaris) dietary exposed to organohalogen contaminated minke whale (Balaenoptera acuterostrata) blubber

    DEFF Research Database (Denmark)

    Sonne, Christian; Kirkegaard, Maja; Jakobsen, Jette;

    2014-01-01

    exposed and six control sister bitches (maternal generation) and their three exposed and four control pups, respectively, were daily fed 112g whale blubber (193µg ∑PCB/day) or porcine fat (0.17µg ∑PCB/day). Mean level of ∑PCB in adipose tissue of exposed bitches and their pups was 3106 and 2670ng/g lw...

  8. REVIEW ON CURRENT WORLDWIDE STATUS, DISTRIBUTION, ECOLOGY AND DIETARY HABITS OF GOLDEN JACKAL, CANIS AUREUS

    Directory of Open Access Journals (Sweden)

    Tripti Negi

    2014-12-01

    Full Text Available The golden jackal is a medium-sized predator and omnivore, with a range covering the southern parts of the Palearctic, South Asia and northeastern Africa. The entire jackal population is now confined to a few clusters grouped into 7 sub-areas with criteria such as connectivity and isolation. Causes of decline seem to be related to the limited habitat availability due to changes in human agro-pastoral activities, which resulted mainly in reduced day-cover availability and possibly reduced food base. This review summarizes the basic aspects of golden jackal distribution, ecology and dietary habits, analyses the main threats and problems of jackal management. The jackals seem to do well in moderately modified agro-systems with non- invasive human activities. Barriers for jackal expansion and population recovery seems to be the mountains with extensive high forests or unbroken scrub, heavy snowy winters and irregular food supply, large intensively cultivated areas without cover, urbanization and established wolf populations. Agro pastoral changes during the past 25-30 years has resulted in habitat and human use changes, which have largely contributed to the massive jackal population declines. Following a short introduction on phylogeny, classification, and evolutionary ecology of the Canidae, this review provides the latest information on the distribution, biology and conservation status of Canid aureus species, organized by geographical region.

  9. Comparison of coproparasitological exams and necropsy for diagnosis of gastro-intestinal helminth infection in mongrel dogs (Canis familiaris, Linnaeus, 1758 from the Metropolitan Region of Recife – state of Pernambuco – Brazil

    Directory of Open Access Journals (Sweden)

    Auxiliadora de Moraes Ostermann

    2011-06-01

    Full Text Available This work was carried out to compare the coproparasitological and necropsy exams for diagnosis of gastrointestinal helminth infection, evaluating the parasitism frequency in stray dogs captured by the Centro de Vigilância Ambiental of the city of Recife, Pernambuco. A total of 96 dogs of both sexes, with variying ages and races, were used. The animals were sacrificed and necropsied for the collection of adult helminthes. In parallel, fecal samples were collected directly from the rectum of the animals and processed using Willis’s technique and spontaneous sedimentation. The results obtained in the necropsy indicated a positivity of 96.8% (93∕96, being 83.3%, 34.4%, 30.2%, 28.1%, 14.6%, 6.3% and 2.1% for Ancylostoma caninum, Dypilidium caninum, Toxocara canis, Trichuris vulpis, Ancylostoma braziliense, Toxascaris leonina and Spirocerca lupi, respectively. Results from the Willis technique, sedimentation and necropsy were only significantly different (p<0.05 in the detection of infection by Ancylostoma spp. The Willis technique and sedimentation did notpresent any differences for the other gastrointestinal helminthes.

  10. Word generalization by a dog (Canis familiaris: is shape important?

    Directory of Open Access Journals (Sweden)

    Emile van der Zee

    Full Text Available We investigated the presence of a key feature of human word comprehension in a five year old Border Collie: the generalization of a word referring to an object to other objects of the same shape, also known as shape bias. Our first experiment confirmed a solid history of word learning in the dog, thus making it possible for certain object features to have become central in his word comprehension. Using an experimental paradigm originally employed to establish shape bias in children and human adults we taught the dog arbitrary object names (e.g. dax for novel objects. Two experiments showed that when briefly familiarized with word-object mappings the dog did not generalize object names to object shape but to object size. A fourth experiment showed that when familiarized with a word-object mapping for a longer period of time the dog tended to generalize the word to objects with the same texture. These results show that the dog tested did not display human-like word comprehension, but word generalization and word reference development of a qualitatively different nature compared to humans. We conclude that a shape bias for word generalization in humans is due to the distinct evolutionary history of the human sensory system for object identification and that more research is necessary to confirm qualitative differences in word generalization between humans and dogs.

  11. Word generalization by a dog (Canis familiaris): is shape important?

    Science.gov (United States)

    van der Zee, Emile; Zulch, Helen; Mills, Daniel

    2012-01-01

    We investigated the presence of a key feature of human word comprehension in a five year old Border Collie: the generalization of a word referring to an object to other objects of the same shape, also known as shape bias. Our first experiment confirmed a solid history of word learning in the dog, thus making it possible for certain object features to have become central in his word comprehension. Using an experimental paradigm originally employed to establish shape bias in children and human adults we taught the dog arbitrary object names (e.g. dax) for novel objects. Two experiments showed that when briefly familiarized with word-object mappings the dog did not generalize object names to object shape but to object size. A fourth experiment showed that when familiarized with a word-object mapping for a longer period of time the dog tended to generalize the word to objects with the same texture. These results show that the dog tested did not display human-like word comprehension, but word generalization and word reference development of a qualitatively different nature compared to humans. We conclude that a shape bias for word generalization in humans is due to the distinct evolutionary history of the human sensory system for object identification and that more research is necessary to confirm qualitative differences in word generalization between humans and dogs. PMID:23185321

  12. Quantity discrimination in wolves (Canis lupus

    Directory of Open Access Journals (Sweden)

    Ewelina eUtrata

    2012-11-01

    Full Text Available Quantity discrimination has been studied extensively in different non-human animal species. In the current study, we tested eleven hand-raised wolves (Canis lupus in a two-way choice task. We placed a number of food items (one to four sequentially into two opaque cans and asked the wolves to choose the larger amount. Moreover, we conducted two additional control conditions to rule out non-numerical properties of the presentation that the animals might have used to make the correct choice. Our results showed that wolves are able to make quantitative judgments at the group, but also at the individual level even when alternative strategies such as paying attention to the surface area or time and total amount are ruled out. In contrast to previous canine studies on dogs (Canis familiaris and coyotes (Canis latrans, our wolves’ performance did not improve with decreasing ratio, referred to as Weber’s law. However, further studies using larger quantities than we used in the current setup are still needed to determine whether and when wolves’ quantity discrimination conforms to Weber’s law.

  13. Basic aspects of scintiphotography for the encephalopathy studies in Canis familiaris L.; Bases fotocintilograficas para o estudo das encefalopatias em Canis familiaris L.

    Energy Technology Data Exchange (ETDEWEB)

    Ramadinha, L.S.

    1988-12-31

    The development of encephalic scintillography on dogs using intravenous administered radiotracer, was presented. The study was conducted by administrating 20 m Cu/99 mTc pertechnetate into the radial vein of 14 normal dogs; the tracer was detected externally on the encephalus using a computerized gamma camera. The static pictures were easily obtained in 4 standard positions and presents good information about encephalic morphology. (author). 29 refs, 15 figs, 3 tabs.

  14. Assessing inbreeding and loss of genetic variation in canids, domestic dog (Canis familiaris) and wolf (Canis lupus), using pedigree data

    OpenAIRE

    Jansson, Mija

    2014-01-01

    Genetic variation is necessary to maintain the ability of wild and domestic populations to genetically adapt to changed selective pressures. When relationships among individuals are known, conservation genetic management can be based on statistical pedigree analysis. Such approaches have traditionally focused on wild animal conservation breeding in captivity. In this thesis, I apply pedigree-based techniques to domestic and wild animal populations, focusing on two canids – the domestic dog an...

  15. Oxytocin receptor gene polymorphisms are associated with human directed social behavior in dogs (Canis familiaris.

    Directory of Open Access Journals (Sweden)

    Anna Kis

    Full Text Available The oxytocin system has a crucial role in human sociality; several results prove that polymorphisms of the oxytocin receptor gene are related to complex social behaviors in humans. Dogs' parallel evolution with humans and their adaptation to the human environment has made them a useful species to model human social interactions. Previous research indicates that dogs are eligible models for behavioral genetic research, as well. Based on these previous findings, our research investigated associations between human directed social behaviors and two newly described (-212AG, 19131AG and one known (rs8679684 single nucleotide polymorphisms (SNPs in the regulatory regions (5' and 3' UTR of the oxytocin receptor gene in German Shepherd (N = 104 and Border Collie (N = 103 dogs. Dogs' behavior traits have been estimated in a newly developed test series consisting of five episodes: Greeting by a stranger, Separation from the owner, Problem solving, Threatening approach, Hiding of the owner. Buccal samples were collected and DNA was isolated using standard protocols. SNPs in the 3' and 5' UTR regions were analyzed by polymerase chain reaction based techniques followed by subsequent electrophoresis analysis. The gene-behavior association analysis suggests that oxytocin receptor gene polymorphisms have an impact in both breeds on (i proximity seeking towards an unfamiliar person, as well as their owner, and on (ii how friendly dogs behave towards strangers, although the mediating molecular regulatory mechanisms are yet unknown. Based on these results, we conclude that similarly to humans, the social behavior of dogs towards humans is influenced by the oxytocin system.

  16. Live Births from Domestic Dog (Canis familiaris Embryos Produced by In Vitro Fertilization.

    Directory of Open Access Journals (Sweden)

    Jennifer B Nagashima

    Full Text Available Development of assisted reproductive technologies (ART in the dog has resisted progress for decades, due to their unique reproductive physiology. This lack of progress is remarkable given the critical role ART could play in conserving endangered canid species or eradicating heritable disease through gene-editing technologies-an approach that would also advance the dog as a biomedical model. Over 350 heritable disorders/traits in dogs are homologous with human conditions, almost twice the number of any other species. Here we report the first live births from in vitro fertilized embryos in the dog. Adding to the practical significance, these embryos had also been cryopreserved. Changes in handling of both gametes enabled this progress. The medium previously used to capacitate sperm excluded magnesium because it delayed spontaneous acrosome exocytosis. We found that magnesium significantly enhanced sperm hyperactivation and ability to undergo physiologically-induced acrosome exocytosis, two functions essential to fertilize an egg. Unlike other mammals, dogs ovulate a primary oocyte, which reaches metaphase II on Days 4-5 after the luteinizing hormone (LH surge. We found that only on Day 6 are oocytes consistently able to be fertilized. In vitro fertilization of Day 6 oocytes with sperm capacitated in medium supplemented with magnesium resulted in high rates of embryo development (78.8%, n = 146. Intra-oviductal transfer of nineteen cryopreserved, in vitro fertilization (IVF-derived embryos resulted in seven live, healthy puppies. Development of IVF enables modern genetic approaches to be applied more efficiently in dogs, and for gamete rescue to conserve endangered canid species.

  17. Cross modal perception of body size in domestic dogs (Canis familiaris.

    Directory of Open Access Journals (Sweden)

    Anna M Taylor

    Full Text Available While the perception of size-related acoustic variation in animal vocalisations is well documented, little attention has been given to how this information might be integrated with corresponding visual information. Using a cross-modal design, we tested the ability of domestic dogs to match growls resynthesized to be typical of either a large or a small dog to size-matched models. Subjects looked at the size-matched model significantly more often and for a significantly longer duration than at the incorrect model, showing that they have the ability to relate information about body size from the acoustic domain to the appropriate visual category. Our study suggests that the perceptual and cognitive mechanisms at the basis of size assessment in mammals have a multisensory nature, and calls for further investigations of the multimodal processing of size information across animal species.

  18. What or where? The meaning of referential human pointing for dogs (Canis familiaris).

    Science.gov (United States)

    Tauzin, Tibor; Csík, Andor; Kis, Anna; Topál, József

    2015-11-01

    Dogs have a unique capacity to follow human pointing, and thus it is often assumed that they can comprehend the referential meaning of such signals. However, it is still unclear whether dogs perceive human directional gestures as signals referring to a target object (indicating what to manipulate) or a spatial cue (indicating where to do something). In the present study, we investigated which of these alternative interpretations may explain dogs' responses to human pointing gestures in ostensive communicative and nonostensive cuing contexts. To test whether dogs select the cued object or the cued location, subjects were presented with 2 alternative object-choice trials. An experimenter first attracted the attention of the dog either by calling the dog's name and looking at it (ostensive condition, n = 24) or by clapping the hands (nonostensive condition, n = 24) then pointed at 1 of 2 different toy objects. Subsequently, the experimenter switched the location of the 2 target objects in full view of the dogs by grasping the objects and making a 180° turn. Dogs were then allowed to choose between the 2 objects. In the ostensive condition, dogs showed a significant bias toward the cued location compared with the nonostensive condition in which they performed at chance. These results suggest that pointing refers to a direction or location for dogs, but only if they are addressed with ostensive cues that indicate the communicative intention of the signaler.

  19. Do dogs (Canis lupus familiaris make counterproductive choices because they are sensitive to human ostensive cues?

    Directory of Open Access Journals (Sweden)

    Sarah Marshall-Pescini

    Full Text Available Dogs appear to be sensitive to human ostensive communicative cues in a variety of situations, however there is still a measure of controversy as to the way in which these cues influence human-dog interactions. There is evidence for instance that dogs can be led into making evaluation errors in a quantity discrimination task, for example losing their preference for a larger food quantity if a human shows a preference for a smaller one, yet there is, so far, no explanation for this phenomenon. Using a modified version of this task, in the current study we investigated whether non-social, social or communicative cues (alone or in combination cause dogs to go against their preference for the larger food quantity. Results show that dogs' evaluation errors are indeed caused by a social bias, but, somewhat contrary to previous studies, they highlight the potent effect of stimulus enhancement (handling the target in influencing the dogs' response. A mild influence on the dog's behaviour was found only when different ostensive cues (and no handling of the target were used in combination, suggesting their cumulative effect. The discussion addresses possible motives for discrepancies with previous studies suggesting that both the intentionality and the directionality of the action may be important in causing dogs' social biases.

  20. Oxytocin receptor gene polymorphisms are associated with human directed social behavior in dogs (Canis familiaris).

    Science.gov (United States)

    Kis, Anna; Bence, Melinda; Lakatos, Gabriella; Pergel, Enikő; Turcsán, Borbála; Pluijmakers, Jolanda; Vas, Judit; Elek, Zsuzsanna; Brúder, Ildikó; Földi, Levente; Sasvári-Székely, Mária; Miklósi, Adám; Rónai, Zsolt; Kubinyi, Enikő

    2014-01-01

    The oxytocin system has a crucial role in human sociality; several results prove that polymorphisms of the oxytocin receptor gene are related to complex social behaviors in humans. Dogs' parallel evolution with humans and their adaptation to the human environment has made them a useful species to model human social interactions. Previous research indicates that dogs are eligible models for behavioral genetic research, as well. Based on these previous findings, our research investigated associations between human directed social behaviors and two newly described (-212AG, 19131AG) and one known (rs8679684) single nucleotide polymorphisms (SNPs) in the regulatory regions (5' and 3' UTR) of the oxytocin receptor gene in German Shepherd (N = 104) and Border Collie (N = 103) dogs. Dogs' behavior traits have been estimated in a newly developed test series consisting of five episodes: Greeting by a stranger, Separation from the owner, Problem solving, Threatening approach, Hiding of the owner. Buccal samples were collected and DNA was isolated using standard protocols. SNPs in the 3' and 5' UTR regions were analyzed by polymerase chain reaction based techniques followed by subsequent electrophoresis analysis. The gene-behavior association analysis suggests that oxytocin receptor gene polymorphisms have an impact in both breeds on (i) proximity seeking towards an unfamiliar person, as well as their owner, and on (ii) how friendly dogs behave towards strangers, although the mediating molecular regulatory mechanisms are yet unknown. Based on these results, we conclude that similarly to humans, the social behavior of dogs towards humans is influenced by the oxytocin system. PMID:24454713

  1. Canis familiaris, UN NUEVO HOSPEDERO DE Ornithodoros (A. puertoricensis FOX, 1947 (ACARI: IXODIDA EN COLOMBIA

    Directory of Open Access Journals (Sweden)

    BEJARANO EDUAR E. E.

    2009-04-01

    Full Text Available

    RESUMEN

    Las garrapatas revisten gran importancia en el campo biomédico por sus hábitos hematófagos y asociación con la transmisión de agentes patógenos a humanos y animales. El objetivo de esta investigación fue establecer las especies de garrapatas que parasitan perros en tres poblaciones del área rural del Caribe colombiano. Durante los meses de agosto y diciembre del año 2006 se realizó búsqueda activa de garrapatas sobre caninos domésticos de las localidades de El Campín, Sabanas del Potrero y Escobar Arriba, departamento de Sucre. Las garrapatas recolectadas fueron almacenadas en viales con etanol al 70% e identificadas empleando claves morfológicas de referencia para cada familia. Para la determinación de especie en la familia Argasidae se realizaron estimaciones morfométricas de estructuras externas. Se recolectaron 420 garrapatas a partir de 50 caninos infestados, de un total de 134 perros examinados, que corresponde a una tasa de infestación del 37,3%. Las garrapatas fueron identificadas como Rhipicephalus sanguineus, Rhipicephalus (Boophilus microplus y Amblyomma ovale pertenecientes a la familia Ixodidae, y Ornithodoros (Alectorobius puertoricensis de la familia Argasidae. La especie predominante fue R. sanguineus (92,1% en los estados de larva, ninfa y adulto, seguida por larvas de O. puertoricensis, que fueron halladas en menor número sobre caninos de las tres localidades. Se registra, por primera vez en América, el parasitismo de O. puertoricensis sobre caninos domésticos y se confirma su presencia en Colombia.

    Palabras clave: garrapatas, perros, Ornithodoros puertoricensis, Ixodida, Colombia.


    ABSTRACT

    Ticks are very important from the biomedical point of view, by their hematophagic activity and their role in the transmission of pathogenic microorganisms to man and animals. The main goal of this work was to establish the tick species parasiting dogs in three rural localities of the Colombian Caribbean. From August to December 2006, an active search of ticks on dogs was carried out in the localities of El Campín, Sabanas del Potrero and Escobar Arriba, department of Sucre. The collected ticks were preserved into eppendorf tubes with 70% ethanol, and identified using standard morphological keys for each family. Argasid species were determined by measuring external morphological characters. Of 134 examined dogs in the three localities, 50 were found infested by ticks, representing a infestation rate of 37,3%. A total of 420 ticks were collected from dogs and identified as Rhipicephalus sanguineus, Rhipicephalus (Boophilus microplus, and Amblyomma ovale of the Ixodidae family, and Ornithodoros puertoricensis of the Argasidae family. R. sanguineus was the predominant species (92,1% in the stages of larva, nymph and adult, following by O. puertoricensis larvae recorded in low numbers in the three regions sampled. The tick O. puertoricensis is recorded for the first time as ectoparasite of domestic dogs in America. Additionally, the presence of this tick species is confirmed in Colombia.

    Key words: Ticks, dogs, Ornithodoros puertoricensis, Ixodida, Colombia

  2. Clinical, anatomic, and immunopathologic characterization of Babesia gibsoni infection in the domestic dog (Canis familiaris).

    Science.gov (United States)

    Wozniak, E J; Barr, B C; Thomford, J W; Yamane, I; McDonough, S P; Moore, P F; Naydan, D; Robinson, T W; Conrad, P A

    1997-08-01

    The pathology associated with acute, chronic, and recrudescent Babesia gibsoni infections was characterized in a group of 6 naturally or experimentally infected, spleen-intact and splenectomized dogs. All experimentally infected dogs became acutely parasitemic, lethargic, anemic, thrombocytopenic, and hemoglobinuric. Anatomic lesions associated, with the disease included diffuse nonsuppurative periportal and centrilobular hepatitis, multifocal necrotizing arteritis, membranoproliferative glomerulonephritis, reactive lymphadenopathy, diffuse erythrophagocytosis, and extramedullary hematopoiesis. The density of CD3+ lymphocytes within the liver sinusoids was markedly increased. Aggregates of large mononuclear cells with immunohistochemical features of activated macrophages were demonstrated in the central veins of the liver. Kupffer cells throughout the hepatic sinusoids appeared hypertrophic and prominent. The density of sinusoidal T lymphocytes, macrophages in central veins, and the degree of Kupffer cell hypertrophy were greatest in the splenectomized dogs. Multifocal deposits of IgM antibody were immunohistochemically demonstrated within the walls of inflamed arteries and renal glomeruli. The results of this study suggest that intense immunostimulation resulting in activation and expansion of T and B lymphocyte populations, macrophage recruitment and activation, vasculitis, glomerulonephritis and anemia contribute to the pathology associated with B. gibsoni infections. PMID:9267413

  3. Change of Diurnal Heart Rate Patterns During Pregnancy and Lactation in Dogs (Canis familiaris

    Directory of Open Access Journals (Sweden)

    Häggström J

    2003-09-01

    Full Text Available Pregnancy and lactation involve great demands on the cardiovascular system. The purpose of this study was to investigate how the heart rate and diurnal heart rate pattern change when dogs become pregnant or lactate. Five clinically healthy female beagle dogs were mated, and delivered three to seven healthy puppies. The heart rate was investigated with 24-h ECG (Holter once during anoestrus, at 3, 5, 7 and 9 weeks of pregnancy, and at week 4 postpartum (lactation. However, at 9 weeks, the ECG could not be recorded for the fully 24 h in 4 of 5 dogs, because labour started and the dogs then appeared disturbed by the recordings. The results at this date are not included in the statistical comparison. The heart rate increased progressively during pregnancy and was still elevated at 4 weeks of lactation. During late pregnancy the difference in heart rates between daytime and nighttime became smaller, but the heart rate was significantly higher in daytime in all periods. In conclusion, the increased heart rates during pregnancy and lactation reflect increased demands on the cardiovascular system and may be important to consider in clinical practice.

  4. Concomitant administration of GonaCon™ and rabies vaccine in female dogs (Canis familiaris) in Mexico.

    Science.gov (United States)

    Vargas-Pino, Fernando; Gutiérrez-Cedillo, Verónica; Canales-Vargas, Erick J; Gress-Ortega, Luis R; Miller, Lowell A; Rupprecht, Charles E; Bender, Scott C; García-Reyna, Patricia; Ocampo-López, Juan; Slate, Dennis

    2013-09-13

    Mexico serves as a global model for advances in rabies prevention and control in dogs. The Mexican Ministry of Health (MMH) annual application of approximately 16 million doses of parenteral rabies vaccine has resulted in significant reductions in canine rabies during the past 20 years. One collateral parameter of rabies programs is dog population management. Enhanced public awareness is critical to reinforce responsible pet ownership. Surgical spaying and neutering remain important to prevent reproduction, but are impractical for achieving dog population management goals. GonaCon™, an anti-gonadotropin releasing hormone (GnRH) vaccine, was initially tested in captive female dogs on the Navajo Nation, 2008. The MMH led this international collaborative study on an improved formulation of GonaCon™ in captive dogs with local representatives in Hidalgo, Mexico in 2011. This study contained 20 bitches assigned to Group A (6 control), Group B (7 GonaCon™), and Group C (7 GonaCon™ and rabies vaccine). Vaccines were delivered IM. Animals were placed under observation and evaluated during the 61-day trial. Clinically, all dogs behaved normally. No limping or prostration was observed, in spite of minor muscle atrophy post-mortem in the left hind leg of dogs that received GonaCon™. Two dogs that began the study pregnant give birth to healthy pups. Dogs that received a GonaCon™ injection had macro and microscopic lesions consistent with prior findings, but the adverse injection effects were less frequent and lower in intensity. Both vaccines were immunogenic based on significant increases in rabies virus neutralizing antibodies and anti-GnRH antibodies in treatment Groups B and C. Simultaneous administration of GonaCon™ and rabies vaccine in Group C did not affect immunogenicity. Progesterone was suppressed significantly in comparison to controls. Future studies that monitor fertility through multiple breeding cycles represent a research need to determine the value of integrating this vaccine into dog rabies management. PMID:23871822

  5. Conservation of the Sapsaree (Canis familiaris), a Korean Natural Monument, using somatic cell nuclear transfer.

    Science.gov (United States)

    Jang, Goo; Hong, SoGun; Kang, JungTaek; Park, JungEun; Oh, HyunJu; Park, ChanKyu; Ha, JiHong; Kim, DaeYong; Kim, MinKyu; Lee, ByeongChun

    2009-09-01

    A recent emerging technology, somatic cell nuclear transfer (SCNT), has been considered for conserving threatened or endangered species. Sapsaree is a native breed in Korea and has been designated as a Natural Monument. The aim of this study was to produce a Sapsaree by SCNT for breed conservation. Donor fibroblasts from a 9-year-old male Sapsaree were placed into the perivitelline spaces of enucleated in vivo matured oocytes and fused electrically. A total of 309 cloned embryos were transferred into the oviducts of 15 naturally synchronized recipients. Two recipients were diagnosed as pregnant, and each delivered one cloned puppy, both of which weighed 530 g. Overall, this study demonstrated that an endangered canine breed can be conserved by SCNT.

  6. Comparative functional anatomy of the epaxial musculature of dogs (Canis familiaris) bred for sprinting vs. fighting.

    Science.gov (United States)

    Webster, Emma L; Hudson, Penny E; Channon, Sarah B

    2014-09-01

    The axial musculoskeletal system of quadrupedal mammals is not currently well understood despite its functional importance in terms of facilitating postural stability and locomotion. Here we examined the detailed architecture of the muscles of the vertebral column of two breeds of dog, the Staffordshire bull terrier (SBT) and the racing greyhound, which have been selectively bred for physical combat and high speed sprint performance, respectively. Dissections of the epaxial musculature of nine racing greyhounds and six SBTs were carried out; muscle mass, length, and fascicle lengths were measured and used to calculate muscle physiological cross-sectional area (PCSA), and to estimate maximum muscle potential for force, work and power production. The longissimus dorsi muscle was found to have a high propensity for force production in both breeds of dog; however, when considered in combination with the iliocostalis lumborum muscle it showed enhanced potential for production of power and facilitating spinal extension during galloping gaits. This was particularly the case in the greyhound, where the m. longissimus dorsi and the m. iliocostalis lumborum were estimated to have the potential to augment hindlimb muscle power by ca. 12%. Breed differences were found within various other muscles of the axial musculoskeletal system, particularly in the cranial cervical muscles and also the deep muscles of the thorax which insert on the ribs. These may also highlight key functional adaptations between the two breeds of dog, which have been selectively bred for particular purposes. Additionally, in both breeds of dog, we illustrate specialisation of muscle function by spinal region, with differences in both mass and PCSA found between muscles at varying levels of the axial musculoskeletal system, and between muscle functional groups. PMID:24917310

  7. Distribution of ectoparasites of Canis lupus familiaris L. (Carnivora: Canidae from Panama

    Directory of Open Access Journals (Sweden)

    Roberto Miranda C

    2011-04-01

    Full Text Available Objetive. To determine the distribution of ectoparasites in dogs in Panama. Materials and methods. There were surveyed 720 canines belonging to 57 communities. Results. The results showed that 84% of the dogs were infested with at least one species of ectoparasite. Dogs from lowlands showed a higher percentage of parasitism and a greater biodiversity of parasites than dogs from highlands. There were found seven species of ticks, four species of fleas, two species of lice, and one specie of botfly. The ticks Rhipicephalus sanguineus, Amblyomma cajennense, A. ovale and the flea Ctenocephalides felis were widespread; however Ixodes boliviensis and Pulex simulans showed a much narrower geographic distribution and they were found only in dogs from highlands. The flea species Rhopalopsyllus cacicus and the tick Haemaphysalis juxtakochi were found for the first time in panamanian dogs. Conclusions. The environmental situation in Panama, can encourage that wildlife ectoparasites parasitized dogs in absence of their native hosts. This condition may increase transmission risk of some diseases where the ticks and fleas are vectors.

  8. Influence of owners' attachment style and personality on their dogs' (Canis familiaris separation-related disorder.

    Directory of Open Access Journals (Sweden)

    Veronika Konok

    Full Text Available Previous research has suggested that owners' attitude to their family dogs may contribute to a variety of behaviour problems in the dog, and authors assume that dogs with separation-related disorder (SRD attach differently to the owner than typical dogs do. Our previous research suggested that these dogs may have an insecure attachment style. In the present study we have investigated whether owners' attachment style, personality traits and the personality of the dog influence the occurrence of SRD in the dog. In an internet-based survey 1508 (1185 German and 323 Hungarian dog-owners filled in five questionnaires: Demographic questions, Separation Behaviour Questionnaire (to determine SRD, Human and Dog Big Five Inventory and Adult Attachment Scale. We found that with owners' higher score on attachment avoidance the occurrence of SRD in the dog increases. Dogs scoring higher on the neuroticism scale were more prone to develop SRD. Our results suggest that owners' attachment avoidance may facilitate the development of SRD in dogs. We assume that avoidant owners are less responsive to the dog's needs and do not provide a secure base for the dog when needed. As a result dogs form an insecure attachment and may develop SRD. However, there may be alternative explanations of our findings that we also discuss.

  9. RASGOS DEL TEMPERAMENTO DE LOS PERROS DOMÉSTICOS (CANIS FAMILIARIS: EVALUACIONES CONDUCTUALES

    Directory of Open Access Journals (Sweden)

    ADRIANA JAKOVCEVIC

    2009-08-01

    Full Text Available

    Los rasgos del temperamento se definen como tendencias conductuales estables entre situaciones similares y a lo largo del tiempo. En el presente trabajo se revisan las pruebas conductuales diseñadas para la evaluación de rasgos aislados del temperamento en los perros domésticos. Para cada dimensión se describen los estímulos empleados, las respuestas evaluadas y el correlato fisiológico de las mismas. Los rasgos más estudiados fueron la temerosidad, la agresividad y la sociabilidad. Sin embargo, sólo la primera cuenta con correlatos fisiológicos bien establecidos. Finalmente, las evaluaciones conductuales resultan de suma importancia para la selección de los perros para las distintas funciones que cumplen en la sociedad humana: detección de drogas, compañía, guardia, rescate de personas, etc.

  10. Rasgos del temperamento de los perros domésticos (Canis familiaris: evaluaciones conductuales

    Directory of Open Access Journals (Sweden)

    ADRIANA JAKOVCEVIC

    2009-01-01

    Full Text Available Los rasgos del temperamento se definen como tendencias conductuales estables entre situaciones similares y a lo largo del tiempo. En el presente trabajo se revisan las pruebas conductuales diseñadas para la evaluación de rasgos aislados del temperamento en los perros domésticos. Para cada dimensión se describen los estímulos empleados, las respuestas evaluadas y el correlato psiológico de las mismas. Los rasgos más estudiados fueron la temerosidad, la agresividad y la sociabilidad. Sin embargo, sólo la primera cuenta con correlatos psiológicos bien establecidos. Finalmente, las evaluaciones conductuales resultan de suma importancia para la selección de los perros para las distintas funciones que cumplen en la sociedad humana: detección de drogas, compañía, guardia, rescate de personas, etc.

  11. Verhaltensphysiologische Experimente zur Erkennung und Unterscheidung menschlicher Gesichter beim Haushund (Canis familiaris)

    OpenAIRE

    Gutmann, Isabel

    2011-01-01

    In der vorliegenden Arbeit wurde die Fähigkeit von Hunden zur Erkennung und Unterscheidung menschlicher Gesichter untersucht. Zu diesem Zweck wurden verschiedene Verhaltensexperimente mit fünf Hunden durchgeführt. Zunächst wurden die Hunde darauf dressiert, ein einlaminiertes DIN A4 Blatt mit einem Gesicht im Zentrum in der dafür vorgesehenen Apparatur mit der Schnauze zu berühren. Bei der Dressur wurden immer zwei Folien präsentiert, wobei nur eine Wahl, nämlich die des Dressurgesichts, durc...

  12. What counts for dogs (Canis lupus familiaris) in a quantity discrimination task?

    Science.gov (United States)

    Miletto Petrazzini, Maria Elena; Wynne, Clive D L

    2016-01-01

    Numerous studies have reported that animals reliably discriminate quantities of more or less food. However, little attention has been given to the relative salience of numerosity compared to the total amount of food when animals are making their choices. Here we investigated this issue in dogs. Dogs were given choices between two quantities of food items in three different conditions. In the Congruent condition, the total amount of food co-varied with the number of food items; in the Incongruent condition the total amount was pitted against the numerosity; and in the Controlled condition the total amount between the sets was equal. Results show that dogs based their choice on the total amount of edible food rather than on the number of food items, suggesting that, in food choice tasks, amount counts more than number. The presence of the largest individual item in a set did not bias dogs' choices. A control test excluded the possibility that dogs based their choices on olfactory cues alone.

  13. Canis familiaris, un nuevo hospedero de ornithodoros (a.) puertoricensis fox, 1947 (acari: ixodida) en colombia

    OpenAIRE

    BEJARANO EDUAR E. E.; PATERNINA-GÓMEZ MARGARET; DÍAZ-OLMOS YIRYS; PATERNINA LUIS E.

    2009-01-01

    RESUMEN

    Las garrapatas revisten gran importancia en el campo biomédico por sus hábitos hematófagos y asociación con la transmisión de agentes patógenos a humanos y animales. El objetivo de esta investigación fue establecer las especies de g...

  14. Urbanization, Grassland, and Diet Influence Coyote (Canis latrans) Parasitism Structure.

    Science.gov (United States)

    Watts, Alexander G; Lukasik, Victoria M; Fortin, Marie-Josée; Alexander, Shelley M

    2015-12-01

    Land use change can alter the ecological mechanisms that influence infectious disease exposure in animal populations. However, few studies have empirically integrated the environmental, spatial, and dietary patterns of wildlife epidemiology. We investigate how urbanization, habitat type, and dietary behavior are associated with coyote (Canis latrans) parasitism structure along a gradient of rural to urban land cover using multivariate redundancy analyses. Coyote fecal samples were collected in eight urban and six rural sites in Calgary, Alberta, Canada. Parasite and diet components were identified using common flotation procedures and fecal dietary analysis, respectively. Redundancy analysis was used to identify the best land cover, connectivity, and dietary predictors. We tested for significance using multiple permutation tests and ANOVAs. Significant factors affecting enteric parasite prevalence included dietary and land cover factors (R (2) = 0.4130, P coyote hosts to enteric parasites and pioneers future investigation of disease ecology for natural populations in anthropogenic landscapes. PMID:26122205

  15. Dietary separation of sympatric carnivores identified by molecular analysis of scats.

    Science.gov (United States)

    Farrell, L E; Roman, J; Sunquist, M E

    2000-10-01

    We studied the diets of four sympatric carnivores in the flooding savannas of western Venezuela by analysing predator DNA and prey remains in faeces. DNA was isolated and a portion of the cytochrome b gene of the mitochondrial genome amplified and sequenced from 20 of 34 scats. Species were diagnosed by comparing the resulting sequences to reference sequences generated from the blood of puma (Puma concolor), jaguar (Panthera onca), ocelot (Leopardus pardalus) and crab-eating fox (Cerdocyon thous). Scat size has previously been used to identify predators, but DNA data show that puma and jaguar scats overlap in size, as do those of puma, ocelot and fox. Prey-content analysis suggests minimal prey partitioning between pumas and jaguars. In field testing this technique for large carnivores, two potential limitations emerged: locating intact faecal samples and recovering DNA sequences from samples obtained in the wet season. Nonetheless, this study illustrates the tremendous potential of DNA faecal studies. The presence of domestic dog (Canis familiaris) in one puma scat and of wild pig (Sus scrofa), set as bait, in one jaguar sample exemplifies the forensic possibilities of this noninvasive analysis. In addition to defining the dietary habits of similar size sympatric mammals, DNA identifications from faeces allow wildlife managers to detect the presence of endangered taxa and manage prey for their conservation. PMID:11050553

  16. Fatal Babesia canis canis infection in a splenectomized Estonian dog.

    Science.gov (United States)

    Tiškina, Valentina; Capligina, Valentina; Must, Külli; Berzina, Inese; Ranka, Renate; Jokelainen, Pikka

    2016-01-25

    A previously splenectomized dog from Estonia was presented with a sudden lack of appetite and discoloration of the urine. Despite supportive therapy, its condition deteriorated dramatically during 1 day. Severe thrombocytopenia and high numbers of protozoan hemoparasites were evident in blood smears, and the hematocrit dropped from 46 to 33 %. The dog was euthanized before specific antibabesial treatment was initiated. Blood samples from the dog and from two other dogs in the same household tested positive for Babesia using molecular methods, and the sequences of partial 18S rRNA gene confirmed the causative species as Babesia canis canis. The risk of severe, rapidly progressing babesiosis in splenectomized dogs merits awareness.

  17. Canis familiaris, UN NUEVO HOSPEDERO DE Ornithodoros (A. puertoricensis FOX, 1947 (ACARI: IXODIDA EN COLOMBIA Canis familiaris, a New Host of Ornithodoros (A. puertoricensis Fox, 1947 (Acari: Ixodida in Colombia

    Directory of Open Access Journals (Sweden)

    LUIS E PATERNINA

    Full Text Available Las garrapatas revisten gran importancia en el campo biomédico por sus hábitos hematófagos y asociación con la transmisión de agentes patógenos a humanos y animales. El objetivo de esta investigación fue establecer las especies de garrapatas que parasitan perros en tres poblaciones del área rural del Caribe colombiano. Durante los meses de agosto y diciembre del año 2006 se realizó búsqueda activa de garrapatas sobre caninos domésticos de las localidades de El Campín, Sabanas del Potrero y Escobar Arriba, departamento de Sucre. Las garrapatas recolectadas fueron almacenadas en viales con etanol al 70% e identificadas empleando claves morfológicas de referencia para cada familia. Para la determinación de especie en la familia Argasidae se realizaron estimaciones morfométricas de estructuras externas. Se recolectaron 420 garrapatas a partir de 50 caninos infestados, de un total de 134 perros examinados, que corresponde a una tasa de infestación del 37,3%. Las garrapatas fueron identificadas como Rhipicephalus sanguineus, Rhipicephalus (Boophilus microplus y Amblyomma ovale pertenecientes a la familia Ixodidae, y Ornithodoros (Alectorobius puertoricensis de la familia Argasidae. La especie predominante fue R. sanguineus (92,1% en los estados de larva, ninfa y adulto, seguida por larvas de O. puertoricensis, que fueron halladas en menor número sobre caninos de las tres localidades. Se registra, por primera vez en América, el parasitismo de O. puertoricensis sobre caninos domésticos y se confirma su presencia en Colombia.Ticks are very important from the biomedical point of view, by their hematophagic activity and their role in the transmission of pathogenic microorganisms to man and animals. The main goal of this work was to establish the tick species parasiting dogs in three rural localities of the Colombian Caribbean. From August to December 2006, an active search of ticks on dogs was carried out in the localities of El Campín, Sabanas del Potrero and Escobar Arriba, department of Sucre. The collected ticks were preserved into eppendorf tubes with 70% ethanol, and identified using standard morphological keys for each family. Argasid species were determined by measuring external morphological characters. Of 134 examined dogs in the three localities, 50 were found infested by ticks, representing a infestation rate of 37,3%. A total of 420 ticks were collected from dogs and identified as Rhipicephalus sanguineus, Rhipicephalus (Boophilus microplus, and Amblyomma ovale of the Ixodidae family, and Ornithodoros puertoricensis of the Argasidae family. R. sanguineus was the predominant species (92,1% in the stages of larva, nymph and adult, following by O. puertoricensis larvae recorded in low numbers in the three regions sampled. The tick O. puertoricensis is recorded for the first time as ectoparasite of domestic dogs in America. Additionally, the presence of this tick species is confirmed in Colombia.

  18. PARASITISMO POR ANCILOSTOMATÍDEOS EM CÃES (Canis familiaris) DOMICILIADOS EM CAMPOS DOS GOYTACAZES, RJ. PARASITISM BY ANCYLOSTOMIDES IN DOGS (Canis familiaris) DOMICILIATED IN CAMPOS DOS GOYTACAZES, RJ.

    OpenAIRE

    Francimar Fernandes Gomes; Antonio Peixoto Albernaz; Farlen Jose Bebber Miranda; Luize Néli Nunes Garcia

    2008-01-01

    Os ancilostomatídeos são nematóides hematófagos parasitas do intestino delgado, podendo causar retardo no crescimento, inapetência, anorexia, apatia, anemia e até a morte. No homem, algumas espécies como Ancylostoma caninum, A. braziliense e A. tubaeforme podem causar larva migrans cutânea, quando as larvas infectantes de terceiro estágio penetram ativamente a pele íntegra. O objetivo deste trabalho foi detectar o parasitismo por ancilostomatídeos em fezes de cães domiciliados e assintomático...

  19. Wolves (Canis lupus) and dogs (Canis familiaris) differ in following human gaze into distant space but respond similar to their packmates' gaze.

    Science.gov (United States)

    Werhahn, Geraldine; Virányi, Zsófia; Barrera, Gabriela; Sommese, Andrea; Range, Friederike

    2016-08-01

    Gaze following into distant space is defined as visual co-orientation with another individual's head direction allowing the gaze follower to gain information on its environment. Human and nonhuman animals share this basic gaze following behavior, suggested to rely on a simple reflexive mechanism and believed to be an important prerequisite for complex forms of social cognition. Pet dogs differ from other species in that they follow only communicative human gaze clearly addressed to them. However, in an earlier experiment we showed that wolves follow human gaze into distant space. Here we set out to investigate whether domestication has affected gaze following in dogs by comparing pack-living dogs and wolves raised and kept under the same conditions. In Study 1 we found that in contrast to the wolves, these dogs did not follow minimally communicative human gaze into distant space in the same test paradigm. In the observational Study 2 we found that pack-living dogs and wolves, similarly vigilant to environmental stimuli, follow the spontaneous gaze of their conspecifics similarly often. Our findings suggest that domestication did not affect the gaze following ability of dogs itself. The results raise hypotheses about which other dog skills might have been altered through domestication that may have influenced their performance in Study 1. Because following human gaze in dogs might be influenced by special evolutionary as well as developmental adaptations to interactions with humans, we suggest that comparing dogs to other animal species might be more informative when done in intraspecific social contexts. (PsycINFO Database Record PMID:27244538

  20. When dogs look back: inhibition of independent problem-solving behaviour in domestic dogs (Canis lupus familiaris) compared with wolves (Canis lupus)

    OpenAIRE

    Udell, Monique A.R.

    2015-01-01

    Domestic dogs have been recognized for their social sensitivity and aptitude in human-guided tasks. For example, prior studies have demonstrated that dogs look to humans when confronted with an unsolvable task; an action often interpreted as soliciting necessary help. Conversely, wolves persist on such tasks. While dogs' ‘looking back’ behaviour has been used as an example of socio-cognitive advancement, an alternative explanation is that pet dogs show less persistence on independent tasks mo...

  1. When dogs look back: inhibition of independent problem-solving behaviour in domestic dogs (Canis lupus familiaris) compared with wolves (Canis lupus).

    Science.gov (United States)

    Udell, Monique A R

    2015-09-01

    Domestic dogs have been recognized for their social sensitivity and aptitude in human-guided tasks. For example, prior studies have demonstrated that dogs look to humans when confronted with an unsolvable task; an action often interpreted as soliciting necessary help. Conversely, wolves persist on such tasks. While dogs' 'looking back' behaviour has been used as an example of socio-cognitive advancement, an alternative explanation is that pet dogs show less persistence on independent tasks more generally. In this study, pet dogs, shelter dogs and wolves were given up to three opportunities to open a solvable puzzle box: when subjects were with a neutral human caretaker, alone and when encouraged by the human. Wolves were more persistent and more successful on this task than dogs, with 80% average success rate for wolves versus a 5% average success rate for dogs in both the human-in and alone conditions. Dogs showed increased contact with the puzzle box during the encouragement condition, but only a moderate increase in problem-solving success. Social sensitivity appears to play an important role in pet and shelter dogs' willingness to engage in problem-solving behaviour, which could suggest generalized dependence on, or deference to, human action.

  2. Effects of organohalogen pollutants on haematological and urine clinical-chemical parameters in Greenland sledge dogs (Canis familiaris)

    DEFF Research Database (Denmark)

    Sonne, Christian; Dietz, Rune; Kirkegaard, Maja;

    2008-01-01

    and urine clinical-chemical parameters were measured and compared between the bitches and pups form the control and exposed cohorts. Based on existing reference intervals, Arctic mammals may have blood clinical-chemical endpoint levels that differ from comparable species at lower latitudes. The cortisol......:05) in the control group, while glucose was signi.cantly highest (ANCOVA: po0:05) in the exposed group. Furthermore, the blood cholesterol levels indicate that exposure via the diet to marine mammal blubber has a preventive effect on the development of cardiovascular diseases. We therefore suggest...

  3. Autoantibodies against Cytochrome P450 Side-Chain Cleavage Enzyme in Dogs (Canis lupus familiaris Affected with Hypoadrenocorticism (Addison's Disease.

    Directory of Open Access Journals (Sweden)

    Alisdair M Boag

    Full Text Available Canine hypoadrenocorticism likely arises from immune-mediated destruction of adrenocortical tissue, leading to glucocorticoid and mineralocorticoid deficiency. In humans with autoimmune Addison's disease (AAD or autoimmune polyendocrine syndrome (APS, circulating autoantibodies have been demonstrated against enzymes associated with adrenal steroid synthesis. The current study investigates autoantibodies against steroid synthesis enzymes in dogs with spontaneous hypoadrenocorticism. Coding regions of canine CYP21A2 (21-hydroxylase; 21-OH, CYP17A1 (17-hydroxylase; 17-OH, CYP11A1 (P450 side-chain cleavage enzyme; P450scc and HSD3B2 (3β hydroxysteroid dehydrogenase; 3βHSD were amplified, cloned and expressed as 35S-methionine radiolabelled recombinant protein. In a pilot study, serum samples from 20 dogs with hypoadrenocorticism and four unaffected control dogs were screened by radio-immunoprecipitation assay. There was no evidence of reactivity against 21-OH, 17-OH or 3βHSD, but five dogs with hypoadrenocorticism showed immunoreactivity to P450scc compared with controls. Serum samples were subsequently obtained from 213 dogs diagnosed with hypoadrenocorticism and 110 dogs from a hospital control population. Thirty control dogs were randomly selected to establish a threshold for antibody positivity (mean + 3 × standard deviation. Dogs with hypoadrenocorticism were more likely to be P450scc autoantibody positive than hospital controls (24% vs. 1.2%, respectively; p = 0.0016. Sex was significantly associated with the presence of P450scc autoantibodies in the case population, with 30% of females testing positive compared with 17% of males (p = 0.037. Significant associations with breed (p = 0.015 and DLA-type (DQA1*006:01 allele; p = 0.017 were also found. This cross-sectional study indicates that P450scc autoantibodies are present in a proportion of dogs affected with hypoadrenocorticism.

  4. Intranasally administered oxytocin affects how dogs (Canis familiaris) react to the threatening approach of their owner and an unfamiliar experimenter.

    Science.gov (United States)

    Hernádi, Anna; Kis, Anna; Kanizsár, Orsolya; Tóth, Katinka; Miklósi, Bernadett; Topál, József

    2015-10-01

    Fear and aggression are among the most prominent behavioural problems in dogs. Oxytocin has been shown to play a role in regulating social behaviours in humans including fear and aggression. As intranasal oxytocin has been found to have some analogous effects in dogs and humans, here we investigated the effect of oxytocin on dogs' behaviour in the Threatening Approach Test. Dogs, after having received intranasal administration of oxytocin (OT) or placebo (PL), showed the same reaction to an unfamiliar experimenter, but OT pretreated dogs showed a less friendly first reaction compared to the PL group when the owner was approaching. Individual differences in aggression (measured via questionnaire) also modulated dogs' first reaction. Moreover, subjects that received OT looked back more at the human (owner/experimenter) standing behind them during the threatening approach. These results suggest that oxytocin has an effect on dogs' response to the threatening cues of a human, but this effect is in interaction with other factors such as the identity of the approaching human and the 'baseline' aggression of the dogs.

  5. Autoantibodies against Cytochrome P450 Side-Chain Cleavage Enzyme in Dogs (Canis lupus familiaris) Affected with Hypoadrenocorticism (Addison's Disease).

    Science.gov (United States)

    Boag, Alisdair M; Christie, Michael R; McLaughlin, Kerry A; Syme, Harriet M; Graham, Peter; Catchpole, Brian

    2015-01-01

    Canine hypoadrenocorticism likely arises from immune-mediated destruction of adrenocortical tissue, leading to glucocorticoid and mineralocorticoid deficiency. In humans with autoimmune Addison's disease (AAD) or autoimmune polyendocrine syndrome (APS), circulating autoantibodies have been demonstrated against enzymes associated with adrenal steroid synthesis. The current study investigates autoantibodies against steroid synthesis enzymes in dogs with spontaneous hypoadrenocorticism. Coding regions of canine CYP21A2 (21-hydroxylase; 21-OH), CYP17A1 (17-hydroxylase; 17-OH), CYP11A1 (P450 side-chain cleavage enzyme; P450scc) and HSD3B2 (3β hydroxysteroid dehydrogenase; 3βHSD) were amplified, cloned and expressed as 35S-methionine radiolabelled recombinant protein. In a pilot study, serum samples from 20 dogs with hypoadrenocorticism and four unaffected control dogs were screened by radio-immunoprecipitation assay. There was no evidence of reactivity against 21-OH, 17-OH or 3βHSD, but five dogs with hypoadrenocorticism showed immunoreactivity to P450scc compared with controls. Serum samples were subsequently obtained from 213 dogs diagnosed with hypoadrenocorticism and 110 dogs from a hospital control population. Thirty control dogs were randomly selected to establish a threshold for antibody positivity (mean + 3 × standard deviation). Dogs with hypoadrenocorticism were more likely to be P450scc autoantibody positive than hospital controls (24% vs. 1.2%, respectively; p = 0.0016). Sex was significantly associated with the presence of P450scc autoantibodies in the case population, with 30% of females testing positive compared with 17% of males (p = 0.037). Significant associations with breed (p = 0.015) and DLA-type (DQA1*006:01 allele; p = 0.017) were also found. This cross-sectional study indicates that P450scc autoantibodies are present in a proportion of dogs affected with hypoadrenocorticism.

  6. Quantification of brown dog tick repellents, 2-hexanone and benzaldehyde, and release from tick-resistant beagles, Canis lupus familiaris

    Science.gov (United States)

    We have recently shown that repellency of the tick Rhipicephalus sanguineus sensu lato by the tick resistant dog breed Beagle is mediated by volatile organic compounds 2-hexanone and benzaldehyde present in Beagle dog odour. Ectoparasite location on animal hosts is affected by variation in odour com...

  7. High speed galloping in the cheetah (Acinonyx jubatus) and the racing greyhound (Canis familiaris): spatio-temporal and kinetic characteristics.

    Science.gov (United States)

    Hudson, Penny E; Corr, Sandra A; Wilson, Alan M

    2012-07-15

    The cheetah and racing greyhound are of a similar size and gross morphology and yet the cheetah is able to achieve a far higher top speed. We compared the kinematics and kinetics of galloping in the cheetah and greyhound to investigate how the cheetah can attain such remarkable maximum speeds. This also presented an opportunity to investigate some of the potential limits to maximum running speed in quadrupeds, which remain poorly understood. By combining force plate and high speed video data of galloping cheetahs and greyhounds, we show how the cheetah uses a lower stride frequency/longer stride length than the greyhound at any given speed. In some trials, the cheetahs used swing times as low as those of the greyhounds (0.2 s) so the cheetah has scope to use higher stride frequencies (up to 4.0 Hz), which may contribute to it having a higher top speed that the greyhound. Weight distribution between the animal's limbs varied with increasing speed. At high speed, the hindlimbs support the majority of the animal's body weight, with the cheetah supporting 70% of its body weight on its hindlimbs at 18 m s(-1); however, the greyhound hindlimbs support just 62% of its body weight. Supporting a greater proportion of body weight on a particular limb is likely to reduce the risk of slipping during propulsive efforts. Our results demonstrate several features of galloping and highlight differences between the cheetah and greyhound that may account for the cheetah's faster maximum speeds. PMID:22723482

  8. DIFERENCIAS INDIVIDUALES EN LOS PERROS DOMÉSTICOS (CANIS FAMILIARIS: REVISIÓN DE LAS EVALUACIONES CONDUCTUALES

    Directory of Open Access Journals (Sweden)

    Adriana Jakovcevic

    2009-01-01

    Full Text Available El estudio de las diferencias individuales en el comportamiento de los perros domésticos tiene un gran valor aplicado dado que permite una mejor selección de los mismos para cumplir las variadas funciones que tienen en la sociedad humanacomo perros guía, policía, compañía, rescatistas de personas, etc. En el trabajo que se informa se presenta una revisión de estudios sobre diferencias individuales en perros, basada únicamente en las baterías conductuales que evalúan un conjunto de rasgos del temperamento. Con este objetivo se realiza una breve descripción de cada batería de pruebas utilizadas en la literatura, analizando las definiciones operacionales de las variables eva luadas y los diferentes tipos de estímulos utilizados. Los rasgos mayormente evaluados son: temerosidad, agresividad, disposición al entrenamiento y sociabilidad. La te merosidad, en general es evaluada a través de la respuesta del animal ante la aparición de un estímulo súbito que puede ser intenso o no, como por ejemplo la reacción frente a un ruido fuerte, la apertura de un paraguas, o la aparición repentina de una figura humana. La agresividad se mide a través de la reacción frentea la amenaza o provocación por parte de un humano, la sustracción de un objeto o la confrontación con un perro dominante. La disposición al entrenamiento es estudiada a través de la respuesta del animal frente a diferentes estímulos como el juego con un trapo o una cuerda, el ejercicio de devolución de un objeto o la obediencia frente a distintos comandos. Por último, la sociabilidad se evalúa con la aparición o el acercamiento de un humano desconocido o con la exposición a un perro no familiar. Se discuten además las limitaciones metodológicas de las baterías así como también los importantes usos aplicados de las mismas.

  9. An Investigation on Social Representations: Inanimate Agent Can Mislead Dogs (Canis familiaris in a Food Choice Task.

    Directory of Open Access Journals (Sweden)

    Judit Abdai

    Full Text Available The nature of mental representation of others plays a crucial role in social interactions. Dogs present an ideal model species for the investigation of such mental representations because they develop social ties with both conspecifics and heterospecifics. Former studies found that dogs' preference for larger food quantity could be reversed by humans who indicate the smaller quantity. The question is whether this social bias is restricted to human partners. We suggest that after a short positive social experience, an unfamiliar moving inanimate agent (UMO can also change dogs' choice between two food quantities. We tested four groups of dogs with different partners: In the (1 Helper UMO and (2 Helper UMO Control groups the partner was an interactive remote control car that helped the dog to obtain an otherwise unreachable food. In the (3 Non-helper UMO and (4 Human partner groups dogs had restricted interaction with the remote control car and the unfamiliar human partners. In the Human partner, Helper UMO and Helper UMO Control groups the partners were able to revert dogs' choice for the small amount by indicating the small one, but the Non-helper UMO was not. We suggest that dogs are able to generalize their wide range of experiences with humans to another type of agent as well, based on the recognition of similarities in simple behavioural patterns.

  10. An Investigation on Social Representations: Inanimate Agent Can Mislead Dogs (Canis familiaris) in a Food Choice Task.

    Science.gov (United States)

    Abdai, Judit; Gergely, Anna; Petró, Eszter; Topál, József; Miklósi, Ádám

    2015-01-01

    The nature of mental representation of others plays a crucial role in social interactions. Dogs present an ideal model species for the investigation of such mental representations because they develop social ties with both conspecifics and heterospecifics. Former studies found that dogs' preference for larger food quantity could be reversed by humans who indicate the smaller quantity. The question is whether this social bias is restricted to human partners. We suggest that after a short positive social experience, an unfamiliar moving inanimate agent (UMO) can also change dogs' choice between two food quantities. We tested four groups of dogs with different partners: In the (1) Helper UMO and (2) Helper UMO Control groups the partner was an interactive remote control car that helped the dog to obtain an otherwise unreachable food. In the (3) Non-helper UMO and (4) Human partner groups dogs had restricted interaction with the remote control car and the unfamiliar human partners. In the Human partner, Helper UMO and Helper UMO Control groups the partners were able to revert dogs' choice for the small amount by indicating the small one, but the Non-helper UMO was not. We suggest that dogs are able to generalize their wide range of experiences with humans to another type of agent as well, based on the recognition of similarities in simple behavioural patterns.

  11. High speed galloping in the cheetah (Acinonyx jubatus) and the racing greyhound (Canis familiaris): spatio-temporal and kinetic characteristics.

    Science.gov (United States)

    Hudson, Penny E; Corr, Sandra A; Wilson, Alan M

    2012-07-15

    The cheetah and racing greyhound are of a similar size and gross morphology and yet the cheetah is able to achieve a far higher top speed. We compared the kinematics and kinetics of galloping in the cheetah and greyhound to investigate how the cheetah can attain such remarkable maximum speeds. This also presented an opportunity to investigate some of the potential limits to maximum running speed in quadrupeds, which remain poorly understood. By combining force plate and high speed video data of galloping cheetahs and greyhounds, we show how the cheetah uses a lower stride frequency/longer stride length than the greyhound at any given speed. In some trials, the cheetahs used swing times as low as those of the greyhounds (0.2 s) so the cheetah has scope to use higher stride frequencies (up to 4.0 Hz), which may contribute to it having a higher top speed that the greyhound. Weight distribution between the animal's limbs varied with increasing speed. At high speed, the hindlimbs support the majority of the animal's body weight, with the cheetah supporting 70% of its body weight on its hindlimbs at 18 m s(-1); however, the greyhound hindlimbs support just 62% of its body weight. Supporting a greater proportion of body weight on a particular limb is likely to reduce the risk of slipping during propulsive efforts. Our results demonstrate several features of galloping and highlight differences between the cheetah and greyhound that may account for the cheetah's faster maximum speeds.

  12. [Molecular and morphological comparison of hookworms from genus Uncinaria invading red fox (Vulpes vulpes) and dog (Canis familiaris)].

    Science.gov (United States)

    Górski, Paweł; Radowańska, Agnieszka; Jaros, Dorota; Wiśniewski, Marcin

    2006-01-01

    Two species of hookworms from genus Uncinaria have been found so far in Poland. Uncinaria stenocephala infects mainly dog, wolf and red fox, whereas Uncinaria criniformis is a parasite of mustelids (but it was also reported from red fox). 19 male and 29 female hookworms from red foxes have been compared with 10 male and 12 female worms from dogs. Hookworms from dogs were generally smaller than these from foxes, but no other morphological differences could be found. These hookworms were qualified to species Uncinaria stenocephala on the ground of morphology of male. Genomic DNA samples have been isolated from these hookworms and segments of rDNA including part of small subunit of ribosomal RNA gene; internal transcribed spacer 1 (ITS1); 5.8 S ribosomal RNA; internal transcribed spacer 2 (ITS2) and part of large subunit of ribosomal RNA have been amplified and sequenced. Sequences from Uncinaria obtained both from foxes and dogs have shown very high similarity to the sequence of Uncinaria stenocephala, so all examined hookworms have been classified as belonging to this species.

  13. Quantification of brown dog tick repellents, 2-hexanone and benzaldehyde, and release from tick-resistant beagles, Canis lupus familiaris.

    Science.gov (United States)

    de Oliveira Filho, Jaires Gomes; Sarria, André Lucio Franceschini; Ferreira, Lorena Lopes; Caulfield, John C; Powers, Stephen J; Pickett, John A; de León, Adalberto A Pérez; Birkett, Michael A; Borges, Lígia Miranda Ferreira

    2016-06-01

    We have recently shown that repellency of the tick Rhipicephalus sanguineus sensu lato by the tick resistant dog breed, the beagle, is mediated by volatile organic compounds (VOCs) 2-hexanone and benzaldehyde present in beagle odour. Ectoparasite location of animal hosts is affected by variation in these odour components and their ratios. The aim of this study was to quantify the release rate, and the ratio, of 2-hexanone and benzaldehyde from beagles. The odour of three beagles was collected, for four days, over one week (day 0, day 1, day 4 and day 7). The compounds were identified using coupled high-resolution gas chromatography-mass spectrometry (GC-MS), and authentic standards of compounds were used to generate external calibration curves for quantification. Both compounds were found in all dogs on all days. The amount of benzaldehyde was always higher than that of 2-hexanone and so their ratio varied from unity, on average (over time) being 3.128±0.365, 1.902±0.390, 1.670±0.671ngmL(-1) for beagle 1, 2 and 3, respectively. There was no significant (pbenzaldehyde in beagle odour samples covering a 7-day period. This knowledge enables development of repellents to protect dogs from R. sanguineus s. l. infestation.

  14. Toxocara canis y asma bronquial Toxocara canis and bronchial asthma

    Directory of Open Access Journals (Sweden)

    María de los Ángeles López

    2010-02-01

    Full Text Available A fin de evaluar la relación entre la infección por Toxocara canis y los síntomas del asma bronquial en niños de una región subtropical con alta prevalencia de toxocariosis, se estudiaron 47 niños con asma y 53 sin asma como grupo control. Se efectuó el examen físico completo, registrándose datos clínicos y epidemiológicos. En los niños con asma se categorizó el patrón de presentación, frecuencia y gravedad de los síntomas con una escala de I a IV. Se investigó la presencia de anticuerpos anti-Toxocara canis en ambos grupos mediante el método de ELISA en fase sólida, empleando antígeno de excreción/secreción y se efectuó dosaje de Ig E total. Los resultados muestran una seropositividad del 55% en el total de los niños, del 57.4% en los niños con asma y del 52.8% en los controles. En los niños con sintomatología más grave (grado II, III y IV hubo un 67.7% de seropositivos, mientras que en los niños con síntomas de grado I la seropositividad fue de 37.5% (p = 0.0470. La infección por T. canis actuaría como un co-factor agravante de los síntomas del asma bronquial.In order to evaluate the association between the infection by Toxocara canis and the symptoms of asthma in children from a subtropical region with high prevalence of toxocariasis, 47 asthmatic children and 53 non-asthmatics as a control group were studied. A complete physical examination was performed and clinical and epidemiological data were registered. In asthmatic children the frequency and severity of symptoms were classified in grades I to IV. The presence of anti-Toxocara canis antibodies in both groups was evaluated employing a solid phase ELISA method with excretion/secretion antigens, and total Ig E was also measured. Results showed a total seropositivity of 55%, 57.4% in children with asthma and 52.8% in the control group. Among asthmatics with severe symptoms (grade II, III and IV, there was a 67.7% of seropositivity while in children with

  15. TEORES SÉRICOS DE CORTISOL DE FÊMEAS CANINAS (Canis familiaris – LINNAEUS, 1758 SUBMETIDAS À CESARIANA SERIC LEVELS OF CORTISOL IN BITCHES (Canis familiaris – LINNAEUS, 1758 SUBMITTED TO AESARIAN SECTION Niveles séricos del cortisol en perras (Canis familiaris – Linnaeus, 1758 sometidas a cesárea

    Directory of Open Access Journals (Sweden)

    Diogo José Cardilli

    2009-12-01

    Full Text Available

    Cadelas submetidas à cesariana, por estarem em situação diferente da fisiológica, podem apresentar alterações séricas para se adaptarem a essa nova condição de estresse. Dentre as possíveis alterações, encontram-se as concentrações de cortisol durante o período periparto. Sendo assim, o objetivo deste estudo foi quantificar os teores séricos do cortisol de cadelas submetidas à cesariana na fase de parto e pós-parto (no dia do ato cirúrgico ou parto, 24 horas, 48 horas e dez dias após. O método de radioimunoensaio foi utilizado para a realização da dosagem do cortisol sérico (nos períodos já descritos. Realizou-se a análise estatística por meio dos testes t e Tukey. O teor de cortisol sérico apresentou diferença (p< 0,05 no dia da cesariana (6,83 µg/dL, porém não diferiu (p> 0,05 nos dias subsequentes (1,82 µg/dL, 24 horas após; 1,38 µg/dL, 48 horas após; 1,48 µg/dL dez dias após. Os valores médios do grupo controle foram 3,43, 2,01, 3,59 e 1,72 µg/dL, após o parto, 24, 48 horas e dez dias após, respectivamente. O estresse devido à distocia elevou a liberação desse hormônio, voltando à normalidade nos dias subsequentes, porém o estresse cirúrgico não promoveu aumento na liberação de cortisol em cadelas submetidas à cesariana. Os animais do grupo controle apresentaram teores séricos de cortisol, nos devidos períodos, compatíveis com os citados pela literatura.

    PALAVRAS-CHAVES: Cadelas, cesariana, cortisol.

    Bitches submitted to caesarian section, for being in a physiological different situation, can present alterations to adapt to this new stress condition. Into possible alterations are cortisol levels during per partum period. So, the objectives of this study was to quantify seric cortisol of bitches submitted to caesarian section in partum and postpartum period (in the day of the partum or surgery , 24, 48 hours and 10 days later. The reserved serum was used to realization of cortisol measure by radioimmunoassay (on already described periods. The statistics analyzes were made by t test and Tukey. The cortisol levels presented difference (p< 0.05 in the dog of caesarian section (6.83 µg/dL but this didn’t differ (p> 0.05 on subsequent days (1.82 µg/dL, 24 hours later; 1.38 µg/dL, 48 hour later; 1.48 µg/dL, 10 days later. The middle values of control group were 3.43, 2.01, 3.59 e 1.72 µg/dL, in partum day, 24 hours later, 48 hours later and 10 days later. The stress because partum dystocic induced to liberation of cortisol, normalizing in subsequent days, but don’t have variation after cesarian (surgical stress don’t induced bigger liberation of cortisol or partum natural, composed compatible with the one found in the literature.
    KEY WORDS: Bitches, caesarian section, cortisol.
    Perras sometidas a cesárea por estar en situación distinta de la fisiológica, pueden presentar alteraciones séricas para se adaptaren a esa nueva condición de estrés. Una de las posibles alteraciones, es la concentración de cortisol durante el período peri-parto. Siendo así, el objetivo de ese estudio fue cuantificar los niveles séricos del cortisol en perras sometidas a cesárea en la fase de parto y posparto en la fase de parto y posparto (en el día del acto quirúrgico o parto, 24h, 48h y 10 días después. El método de radioinmunoensayo fue utilizado para la realización del dosaje de cortisol sérico (en los períodos ya descritos. La evaluación estadística fue realizada por medio de los testes t y Tukey. El nivel de cortisol sérico presentó diferencia (p< 0,05 en el día de la cesárea (6,83 µg/dL, pero no hubo diferencia estadística (p> 0,05 en los días consecutivos (1,82 µg/dL, 24 horas después; 1,38 µg/dL, 48 horas después; 1,48 µg/dL 10 días después. Los niveles medios del grupo control fueron 3,43, 2,01, 3,59 y 1,72 µg/dL, después del parto, 24, 48 horas y 10 días después, respectivamente. El estrés debido a la distocia elevó la liberación de esa hormona, que volvió a la normalidad en los días siguientes, pero el estrés quirúrgico no promovió aumento en la liberación de cortisol en perras sometidas a cesárea, y los animales del grupo control presentaron niveles séricos de cortisol, en los debidos períodos, de acuerdo con los descritos por la literatura.

  16. TEORES SÉRICOS DE CORTISOL DE FÊMEAS CANINAS (Canis familiaris – LINNAEUS, 1758) SUBMETIDAS À CESARIANA SERIC LEVELS OF CORTISOL IN BITCHES (Canis familiaris – LINNAEUS, 1758) SUBMITTED TO AESARIAN SECTION Niveles séricos del cortisol en perras (Canis familiaris – Linnaeus, 1758) sometidas a cesárea

    OpenAIRE

    Diogo José Cardilli; Patrícia Rotta Lopes; Gilson Hélio Toniollo; Valeska Rodrigues; João Ademir de Oliveira

    2009-01-01

    Cadelas submetidas à cesariana, por estarem em situação diferente da fisiológica, podem apresentar alterações séricas para se adaptarem a essa nova condição de estresse. Dentre as possíveis alterações, encontram-se as concentrações de cortisol durante o período periparto. Sendo assim, o objetivo deste estudo foi quantificar os teores séricos do cortisol de cadelas submetidas à cesariana na fase de parto e pós-parto (no dia do ato cirúrgico ou parto, 24 horas, 48 horas e dez dias ap...

  17. Taxonomy Icon Data: dog [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available s_NS.png http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Canis+lupus+familiaris&t=L http://biosciencedbc.jp/taxonomy_icon/icon....cgi?i=Canis+lupus+familiaris&t=NL http://biosciencedbc.jp/taxonomy_icon/icon....cgi?i=Canis+lupus+familiaris&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Canis+lupus+familiaris&t=NS ...

  18. Hallazgo de Ehrlichia canis en Chile, informe preliminar Ehrlichia canis in Chile; preliminary report

    Directory of Open Access Journals (Sweden)

    J. LÓPEZ

    1999-01-01

    Full Text Available Se describe el primer caso de Ehrlichiosis canina detectado en Chile, causado por la rickettsia Ehrlichia canis y transmitida por el vector Rhipicephalus sanguineus. El diagnóstico clínico fue confirmado en Alemania por Inmunofluorescencia Indirecta (IFATThe first case of canine ehrlichiosis detected in Chile is described. It is caused by the rickettsia Ehrlichia canis and carried by the vektor Rhipicephalus sanguineus. The clinical diagnosis was confirmed in Germany using the Immunofluorescent Antibody Test (IFA

  19. Food preferences of the Golden Jackal Canis aureus in the Gir National Park and Sanctuary, Gujarat, India

    OpenAIRE

    M. Shamshad Alam; Khan, Jamal A; Chege H. Njoroge; Sandeep Kumar; Meena, R L

    2015-01-01

    The feeding habits of the Golden Jackal Canis aureus were investigated by analysis of its scat contents (n=81), collected between October 2007 and June 2008 in Gir National Park and Sanctuary, Gujarat, India. Jackal dietary habits reflected the availability of a wide variety of food items and the differential vulnerability of prey. Potential animal and plant foods available to jackal varied because of their seasonal variability. About 32.69% scats were found to have only one prey item, wherea...

  20. Forest fragmentation is associated with primary brood sex ratio in the treecreeper (Certhia familiaris).

    OpenAIRE

    Suorsa, Petri; Helle, Heikki; Huhta, Esa; Jäntti, Ari; Nikula, Ari; Hakkarainen, Harri

    2003-01-01

    We studied the primary brood sex ratio of an old-growth forest passerine, the Eurasian treecreeper (Certhia familiaris), along a gradient of forest fragmentation. We found evidence that male nestlings were more costly to produce, since they suffered twofold higher nestling mortality and were larger in body size than females. Furthermore, the proportion of males in the brood was positively associated with the provisioning rate and the amount of food delivered to the nestlings. During the first...

  1. Book review. Conoscere gli animali familiari. Francesca Bellini, Alessia Liverini, Vincenzo Rosa

    OpenAIRE

    Manuel Graziani

    2014-01-01

    Conoscere gli animali familiari è la settima uscita della collana diretta da Paolo Polidori "produzioni animali e sicurezza alimentare" sulla ricerca nell'ambito della nutrizione e alimentazione animale, zootecnia, ispezione degli alimenti di origine animale, clinica medica e parassitologia veterinaria con risvolti di natura tecnica, scientifica e pratica. Il volume, redatto da medici veterinari in servizio presso differenti Aziende Sanitarie italiane, è un sintetico manuale su domesticazi...

  2. The transmission of Babesia canis to the wild dog Lycaon pictus (Temminck) and black-backed jackal Canis mesomelas Schreber.

    Science.gov (United States)

    Van Heerden, J

    1980-06-01

    Babesia canis was successfully transmitted from the domestic dog to 3 wild dogs Lycaon pictus and 4 black-backed jackals Canis mesomelas. Both wild dogs and black-backed jackals showed no clinical signs or clinical pathological evidence of disease. Trophozoites of Babesia canis were found in peripheral blood smears from all experimental animals. The disease was also successfully transmitted from both black-backed jackals and wild dogs to the domestic dog. PMID:7252967

  3. The transmission of Babesia canis to the wild dog Lycaon pictus (Temminck) and black-backed jackal Canis mesomelas Schreber.

    Science.gov (United States)

    Van Heerden, J

    1980-06-01

    Babesia canis was successfully transmitted from the domestic dog to 3 wild dogs Lycaon pictus and 4 black-backed jackals Canis mesomelas. Both wild dogs and black-backed jackals showed no clinical signs or clinical pathological evidence of disease. Trophozoites of Babesia canis were found in peripheral blood smears from all experimental animals. The disease was also successfully transmitted from both black-backed jackals and wild dogs to the domestic dog.

  4. Pathogenic fungus Microsporum canis activates the NLRP3 inflammasome.

    Science.gov (United States)

    Mao, Liming; Zhang, Liping; Li, Hua; Chen, Wei; Wang, Hongbin; Wu, Shuxian; Guo, Caiqin; Lu, Ailing; Yang, Guiwen; An, Liguo; Abliz, Paride; Meng, Guangxun

    2014-02-01

    Microsporum canis is a pathogenic fungus with worldwide distribution that causes tinea capitis in animals and humans. M. canis also causes invasive infection in immunocompromised patients. To defy pathogenic fungal infection, the host innate immune system is the first line of defense. As an important arm of innate immunity, the inflammasomes are intracellular multiprotein complexes that control the activation of caspase-1, which cleaves proinflammatory cytokine pro-interleukin-1β (IL-1β) into its mature form. To determine whether the inflammasome is involved in the host defense against M. canis infection, we challenged human monocytic THP-1 cells and mouse dendritic cells with a clinical strain of M. canis isolated from patients with tinea capitis. We found that M. canis infection triggered rapid secretion of IL-1β from both THP-1 cells and mouse dendritic cells. Moreover, by using gene-specific shRNA and competitive inhibitors, we determined that M. canis-induced IL-1β secretion was dependent on NLRP3. The pathways proposed for NLRP3 inflammasome activation, namely, cathepsin B activity, K(+) efflux, and reactive oxygen species production, were all required for the inflammasome activation triggered by M. canis. Meanwhile, Syk, Dectin-1, and Card9 were found to be involved in M. canis-induced IL-1β secretion via regulation of pro-IL-1β transcription. More importantly, our data revealed that M. canis-induced production of IL-1β was dependent on the NLRP3 inflammasome in vivo. Together, this study unveils that the NLRP3 inflammasome exerts a critical role in host innate immune responses against M. canis infection, and our data suggest that diseases that result from M. canis infection might be controlled by regulating the activation of inflammasomes. PMID:24478101

  5. Helicobacter canis bacteremia in a renal transplant patient

    NARCIS (Netherlands)

    van der Vusse, M. L.; van Son, W. J.; Ott, A.; Manson, W.

    2014-01-01

    Here we present a case report of a 41-year-old woman suffering from high fever and bacteremia due to Helicobacter canis, 11months after kidney transplantation. Identification of H.canis was achieved by 16s rDNA sequence analysis of a positive blood culture. The patient was restored fully to health a

  6. "Toxocara canis" Infection of Children: Epidemiology and Neurospychologic Findings.

    Science.gov (United States)

    Marmor, Michael; And Others

    1987-01-01

    Presents results of a serologic survey for antibodies to Toxocara canis (the common roundworm of dogs) in a sample of 4,652 New York City children. Discusses findings of a case-control study conducted to identify host and environmental risk factors for T. canis infection and to investigate its consequences. (KH)

  7. [Prevalence of ocular lesions in children seropositive to Toxocara canis].

    Science.gov (United States)

    Sánchez T, Juan E; López G, Juan P; González N, Militza; Villaseca D, Eduardo; Manieu M, Denise; Roizen B, Alejandra; Noemí H, Isabel; Viovy A, Alejandro

    2011-10-01

    Intraocular invasion by Toxocara canis is one of the most commonly recognized etiologies of uveitis and blindness in children. In order to estimate the prevalence of ocular lesions caused by toxocariasis in a pediatric referral hospital, we conducted a retrospective analysis of clinical charts of all children seropositive to Toxocara canis, who also had an eye exam between the years 2005 and 2009 at the Calvo Mackenna Children's Hospital in Santiago, Chile. We identified 175 children [mean age 6 years (range 0.66-15)] seropositive to Toxocara canis, who had dilated eye exam. Only one child [(0.57%); 95% CI, -0.55 - 1.69] had ophthalmoscopic findings compatible with Toxocara canis infection. The patient also suffered from decreased vision of the affected eye. The information gained from this study may be of useful for the implementation of algorithms for the ophthalmological examination of children seropositive to Toxocara canis in public hospitals in Chile. PMID:22051620

  8. Estudio histoquímico e inmunohistoquímico de los músculos de la lengua, paladar y faringe en el perro (Canis familiaris L.)

    OpenAIRE

    Sánchez Collado, Cayetano

    2009-01-01

    Un análisis de los tipos de fibras y de su distribución fue realizado en muestras de músculos de la lengua (mm. geniogloso, estilogloso, hiogloso y lingual propio), del paladar y fauces (mm. palatofaríngeo, palatino, elevador y tensor del velo palatino) y de la faringe (mm. terigofaríngeo, estilofaríngeo caudal, hiofaríngeo, tirofaríngeo y cricofaríngeo) en la especie canina. Asimismo, se procesaron muestras del músculo semitendinoso, que fue utilizado como músculo control. La tipificación fi...

  9. Individual differences in social and non-social behaviors in domestic dogs (Canis familiaris) during the acquisition, extinction and reacquisition of a problem solving task.

    Science.gov (United States)

    Shimabukuro, Carolina; Putrino, Natalia; Helbling, Julia; Tognetti, Sandra; Bentosela, Mariana

    2015-04-01

    Dogs are able to solve different problems by trial and error learning, but it seems that they cannot understand the means-end connection. Some studies suggest that dogs' performance is influenced by their breed and by the level of familiarity with the person they interact with. In our study, we assess individual differences in both social and non-social responses in a problem-solving task during the acquisition, extinction, and reacquisition phases. In order to investigate the effect of familiarity, in the first experiment, the human present during the task was either a familiar (the dog's owner) or unfamiliar person. In the second experiment, we compared breeds (Retrievers and Shepherds) that had previously shown differences in a communicative task. The results revealed that all groups learned the task and became more efficient in the acquisition trials. These non-social responses diminished during extinction, where an increase in social responses was observed. With regard to individual differences, dogs were more persistent in searching the reward during the second extinction trial when the owner was present (in contrast with a stranger), and also looked longer at the unfamiliar person at the beginning of the acquisition trial. On the other hand, Retrievers showed greater social motivation during reacquisition and Shepherds picked up more bones during the third acquisition trial, thus suggesting a more persistent search of the reward. These findings highlight the relevance of studying different learning schedules as well as individual differences in problem-solving ability so as to improve selection and training techniques.

  10. Shut up and pet me! Domestic dogs (Canis lupus familiaris) prefer petting to vocal praise in concurrent and single-alternative choice procedures.

    Science.gov (United States)

    Feuerbacher, Erica N; Wynne, Clive D L

    2015-01-01

    The nature of the interactions that maintain the social behavior of dogs toward humans and which interactions dogs prefer have not been thoroughly investigated. We focused here on dogs' preference for petting and vocal praise, and the influence that familiarity (owner vs. stranger) has on that preference. We first used concurrent choice to evaluate dogs' preference for petting or vocal praise and measured the initial choice, the time spent with each alternative, and the number of within-session alternations. We assessed dogs' preference for petting or vocal praise in (1) shelter dogs, (2) owned dogs with strangers providing both interactions, and (3) owned dogs with the dog's owner providing the interactions. Across all experimental groups, dogs preferred petting to vocal praise. We next assessed time spent with each alternative when only one alternative was available at a time in shelter dogs and owned dogs (Experiment 2). Shelter dogs were tested with a stranger and owned dogs were tested with their owners providing the interaction. Dogs alternated between petting and vocal praise, vocal praise and no interaction, or received only petting for eight 3-min sessions of each comparison. Both shelter and owned dogs spent significantly longer in proximity to the experimenter when the interaction was petting compared to vocal praise. Vocal praise produced as little proximity-seeking behavior as did no interaction. Additionally, dogs did not show any sign of satiation with petting across all eight sessions. Overall, petting seems to be an important interaction between dogs and humans that might maintain inter-specific social behavior but vocal praise likely has to be specifically conditioned. This article is part of a Special Issue entitled: Canine Behavior.

  11. Purification and characterization of the major whey proteins from the milks of the bottlenose dolphin (Tursiops truncatus), the Florida manatee (Trichechus manatus latirostris), and the beagle (Canis familiaris).

    Science.gov (United States)

    Pervaiz, S; Brew, K

    1986-05-01

    The major whey proteins of the milks of the dolphin, manatee, and beagle were purified by gel filtration and ion exchange chromatography and characterized and identified by molecular weight determination, amino acid analysis, N-terminal sequencing, and activity measurements. The major whey protein components from all three species were found to be monomeric beta-lactoglobulins. These proteins were all active in binding retinol. Dolphin milk contained two beta-lactoglobulins (designated 1 and 2) which showed a slight difference in molecular weight and considerably divergent N-terminal sequences, whereas the other milks only contained a single form of beta-lactoglobulin. alpha-Lactalbumins were purified from dolphin and dog milks and were active in promoting lactose synthesis by bovine galactosyltransferase. The dolphin protein had an N-terminal sequence more similar to ruminant alpha-lactalbumins than to those known from other species. Although alpha-lactalbumin activity has been detected in manatee milk at low levels, the corresponding protein was not isolated. In addition, dog milk was found to contain high levels of lysozyme (greater than 1.0 mg/ml), which were identified by activity and sequencing. The functional and evolutionary implications of these results are discussed. PMID:3707136

  12. A Review of Domestic Dogs' ("Canis Familiaris") Human-Like Behaviors: Or Why Behavior Analysts Should Stop Worrying and Love Their Dogs

    Science.gov (United States)

    Udell, Monique A. R.; Wynne, C. D. L.

    2008-01-01

    Dogs likely were the first animals to be domesticated and as such have shared a common environment with humans for over ten thousand years. Only recently, however, has this species' behavior been subject to scientific scrutiny. Most of this work has been inspired by research in human cognitive psychology and suggests that in many ways dogs are…

  13. Distribución de los ectoparásitos de Canis lupus familiaris L. (Carnivora: Canidae) de Panamá

    OpenAIRE

    Bermúdez, Sergio; Miranda, Roberto

    2011-01-01

    Objetivo. Determinar la distribución de ectoparásitos de perros en Panamá. Materiales y métodos. Se examinaron 720 individuos en 57 comunidades. Resultados. Los resultados demostraron que el 84% de los perros presentaron al menos una especie de ectoparásito. Los perros de tierras bajas mostraron un mayor porcentaje de parasitismo y mayor biodiversidad de parásitos que los animales de tierras altas. Se encontraron siete especies de garrapatas, cuatro de pulgas, dos de piojo...

  14. A Review of Domestic Dogs' (Canis Familiaris) Human-Like Behaviors: Or Why Behavior Analysts Should Stop Worrying and Love Their Dogs

    OpenAIRE

    Udell, Monique A.R; Wynne, C. D. L.

    2008-01-01

    Dogs likely were the first animals to be domesticated and as such have shared a common environment with humans for over ten thousand years. Only recently, however, has this species' behavior been subject to scientific scrutiny. Most of this work has been inspired by research in human cognitive psychology and suggests that in many ways dogs are more human-like than any other species, including nonhuman primates. Behavior analysts should add their expertise to the study of dog behavior, both to...

  15. Toxocara canis and the allergic process.

    Science.gov (United States)

    Zaia, Mauricio Grecco; Oliveira, Sandra Regina Pereira de; Castro, Cynthia Aparecida de; Soares, Edson Garcia; Afonso, Ana; Monnazzi, Luis Gustavo S; Peitl Filho, Oscar; Faccioli, Lúcia Helena; Anibal, Fernanda de Freitas

    2015-09-01

    The protective effect of infectious agents against allergic reactions has been thoroughly investigated. Current studies have demonstrated the ability of some helminths to modulate the immune response of infected hosts. The objective of the present study was to investigate the relationship between Toxocara canis infection and the development of an allergic response in mice immunised with ovalbumin (OVA). We determined the total and differential blood and bronchoalveolar lavage fluid cells using BALB/c mice as a model. To this end, the levels of interleukin (IL)-4, IL-5 and IL-10 and anti-OVA-IgE were measured using an ELISA. The inflammatory process in the lungs was observed using histology slides stained with haematoxylin and eosin. The results showed an increase in the total number of leukocytes and eosinophils in the blood of infected and immunised animals at 18 days after infection. We observed a slight lymphocytic inflammatory infiltrate in the portal space in all infected mice. Anti-OVA-IgE levels were detected in smaller proportions in the plasma of immunised and infected mice compared with mice that were only infected. Therefore, we concluded that T. canis potentiates inflammation in the lungs in response to OVA, although anti-OVA-IgE levels suggest a potential reduction of the inflammatory process through this mechanism. PMID:26517650

  16. Ehrlichia canis in Rhipicephalus sanguineus ticks in the Ivory Coast.

    Science.gov (United States)

    Socolovschi, Cristina; Gomez, José; Marié, Jean-Lou; Davoust, Bernard; Guigal, Pierre-Michel; Raoult, Didier; Parola, Philippe

    2012-12-01

    Canine monocytic ehrlichiosis caused by Ehrlichia canis is distributed globally, but its prevalence in Africa is poorly known. In the study reported herein, 27% of Rhipicephalus sanguineus ticks collected from watchdogs in Abidjan, Ivory Coast, were positive for E. canis using quantitative real-time PCR. A new molecular strategy is proposed that can be used not only for epidemiological study, but also for the diagnosis of canine monocytic ehrlichiosis. Our findings show for the first time the presence of E. canis using molecular tools in the Ivory Coast, providing direct evidence for the presence of this pathogen.

  17. Toxocara canis-Associated Myelitis with Eosinophilic Pneumonia.

    Science.gov (United States)

    Park, Kee Hong; Kim, Young-Soo; Kim, Soo-Kyung; Choi, Nack-Cheon; Kwon, Oh-Young; Lim, ByeongHoon; Park, Ki-Jong

    2016-06-01

    The existence of Toxocara canis-specific antibodies has recently been reported in patients with atopic myelitis. Here, we report the case of a 35-year-old male patient admitted with a chief complaint of right lower limb hypoesthesia lasting for a month. The patient was diagnosed with eosinophilic pneumonia 3 months ago, and a spine MRI revealed the presence of myelitis in the cervicothoracic cord. After confirming the presence of hyper-IgE-emia and Toxocara canis antibodies, the patient was treated with steroids and albendazole treatment, which improved his symptoms. To our knowledge, this is the first case of Toxocara canis-associated myelitis with eosinophilic pneumonia. PMID:27358582

  18. Dietary Assessment

    Science.gov (United States)

    The Epidemiology and Genomics Research Program's goals in Dietary Assessment are to increase the precision of dietary intake estimates by improving self-report of dietary intake and the analytic procedures for processing reported information.

  19. Infections with Ehrlichia canis and Borrelia burgdorferi in a dog

    OpenAIRE

    Tsachev Ilia; Simeonov R.; Petrov Vladimir

    2007-01-01

    A clinical case of Ehrlichia canis and Borrelia burgdorferi infections in a 5year-old male German Shepherd is described. Clinical, serological, necropsy and histopathological examinations supporting the diagnosis have been performed.

  20. Infections with Ehrlichia canis and Borrelia burgdorferi in a dog

    Directory of Open Access Journals (Sweden)

    Tsachev Ilia

    2007-01-01

    Full Text Available A clinical case of Ehrlichia canis and Borrelia burgdorferi infections in a 5year-old male German Shepherd is described. Clinical, serological, necropsy and histopathological examinations supporting the diagnosis have been performed.

  1. Visceral larva migrans: migratory pattern of Toxocara canis in pigs

    DEFF Research Database (Denmark)

    Helwigh, Birgitte; Lind, Peter; Nansen, Peter

    1999-01-01

    The migratory pattern of Toxocara canis was investigated following infection of pigs with 60 000 infective eggs. Groups of six pigs were slaughtered at 7, 14 and 28 days after infection (p.i.), and the number of larvae in selected organs and muscles was determined by digestion. A group...... of uninfected pigs was used as negative controls for blood parameters and weight gain. Toxocara canis migrated well in the pig, although the relative numbers of larvae recovered decreased significantly during the experiment. On day 7 p.i., high numbers of larvae were recovered from the lymph nodes around...... towards T. canis L2/L3 ES products was observed from day 14 p.i. until termination of the experiment, and the maximum eosinophil response was observed 14 days p.i. The pig is a useful non-primate model for human visceral larva migrans, since T. canis migrate well and induce a strong immunological response...

  2. Streptococcus canis arthritis in a cat breeding colony.

    Science.gov (United States)

    Iglauer, F; Kunstýr, I; Mörstedt, R; Farouq, H; Wullenweber, M; Damsch, S

    1991-01-01

    This is the first description of a pathologic condition--arthritis in cats affecting mainly one joint, i.e. monarthritis--caused by Streptococcus canis (S. canis), of the Lancefield serologic group G. Six cases were recorded in a closed cat breeding colony during a 6 month period in 1988, and one additional case in 1990. Therapy with penicillin and streptomycin led to full recovery in four of six cases. The bacterium had been detected from different purulent processes sporadically--including one case of purulent arthritis in 1982--as a nosocomial infection since 1980, the year the breeding colony was established. A possible genetic predisposition (high inbreeding) may have contributed to the accumulation of the six cases in 1988. Although S. canis was isolated in mouse, rat, rabbit and dog, cat and man seem to be more frequently affected. There are some similarities between S. canis-arthritis in cat and man.

  3. A WISE Census of Young Stellar Objects in Canis Major

    OpenAIRE

    Fischer, William J.; Deborah L. Padgett(NASA/GSFC, Code 665, Greenbelt, MC 20770, USA); Stapelfeldt, Karl L.; Sewilo, Marta

    2016-01-01

    With the Wide-Field Infrared Survey Explorer (WISE), we searched for young stellar objects (YSOs) in a 100 deg^2 region centered on the lightly studied Canis Major star forming region. Applying stringent magnitude cuts to exclude the majority of extragalactic contaminants, we find 144 Class I candidates and 335 Class II candidates. The sensitivity to Class II candidates is limited by their faintness at the distance to Canis Major (assumed as 1000 pc). More than half the candidates (53%) are f...

  4. Pathogenic Fungus Microsporum canis Activates the NLRP3 Inflammasome

    OpenAIRE

    Mao, Liming; Zhang, Liping; Li, Hua; Chen, Wei; Wang, Hongbin; Wu, Shuxian; Guo, Caiqin; Lu, Ailing; Yang, Guiwen; An, Liguo; Abliz, Paride; Meng, Guangxun

    2014-01-01

    Microsporum canis is a pathogenic fungus with worldwide distribution that causes tinea capitis in animals and humans. M. canis also causes invasive infection in immunocompromised patients. To defy pathogenic fungal infection, the host innate immune system is the first line of defense. As an important arm of innate immunity, the inflammasomes are intracellular multiprotein complexes that control the activation of caspase-1, which cleaves proinflammatory cytokine pro-interleukin-1β (IL-1β) into...

  5. Reviving the African wolf Canis lupus lupaster in North and West Africa: a mitochondrial lineage ranging more than 6,000 km wide.

    Directory of Open Access Journals (Sweden)

    Philippe Gaubert

    Full Text Available The recent discovery of a lineage of gray wolf in North-East Africa suggests the presence of a cryptic canid on the continent, the African wolf Canis lupus lupaster. We analyzed the mtDNA diversity (cytochrome b and control region of a series of African Canis including wolf-like animals from North and West Africa. Our objectives were to assess the actual range of C. l. lupaster, to further estimate the genetic characteristics and demographic history of its lineage, and to question its taxonomic delineation from the golden jackal C. aureus, with which it has been considered synonymous. We confirmed the existence of four distinct lineages within the gray wolf, including C. lupus/familiaris (Holarctic wolves and dogs, C. l. pallipes, C. l. chanco and C. l. lupaster. Taxonomic assignment procedures identified wolf-like individuals from Algeria, Mali and Senegal, as belonging to C. l. lupaster, expanding its known distribution c. 6,000 km to the west. We estimated that the African wolf lineage (i had the highest level of genetic diversity within C. lupus, (ii coalesced during the Late Pleistocene, contemporaneously with Holarctic wolves and dogs, and (iii had an effective population size of c. 80,000 females. Our results suggest that the African wolf is a relatively ancient gray wolf lineage with a fairly large, past effective population size, as also suggested by the Pleistocene fossil record. Unique field observations in Senegal allowed us to provide a morphological and behavioral diagnosis of the African wolf that clearly distinguished it from the sympatric golden jackal. However, the detection of C. l. lupaster mtDNA haplotypes in C. aureus from Senegal brings the delineation between the African wolf and the golden jackal into question. In terms of conservation, it appears urgent to further characterize the status of the African wolf with regard to the African golden jackal.

  6. Reviving the African wolf Canis lupus lupaster in North and West Africa: a mitochondrial lineage ranging more than 6,000 km wide.

    Science.gov (United States)

    Gaubert, Philippe; Bloch, Cécile; Benyacoub, Slim; Abdelhamid, Adnan; Pagani, Paolo; Djagoun, Chabi Adéyèmi Marc Sylvestre; Couloux, Arnaud; Dufour, Sylvain

    2012-01-01

    The recent discovery of a lineage of gray wolf in North-East Africa suggests the presence of a cryptic canid on the continent, the African wolf Canis lupus lupaster. We analyzed the mtDNA diversity (cytochrome b and control region) of a series of African Canis including wolf-like animals from North and West Africa. Our objectives were to assess the actual range of C. l. lupaster, to further estimate the genetic characteristics and demographic history of its lineage, and to question its taxonomic delineation from the golden jackal C. aureus, with which it has been considered synonymous. We confirmed the existence of four distinct lineages within the gray wolf, including C. lupus/familiaris (Holarctic wolves and dogs), C. l. pallipes, C. l. chanco and C. l. lupaster. Taxonomic assignment procedures identified wolf-like individuals from Algeria, Mali and Senegal, as belonging to C. l. lupaster, expanding its known distribution c. 6,000 km to the west. We estimated that the African wolf lineage (i) had the highest level of genetic diversity within C. lupus, (ii) coalesced during the Late Pleistocene, contemporaneously with Holarctic wolves and dogs, and (iii) had an effective population size of c. 80,000 females. Our results suggest that the African wolf is a relatively ancient gray wolf lineage with a fairly large, past effective population size, as also suggested by the Pleistocene fossil record. Unique field observations in Senegal allowed us to provide a morphological and behavioral diagnosis of the African wolf that clearly distinguished it from the sympatric golden jackal. However, the detection of C. l. lupaster mtDNA haplotypes in C. aureus from Senegal brings the delineation between the African wolf and the golden jackal into question. In terms of conservation, it appears urgent to further characterize the status of the African wolf with regard to the African golden jackal. PMID:22900047

  7. Book review. Conoscere gli animali familiari. Francesca Bellini, Alessia Liverini, Vincenzo Rosa

    Directory of Open Access Journals (Sweden)

    Manuel Graziani

    2014-03-01

    Full Text Available Conoscere gli animali familiari è la settima uscita della collana diretta da Paolo Polidori "produzioni animali e sicurezza alimentare" sulla ricerca nell'ambito della nutrizione e alimentazione animale, zootecnia, ispezione degli alimenti di origine animale, clinica medica e parassitologia veterinaria con risvolti di natura tecnica, scientifica e pratica. Il volume, redatto da medici veterinari in servizio presso differenti Aziende Sanitarie italiane, è un sintetico manuale su domesticazione, cura sanitaria, etnografia e addestramento del proprio cane (o gatto. Gli autori partono dall'assunto che i proprietari scelgono il cane per lo più sulla base del gusto visivo o sulla consuetudine tramandata in famiglia, senza un'esaustiva conoscenza degli aspetti riguardanti l'origine dell'animale, la sua attitudine prevalente, le sue patologie ricorrenti e le eventuali predisposizioni genetiche nei confronti di una determinata patologia. Puntano l'accento sin dalle prime battute sul cambiamento culturale che ha modificato anche il rapporto uomo-animale sotto l'aspetto sociale, effettuale e giuridico. L'animale da semplice "res" si è da tempo affermato come un essere diverso ma senziente, quindi destinatario di tutele, con diritti contemplati dalle carte costituzionali di diversi Paesi. Per questo motivo chi detiene un animale domestico deve prepararsi ad un impegno non riducibile al possesso di un oggetto, al punto di risponderne penalmente per eventuali sofferenze fisiche o psicologiche, per l'abbandono (anche solo temporaneo o per l'incuria. Conoscere gli animali familiari fornisce nozioni scientifiche e sanitarie alla portata di tutti, utili soprattutto nelle occasioni in cui i proprietari dovranno recarsi dal veterinario o affrontare visite legate alla profilassi e alle vaccinazioni di routine.

  8. In vitro production of Toxocara canis excretory-secretory (TES) antigen.

    Science.gov (United States)

    Thomas, Divyamol; Jeyathilakan, N; Abdul Basith, S; Senthilkumar, T M A

    2016-09-01

    Toxocara canis is a widespread gastrointestinal nematode parasite of dogs and cause Toxocara larva migrans, an important zoonotic disease in humans on ingestion of infective eggs. Toxocarosis is one of the few human parasitic diseases whose serodiagnosis uses a standardized antigen, T. canis excretory secretory antigen (TES). The present study describes collection of T. canis adult worm, collection and embryonation of T. canis eggs, hatching and separation of T. canis larvae, in vitro maintenance of T. canis second stage larvae for production of TES, concentration of culture fluid TES and yield of TES in correlation with various methods cited in literature. PMID:27605834

  9. Trophic cascades linking wolves (Canis lupus), coyotes (Canis latrans), and small mammals

    Science.gov (United States)

    Miller, B.J.; Harlow, H.J.; Harlow, T.S.; Biggins, D.; Ripple, W.J.

    2012-01-01

    When large carnivores are extirpated from ecosystems that evolved with apex predators, these systems can change at the herbivore and plant trophic levels. Such changes across trophic levels are called cascading effects and they are very important to conservation. Studies on the effects of reintroduced wolves in Yellowstone National Park have examined the interaction pathway of wolves (Canis lupus L., 1758) to ungulates to plants. This study examines the interaction effects of wolves to coyotes to rodents (reversing mesopredator release in the absence of wolves). Coyotes (Canis latrans Say, 1823) generally avoided areas near a wolf den. However, when in the proximity of a den, they used woody habitats (pine or sage) compared with herbaceous habitats (grass or forb or sedge)- when they were away from the wolf den. Our data suggested a significant increase in rodent numbers, particularly voles (genus Microtus Schrank, 1798), during the 3-year study on plots that were within 3 km of the wolf den, but we did not detect a significant change in rodent numbers over time for more distant plots. Predation by coyotes may have depressed numbers of small mammals in areas away from the wolf den. These factors indicate a top-down effect by wolves on coyotes and subsequently on the rodents of the area. Restoration of wolves could be a powerful tool for regulating predation at lower trophic levels.

  10. Triplex Doppler da artéria renal e a relação entre a ecobiometria dos rins com distância atlanto-coccígea e altura em Canis familiaris Renal artery Triplex Doppler and the relationship between kidney ecobiometry with atlanto-coccyges distance (ACD and height (H in Canis familiaris

    Directory of Open Access Journals (Sweden)

    Expedito Jr Matos Santana

    2009-10-01

    Full Text Available O objetivo do trabalho foi estabelecer a relação entre a ecobiometria renal com medidas de conformação corporal como a distância atlanto-coccígea (DAC e a altura (H de cães adultos saudáveis, obtendo-se parâmetros de normalidade para avaliar o tamanho e volume renal, bem como estabelecer valores de referência para avaliar a perfusão sanguínea dos rins por meio do índice de resistividade (IR e do índice de pulsatilidade (IP do ramo principal da artéria renal. No estudo foram utilizados 22 cães adultos sem raça definida, sendo 11 machos e 11 fêmeas. Os animais foram previamente aferidos quanto a DAC e a H. Os exames ultra-sonográficos foram realizados com um aparelho HDI 4000 PHILIPS munido de um transdutor microconvexo multifreqüêncial (5-8 MHz, dispositivos Doppler Colorido e Doppler de Fluxo. Os animais foram posicionados em decúbito lateral direito ou esquerdo, de acordo com o rim a ser avaliado. Os diâmetros longitudinal (DL e dorsoventral (DDV dos rins foram mensurados na secção longitudinal e, o diâmetro transversal (DT foi aferido no plano transversal. O volume (V foi calculado automaticamente pelo software do ultra-som. Com o uso do Triplex Doppler, o IR e o IP das artérias renais direita e esquerda foram obtidos. Todos os dados foram apresentados em média ± EPM. Análises de regressão linear foram realizadas tendo o DL, DDV, DT e V como variáveis dependentes e a DAC e H como variáveis independentes. Os IR e IP dos rins direito e esquerdo foram comparados pelo teste t de Student. A DAC variou de 54-78cm para machos e 37-71cm para fêmeas e a altura variou entre 34-64 cm para os machos e 24-57cm para as fêmeas. As médias obtidas para DL, DDV, DT e V dos rins esquerdo e direito foram: 5,24±0,27cm, 3,07±0,15cm, 3,07±0,9cm, 28,01±3,4mL e 4,50±0,19cm, 2,88±0,14cm, 2,71±0,15cm, 21,27±2,6mL, respectivamente. As análises de regressão linear entre as medidas lineares e volume renal com a DAC e a H foram significativas para os interceptos e coeficientes de regressão (PThe aim of this paper was to establish the relation between the kidney ecobiometry with atlanto-coccyges distance (ACD and height (H in adult healthy dogs, to obtain normality parameters for assessment of renal size and volume, as well as establish reference values to evaluate kidney blood perfusion by the resistivity index (RI and pulsatility index (PI of main renal artery. The study was applied at 22 adult dogs, 11 males and 11 females. Previously, the DAC and H of all animals were measured. For ultrasonographic examination, the ultra-sound system HDI 4000 PHILIPS equipped with a multi-frequency microconvex transducer, Color Doppler and Spectral Doppler devices was used. The animals were placed into right or left lateral decubitus position, in agreement with the kidney to be assessed. The longitudinal (LD and dorsoventral diameters (DVD of kidney were measured in longitudinal plane, and the transverse diameter (TD was determined in transversal section. The renal volume (V was automatically calculated by the ultrasound software. With Triplex Doppler, the RI and PI of right and left main renal arteries were obtained. All data were represented in mean ± SEM. Linear regression analyses were performed with renal LD, DVD, TD and V as dependent variable, and ACD and H as independent variable. RI and PI were compared between right and left renal arteries with Student's t-test. The LD, DVD, TD (cm and V (ml mean measurements for the left and right kidneys were: 5.24±0.27, 3.07±0.15, 3.07±0.9, 28.01±3.4 and 4.50±0.19, 2.88±0.14, 2.71±0.15, 21.27±2.6. All regression analyses were significant for the intercept and regression coefficient (P<0.01. There were statistical differences on RI and PI means between right and left renal arteries (P=0.001. The RI and PI means of left and right renal artery obtained were: 0.62±0.08 and 1.34±0.18; 0.70±0.06 and 1.62±0.13. The data obtained in the present paper can be used as parameters for evaluation of the renal size, volume and perfusion in adult dogs.

  11. Occurrence of gastrointestinal parasites in dogs (Canis familiaris with acute diarrhea from metropolitan region of Londrina, Parana State, Brazil/ Ocorrência de parasitos gastrintestinais em cães (Canis familiaris com diarréia aguda oriundos da região metropolitana de Londrina, Estado do Paraná, Brasil

    Directory of Open Access Journals (Sweden)

    Pedro Luiz de Camargo

    2007-10-01

    Full Text Available One hundred and fifty fecal samples from dogs with acute diarrhea (Group 1 and from 50 dogs without diarrhea (Group 2 were collected and analyzed at the Veterinary Teaching Hospital of the State University of Londrina, between October, 2004 and October 2005. From the positive samples (29.3% of Group 1, 72.7% were infected by only one agent, while 27.3% had mixed infection. The following genera wereobserved by coproparasitologic evaluation: Giardia sp. (9.3%, Ancylostoma sp. (7.3%, Cystoisospora (7.3%, Entamoeba sp. (6.7%, Toxocara sp.(4%, Pentatrichomanas hominis (3.3%, and Trichurisvulpis (1.3%. From the 50 animals without diarrhea, six (12% were positive by coproparasitologic evaluation: two (4% for Ancylostoma sp., three (6% with Giardia sp., and one (2% for both Ancylostoma sp. and Cystoisospora sp. There was a significant relationship between infection and diarrhea (P=0,005, age and infection (PForam examinadas 150 amostras de fezes colhidas de cães com diarréia aguda (Grupo 1, e outras 50 de animais sem diarréia (Grupo 2, atendidos entre outubro de 2004 e outubro 2005, no Hospital Veterinário Escola da Universidade Estadual de Londrina. Dos 150 animais do G1, 44 (29,3% estavam infectados por helmintos e/ou protozoários, sendo que destes, 32 (72,7% apresentavam infecção simples e 12 (27,3% infecções múltiplas. Os gêneros identificados nestes animais foram: Giardia sp. (9,3%, Cystoisospora sp. (7,3%, Ancylostoma sp. (7,3%, Entamoeba sp. (6,7%, Toxocara sp. (4%, Pentatrichomonas hominis (3,3% e Trichuris vulpis (1,3%. Dos 50 animais sem diarréia, seis (12% eram positivos, dois (4% para Ancylostoma sp., três (6% para Giardia sp. e um (2% para Ancylostoma sp. e Cystoisospora simultaneamente. Houve relação estatisticamente significativa (P=0,005 entre o parasitismo e a ocorrência de diarréia, assim como entre a faixa etária e a proporção de infecções (P<0,001, porém, machos e fêmeas foram igualmente acometidos (P=0,08. O número de cães com raça definida foi significativamente maior do que de cães sem definição racial (P=0,01. Os resultados demonstram a importância de realizaçãoperiódica de exames parasitológicos em cães com e sem diarréia para tratamento específico e adoção medidas de controle e profilaxia.

  12. Occurrence of gastrointestinal parasites in dogs (Canis familiaris) with acute diarrhea from metropolitan region of Londrina, Parana State, Brazil/
    Ocorrência de parasitos gastrintestinais em cães (Canis familiaris) com diarréia aguda oriundos da região metropolitana de Londrina, Estado do Paraná, Brasil

    OpenAIRE

    Pedro Luiz Camargo; Odilon Vidotto; Milton Hissashi Yamamura; Fábio Augusto Galli dos Santos

    2007-01-01

    One hundred and fifty fecal samples from dogs with acute diarrhea (Group 1) and from 50 dogs without diarrhea (Group 2) were collected and analyzed at the Veterinary Teaching Hospital of the State University of Londrina, between October, 2004 and October 2005. From the positive samples (29.3%) of Group 1, 72.7% were infected by only one agent, while 27.3% had mixed infection. The following genera wereobserved by coproparasitologic evaluation: Giardia sp. (9.3%), Ancylostoma sp. (7.3%), Cystoi...

  13. Stability of CaNi5Hx stored at temperatures between 20 and 150 degrees C

    DEFF Research Database (Denmark)

    Jensen, Jens Oluf; Møller, T.S.; Bjerrum, Niels

    2002-01-01

    The stability of CaNi5Hx stored at different temperatures was studied as a function of time. In general AB(5) metal hydrides are known to be metastable with a tendency to disproportionate at elevated temperatures. In the present study samples of CaNi5 were stored in the hydrided state (as CaNi5...

  14. Mycoplasma canis and urogenital disease in dogs in Norway

    DEFF Research Database (Denmark)

    L'Abee-Lund, T.M.; Heiene, R.; Friis, N.F.;

    2003-01-01

    Mycoplasmas identified as Mycoplasma canis were isolated from nine dogs with clinical signs of urogenital disease in Norway over a period of 20 months. Some of the dogs had been treated unsuccessfully with antibiotics, and three were euthanased as a result of severe persistent disease. Seven...... of the dogs had a urinary tract infection, one had chronic purulent epididymitis and one had chronic prostatitis. Overt haematuria was frequently observed among the dogs with cystitis. M canis was isolated in pure culture from seven of the dogs and in mixed culture from the other two. In three cases...... the mycoplasma was cultivated only from urinary sediment, and it was typically obtained in smaller numbers than would be considered indicative of a urinary tract infection. In contrast with most mycoplasmas, the M canis isolated from all the dogs grew on ordinary blood agar plates used for routine...

  15. Toxocara canis infection: Unusual trigger of systemic lupus erythematosus.

    Science.gov (United States)

    Levy, Michaël; Bourrat, Emmanuelle; Baudouin, Véronique; Guillem, Colette; Peuchmaur, Michel; Deschênes, Georges; Fila, Marc

    2015-08-01

    Infection by Toxocara canis can cause systemic vasculitis. We report here a unique case of systemic lupus erythematosus (SLE) triggered by T. canis infection. An 8-year-old girl was treated with albendazole therapy for common toxocariasis, but she developed two weeks later, asthenia, fever, infiltrated maculopapular eruption of the face, peripheral vascular disease with necrosis of the fingers and inflammatory anemia with proteinuria. Anti-nuclear, anti-DNA and anti-Sm antibodies positivity, together with minimal change nephritis with mesangial exclusive IgM deposit on renal biopsy and clinical relapse after initially successful steroid therapy, led to the diagnosis of SLE. T. canis infection can trigger systemic lupus but must also be ruled out of the differential diagnosis given its association with autoimmunity. PMID:26147636

  16. Book review, Amati cani, José Jorge Letria

    Directory of Open Access Journals (Sweden)

    Manuel Graziani

    2008-03-01

    Full Text Available Con Amati cani ci discostiamo per una volta dalle pubblicazioni a carattere scientifico, per dare il giusto risalto ad un’interessante raccolta di narrativa che esplora il rapporto tra l'uomo e il suo miglior amico. José Jorge Latria, noto soprattutto per essere un esponente di spicco della canzone politica portoghese e per le sue opere poetiche, teatrali e di letteratura per ragazzi, nello scrivere questo libro compie un vero e proprio atto d’amore verso i cani, con il preciso intento di costringere i lettori ad eliminare dal proprio vocabolario il gratuito modo di dire ‘mondo cane’. L’Autore delinea brevi ritratti di cani che, da Argo in poi, hanno accompagnato da amici veri i loro celebri padroni nella buona e nella cattiva sorte: racconta cioè la storia di quei cani che non sono sprofondati nella voragine dell’oblio perchè i loro padroni hanno raggiunto la celebrità nel mondo della letteratura, della politica, del cinema, delle scienze o della musica. Con a fianco un amico fedele come un cane, la vita ha avuto un sapore diverso per Ernest Hemingway, Isaac Newton, Sigmund Freud, Buster Keaton, Marilyn Monroe, Pablo Picasso, John Steinbeck, Lord Byron, Tim Burton e altri ancora, tutti personaggi che sono presenti in questo libro grazie ai cani che hanno condiviso con loro la vita e le memorie. La lettura di Amati cani dà piacere poichè in ognuno di questi racconti batte, affettuoso e delicato, il cuore di un cane; ma dà anche un pò da pensare in quanto celebra in maniera molto tenera l’amore, la fedeltà e la solidarietà tra l’uomo e il suo speciale amico a quattro zampe.

  17. NCBI nr-aa BLAST: CBRC-PCAP-01-1484 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-1484 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 93% ...

  18. NCBI nr-aa BLAST: CBRC-CFAM-20-0004 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-20-0004 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 0.0 97% ...

  19. NCBI nr-aa BLAST: CBRC-SARA-01-1323 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1323 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 2e-62 94% ...

  20. NCBI nr-aa BLAST: CBRC-OPRI-01-0072 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0072 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 1e-91 91% ...

  1. NCBI nr-aa BLAST: CBRC-OCUN-01-0084 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-0084 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 3e-64 95% ...

  2. NCBI nr-aa BLAST: CBRC-MDOM-04-0139 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-04-0139 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 87% ...

  3. NCBI nr-aa BLAST: CBRC-PVAM-01-0795 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0795 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 1e-123 81% ...

  4. NCBI nr-aa BLAST: CBRC-STRI-01-2759 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2759 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 96% ...

  5. NCBI nr-aa BLAST: CBRC-MEUG-01-2654 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2654 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 79% ...

  6. Hepatozoon canis infection in Slovakia: imported or autochthonous?

    Science.gov (United States)

    Majláthová, Viktória; Hurníková, Zuzana; Majláth, Igor; Petko, Branislav

    2007-01-01

    Tissue samples from nine red foxes (four samples of striated muscle tissue and five samples of heart tissue) that originated from the Michalovce district (Slovakia), an area with endemic occurrence of canine babesiosis were examined by PCR method using primers amplifying a fragment of the 18S rRNA spanning the V4 region of Babesia and Theileria. An unexpected determination of 450 bp DNA fragment of Hepatozoon canis was found in four samples. Partial sequences of the 18S rRNA gene from the H. canis showed 100% similarity with the sequence from Brasil isolate of H. canis from a pampas fox (Pseudalopex gymnocercus) (AY471615) as well as from a fox in Spain (AY150067) and from a dog in Brazil (AY864677). In the present study, we report the first PCR detection of Hepatozoon canis in a naturally infected red fox from Slovakia, a Rhipicephalus sanguineus-free region. We assume that the infection was spread by infected R. sanguineus that might have been brought to Slovakia by travelers, by golden jackals, or by foxes migrating because of expansion of golden jackals and environmental and climate changes. PMID:17627439

  7. Serodetection of Ehrlichia canis amongst dogs in central Namibia

    Directory of Open Access Journals (Sweden)

    Rutendo Manyarara

    2015-03-01

    Full Text Available Ehrlichia canis is a major pathogen in dogs throughout Africa, yet it has not been reported in Namibia. The aim of this study was to determine the seroprevalence of canine ehrlichiosis in central Namibia using the ImmunoComb assay (Biogal, Galed Laboratories. The study included 76 dogs that presented to the Rhino Park Veterinary Clinic in the north-western suburb of Khomasdal, Windhoek, Namibia, as well as 30 stray dogs from the Windhoek branch of the Society for the Prevention of Cruelty to Animals. Of the 106 dogs tested, 53.8% were seropositive at titres > 1:80. Dogs that presented with symptoms of E. canis infection had a significantly higher seroprevalence (86.6% compared with apparently healthy dogs (41.6% (P = 0.00. Location of habitation was significant (P < 0.017, with a high percentage of dogs exposed to E. canis living in the northern or north-western part of Windhoek. As the first study to serologically establish E. canis as a major pathogen in dogs in central Namibia, it is notable that the highest proportion of seropositive dogs came from low-income areas. Further investigation is necessary to describe the ecology of this important tick-borne pathogen of companion animals in Namibia.

  8. MRI findings of spinal visceral larva migrans of Toxocara canis

    International Nuclear Information System (INIS)

    Purpose: The purpose of this study is to investigate the MRI findings of visceral larva migrans (VLS) of Toxocara canis in spinal cord. Materials and methods: We retrospectively reviewed spinal MRI findings in eight patients with serologically proven Toxocara canis between 2005 and 2008. We evaluated the location, length, extent and migration of the lesion, MR signal intensity (SI), enhancement pattern, and swelling of the spinal cord. We evaluated clinical features including presenting symptoms and signs and treatment response. Results: Total 8 patients (M = 8; age range 36-79 years) were included. The lesions were located in the cervical or thoracic spinal cord in all patients. All lesions showed high SI and minimal or mild swelling of involved spinal cord on T2WI and focal nodular enhancement on posterior or posterolateral segment of spinal cord. The length of involved lesion was relatively short in most patients. There was a migration of lesion in one patient. In spite of albendazole or steroid treatment, neurological symptoms or signs were not significantly improved in all patients. Conclusion: Although all lesions show non-specific imaging findings like non-tumorous myelopathy mimicking transverse myelitis, single lesion, focal nodular enhancement on posterior or posterolateral segment of spinal cord, relatively short segmental involvement and migration of lesion may be characteristic findings of spinal VLM of Toxocara canis. In addition, the reluctant response to the treatment may be characteristic of spinal VLM of Toxocara canis.

  9. Long daily movements of wolves (Canis lupus) during pup raising

    Science.gov (United States)

    Mech, L. David; Cluff, H. Dean

    2009-01-01

    Wolves, Canis lupus, on Ellesmere Island traveled a daily round-trip distance of 40.2 km from their den to a landfill during July 2008, plus an undetermined distance hunting after leaving the landfill. Although long travels by Wolves are well known, this appears to be the first documentation of long daily movements by Wolves rearing pups.

  10. MRI findings of spinal visceral larva migrans of Toxocara canis

    Energy Technology Data Exchange (ETDEWEB)

    Lee, In Ho, E-mail: leeinho1974@hanmail.ne [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Department of Radiology, Chungnam National University Hospital, 33 Munhwa-ro, Jung-gu, Daejeon 301-721 (Korea, Republic of); Kim, Sung Tae, E-mail: st7.kim@hotmail.co [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Oh, Dae Kun, E-mail: odk6464@nate.co [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Kim, Hyung-Jin, E-mail: hyungkim@skku.ed [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Kim, Keon Ha, E-mail: somatom@skku.ed [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Jeon, Pyoung, E-mail: drpjeon@gmail.co [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Byun, Hong Sik, E-mail: byun5474@skku.ed [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of)

    2010-08-15

    Purpose: The purpose of this study is to investigate the MRI findings of visceral larva migrans (VLS) of Toxocara canis in spinal cord. Materials and methods: We retrospectively reviewed spinal MRI findings in eight patients with serologically proven Toxocara canis between 2005 and 2008. We evaluated the location, length, extent and migration of the lesion, MR signal intensity (SI), enhancement pattern, and swelling of the spinal cord. We evaluated clinical features including presenting symptoms and signs and treatment response. Results: Total 8 patients (M = 8; age range 36-79 years) were included. The lesions were located in the cervical or thoracic spinal cord in all patients. All lesions showed high SI and minimal or mild swelling of involved spinal cord on T2WI and focal nodular enhancement on posterior or posterolateral segment of spinal cord. The length of involved lesion was relatively short in most patients. There was a migration of lesion in one patient. In spite of albendazole or steroid treatment, neurological symptoms or signs were not significantly improved in all patients. Conclusion: Although all lesions show non-specific imaging findings like non-tumorous myelopathy mimicking transverse myelitis, single lesion, focal nodular enhancement on posterior or posterolateral segment of spinal cord, relatively short segmental involvement and migration of lesion may be characteristic findings of spinal VLM of Toxocara canis. In addition, the reluctant response to the treatment may be characteristic of spinal VLM of Toxocara canis.

  11. Investigation of tick vectors of Hepatozoon canis in Brazil.

    Science.gov (United States)

    Demoner, Larissa de Castro; Rubini, Adriano Stefani; Paduan, Karina dos Santos; Metzger, Betina; de Paula Antunes, João Marcelo Azevedo; Martins, Thiago Fenandes; Mathias, Maria Izabel Camargo; O'Dwyer, Lucia Helena

    2013-12-01

    Hepatozoon canis is a common apicomplexan parasite of dogs. In Brazil, in addition to Rhipicephalus sanguineus, Amblyomma ovale, Amblyomma cajennense, and Rhipicephalus (Boophilus) microplus have been suggested to act as vectors. The present study aimed to evaluate, under controlled conditions, the acquisition of H. canis by A. ovale, R. sanguineus, and A. cajennense after feeding on naturally infected dogs. Cytological and histophatological examinations were performed to recover oocysts and other sporogonic stages of the protozoan from the experimentally infected nymphs and adults. None of the R. sanguineus (n=30) or A. cajennense nymphs (n=15) that were dissected after feeding on H. canis naturally infected dogs became infected by the hemoparasite. Likewise, none of the R. sanguineus (n=165) and A. cajennense (n=114) adult ticks that were fed as nymphs on dogs demonstrated infection. Additionally, A. cajennense adult ticks were incapable of acquiring the infection, since no parasite was found in 62 adults that fed on H. canis-infected dogs. With regard to A. ovale ticks, 2 different infestations were carried out. Firstly, a dog with naturally occurring hepatozoonosis was infested with A. ovale adults originating from Rondônia, Brazil. Ticks fed to full engorgement. A total of 31 adults was collected from the dog and dissected on the third day after natural detachment. Oocysts were detected in 13 (42%) of the ticks. The second experimental infestation was carried out using adult ticks originating from São Paulo, Brazil. Surprisingly, of the 103 dissected ticks, only one (1%) contained oocysts in the hemocoel. No other sporogonic stage was found. Results indicate that different strains of A. ovale ticks may exist in Brazil with different susceptibilities to pathogens. Furthermore, it is possible that R. sanguineus and A. cajennense have little or no importance in the transmission of H. canis in rural areas of Brazil.

  12. Dietary Fiber

    Science.gov (United States)

    Fiber is a substance in plants. Dietary fiber is the kind you eat. It's a type of carbohydrate. You may also see it listed on a food label as soluble fiber or insoluble fiber. Both types have important health benefits. Good sources of dietary fiber include Whole grains Nuts ...

  13. Disodium cromoglycate prevents ileum hyperreactivity to histamine in Toxocara canis-infected guinea pigs.

    Science.gov (United States)

    Sá-Nunes, A; Corrado, A P; Baruffi, M D; Faccioli, L H

    2003-11-01

    The aim of this study was to investigate whether Toxocara canis infection in guinea pigs provokes changes in ileum responsiveness to histamine. Ileum segments from control and T. canis-infected groups were placed at isometric conditions and submitted to various doses of histamine. No changes were observed between controls and T. canis-infected groups at days 3, 6 and 12 after infection. However, at days 18 and 24 after infection, there was a significant increase in ileum responsiveness to histamine in T. canis-infected group. Pre-incubation of ileum segments with 1mgml(-1) disodium cromoglycate (DSCG) prevented the increased responsiveness to histamine in T. canis-infected guinea pigs and did not affect ileum contractility in non-infected animals. These results indicate that T. canis-infected guinea pigs develop increased intestinal responsiveness to histamine and that DSCG prevents alterations in smooth-muscle contractility. PMID:12967589

  14. Microsporum canis scalp ringworm: its primary or secondary ectothrix character.

    Science.gov (United States)

    Vismer, H F

    1993-06-01

    This study supports the view that, in cases of tinea capitis due to a Microsporum canis infection, ectothrix arthroconidium formation is extrapilary and arises from intrapilary hyphae. The hyphae of M. canis perforate and digest the hair cuticle to alter its appearance from a normally identifiable structure of imbricated cells with a distal free border, to a grossly altered and pathological layer. Conidium production mainly takes place outside the hair shaft and forms thick clusters between the cuticular tiles. Finally, a shaft of conidia is formed around the hair. The cuticular covering of such a conidium sheath belongs to the root sheath of the hair follicle, and not to the hair structure proper. PMID:8108682

  15. Dicty_cDB: SHH577 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0334758850 Dog Library Canis familiaris genomic,genomic survey sequence. 30 0.052... 3 CE699805 |CE699805.1 tigr-gss-dog-17000368830355 Dog Library Canis familiaris genomic, genomic survey seq...uence. 40 0.16 2 CE011802 |CE011802.1 tigr-gss-dog-17000321033562 Dog Library Canis familiaris genomic, genomic survey...og Library Canis familiaris genomic, genomic survey sequence. 46 0.59 1 CE427774 |CE427774.1 tigr-gss-dog-17...000362871784 Dog Library Canis familiaris genomic, genomic survey sequence. 30 1.5 3 CE637188 |CE637188.1 ti

  16. Dicty_cDB: VSE320 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available og Library Canis familiaris genomic, genomic survey sequence. 40 0.001 2 AC106112 |AC106112.6 Rattus norvegi...003 3 CE198350 |CE198350.1 tigr-gss-dog-17000372200949 Dog Library Canis familiaris genomic, genomic survey ...sequence. 50 0.005 1 CE120051 |CE120051.1 tigr-gss-dog-17000325900106 Dog Library Canis familiaris genomic, genomic survey...804 Dog Library Canis familiaris genomic, genomic survey sequence. 38 0.005 2 AC139061 |AC139061.3 Mus muscu... |CE001298.1 tigr-gss-dog-17000320774441 Dog Library Canis familiaris genomic, genomic survey

  17. A new star-forming region in Canis Major

    Science.gov (United States)

    Magakian, T. Yu.; Movsessian, T. A.; Bally, J.

    2016-07-01

    A new southern star-formation region, located at an estimated distance of ˜1.5 kpc in the Lynds 1664 dark cloud in Canis Major, is described. Lynds 1664 contains several compact star clusters, small stellar groups and young stars associated with reflection nebulae. Narrow-band H α and [S II] images obtained with the 4-m telescope at the Cerro Tololo Inter-American Observatory reveal more than 20 new Herbig-Haro objects associated with several protostellar outflows.

  18. Schistosoma spindale infection in a captive jackal (Canis aureus)

    OpenAIRE

    Vimalraj, P. G.; Latchumikanthan, A.

    2013-01-01

    This report is based on the findings from a captive jackal (Canis aureus) housed in Amirthi Zoological Park, Javadu Hills, Vellore. The animal was reported to be dull, depressed and also had diarrhea. Fecal samples were collected in 10 % formalin and subjected to direct and sedimentation method of faecal examination and was examined for endoparasitic infection. Surprisingly, fecal examination revealed two spindle shaped eggs having terminal spine with a size of 250μ by 60μ. The eggs were iden...

  19. Acral lick dermatitis in a jackal (Canis aureus).

    Science.gov (United States)

    Yeruham, I; Nyska, A

    1998-06-01

    Acral lick dermatitis was diagnosed in a 6-mo-old female jackal (Canis aureus) that was born and housed in a zoological garden in Hafez-Haim, Israel. Other dermatologic diseases were ruled out. Although the lesions were presumed to be psychogenic in origin, they resolved with topical therapy using an ointment containing benzocaine, neomycin sulfate, and hydrocortisone acetate. No recurrence has been observed. PMID:9732044

  20. Probable Pulmonary Blastomycosis in a Wild Coyote (Canis latrans)

    OpenAIRE

    Luis E. Rodríguez-Tovar; Nevárez-Garza, Alicia M.; Ricardo Vladimir Barajas-Juárez; Juan J. Zarate-Ramos; Ledezma-Torres, Rogelio A.; Armando Trejo-Chávez

    2015-01-01

    A female coyote (Canis latrans) was fatally injured by a vehicle on a road in San Luis Potosi, Mexico. Because of deteriorating clinical signs, the animal was euthanized. Postmortem examination of the lungs showed numerous small multifocal white nodules (0.5–1 cm diameter) disseminated throughout. Histopathologic examination revealed multifocal coalescing granulomas with abundant macrophages, numerous neutrophils, fibroblasts, plasma cells, and lymphocytes. Abundant intracellular and extracel...

  1. A new star-forming region in Canis Major

    CERN Document Server

    Magakian, T Yu; Bally, J

    2016-01-01

    A new southern star-formation region, located at an estimated distance of ~1.5 kpc in the Lynds 1664 dark cloud in Canis Major, is described. Lynds 1664 contains several compact star clusters, small stellar groups, and young stars associated with reflection nebulae. Narrow-band H{\\alpha} and [SII] images obtained with 4-m CTIO telescope reveal more than 20 new Herbig-Haro objects associated with several protostellar outflows.

  2. Toxocara canis: Larvicidal activity of fatty acid amides.

    Science.gov (United States)

    Mata-Santos, Taís; D'Oca, Caroline da Ros Montes; Mata-Santos, Hílton Antônio; Fenalti, Juliana; Pinto, Nitza; Coelho, Tatiane; Berne, Maria Elisabeth; da Silva, Pedro Eduardo Almeida; D'Oca, Marcelo Gonçalves Montes; Scaini, Carlos James

    2016-02-01

    Considering the therapeutic potential of fatty acid amides, the present study aimed to evaluate their in vitro activity against Toxocara canis larvae and their cytotoxicity for the first time. Linoleylpyrrolidilamide was the most potent, with a minimal larvicidal concentration (MLC) of 0.05 mg/mL and 27% cytotoxicity against murine peritoneal macrophages C57BL/6 mice, as assessed by the MTT assay. PMID:26783180

  3. ENCUESTA EXPLORATORIA DE INFECCION POR Brucella canis EN PERROS DE

    Directory of Open Access Journals (Sweden)

    Ana Pardo D

    2009-08-01

    Full Text Available Objetivo. Determinar la presencia de anticuerpos a B. canis en perros domésticos y callejeros del municipio de Villavicencio, Colombia. Materiales y métodos. Se utilizó la prueba de aglutinación rápida en placa con antígeno menos mucoide (M- en 201 muestras de suero. En dos animales seropositivos se realizó intento de aislamiento por hemocultivo en medio selectivo para Brucella (oxoid®. En un animal seropositivo, con crecimiento bacteriano con características morfológicas sugestivas a B. canis se realizó histopatología de testículo, bazo e hígado. Resultados. La seropositividad general fue de 1.49% y correspondió a tres caninos machos, dos de los cuales presentaron signos clínicos de epididimitis y orquitis (unilateral. El cultivo y la histopatología no fueron concluyentes para el diagnostico de B. canis. Conclusiones. La seropositividad fue baja y sugiere que la población estudiada no ha estado en contacto con la bacteria. La presencia de reactores puede estar asociado con falsos positivos. El no aislamiento de la bacteria no indica que la enfermedad no exista por lo que se requiere de nuevos estudios.

  4. Stellar populations in the Canis Major over-density

    CERN Document Server

    Carraro, Giovanni; Vazquez, Ruben A

    2008-01-01

    We performed a photometric multicolor survey of the core of the Canis Major over-density at l 244, -8.0, reaching V = 22 and covering 0.3 x 1 degree. The main aim is to unravel the complex mixture of stellar populations toward this Galactic direction, where in the recent past important signatures of an accretion event have been claimed to be detected. While our previous investigations were based on disjointed pointings aimed at revealing the large scale structure of the third Galactic Quadrant, we now focus on a complete coverage of a smaller field centered on the Canis Major over-density. A large wave-length baseline, in the UBVRI bands, allows us to build up a suite of colour colour and colour magnitude diagrams, providing a much better diagnostic tool to disentangle the stellar populations of the region. In fact, the simple use of one colour magnitude diagram, widely employed in all the previous studies defending the existence of the Canis Major galaxy, does not allow one to separate the effects of the dif...

  5. Effect of Saprotrophic Soil Fungi on Toxocara canis Eggs

    Directory of Open Access Journals (Sweden)

    Ciarmela, M. L.

    2010-01-01

    Full Text Available The purpose of this work was to assess the ovicidal activity of Chrysosporium merdarium, Trichoderma harzianum, Fusarium oxysporum, F. moniliforme and F. sulphureum isolated from public areas in the city of La Plata, Argentina, on Toxocara canis eggs in vitro. Each species were cultured on water agar 2% with a suspension of immature-stage T. canis eggs. At 4, 7, 14, 21 and 28 days post-culture, they were observed by light and scanning electron microscopy. One hundred eggs were evaluated and scored according to Lỳsek’s ovicidal effect classification. These procedures were repeated three times which each fungal species. Chrysosporium merdarium and F. oxysporum showed very high ovicidal activity, F. sulphureum high ovicidal activity, F. moniliforme intermediate ovicidal activity and T. harzianum did not affect the viability of T. canis eggs. Taking into account the effects on human and animal health and the environment, the species with better prospects for studying its potential use as biological control was F. sulphureum.

  6. Antibodies reactive with Ehrlichia canis, Ehrlichia phagocytophila genogroup antigens and the spotted fever group rickettsial antigens, in free-ranging jackals (Canis aureus syriacus) from Israel.

    Science.gov (United States)

    Waner, T; Baneth, G; Strenger, C; Keysary, A; King, R; Harrus, S

    1999-03-31

    A seroepidemiological survey was conducted to investigate the prevalence of antibodies reactive with the Ehrlichia canis and Ehrlichia phagocytophila genogroup antigens, and the spotted fever group (SFG) rickettsiae antigens in jackals in Israel (Canis aureus syriacus), to assess the possible role of the jackal in the epidemiology of these diseases. Fifty-three serum samples from jackals were assayed by the indirect immunofluorescence antibody test. Antibodies to E. canis were detected in 35.8% serum samples while 26.4% of the samples tested were positive to Ehrlichia chaffeensis. Twenty-six percent of the jackals tested were seropositive to E. phagocytophila, of which 5.7% were seropositive to E. phagocytophila alone without any seroreactivity to either E. canis or E. chaffeensis. Fifty-five percent of the jackals were seropositive to the SFG-rickettsiae antigens. The results suggest a high exposure rate of jackals in Israel to E. canis. Positive reactivity to E. chaffeensis was considered to be due to antigenic cross-reactions with E. canis. The study demonstrated for the first time the presence of E. phagocytophila antibodies in free-range jackals. The high incidence of antibodies to the SFG-rickettsiae and their relatively high antibody titers was suggestive of either recent or persistent infection. The possibility that jackals may play a role in the transmission of E. canis, E. phagocytophila and the SFG-rickettsiae for human and canine infections is discussed. PMID:10321583

  7. Tick Acquisition of Ehrlichia canis from Dogs Treated with Doxycycline Hyclate▿

    OpenAIRE

    Schaefer, John J.; Needham, Glen R.; Bremer, William G; Rikihisa, Yasuko; Ewing, S. A.; Stich, R W

    2007-01-01

    Doxycycline generally alleviates clinical monocytic ehrlichiosis, but its efficacy in the control of monocytotropic ehrlichial pathogens requires further investigation. In this study, Ehrlichia canis was detected in dogs treated with doxycycline for 14 days and in ticks fed on these dogs, suggesting that treated dogs can remain reservoirs for E. canis.

  8. 76 FR 81665 - Endangered and Threatened Wildlife and Plants; Revising the Listing of the Gray Wolf (Canis lupus...

    Science.gov (United States)

    2011-12-28

    ... gray wolf (Canis lupus) (72 FR 6052). Three parties challenged this rule (Humane Society of the United...) from the western wolf (Canis lupus). In our May 5, 2011, proposed rule (76 FR 26806), we proposed to... that identified and delisted the WGL DPS of the gray wolf (Canis lupus) (72 FR 6052). Three...

  9. A golden jackal (Canis aureus) from Austria bearing Hepatozoon canis--import due to immigration into a non-endemic area?

    Science.gov (United States)

    Duscher, Georg Gerhard; Kübber-Heiss, Anna; Richter, Barbara; Suchentrunk, Franz

    2013-02-01

    The protozoan Hepatozoon canis, which is transmitted via ingestion of infected ticks by canine hosts, is not endemic to mid-latitude regions in Europe. Its distribution is supposed to be linked to the occurrence of its primary tick vector Rhipicephalus sanguineus. A young male golden jackal (Canis aureus) found as road kill close to Vienna, Austria, was infected by this pathogen. Cloning and sequencing of the PCR product revealed 6 different haplotypes of H. canis. Based on the sequences, no clear relationship to the origin of infection could be traced. This is the first report of H. canis for Austria, and wild canines such as the currently found jackal may provide a source of natural spread of this parasite into non-endemic areas. This natural immigration of wild animals represents a way of pathogen introduction, which has to be considered in disease prevention in addition to human-made introduction due to animal import and export. PMID:23306030

  10. Behavioral changes in Rattus norvegicus experimentally infected by Toxocara canis larvae Alterações de comportamento em Rattus norvegicus experimentalmente infectados por larvas de Toxocara canis

    Directory of Open Access Journals (Sweden)

    Pedro P. Chieffi

    2010-10-01

    Full Text Available Toxocara canis is a common canine nematode parasite and one of its possible transmission mechanisms is the predation of infected rodents by canids. Fifty Rattus norvegicus were used to study behavioral alterations in rodents infected by T. canis larvae. The rats were divided into three groups: G1, 20 rats infected with 300 T. canis eggs; G2, 20 rats infected with 2,000 T. canis eggs; and G3, 10 non-infected rats. Thirty and 60 days post-infection, rats from all the groups were submitted to an open-field apparatus for five min and subsequently, to an elevated plus-maze apparatus, again for five min. The data obtained indicated improvement in mobility (total locomotion time and rearing frequency and exploratory behavior in infected rats, principally in G2, which provides some support for the hypothesis that behavioral alterations in rodents infected by Toxocara canis larvae enhance the transmission rate of this ascarid to dogs.Toxocara canis é um nematódeo parasita habitual do intestino delgado de cães. Um dos mecanismos conhecidos de transmissão para cães é representado pela predação de pequenos roedores que, como hospedeiros paratênicos albergam larvas de Toxocara canis em seus tecidos. Para avaliar a ocorrência de alterações de comportamento em roedores infectados por Toxocara canis 50 exemplares de Rattus norvegicus foram utilizados no experimento. Os animais foram divididos em três grupos: G1 - 20 ratos infectados com 300 ovos de Toxocara canis; G2 - 20 ratos infectados com 2.000 ovos de Toxocara canis e G3 - 10 ratos sem infecção. Trinta e 60 dias após a infecção avaliou-se a ocorrência de alterações comportamentais nos três grupos submetendo os animais, primeiramente, a uma arena de campo aberto durante cinco minutos e, a seguir, a labirinto em cruz elevado por mais cinco minutos. Os resultados obtidos indicaram aumento significativo da mobilidade (tempo total de movimentação e número de vezes em que os animais se

  11. Schistosoma spindale infection in a captive jackal (Canis aureus).

    Science.gov (United States)

    Vimalraj, P G; Latchumikanthan, A

    2015-03-01

    This report is based on the findings from a captive jackal (Canis aureus) housed in Amirthi Zoological Park, Javadu Hills, Vellore. The animal was reported to be dull, depressed and also had diarrhea. Fecal samples were collected in 10 % formalin and subjected to direct and sedimentation method of faecal examination and was examined for endoparasitic infection. Surprisingly, fecal examination revealed two spindle shaped eggs having terminal spine with a size of 250μ by 60μ. The eggs were identified as belonging to Schistosoma spindale and as per the standard keys (Soulsby 1982). PMID:25698875

  12. Systematic status of wild Canis in North-central Texas

    Science.gov (United States)

    Mech, L. David; Nowak, Ronald M.

    2010-01-01

    Skulls of wild Canis collected 2003–2004 in north-central Texas are morphometrically similar to a series taken there and in nearby areas in 1964–1971, which was considered to represent a population of Coyotes (C. latrans) modified through introgression from Red Wolves (C. rufus). A few of the new specimens closely resemble small examples of Red Wolves. Such affinity is supported by authoritative examination of living and videotaped animals. The persistence of influence of Red Wolves, long after presumed extirpation through hybridization and human persecution, may be relevant to wolf conservation.

  13. REVIEW ON CURRENT WORLDWIDE STATUS, DISTRIBUTION, ECOLOGY AND DIETARY HABITS OF GOLDEN JACKAL, CANIS AUREUS

    OpenAIRE

    Tripti Negi

    2014-01-01

    The golden jackal is a medium-sized predator and omnivore, with a range covering the southern parts of the Palearctic, South Asia and northeastern Africa. The entire jackal population is now confined to a few clusters grouped into 7 sub-areas with criteria such as connectivity and isolation. Causes of decline seem to be related to the limited habitat availability due to changes in human agro-pastoral activities, which resulted mainly in reduced day-cover availability and possibly reduced food...

  14. Food preferences of the Golden Jackal Canis aureus in the Gir National Park and Sanctuary, Gujarat, India

    Directory of Open Access Journals (Sweden)

    M. Shamshad Alam

    2015-02-01

    Full Text Available The feeding habits of the Golden Jackal Canis aureus were investigated by analysis of its scat contents (n=81, collected between October 2007 and June 2008 in Gir National Park and Sanctuary, Gujarat, India. Jackal dietary habits reflected the availability of a wide variety of food items and the differential vulnerability of prey. Potential animal and plant foods available to jackal varied because of their seasonal variability. About 32.69% scats were found to have only one prey item, whereas 48.08% of scats represented two prey items. Overall, it was found that the large mammalian prey was the most important food item which was significantly supplemented by vegetative material particularly Zizyphus spp. Amongst mammalian prey, the percentage frequency of occurrence (percentage±SE of Chital Axis axis was 25.93±2.84, Buffalo Bubalus arnee bubalis was 27.16±2.98 followed by Indian Hare Rufus nigricollis 19.75±2.15 and Sambar Rusa unicolor 11.11±1.19 while the least was found for Langur Semnopithecus entellus 2.47±0.21 and Bluebull Boselaphus tragocamelus 2.47±0.21. Although, there is substantial availability of wild prey kills, the results suggest the presence of domestic mammals and human waste matter in the scats which could be assumed as a fortification of the Jackal’s dietary spectrum, substantiating the scavenging tendency of the jackal to forage near human settlements.

  15. Dietary fiber.

    Science.gov (United States)

    Madar, Z; Thorne, R

    1987-01-01

    Studies done on dietary fiber (DF) over the past five years are presented in this Review. The involvement of dietary fiber in the control of plasma glucose and lipid levels is now established. Two dietary fiber sources (soybean and fenugreek) were studied in our laboratory and are discussed herein. These sources were found to be potentially beneficial in the reduction of plasma glucose in non-insulin dependent diabetes mellitus subjects. They are shown to be acceptable by human subjects and are easy to use either in a mixture of milk products and in cooking. The mechanism by which dietary fiber alters the nutrient absorption is also discussed. The effect of DF on gastric emptying, transit time, adsorption and glucose transport may contribute to reducing plasma glucose and lipid levels. DF was found to be effective in controlling blood glucose and lipid levels of pregnant diabetic women. Dietary fiber may also be potentially beneficial in the reduction of exogenous insulin requirements in these subjects. However, increased consumption of DF may cause adverse side effects; the binding capabilities of fiber may affect nutrient availability, particularly that of minerals and prolonged and high DF dosage supplementation must be regarded cautiously. This is particularly true when recommending such a diet for pregnant or lactating women, children or subjects with nutritional disorders. Physiological effects of DF appear to depend heavily on the source and composition of fiber. Using a combination of DF from a variety of sources may reduce the actual mass of fiber required to obtain the desired metabolic effects and will result in a more palatable diet. Previously observed problems, such as excess flatus, diarrhea and mineral malabsorption would also be minimized.

  16. Demodicosis caused by Demodex canis and Demodex cornei in dogs.

    Science.gov (United States)

    Sivajothi, S; Sudhakara Reddy, B; Rayulu, V C

    2015-12-01

    Two mongrel dogs aged between 7 and 9 months in a same house were presented to the clinics with a history of chronic dermatitis associated with pruritus. Clinical examination revealed presence of primary and secondary skin lesions on the face, around the ears, chin, neck, fore limbs and lateral abdomen. Examination of skin scrapings revealed Demodex cornei (majority) and D. canis (minority) in both the dogs. By using hair pluck examination D. canis were detected and by tape impression smears examination large number of adult short-tail Demodex mites were found. D. cornei was identified by based on the morphological characters including short opisthosoma with blind and round terminal end. Mean length of total body, opisthosoma of both types of the mites were differed statistically significant (P  0.05). Dogs were treated with daily oral ivermectin @ 500 μg/kg/day, external application of amitraz along with supportive therapy. After completion of 45 days of therapy dogs were recovered completely without any side effects. PMID:26688632

  17. Toxocara canis: una zoonosis frecuente a nivel mundial

    Directory of Open Access Journals (Sweden)

    Ana Carolina Rojas-Salamanca

    2016-01-01

    Full Text Available La toxocariasis, causada principalmente por Toxocara canis, es una de las zoonosis más comunes a nivel mundial; se presenta con mayor frecuencia en niños, asociada a condiciones desfavorables de higiene, hacinamiento, convivencia con perros parasitados, el nivel socioeconómico, la ubicación geográfica y los entornos en los cuales los animales depositan sus heces, lo que se convierte en un gran foco de contaminación para los humanos. El Toxocara canis ingresa al ser humano por contacto directo con heces de perro o por contaminación de alimentos. La carga parasitaria es de vital importancia, ya que está relacionada directamente con la gravedad de la enfermedad, con los diferentes síndromes que se producen y con la respuesta inmune desencadenada por el organismo, teniendo en cuenta el ciclo de vida que se lleva a cabo en el organismo humano. Para esta enfermedad no se puede realizar un diagnóstico por técnicas coproparasitológicas, por lo cual es necesario utilizar otros métodos, como el aumento de leucocitos con presencia de eosinofilia, la prueba de ELISA y, en algunos casos, por medio de biopsias.

  18. A WISE Census of Young Stellar Objects in Canis Major

    Science.gov (United States)

    Fischer, William J.; Padgett, Deborah L.; Stapelfeldt, Karl L.; Sewiło, Marta

    2016-08-01

    With the Wide-field Infrared Survey Explorer (WISE), we searched for young stellar objects (YSOs) in a 100 deg2 region centered on the lightly studied Canis Major star-forming region. Applying stringent magnitude cuts to exclude the majority of extragalactic contaminants, we find 144 Class I candidates and 335 Class II candidates. The sensitivity to Class II candidates is limited by their faintness at the distance to Canis Major (assumed as 1000 pc). More than half the candidates (53%) are found in 16 groups of more than four members, including four groups with more than 25 members each. The ratio of Class II to Class I objects, N II/N I, varies from 0.4 to 8.3 in just the largest four groups. We compare our results to those obtainable with combined Two Micron All Sky Survey and post-cryogenic Spitzer Space Telescope data; the latter approach recovers missing Class II sources. Via a comparison to protostars characterized with the Herschel Space Observatory, we propose new WISE color criteria for flat-spectrum and Class 0 protostars, finding 80 and 7 of these, respectively. The distribution of YSOs in CMa OB1 is consistent with supernova-induced star formation, although the diverse N II/N I ratios are unexpected if this parameter traces age and the YSOs are due to the same supernova. Less massive clouds feature larger N II/N I ratios, suggesting that initial conditions play a role in determining this quantity.

  19. A WISE Census of Young Stellar Objects in Canis Major

    CERN Document Server

    Fischer, William J; Stapelfeldt, Karl L; Sewilo, Marta

    2016-01-01

    With the Wide-Field Infrared Survey Explorer (WISE), we searched for young stellar objects (YSOs) in a 100 deg^2 region centered on the lightly studied Canis Major star forming region. Applying stringent magnitude cuts to exclude the majority of extragalactic contaminants, we find 144 Class I candidates and 335 Class II candidates. The sensitivity to Class II candidates is limited by their faintness at the distance to Canis Major (assumed as 1000 pc). More than half the candidates (53%) are found in 16 groups of more than four members, including four groups with more than 25 members each. The ratio of Class II to Class I objects, N_II/N_I, varies from 0.4 to 8.3 in just the largest four groups. We compare our results to those obtainable with combined Two Micron All Sky Survey (2MASS) and post-cryogenic Spitzer Space Telescope data; the latter approach recovers missing Class II sources. Via a comparison to protostars characterized with the Herschel Space Observatory, we propose new WISE color criteria for flat...

  20. Toxocara canis: anthelmintic activity of quinone derivatives in murine toxocarosis.

    Science.gov (United States)

    Mata-Santos, T; Mata-Santos, H A; Carneiro, P F; De Moura, K C G; Fenalti, J M; Klafke, G B; Cruz, L A X; Martins, L H R; Pinto, N F; Pinto, M C F R; Berne, M E A; Da Silva, P E A; Scaini, C J

    2016-04-01

    Human toxocarosis is a chronic tissue parasitosis most often caused by Toxocara canis. The seroprevalence can reach up to 50%, especially among children and adolescents. The anthelmintics used in the treatment have moderate efficacy. The aim of this study was to evaluate the in vitro and in vivo anthelmintic activity of quinones and their derivatives against T. canis larvae and the cytotoxicity of the larvicidal compounds. The compounds were evaluated at 1 mg mL(-1) concentration in microculture plates containing third stage larvae in an Roswell Park Memorial Institute (RPMI) 1640 environment, incubated at 37 °C in 5% CO2 tension for 48 h. Five naphthoxiranes were selected for the cytotoxicity analysis. The cell viability evaluated by 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide and lactate dehydrogenase assays using murine peritoneal macrophages isolated from C57BL/6 mice revealed that the naphthoxiranes (1 and 3) were less cytotoxic at a concentration of 0.05 mg mL(-1). The efficacy of naphthoxiranes (1 and 3) was examined in murine toxocarosis also. The anthelmintic activity was examined by evaluating the number of larvae in the brain, carcass, liver, lungs, heart, kidneys and eyes. Compound (3) demonstrated anthelmintic activity similar to that of albendazole by decreasing the number of larvae in the organs of mice and thus could form the basis of the development of a new anthelmintic drug. PMID:26887285

  1. Toxocara Canis IgG Seropositivity in Patients with Chronic Urticaria.

    Science.gov (United States)

    Burak Selek, Mehmet; Baylan, Orhan; Kutlu, Ali; Özyurt, Mustafa

    2015-08-01

    We aimed to investigate IgG antibody levels specific to Toxocara canis (T. canis), a parasite which subsists in dog's intestine, on serum samples obtained from patients with chronic urticaria (CU) to evaluate effective risk in CU etiopathogenesis. In this study, 73 patients diagnosed with CU and 109 healthy individuals as control group, were included. Various factors such as sex, age, education and income, daily hand washing habits, history of dog owning and soil eating were questioned in patient anamnesis. T. canis IgG antibodies were detected using an enzyme linked immunosorbent assay (ELISA) kit prepared with T. canis larval excretory-secretory antigens. Positive results were confirmed with western blot (WB) WB test. We found T. canis IgG positivity in 17.8% (n=13) of patients (n=73) with CU. But we did not observe any T. canis IgG positivity in healthy controls (n=109). Low molecular weight bands (24-35 kDa) were observed in 11 samples in WB analyses while two of the samples were weakly positive. It is revealed that dog owning history increases T. canis seropositivity 12.9 times while insufficient daily hand washing habit (less than six times a day) increases seropositivity 20.7 times. Our study showed that T. canis may trigger CU since we found 17.8% seropositivity in 73 patients with CU and none in 109 healthy individuals. Moreover, various socio-demographic characteristics have been shown to affect T. canis seropositivity in patients with CU.

  2. Toxocara Canis IgG Seropositivity in Patients with Chronic Urticaria.

    Science.gov (United States)

    Burak Selek, Mehmet; Baylan, Orhan; Kutlu, Ali; Özyurt, Mustafa

    2015-08-01

    We aimed to investigate IgG antibody levels specific to Toxocara canis (T. canis), a parasite which subsists in dog's intestine, on serum samples obtained from patients with chronic urticaria (CU) to evaluate effective risk in CU etiopathogenesis. In this study, 73 patients diagnosed with CU and 109 healthy individuals as control group, were included. Various factors such as sex, age, education and income, daily hand washing habits, history of dog owning and soil eating were questioned in patient anamnesis. T. canis IgG antibodies were detected using an enzyme linked immunosorbent assay (ELISA) kit prepared with T. canis larval excretory-secretory antigens. Positive results were confirmed with western blot (WB) WB test. We found T. canis IgG positivity in 17.8% (n=13) of patients (n=73) with CU. But we did not observe any T. canis IgG positivity in healthy controls (n=109). Low molecular weight bands (24-35 kDa) were observed in 11 samples in WB analyses while two of the samples were weakly positive. It is revealed that dog owning history increases T. canis seropositivity 12.9 times while insufficient daily hand washing habit (less than six times a day) increases seropositivity 20.7 times. Our study showed that T. canis may trigger CU since we found 17.8% seropositivity in 73 patients with CU and none in 109 healthy individuals. Moreover, various socio-demographic characteristics have been shown to affect T. canis seropositivity in patients with CU. PMID:26547714

  3. Dietary sodium

    DEFF Research Database (Denmark)

    Graudal, Niels

    2015-01-01

    The 2013 Institute of Medicine (IOM) report "Sodium Intake in Populations: Assessment of Evidence" did not support the current recommendations of the IOM and the American Heart Association (AHA) to reduce daily dietary sodium intake to below 2,300 mg. The report concluded that the population......-based health outcome evidence was not sufficient to define a safe upper intake level for sodium. Recent studies have extended this conclusion to show that a sodium intake below 2,300 mg/day is associated with increased mortality. In spite of this increasing body of evidence, the AHA, Centers for Disease...... Control (CDC), other public health advisory bodies, and major medical journals have continued to support the current policy of reducing dietary sodium....

  4. Probable Pulmonary Blastomycosis in a Wild Coyote (Canis latrans

    Directory of Open Access Journals (Sweden)

    Luis E. Rodríguez-Tovar

    2015-01-01

    Full Text Available A female coyote (Canis latrans was fatally injured by a vehicle on a road in San Luis Potosi, Mexico. Because of deteriorating clinical signs, the animal was euthanized. Postmortem examination of the lungs showed numerous small multifocal white nodules (0.5–1 cm diameter disseminated throughout. Histopathologic examination revealed multifocal coalescing granulomas with abundant macrophages, numerous neutrophils, fibroblasts, plasma cells, and lymphocytes. Abundant intracellular and extracellular thick-walled, refractile, spherical yeasts (10–15 μm were observed within the granulomas. The yeasts were intensely PAS-positive, with granular protoplasm. Broad-based single budding yeasts were occasionally present. Based on the microscopic findings of the pulmonary lesions and the morphological features of the organism, a diagnosis of chronic pyogranulomatous pneumonia caused by Blastomyces dermatitidis was made. To our knowledge, the case described herein is the first report of pulmonary blastomycosis in a wild coyote.

  5. Searching for RR Lyrae stars in the Canis Major Overdensity

    CERN Document Server

    Mateu, Cecilia; Zinn, Robert; Miller, Lissa; .,; 10.1017/S1743921307008459

    2009-01-01

    The Canis Major overdensity (CMa) was initially proposed to be the remnant of a tidally disrupting dSph galaxy. Since its nature is still subject of debate, the goal of the present work was to conduct a large-scale RR Lyrae survey in CMa, in order to see if there is an overdensity of these stars. The survey spans a total area of ~34 sq. deg. with observations in V and R filters, made with the 1.0m Jurgen Stock Schmidt telescope at the National Astronomical Observatory of Venezuela. Current results in a subregion, including spectroscopic observations, show that the small number of RR Lyrae stars found can be accounted for by the halo and thick disk components of our Galaxy.

  6. Prolonged intensive dominance behavior between gray wolves, Canis lupus

    Science.gov (United States)

    Mech, L. David; Cluff, H. Dean

    2010-01-01

    Dominance is one of the most pervasive and important behaviors among wolves in a pack, yet its significance in free-ranging packs has been little studied. Insights into a behavior can often be gained by examining unusual examples of it. In the High Arctic near Eureka, Nunavut, Canada, we videotaped and described an unusually prolonged and intensive behavioral bout between an adult male Gray Wolf (Canis lupus) and a male member of his pack, thought to be a maturing son. With tail raised, the adult approached a male pack mate about 50 m from us and pinned and straddled this packmate repeatedly over 6.5 minutes, longer than we had ever seen in over 50 years of studying wolves. We interpreted this behavior as an extreme example of an adult wolf harassing a maturing offspring, perhaps in prelude to the offspring?s dispersal.

  7. Diabetes and Dietary Supplements

    Science.gov (United States)

    ... R S T U V W X Y Z Diabetes and Dietary Supplements: In Depth Share: On This ... health product or practice. Are dietary supplements for diabetes safe? Some dietary supplements may have side effects, ...

  8. 犬颅脑创伤后局部脑代谢的微透析监测%Microdialysis Monitoring for Topical Cerebral Metabolism Changes after Traumatic Brain Injury in Canis Familiaris

    Institute of Scientific and Technical Information of China (English)

    张小梅; 衡新华; 宋晓斌; 杨智勇; 张晓丽娜; 王常伟

    2011-01-01

    Objective To establish the traumatic brain injury (TBI) model in oanis, and monitor the variations of topical biochemical substances by intracranial microdialysis. Methods Nine healthy adult male mongrel canines were randonmized into three groups: mild TBI group (n = 3) , severe TBI group (n = 3) , and control group (re =3). The model was established by the method of free falling body extradural hitting. The extracellular fluid (ECF) was collected by using the intracranial microdialysis. Then the content variations of Glucose, Lactic Acid and Glycerol in the collected dialysate were detected. Results The contents of glucose reduced after traumatic brain injury, which changed significantly in 5.5 h and 6 h (P0.05). Conlusions Microdialysis monitoring the content variations of Glu and Lac in ECF after traumatic brain injury can judge the state and prognosis of traumatic brain injury.%目的 建立犬的颅脑外伤模型,运用微透析技术研究脑创伤后局部脑代谢的变化.方法 取家犬9只,随机分为轻度创伤组(n=3),重度创伤组(n=3)和对照组(n=3).以自由落体硬膜外撞击方法制作轻度和重度脑损伤模型,应用微透析技术动态收集脑损伤局部的脑组织细胞外液(extracellular fluid,ECF),检测颅脑创伤状态下葡萄糖(Glucose,Glu)、乳酸(Lactic Acid,Lac)、甘油(Glocerol,Gly)含量及其动态变化.结果 犬脑损伤后Glu含量降低,伤后5.5 h,6h变化最显著(P<0.01),之后缓慢上升;Lac含量在伤后出现与Glu相反的变化,伤后5.5 h 上升至最高值(P<0.05);重度组尤为甚.Gly在伤后6h缓慢上升,但其变化不明显(P>0.05).结论 微透析技术监测脑损伤后ECF中Glu和Lac含量的变化,可以作为判断伤情和预后的重要生化指标.

  9. Experimentelle Untersuchungen zu kognitiven und sozialen Mechanismen der Kooperation an je einer Gruppe Europäischer Wölfe (Canis l. lupus L.) und Deutscher Schäferhunde (C. lupus familiaris) unter Gehegebedingungen – Eine Fallstudie

    OpenAIRE

    Plagmann, Silke

    2010-01-01

    Kooperation spielt bei vielen Arten eine wichtige Rolle, doch über die Mechanismen ist noch vieles unbekannt. Diese Arbeit untersuchte kognitive und soziale Mechanismen des kooperativen Problemlöseverhaltens beim Wolf und beim Haushund im experimentellen Ansatz. Obwohl die Wölfe in der Testsituation nicht kooperierten, wiesen bestimmte Verhaltensmerkmale auf grundlegende Voraussetzungen zur Kooperation hin. Haushunde kooperieren bei der Futterbeschaffung, sie passen ihr Verhalten an das eines...

  10. Comparison of coproparasitological exams and necropsy for diagnosis of gastro-intestinal helminth infection in mongrel dogs (Canis familiaris, Linnaeus, 1758) from the Metropolitan Region of Recife – state of Pernambuco – Brazil

    OpenAIRE

    Auxiliadora de Moraes Ostermann; Marilene Maria de Lima; Márcia Paula Oliveira Farias; Alessandra Santos d’Alencar; Mariana Karolina Freitas Galindo; Carla Tejo da Silva; Leucio Câmara Alves; Maria Aparecida da Gloria Faustino

    2011-01-01

    This work was carried out to compare the coproparasitological and necropsy exams for diagnosis of gastrointestinal helminth infection, evaluating the parasitism frequency in stray dogs captured by the Centro de Vigilância Ambiental of the city of Recife, Pernambuco. A total of 96 dogs of both sexes, with variying ages and races, were used. The animals were sacrificed and necropsied for the collection of adult helminthes. In parallel, fecal samples were collected directly from the rectum of th...

  11. Behavioral changes in Rattus norvegicus coinfected by Toxocara canis and Toxoplasma gondii

    Directory of Open Access Journals (Sweden)

    Maisa Leite de Queiroz

    2013-02-01

    Full Text Available Using an elevated plus maze apparatus and an activity cage, behavioral changes in Rattus norvegicus concomitantly infected by Toxocara canis and Toxoplasma gondii were studied, during a period of 120 days. Rats infected by Toxocara canis or Toxoplasma gondii showed significant behavioral changes; however, in the group coinfected by both parasites a behavioral pattern similar to that found in the group not infected was observed thirty days after infection, suggesting the occurrence of modulation in the behavioral response.

  12. Biologie a radiace šakala obecného (Canis aureus, Linnaeus, 1758)

    OpenAIRE

    Krčmová, Hana

    2014-01-01

    This bachelor work is focused on biology and distribution of the species golden jackal (Canis aureus), which is the only one of three species of jackals which live outside the African continent and begins to expand increasingly into Europe and Asia. At first glance it's a reddish yellow-brown coloured beast resembling the red fox (Vulpes vulpes) or the small grey wolf (Canis lupus). Its typical distinguishing feature is partial symphysis of the digital pads in all paws, typically observabl...

  13. ANTHELMINTIC ACTIVITY OF LAPACHOL, β-LAPACHONE AND ITS DERIVATIVES AGAINST Toxocara canis LARVAE

    OpenAIRE

    MATA-SANTOS, Taís; PINTO, Nitza França; Hilton Antônio MATA-SANTOS; DE MOURA, Kelly Gallan; Carneiro, Paula Fernandes; CARVALHO, Tatiane dos Santos; DEL RIO, Karina Pena; PINTO, Maria do Carmo Freire Ribeiro; MARTINS, Lourdes Rodrigues; Juliana Montelli FENALTI; da Silva, Pedro Eduardo Almeida; Scaini, Carlos James

    2015-01-01

    Anthelmintics used for intestinal helminthiasis treatment are generally effective; however, their effectiveness in tissue parasitosis (i.e. visceral toxocariasis) is moderate. The aim of this study was to evaluate the in vitro activity of lapachol, β-lapachone and phenazines in relation to the viability of Toxocara canis larvae. A concentration of 2 mg/mL (in duplicate) of the compounds was tested using microculture plates containing Toxocara canis larvae in an RPMI-1640 environment, incubate...

  14. Evidence for unapparent Brucella canis infections among adults with occupational exposure to dogs.

    Science.gov (United States)

    Krueger, W S; Lucero, N E; Brower, A; Heil, G L; Gray, G C

    2014-11-01

    Human serological assays designed to detect brucellosis will miss infections caused by Brucella canis, and low levels of periodic bacteremia limit diagnosis by blood culture. Recent B. canis outbreaks in dogs and concomitant illnesses in caretakers suggest that unapparent human infections may be occurring. With more than a quarter of a million persons in occupations involving dogs, and nearly 80 million dog owners in the United States, this pathogen is an under-recognized human health threat. To investigate occupational exposure to B. canis, we adapted a commercial canine serological assay and present the first controlled seroepidemiological study of human B. canis infections in recent years. 306 adults with occupational exposure to dogs and 101 non-matched, non-canine-exposed subjects were enrolled. Antibodies were detected using the canine D-Tec(®) CB rapid slide agglutination test (RSAT) kit with a secondary 2-mercaptoethanol (ME)-RSAT. Results were validated on a blinded subset of sera with an additional RSAT and indirect enzyme-linked immunoassay at the National Administration of Laboratories and Health Institutes (ANLIS) in Argentina. Seroprevalence ranged from 10.8% (RSAT) to 3.6% (ME-RSAT) among canine-exposed subjects. Kennel employees were more likely to test RSAT seropositive compared with other canine exposures (OR = 2.7; 95% CI, 1.3-5.8); however, low seroprevalence limited meaningful occupational risk factor analyses. Two seropositive participants reported experiencing symptoms consistent with brucellosis and having exposure to B. canis-infected dogs; however, temporality of symptom onset with reported exposure could not be determined. D-Tec(®) CB results had substantial agreement with ANLIS assays (Cohen's kappa = 0.60-0.68). These data add to a growing body of literature suggesting that people occupationally exposed to dogs may be at risk of unapparent B. canis infection. It seems prudent to consider B. canis as an occupational public health

  15. A Fluoroquinolone Induces a Novel Mitogen-Encoding Bacteriophage in Streptococcus canis

    OpenAIRE

    Ingrey, Keely T.; Ren, Jun; Prescott, John F.

    2003-01-01

    This study investigated whether the recently recognized emergence of canine streptococcal toxic shock syndrome (STSS) and necrotizing fasciitis (NF) might be partly attributed to the use of fluoroquinolones to treat Streptococcus canis infections in dogs. Both mitomycin and the fluoroquinolone enrofloxacin caused bacteriophage-induced lysis of S. canis strain 34, an isolate from a case of canine STSS and NF. Fluoroquinolone-evoked, bacteriophage-induced lysis occurred over a range of concentr...

  16. Ancient Himalayan wolf ( Canis lupus chanco ) lineage in Upper Mustang of the Annapurna Conservation Area, Nepal

    OpenAIRE

    Chetri, Madhu; Jhala, Yadvendradev V.; Jnawali, Shant R.; Subedi, Naresh; Dhakal, Maheshwar; Yumnam, Bibek

    2016-01-01

    Abstract The taxonomic status of the wolf ( Canis lupus ) in Nepal’s Trans-Himalaya is poorly understood. Recent genetic studies have revealed the existence of three lineages of wolves in the Indian sub-continent. Of these, the Himalayan wolf, Canis lupus chanco , has been reported to be the most ancient lineage historically distributed within the Nepal Himalaya. These wolves residing in the Trans-Himalayan region have been suggested to be smaller and very different from the European wolf. Du...

  17. Toxocara Canis IgG Seropositivity in Patients with Chronic Urticaria

    Directory of Open Access Journals (Sweden)

    Mehmet Burak-Selek

    2015-10-01

    Full Text Available We aimed to investigate IgG antibody levels specific to Toxocara canis (T. canis, a parasite which subsists in dog’s intestine, on serum samples obtained from patients with chronic urticaria (CU to evaluate effective risk in CU etiopathogenesis.In this study, 73 patients diagnosed with CU and 109 healthy individuals as control group, were included. Various factors such as sex, age, education and income, daily hand washing habits, history of dog owning and soil eating were questioned in patient anamnesis. T. canis IgG antibodies were detected using an enzyme linked immunosorbent assay (ELISA kit prepared with T. canis larval excretory-secretory antigens. Positive results were confirmed with western blot (WB WB test.We found T. canis IgG positivity in 17.8% (n=13 of patients (n=73 with CU. But we did not observe any T. canis IgG positivity in healthy controls (n=109. Low molecular weight bands (24-35 kDa were observed in 11 samples in WB analyses while two of the samples were weakly positive. It is revealed that dog owning history increases T. canis seropositivity12.9 times while insufficient daily hand washing habit (less than six times a day increasesseropositivity 20.7 times. Our study showed that T. canis may trigger CU since we found17.8% seropositivity in 73 patients with CU and none in 109 healthy individuals.Moreover, various socio-demographic characteristics have been shown to affect T. canisseropositivity in patients with CU. 

  18. Experimental infection and co-infection of dogs with Anaplasma platys and Ehrlichia canis: hematologic, serologic and molecular findings

    Directory of Open Access Journals (Sweden)

    Diniz PPVP

    2010-04-01

    Full Text Available Abstract Background Rhipicephalus sanguineus is a ubiquitous tick responsible for transmitting Ehrlichia canis and most likely Anaplasma platys to dogs, as either single or co-infections. The objective of this study was to assess the effects of either simultaneous or sequential experimental infections with E. canis and A. platys on hematological and serological parameters, duration of infection, and efficacy of doxycycline therapy in dogs infected with one or both organisms. Six dogs per group were either uninfected, A. platys infected, E. canis infected, A. platys and E. canis co-infected, A. platys infected and E. canis challenged or E. canis infected and A. platys challenged at day 112 post-infection (PI. Doxycycline treatment was initiated at 211 days PI, followed by dexamethasone immunosuppression beginning 410 days PI. Results Initially, transient decreases in hematocrit occurred in all groups infected with E. canis, but the mean hematocrit was significantly lower in the A. platys and E. canis co-infected group. All dogs except the controls developed marked thrombocytopenia after initial infection followed by gradually increased platelet counts by 112 days PI in groups with the single infections, while platelet counts remained significantly lower in the A. platys and E. canis co-infected group. Both sequential and simultaneous infections of A. platys and E. canis produced an enhanced humoral immune response to A. platys when compared to infection with A. platys alone. Likewise, co-infection with E. canis and A. platys resulted in a more persistent A. platys infection compared to dogs infected with A. platys only, but nearly all A. platys infected dogs became A. platys PCR negative prior to doxycycline treatment. E. canis infected dogs, whether single or co-infected, remained thrombocytopenic and E. canis PCR positive in blood for 420 days. When treated with doxycycline, all E. canis infected dogs became E. canis PCR negative and the

  19. Ultra-sonografia bidimensional em tempo real do bulbo ocular de cães (Canis familiaris, Linnaeus, 1758 com opacificação de meios transparentes. Emprego do transdutor mecânico setorial de 7,5 MHz com almofada de recuo Two-dimensional real-time ultrasonography in eyes of dogs (Canis familiaris, Linnaeus, 1758 with opacification of transparent media use of a 7.5 MHz mechanical sector fluid offset transducer

    Directory of Open Access Journals (Sweden)

    Ana Maria Barros Soares

    1998-12-01

    Full Text Available Utilizou-se ultra-sonografia bidimensional em tempo real na avaliação de 20 bulbos oculares de 10 cães, sem alterações clínicas visíveis, e de 55 bulbos oculares de 30 cães com opacificação de meios transparentes. Empregou-se transdutor mecânico setorial de 7,5 MHz com almofada de recuo, em técnica de contato corneano. Para a realização dos exames, os animais foram contidos mecanicamente e as córneas receberam anestesia tópica. A blefarostasia deu-se manualmente. Os bulbos foram avaliados com o transdutor aplicado nas posições vertical e horizontal. As características ultra-sonográficas encontradas em olhos normais o foram a similitude da literatura especializada. Relativamente aos bulbos oculares com opacificação de meios transparentes, encontraram-se alterações junto às estruturas e compartimentos. Destacaram-se as cataratas, as luxações e subluxações do cristalino, as degenerações do vítreo, as hemorragias e inflamações em câmaras anterior e vítrea e os descolamentos de retina. A base dos achados e a fidedignidade das imagens colhidas permitem admitir que a ultra-sonografia bidimensional em tempo real, utilizando o transdutor mecânico setorial de 7,5MHz com almofada de recuo, adequa-se ao exame das estruturas intra-oculares, mormente na Medicina Veterinária em que os recursos são parcos à aplicação de procedimentos mais sofisticados ou de equipamentos para ultra-sonografia próprios à especialidade.The two-dimensional real-time ultrasonography was used to evaluate 20 normal eyes of 10 dogs and 55 eyes o f 30 dogs with ocular opacity. A 7.5MHz mechanical sector fluid offset transducer was utilized, and the corneal contact method was performed. The exams were carried out with the animal awake, the córnea received a topical ophtalmic anesthetic, and the eyelids were held open manually. The eyes were examined with the transducer in vertical and horizontal positions. The ultraso- nographic characteristics found in the normal eye structures were compatible with the experiences related by several dijferent authors. Several changes were found in the structures and chambers of the eye which presented opacities of the media, such as cataracts, lens luxation and sub-luxation, vitreous degeneration, hemorrhage and inflammation in the vitreal chamber, besides retinal detachments. On the basis of the studies carried out and the obtained results, it was possible to conclude that the two-dimensional real-time ultrasonography, with the use of a 7.5MHz mechanical sector fluid offset transducer shows a satisfactory adaptability to the evaluation of the intra-ocular structures. It is indicated specially in Veterinary Medicine in which resources are scanty to sophisticated procedures or specific eye ultrasound equipment.

  20. The effect of the synthetic oviductal fluid medium (SOF supplemented with insulin-like growth factor-I (IGF-I on in vitro maturation of canine oocytes (Canis familiaris/ Influência do fator de crescimento semelhante à insulina I (IGF-I adicionado ao meio fluido sintético de tuba uterina (SOF sobre a maturação in vitro de oócitos caninos (Canis familiaris

    Directory of Open Access Journals (Sweden)

    Kellen Oliveira

    2007-08-01

    Full Text Available The follicular growth and oocyte maturation knowledge are very important to the development and improvement ofnew biotechnologies such as in vitro fertilization and somatic cell nuclear transfer. In order to the necessity of clarifythe basic mechanisms related to canine oocyte maturation, this investigation focuses on the evaluation of the effectof insulin-like growth factor-i (IGF-I, added to synthetic oviductal fluid medium (SOF on the in vitro maturation ofdomestic dog oocytes. Thirty-seven bitches undergoing ovariohysterectomy for castration or due to pathologicalconditions of the uterus were selected as oocytes’ donors (n=875. The oocytes were allocated in the followinggroups: M0 (stained in the collection’s time, Control (72h in SOF and Experimental (72h in SOF plus 100 ng IGF-I.After 72 hours of maturation the oocytes’ nuclear status were assessed by Hoechst 33342 dye. The best results interms of oocyte harvest were observed in those juvenile donors, females in estrus, nuliparous and pure breeds. Nosignificant differences were observed between treatments control (SOF or experimental (IGF-I.O conhecimento da regulação do crescimento folicular e da maturação oocitária é de grande importância no desenvolvimento e aperfeiçoamento de novas biotecnologias como a fecundação in vitro e a transferência nuclear. Considerando-se a necessidade de elucidação dos mecanismos básicos envolvidos na maturação oocitária na espécie canina, a presente pesquisa foi desenvolvida com o objetivo de avaliar o efeito do fator de crescimento semelhante à insulina-I (IGF-I, adicionado ao meio fluido sintético de tuba uterina (SOF, sobre a maturação de oócitos caninos. Foram utilizadas 37 cadelas submetidas à ovariohisterectomia, eletivas e terapêuticas, como doadoras dos complexos cumulus oócitos grau 1 (n=875 que foram alocados em três grupos: M0 (coloração no momento da colheita, Controle (72 h no meio SOF e Experimental (72h no meio SOF + 100 ng de IGF-I. Após 72 horas de maturação dos oócitos o estádio de maturação nuclear foi avaliado, por meio de coloração com Hoechst 33342. Os maiores índices de recuperação das estruturas foram obtidos daquelas doadoras com raças definidas, fêmeas jovens, nulíparas e em estro. Não houve diferenças estatísticas entre os dados analisados quanto à maturação nuclear entre os grupos controle (SOF e experimental (IGF-I.

  1. Brucella canis: inquéritos sorológico e bacteriológico em população felina Brucella canis: serological and bacteriological surveys in the feline population

    Directory of Open Access Journals (Sweden)

    Maria Helena Matiko Akao Larsson

    1984-02-01

    Full Text Available De 134 soros de felinos domésticos examinados pela prova de soroaglutinação lenta em tubos, 4 (3% foram positivos para Brucella canis, todos com título igual a 100. Não se obteve êxito na tentativa de isolamento de Brucella canis através de hemocultura desses animais.Of the 134 feline sera tested by tube agglutination test, 4 (3% were positive for Brucella canis antibodies, all with titer 100. It was not possible to isolate Brucella canis by blood culture in the case of these animals.

  2. IgG Antibody responses in mice coinfected with Toxocara canis and other helminths or protozoan parasites

    Directory of Open Access Journals (Sweden)

    Susana A. Zevallos Lescano

    2012-06-01

    Full Text Available The immune response expressed by IgG antibodies in BALB/c mice experimentally infected with Toxocara canis, was studied with the aim of verifying the possible in vivo cross-reactivity between antigens of T. canis and other parasites (Ascaris suum, Taenia crassiceps, Schistosoma mansoni, Strongyloides venezuelensis and Toxoplasma gondii. Experiments included three groups of mice: one infected only by T. canis, another with one of the other species of parasites and a third concomitantly infected with T. canis and the other species in question. Animals were bled by orbital plexus at 23, 38 and 70 days post infection (p.i.. Sera were analyzed for anti-Toxocara antibodies by ELISA and Immunoblotting, using excretion-secretion antigens (ES, obtained from culture of third-stage larvae of T. canis. For all experiments a control group comprised by ten non-infected mice was used. Only in the case of A. suum infection, in these experimental conditions, the occurrence of cross-reactivity with T. canis was observed. However, in the case of co-infection of T. canis - S. mansoni, T. canis - S. venezuelensis and T. canis - T. crassiceps the production of anti-Toxocara antibodies was found at levels significantly lower than those found in mice infected with T. canis only. Co-infection with S. mansoni or S. venezuelensis showed lower mortality rates compared to what occurred in the animals with single infections. Results obtained in mice infected with T. canis and T. gondii showed significant differences between the mean levels of the optical densities of animals infected with T. canis and concomitantly infected with the protozoan only in the 23rd day p.i.

  3. Dietary guidelines

    DEFF Research Database (Denmark)

    Jelsøe, Erling

    2015-01-01

    in a number of countries have addressed the issue of making dietary guidelines that integrate health and sustainability, but in all cases they have been met with different kinds of resistance. This article reviews the development towards an integrated understanding of health and sustainability in...... relation to food and eating and the emergence of proposals for integrated guidelines. It explores the conflicts and controversies that have arisen in the wake of the various proposals and identifies a number of different types of conflicts. These relate to conflicts of interests between the various actors...... involved and political resistance against initiatives that are perceived as being in conflict with the values of a market economy and free trade. Furthermore, there are controversies that can be broadly characterised as relating to the politics of knowledge and have to do with the differentiation of...

  4. Dietary guidelines

    DEFF Research Database (Denmark)

    Jelsøe, Erling

    2015-01-01

    in a number of countries have addressed the issue of making dietary guidelines that integrate health and sustainability, but in all cases they have been met with different kinds of resistance. This article reviews the development towards an integrated understanding of health and sustainability in relation...... to food and eating and the emergence of proposals for integrated guidelines. It explores the conflicts and controversies that have arisen in the wake of the various proposals and identifies a number of different types of conflicts. These relate to conflicts of interests between the various actors involved...... and political resistance against initiatives that are perceived as being in conflict with the values of a market economy and free trade. Furthermore, there are controversies that can be broadly characterised as relating to the politics of knowledge and have to do with the differentiation of expertise...

  5. Diagnosis of Hepatozoon canis in young dogs by cytology and PCR

    Directory of Open Access Journals (Sweden)

    Decaprariis Donato

    2011-04-01

    Full Text Available Abstract Background Hepatozoon canis is a widespread tick-borne protozoan affecting dogs. The diagnosis of H. canis infection is usually performed by cytology of blood or buffy coat smears, but this method may not be sensitive. Our study aimed to evaluate the best method to achieve a parasitological diagnosis of H. canis infection in a population of receptive young dogs, previously negative by cytology and exposed to tick infestation for one summer season. Results A total of 73 mongrel dogs and ten beagles younger than 18 months of age, living in an animal shelter in southern Italy where dogs are highly infested by Rhipicephalus sanguineus, were included in this study. In March-April 2009 and in October 2009, blood and bone marrow were sampled from each dog. Blood, buffy coat and bone marrow were examined by cytology only (at the first sampling and also by PCR for H. canis (second sampling. In March-April 2009, only one dog was positive for H. canis by cytological examination, whereas in October 2009 (after the summer season, the overall incidence of H. canis infection by cytological examinations was 43.9%. Molecular tests carried out on samples taken in October 2009 showed a considerably higher number of dogs positive by PCR (from 27.7% up to 51.2% on skin and buffy coat tissues, respectively, with an overall positivity of 57.8%. All animals, but one, which were positive by cytology were also PCR-positive. PCR on blood or buffy coat detected the highest number of H. canis-positive dogs displaying a sensitivity of 85.7% for both tissues that increased up to 98% when used in parallel. Twenty-six (74.8% out of the 28 H. canis-positive dogs presented hematological abnormalities, eosinophilia being the commonest alteration observed. Conclusions The results suggest that PCR on buffy coat and blood is the best diagnostic assay for detecting H. canis infection in dogs, although when PCR is not available, cytology on buffy coat should be preferred to

  6. Phylogeography of the Golden Jackal (Canis aureus) in India

    Science.gov (United States)

    Yumnam, Bibek; Negi, Tripti; Maldonado, Jesús E.; Fleischer, Robert C.; Jhala, Yadvendradev V.

    2015-01-01

    The golden jackal (Canis aureus) is one of the most common and widely distributed carnivores in India but phylogeographic studies on the species have been limited across its range. Recent studies have observed absence of mitochondrial (mt) DNA diversity in European populations while some North African populations of golden jackal were found to carry gray wolf (Canis lupus lupaster) mtDNA lineages. In the present study, we sequenced 440 basepairs (bp) of control region (CR) and 412 bp of cytochrome b (cyt b) gene of mtDNA from 62 golden jackals sampled from India (n = 55), Israel (n = 2) and Bulgaria (n = 5), to obtain a total of eighteen haplotypes, comprising sixteen from India and one each from Israel and Bulgaria. Except for three previously described haplotypes represented by one cyt b and one CR haplotype both from India, and one CR haplotype from Bulgaria, all haplotypes identified in this study are new. Genetic diversity was high in golden jackals compared to that reported for other canids in India. Unlike the paraphyletic status of African conspecifics with the gray wolf, the Indian (and other Eurasian) golden jackal clustered in a distinct but shallow monophyletic clade, displaying no evidence of admixture with sympatric and related gray wolf and domestic dog clades in the region. Phylogeographic analyses indicated no clear pattern of genetic structuring of the golden jackal haplotypes and the median joining network revealed a star-shaped polytomy indicative of recent expansion of the species from India. Indian haplotypes were observed to be interior and thus ancestral compared to haplotypes from Europe and Israel, which were peripheral and hence more derived. Molecular tests for demographic expansion confirmed a recent event of expansion of golden jackals in the Indian subcontinent, which can be traced back ~ 37,000 years ago during the late Pleistocene. Our results suggest that golden jackals have had a potentially longer evolutionary history in India

  7. Phylogeography of the Golden Jackal (Canis aureus in India.

    Directory of Open Access Journals (Sweden)

    Bibek Yumnam

    Full Text Available The golden jackal (Canis aureus is one of the most common and widely distributed carnivores in India but phylogeographic studies on the species have been limited across its range. Recent studies have observed absence of mitochondrial (mt DNA diversity in European populations while some North African populations of golden jackal were found to carry gray wolf (Canis lupus lupaster mtDNA lineages. In the present study, we sequenced 440 basepairs (bp of control region (CR and 412 bp of cytochrome b (cyt b gene of mtDNA from 62 golden jackals sampled from India (n = 55, Israel (n = 2 and Bulgaria (n = 5, to obtain a total of eighteen haplotypes, comprising sixteen from India and one each from Israel and Bulgaria. Except for three previously described haplotypes represented by one cyt b and one CR haplotype both from India, and one CR haplotype from Bulgaria, all haplotypes identified in this study are new. Genetic diversity was high in golden jackals compared to that reported for other canids in India. Unlike the paraphyletic status of African conspecifics with the gray wolf, the Indian (and other Eurasian golden jackal clustered in a distinct but shallow monophyletic clade, displaying no evidence of admixture with sympatric and related gray wolf and domestic dog clades in the region. Phylogeographic analyses indicated no clear pattern of genetic structuring of the golden jackal haplotypes and the median joining network revealed a star-shaped polytomy indicative of recent expansion of the species from India. Indian haplotypes were observed to be interior and thus ancestral compared to haplotypes from Europe and Israel, which were peripheral and hence more derived. Molecular tests for demographic expansion confirmed a recent event of expansion of golden jackals in the Indian subcontinent, which can be traced back ~ 37,000 years ago during the late Pleistocene. Our results suggest that golden jackals have had a potentially longer evolutionary history

  8. Phylogeography of the Golden Jackal (Canis aureus) in India.

    Science.gov (United States)

    Yumnam, Bibek; Negi, Tripti; Maldonado, Jesús E; Fleischer, Robert C; Jhala, Yadvendradev V

    2015-01-01

    The golden jackal (Canis aureus) is one of the most common and widely distributed carnivores in India but phylogeographic studies on the species have been limited across its range. Recent studies have observed absence of mitochondrial (mt) DNA diversity in European populations while some North African populations of golden jackal were found to carry gray wolf (Canis lupus lupaster) mtDNA lineages. In the present study, we sequenced 440 basepairs (bp) of control region (CR) and 412 bp of cytochrome b (cyt b) gene of mtDNA from 62 golden jackals sampled from India (n = 55), Israel (n = 2) and Bulgaria (n = 5), to obtain a total of eighteen haplotypes, comprising sixteen from India and one each from Israel and Bulgaria. Except for three previously described haplotypes represented by one cyt b and one CR haplotype both from India, and one CR haplotype from Bulgaria, all haplotypes identified in this study are new. Genetic diversity was high in golden jackals compared to that reported for other canids in India. Unlike the paraphyletic status of African conspecifics with the gray wolf, the Indian (and other Eurasian) golden jackal clustered in a distinct but shallow monophyletic clade, displaying no evidence of admixture with sympatric and related gray wolf and domestic dog clades in the region. Phylogeographic analyses indicated no clear pattern of genetic structuring of the golden jackal haplotypes and the median joining network revealed a star-shaped polytomy indicative of recent expansion of the species from India. Indian haplotypes were observed to be interior and thus ancestral compared to haplotypes from Europe and Israel, which were peripheral and hence more derived. Molecular tests for demographic expansion confirmed a recent event of expansion of golden jackals in the Indian subcontinent, which can be traced back ~ 37,000 years ago during the late Pleistocene. Our results suggest that golden jackals have had a potentially longer evolutionary history in India

  9. Digital gene expression analysis of Microsporum canis exposed to berberine chloride.

    Directory of Open Access Journals (Sweden)

    Chen-Wen Xiao

    Full Text Available Berberine, a natural isoquinoline alkaloid of many medicinal herbs, has an active function against a variety of microbial infections including Microsporum canis (M. canis. However, the underlying mechanisms are poorly understood. To study the effect of berberine chloride on M. canis infection, a Digital Gene Expression (DGE tag profiling was constructed and a transcriptome analysis of the M. canis cellular responses upon berberine treatment was performed. Illumina/Hisseq sequencing technique was used to generate the data of gene expression profile, and the following enrichment analysis of Gene Ontology (GO and Pathway function were conducted based on the data of transcriptome. The results of DGE showed that there were 8476945, 14256722, 7708575, 5669955, 6565513 and 9303468 tags respectively, which was obtained from M. canis incubated with berberine or control DMSO. 8,783 genes were totally mapped, and 1,890 genes have shown significant changes between the two groups. 1,030 genes were up-regulated and 860 genes were down-regulated (P<0.05 in berberine treated group compared to the control group. Besides, twenty-three GO terms were identified by Gene Ontology functional enrichment analysis, such as calcium-transporting ATPase activity, 2-oxoglutarate metabolic process, valine catabolic process, peroxisome and unfolded protein binding. Pathway significant enrichment analysis indicated 6 signaling pathways that are significant, including steroid biosynthesis, steroid hormone biosynthesis, Parkinson's disease, 2,4-Dichlorobenzoate degradation, and tropane, piperidine and Isoquinoline alkaloid biosynthesis. Among these, eleven selected genes were further verified by qRT-PCR. Our findings provide a comprehensive view on the gene expression profile of M. canis upon berberine treatment, and shed light on its complicated effects on M. canis.

  10. Medical management of pyometra in three red wolves (Canis rufus).

    Science.gov (United States)

    Anderson, Kadie; Wolf, Karen N

    2013-12-01

    Pyometra is a serious, life-threatening disease of both domestic and non-domestic species often requiring ovariohysterectomy to preserve the life of the animal. Medical management of pyometra has been successful in domestic and non-domestic species, and the consideration of such treatment is of marked importance in a critically endangered species. Of the canids, the red wolf (Canis rufus) is second only to African hunting dogs (Lycaon pictus) in terms of the prevalence of both cystic endometrial hyperplasia and pyometra. In this report, three red wolves were medically managed for pyometra. Aside from vaginal discharge, none of the wolves exhibited clinical signs, nor were there reflective inflammatory changes in the laboratory findings. All wolves received standard treatment for pyometra, including prostaglandin F2alpha and antibiotic therapy, while one wolf was more aggressively managed with uterine lavage. Pyometra recurred in two of the treated wolves, while the most aggressively managed wolf continues to show ultrasonographic resolution 2 yr posttreatment. Aggressive medical management of pyometra should be considered a treatment option in certain red wolf females, as it may preserve the animal's reproductive potential. PMID:24450062

  11. Phylogeography of wolves (Canis lupus) in the Pacific Northwest

    Science.gov (United States)

    Weckworth, B.V.; Talbot, S.L.; Cook, J.A.

    2010-01-01

    Glacial cycles in the late Pleistocene played a dominant role in sculpting the evolutionary histories of many high-latitude organisms. The refugial hypothesis argues that populations retracted during glacial maxima and were isolated in separate refugia. One prediction of this hypothesis is that populations inhabiting different refugia diverged and then, during interglacial periods, rapidly expanded into deglaciated regions. The range of the gray wolf (Canis lupus) was modified by these expansion and contraction cycles in the late Pleistocene. Our analyses of variation of mitochondrial control region sequences corroborate previous microsatellite analyses supporting independent evolutionary histories for Coastal and Continental wolves in North America. Coastal wolves represent the remnants of a formerly widespread and diverse southern clade that expanded into coastal Southeast Alaska, likely in the early Holocene. In contrast, extant northern Continental populations appear to be admixed, composed of lineages independently arising from ancestors that persisted in either southern or northern (Beringia) refugia. This pattern of diversification suggests the possibility of 3 temporally independent colonizations of North America by wolves from Asia. Coastal wolves are the last vestige of a formerly widespread phylogroup that largely was extirpated in North America by humans during the last century. The independent phylogeographic history of these Coastal wolves has yet to be characterized. Their distinctiveness among North American wolf populations may warrant a reevaluation of their conservation status and management. ?? 2009 American Society of Mammalogists.

  12. Large dust grains in the wind of VY Canis Majoris

    CERN Document Server

    Scicluna, P; Wesson, R; Blommaert, J A D L; Kasper, M; Voshchinnikov, N V; Wolf, S

    2015-01-01

    Massive stars live short lives, losing large amounts of mass through their stellar wind. Their mass is a key factor determining how and when they explode as supernovae, enriching the interstellar medium with heavy elements and dust. During the red supergiant phase, mass-loss rates increase prodigiously, but the driving mechanism has proven elusive. Here we present high-contrast optical polarimetric-imaging observations of the extreme red supergiant VY Canis Majoris and its clumpy, dusty, mass-loss envelope, using the new extreme-adaptive-optics instrument SPHERE at the VLT. These observations allow us to make the first direct and unambiguous detection of submicron dust grains in the ejecta; we derive an average grain radius $\\sim$ 0.5 $\\mu$m, 50 times larger than in the diffuse ISM, large enough to receive significant radiation pressure by photon scattering. We find evidence for varying grain sizes throughout the ejecta, highlighting the dynamical nature of the envelope. Grains with 0.5 $\\mu$m sizes are likel...

  13. Cross-fostering in gray wolves (Canis lupus lupus).

    Science.gov (United States)

    Scharis, Inger; Amundin, Mats

    2015-01-01

    Cross-fostering in canids, with captive-bred pups introduced into endangered wild populations, might aid conservation efforts by increasing genetic diversity and lowering the risk of inbreeding depression. The gray wolf (Canis lupus lupus) population in Scandinavia suffers from severe inbreeding due to a narrow genetic base and geographical isolation. This study aimed at evaluating the method to cross-foster wolf pups from zoo-born to zoo-born litters. The following was assessed: female initial acceptance of foster pups, growth rate in relation to age difference between foster pups and pups in recipient litters and survival over the first 33 weeks. The study included four litters added by two foster pups in each. The age differences between the foster pups and the recipient litters were 2-8 days. After augmentation, all four females accepted the foster pups, demonstrated by her moving the entire litter to a new den site. Growth rate was dependent on the age difference of the pups in the foster litters, with a considerably slower growth rate in the 8 days younger pups. However, these pups later appeared to be at no disadvantage. Foster pups had a higher survival rate than females' pups, however, the causes of death were probably not kin or non-kin related. The results indicate that cross-fostering works in gray wolves and that this might be a plausible way to increase genetic variation in the wild population. PMID:25773058

  14. Hypertrophic Osteodystrophy in Two Red Wolf (Canis rufus Pups

    Directory of Open Access Journals (Sweden)

    Jenessa L. Gjeltema

    2015-01-01

    Full Text Available A 6-month-old red wolf (Canis rufus pup presented for evaluation of progressive thoracic and pelvic limb lameness, joint swelling, and decreased body condition. Radiographic evaluation revealed medullary sclerosis centered at the metaphyses of multiple long bones, well-defined irregular periosteal proliferation, and ill-defined lucent zones paralleling the physes, consistent with hypertrophic osteodystrophy (HOD. Biopsies of affected bone revealed medullary fibrosis and new bone formation. The pup improved following treatment with nonsteroidal anti-inflammatories, opioids, and supportive care over the course of 4 weeks. Metaphyseal periosteal bone proliferation persisted until the animal was humanely euthanized several years later for poor quality of life associated with bilateral cranial cruciate ligament rupture. A second red wolf pup of 4.5 months of age presented for evaluation of lethargy, kyphotic posture, and swollen carpal and tarsal joints. Radiographs revealed bilateral medullary sclerosis and smooth periosteal reaction affecting multiple long bones, suggestive of HOD. Further diagnostics were not pursued in this case to confirm the diagnosis, and the clinical signs persisted for 4 weeks. In light of these two case reports, HOD should be recognized as a developmental orthopedic disease in growing red wolves.

  15. Helminth parasites in the endangered Ethiopian wolf, Canis simensis.

    Science.gov (United States)

    van Kesteren, F; Piggott, K J; Bengui, T; Kubri, S B; Mastin, A; Sillero-Zubiri, C; Paris, M; Millar, R P; Macdonald, D W; Shiferaw, F; Craig, P S

    2015-07-01

    Ethiopian wolves, Canis simensis, are an endangered carnivore endemic to the Ethiopian highlands. Although previous studies have focused on aspects of Ethiopian wolf biology, including diet, territoriality, reproduction and infectious diseases such as rabies, little is known of their helminth parasites. In the current study, faecal samples were collected from 94 wild Ethiopian wolves in the Bale Mountains of southern Ethiopia, between August 2008 and February 2010, and were screened for the presence of helminth eggs using a semi-quantitative volumetric dilution method with microscopy. We found that 66 of the 94 faecal samples (70.2%) contained eggs from at least one group of helminths, including Capillaria, Toxocara, Trichuris, ancylostomatids, Hymenolepis and taeniids. Eggs of Capillaria sp. were found most commonly, followed by Trichuris sp., ancylostomatid species and Toxocara species. Three samples contained Hymenolepis sp. eggs, which were likely artefacts from ingested prey species. Four samples contained taeniid eggs, one of which was copro-polymerase chain reaction (copro-PCR) and sequence positive for Echinococcus granulosus, suggesting a spillover from a domestic parasite cycle into this wildlife species. Associations between presence/absence of Capillaria, Toxocara and Trichuris eggs were found; and egg burdens of Toxocara and ancylostomatids were found to be associated with geographical location and sampling season. PMID:25007150

  16. Retrospective analysis of clinical and laboratory findings in hunting dogs with serologic reactions to tick-borne pathogens (Anaplasma phagocytophilum, Borrelia burgdorferi, Babesia canis, Ehrlichia canis, Ricketsia conorii

    Directory of Open Access Journals (Sweden)

    Spasojević-Kosić Ljubica

    2015-01-01

    Full Text Available Seroprevalence of tick-borne infections in endemic areas could be high. In this study, we investigated the seroprevalence of tick-borne pathogens (Anaplasma phagocytophilum, Borrelia burgdorferi, Babesia canis, Ehrlichia canis, Rickettsia conorii in hunting dogs, naturally infected with one or more pathogens. Serological test results of the investigated animals were compared to those from clinical examination, as well as from haematological and biochemical analyses. A total of 74.14% dogs were seropositive (R.conorii 44.83%, B. canis 32.76%, B. burgdorferi 25.86%, E. canis 13.79%, A. phagocytophilum 8.47%, with 25.86% of dogs seropositive to two pathogens, 15.52% seropositive to three pathogens, and 1.72% of dogs seropositive to four pathogens. Among all registered clinical signs, only pyrexia (p<0.05 and arrhythmia (p<0.05 were significant in seropositive dogs. There was no significant difference between seropositive and seronegative dogs regarding the majority of haematological and biochemical parameters. Statistically significant difference was registered for particular haematological (number of red blood cells and seroreactivity to B. burgdorferi and biochemical parameters (albumin concentration and seroreactivity to E. canis, and AST and seroreactivity to R. conorii but these values were not clinically significant. The high exposure to tick-borne pathogens suggests that ectoparasitic profilactic treatment is not adequate in examined population of hunting dogs. Clinical finding of pyrexia need to be further investigated and explained etiologically, which means that molecular diagnosis should be used in order to identify larger number of pathogens because of the possibility of coinfection. [Projekat Ministarstva nauke Republike Srbije, br. TR 31084

  17. A serological diagnostic survey for Brucella canis infection in Turkish patients with Brucellosis-like symptoms.

    Science.gov (United States)

    Sayan, Murat; Erdenlig, Sevil; Stack, Judy; Kilic, Selcuk; Guducuoglu, Huseyin; Aksoy, Yavuz; Baklan, Ayhan; Etiler, Nilay

    2011-01-01

    The incidence of Brucella canis infection in humans is unknown in Turkey. In this study, we investigated the prevalence of B. canis infection in human sera obtained from six regions in Turkey and comparatively evaluated the results obtained by agglutination-based techniques using standardized antigens made from B. canis. The patients (n = 1,746) presented with clinical symptoms that were similar to those of brucellosis. All patients who tested negative in the Rose Bengal test for the smooth Brucella strains (abortus, melitensis, and suis) were screened for evidence of B. canis infection using the rapid slide agglutination test (RSAT), the microagglutination test (MAT), and the 2-mercaptoethanol RSAT test (2ME-RSAT). Of the samples tested, 157 (8.9%), 68 (3.8%), and 66 (3.7%) were positive for B. canis, as determined by RSAT, MAT, and 2ME-RSAT, respectively. The diagnostic sensitivity, specificity, positive predictive value, and negative predictive value of RSAT were 100%, 94.6%, 42%, and 100%, respectively, and of MAT were 100%, 99.9%, 97%, and 100%, respectively. We recommend the routine use of MAT and 2ME-RSAT to check the sera of all patients with symptoms of brucellosis who are negative for brucellosis using a smooth Brucella antigen. PMID:22116333

  18. Babesia canis vogeli infection in dogs and ticks in the semiarid region of Pernambuco, Brazil

    Directory of Open Access Journals (Sweden)

    Andreina C. Araujo

    2015-05-01

    Full Text Available Abstract:This study aimed to report the prevalence of Babesia canis vogeli in dogs and ticks in the urban and rural areas of Petrolina, Pernambuco. Serum and peripheral blood samples of 404 dogs were tested by indirect immunofluorescence assay (IFA and by blood smears, respectively. The presence of tick infestation was evaluated, and some specimens were submitted to DNA amplification by polymerase chain reaction (PCR. The presence of antibodies anti-B. canis vogeli was determinate in 57.9% (234/404 of dogs. The direct detection of Babesia spp was obtained in 0.5% (2/404 dogs by visualization of intraerythrocytic forms. Infestation by Rhipicephalus sanguineus sensu lato was observed in 54.5% (220/404 of dogs in both urban and rural areas. DNA of Babesia canis vogeli were obtained by PCR in 6% individual (3/50 and 8.7% of pool of ticks (7/80. The risk factors for the presence of anti-B. canis vogeli antibodies, as determined through the application of logistic regression models (P<0.05, were the following: medium breed size variables (P<0.001; contact with areas of forest (P=0.021; and access on the street (P=0.046. This study describes, for the first time, the confirmation of infection of B. canis vogeli in dogs and ticks in the semiarid region of Pernambuco, Brazil.

  19. Genetic variability in Microsporum canis isolated from cats, dogs and humans in Brazil.

    Science.gov (United States)

    da Costa, Fernanda V A; Farias, Marconi R; Bier, Daniele; de Andrade, Caroline P; de Castro, Luiza A; da Silva, Sérgio C; Ferreiro, Laerte

    2013-09-01

    Dermatophytosis caused by Microsporum canis is a heterogeneous disease with variable clinical manifestations. M. canis is a zoophilic dermatophyte and the most frequent fungi isolated from dogs, cats and children in Brazil. The aim of this study was to investigate the genetic variability of M. canis isolates from different animal species using two microsatellite markers, namely, McGT(13) and McGT(17), and to correlate the results with the clinical and epidemiological patient data in Brazil. The study included a global set of 102 M. canis strains, including 37 symptomatic cats, 35 asymptomatic cats, 19 human patients with tinea, 9 asymptomatic dogs and 2 symptomatic dogs. A total of 14 genotypes were identified, and 6 large populations were distinguished. There was no correlation between these multilocus genotypes and the clinical and epidemiological data, including the source, symptomatology, clinical picture, breed, age, sex, living conditions and geographic location. These results demonstrate that the use of microsatellite polymorphisms is a reliable method for the differentiation of M. canis strains. However, we were unable to demonstrate a shared clinical and epidemiological pattern among the same genotype samples. PMID:23551796

  20. Chromosome analysis in the Kruger National Park - the chromosomes of the saddle-backed jackal Canis Mesomelas

    Directory of Open Access Journals (Sweden)

    C. Wallace

    1977-08-01

    Full Text Available Among the present-day members of the Canidae family are included the dogs and foxes (Wurster and Benirschke 1968. The genus Canis is represented in Africa by four species of jackal (Bigaike 1972. This paper presents the chromosome Findings in a male saddle-backed jackal Canis mesomelas studied in the Kruger National Park, Republic of South Africa.

  1. Gene : CBRC-PHAM-01-1587 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available D: similar to CG31439-PA [Canis familiaris] 6e-46 29% MDPVEVSILRRSVPCGGVYPVEVCPCGGMDPVEVCILWRCVPCTLWRCVPCTLWRYVPCGGMDPVEVC...ILWRCVPCGGVYPVEVCTLWRCVPCGSMDPVEVCIPWRYVPCGGVYPVEVCILWRCVPCGGVYSVEVCTLWRCVSCGGMNPVEVCTLYPVEVSTLWRCVPCGGMDPVEVC...TLWRCVPVEVWILWRHVPCEGVHPVKVWILWRCVLCGDMYPVEVCTLWRYRSCGAVYPVEVYTLW...RFVLCGGVYPAEVWILWRYVPCGSVYPVEVWILWRCVLCGGVYPVEVCTLWRCILCGGVYPVEVWNLWRCVSCGGVYPVEVYILWRCVPCGGMEPVEVCILWRRVSCGGVYPVEVYTLWRCVPCGGMEPVEVC...ILWRYGSCGGVYPVEVWILWRCVPCRSVYPVEVCTLWRCVPCGGMEPVEVCILWRYGSCGGVYLVGVCTLWRCVLCGGVYPVEVWNLWRCVSCGGMDSVNVCTLWECVPCGGVYPVEIWIL ...

  2. Gene : CBRC-FCAT-01-0270 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available lfactory receptor-like protein DTMT emb|CAA46129.1| DTMT [Canis familiaris] prf||1804351B olfactory receptor...N*SFSDLCFSSVTMPKLLQNMQSQVPPLPYASCLAQMYCYLFFGVLESFLIVVMAYGRYVAICFPLHYTTIMSPNLCLSLVVVLWVLTTAHAMLHTLLMAKLSFCANNIIPRF

  3. Data on the parasitological status of golden jackal (Canis aureus L., 1758) in Hungary.

    Science.gov (United States)

    Takács, András; Szabó, László; Juhász, Lajos; Takács, András Attila; Lanszki, József; Takács, Péter Tamás; Heltai, Miklós

    2014-03-01

    In Hungary, twenty Canis aureus individuals were submitted to parasitological examinations in 2010-2012. Two Coccidia: Cystoisospora canis (15%) and Toxoplasma-type oocysts (5%), one Trematoda: Alaria alata (10%), six Cestoda: Mesocestoides lineatus (20%), Echinococcus granulosus (10%), Dipylidium caninums (5%), Taenia hydatigena (15%), Taenia pisiformis (20%), Taenia crassiceps (40%), and nine Nematoda: Angiostrongylus vasorum (10%), Crenosoma vulpis (30%), Capillaria aerophila (5%), Toxocara canis (20%), Toxascaris leonina (15%), Trichuris vulpis (10%), Ancylostoma caninum (45%), Uncinaria stenocephala (40%), Capillaria plica (45%) have been identified. Angiostronglyus vasorum has been reported from carnivores in Europe, Africa, South America and North America. The helminth A. vasorum or French heartworm is a metastrongylid nematode, widely distributed in Western Europe, that infects the pulmonary arterial tree of dogs, various species of foxes, wolves, Eurasian badgers, coyotes and stoats. To our knowledge, this is the first report of natural A. vasorum infection in golden jackal. PMID:24334089

  4. Comparação antigênica entre extratos de Toxocara canis e Ascaris suum

    Directory of Open Access Journals (Sweden)

    Felix R. Zyngier

    1974-06-01

    Full Text Available O autor apresenta a comparação de dois extratos de Toxocara canis e um de Ascaris suum do ponto de vista antigênico. O método usado foi a imunodifusão em gel segundo Ouchtehlöny. O extrato de T. canis obtido pela técnica de Jeska mostrou 7 faixas de precipitação contra o anti-soro homólogo. O extrato de A. suum obtido pela mesma técnica apenas revelou 3 faixas, uma das quais com identidade parcial com o antígeno anterior. O extrato de T. canis segundo Woodruff e Thacker revelou 3 faixas de precipitação contra o anti-soro homólogo, todas elas com identidade total com o outro extrato do mesmo parasita.

  5. Population dynamics of Toxocara canis in pigs receiving a single or multiple infection

    DEFF Research Database (Denmark)

    Taira, K.; Saeed, I.; Lind, Peter;

    2003-01-01

    The population dynamics of Toxocara canis in pigs, and their immune response to a primary and a challenge infection, were studied by parasitological, haematological and serological parameters. Seventy pigs were divided into 4 groups; 35 pigs received a primary infection (group A), 15 pigs received...... (day 28). On days 7, 14, 21 and 28 p.i., 5 pigs of group A, and on days 35, 42 and 49 p.i., 5 pigs from each of groups A, B and C were necropsied. Numbers of recovered larvae varied widely among the 5 pigs of each group on all days of necropsy. Toxocara canis larvae were recovered predominantly from...... receiving a challenge infection, in contrast to the challenge control pigs. The fact that T. canis larvae migrate and persist in the tissues of pigs for more than 1 month suggests a zoonotic risk in infected pigs. The relevance of these data to the population biology and immunology of porcine and human...

  6. Influence of dietary protein content and source on colonic fermentative activity in dogs differing in body size and digestive tolerance.

    Science.gov (United States)

    Nery, J; Goudez, R; Biourge, V; Tournier, C; Leray, V; Martin, L; Thorin, C; Nguyen, P; Dumon, H

    2012-08-01

    Low-consistency, high-moisture feces have been observed in large dogs (Canis lupus familiaris), compared with small dogs, and particularly in sensitive breeds (e.g., German Shepherd dogs). The aim of this work was to determine if greater colonic protein fermentation is responsible for poorer fecal quality in large sensitive dogs. Twenty-seven bitches were allotted to 4 groups based on size and digestive sensitivity: small, medium, large tolerant, and large sensitive. Five experimental diets varying in protein source [highly digestible wheat gluten (WG) vs. medium digestible poultry meal (PM), and protein concentration from 21.4 to 21.6 (LP) to 38.2 to 39.2% CP (HP)] were tested. Diets were fed for 14 d and followed by a 12-d transition period. Digestive fermentation by-products were investigated in fresh stools [ammonia, phenol, indole, and short chain fatty acids including acetate, propionate, and butyrate (C2 to C4 SCFA), branched-chain fatty acids (BCFA), and valerate] and in urine (phenol and indole). Bacterial populations in feces were identified. The PM diets resulted in greater fecal concentrations of ammonia, BCFA, valerate, indole, and C2 to C4 SCFA than WG diets (P = 0.002, P fermentation products in feces together with improved fecal quality in dogs, especially in large sensitive ones. Poor fecal quality in large sensitive dogs could be partly related to the pattern of protein fermentation in the hindgut. PMID:22328724

  7. Comparative Experimental Infection Study in Dogs with Ehrlichia canis, E. chaffeensis, Anaplasma platys and A. phagocytophilum.

    Directory of Open Access Journals (Sweden)

    Arathy D S Nair

    Full Text Available Dogs acquire infections with the Anaplasmataceae family pathogens, E. canis, E. chaffeensis, E. ewingii, A. platys and A. phagocytophilum mostly during summer months when ticks are actively feeding on animals. These pathogens are also identified as causing diseases in people. Despite the long history of tick-borne diseases in dogs, much remains to be defined pertaining to the clinical and pathological outcomes of infections with these pathogens. In the current study, we performed experimental infections in dogs with E. canis, E. chaffeensis, A. platys and A. phagocytophilum. Animals were monitored for 42 days to evaluate infection-specific clinical, hematological and pathological differences. All four pathogens caused systemic persistent infections detectible throughout the 6 weeks of infection assessment. Fever was frequently detected in animals infected with E. canis, E. chaffeensis, and A. platys, but not in dogs infected with A. phagocytophilum. Hematological differences were evident in all four infected groups, although significant overlap existed between the groups. A marked reduction in packed cell volume that correlated with reduced erythrocytes and hemoglobin was observed only in E. canis infected animals. A decline in platelet numbers was common with E. canis, A. platys and A. phagocytophilum infections. Histopathological lesions in lung, liver and spleen were observed in all four groups of infected dogs; infection with E. canis had the highest pathological scores, followed by E. chaffeensis, then A. platys and A. phagocytophilum. All four pathogens induced IgG responses starting on day 7 post infection, which was predominantly comprised of IgG2 subclass antibodies. This is the first detailed investigation comparing the infection progression and host responses in dogs after inoculation with four pathogens belonging to the Anaplasmataceae family. The study revealed a significant overlap in clinical, hematological and pathological

  8. Toxocara canis, Trichinella spiralis and Taenia solium helminthozoonoses: seroprevalence among selected populations in north India.

    Science.gov (United States)

    Singh, B B; Sharma, R; Gill, J P S

    2015-09-01

    Helminthozoonoses are being considered as a research priority in India and many other tropical and subtropical countries. Taenia solium and Trichinella spiralis are emerging public health and food safety issues in the country and the developing world. The asymptomatic Ta. solium carriers act as important risk for neurocysticercosis, leading to adult onset epilepsy in the country. Human toxocariasis is another common zoonosis which occurs due to larvae of Toxocara canis or T. cati. The current study was planned to obtain baseline seropositivity data for Ta. solium, To. canis and Tr. spiralis antibodies among selected populations in Punjab province of northern India. In the present study, 122 human subjects belonging to selected occupations viz. farmers and veterinary practitioners were screened using the RIDASCREEN(®) Ta. solium IgG, RIDASCREEN(®) Toxocara IgG and RIDASCREEN(®) Trichinella IgG enzyme immunoassays for the qualitative determination of IgG antibodies against Ta. solium, Tr. spiralis and To. canis, respectively in human serum. The seropositivity of To. canis, Tr. spiralis and Ta. solium infections were found to be 22.13, 5.73 and 11.47 %, respectively in human serum samples. The relative risk of being infected for To. canis, Tr. spiralis and Ta. solium infections was found to be 1.91 (95 % CI 0.786-4.669), 2.61 (95 % CI 0.3258-20.94) and 1.596 (95 % CI 0.427-5.3893) times high respectively in farmers when compared to veterinary practitioners. The present study indicates that exposure to To. canis and Ta. solium is not uncommon among farmers and veterinary practitioners in this part of the country. These results provided evidence of Tr. spiralis among selected human populations in the country and demand more research related to trichinellosis in their respective animal and human hosts.

  9. Toxocara canis, Trichinella spiralis and Taenia solium helminthozoonoses: seroprevalence among selected populations in north India.

    Science.gov (United States)

    Singh, B B; Sharma, R; Gill, J P S

    2015-09-01

    Helminthozoonoses are being considered as a research priority in India and many other tropical and subtropical countries. Taenia solium and Trichinella spiralis are emerging public health and food safety issues in the country and the developing world. The asymptomatic Ta. solium carriers act as important risk for neurocysticercosis, leading to adult onset epilepsy in the country. Human toxocariasis is another common zoonosis which occurs due to larvae of Toxocara canis or T. cati. The current study was planned to obtain baseline seropositivity data for Ta. solium, To. canis and Tr. spiralis antibodies among selected populations in Punjab province of northern India. In the present study, 122 human subjects belonging to selected occupations viz. farmers and veterinary practitioners were screened using the RIDASCREEN(®) Ta. solium IgG, RIDASCREEN(®) Toxocara IgG and RIDASCREEN(®) Trichinella IgG enzyme immunoassays for the qualitative determination of IgG antibodies against Ta. solium, Tr. spiralis and To. canis, respectively in human serum. The seropositivity of To. canis, Tr. spiralis and Ta. solium infections were found to be 22.13, 5.73 and 11.47 %, respectively in human serum samples. The relative risk of being infected for To. canis, Tr. spiralis and Ta. solium infections was found to be 1.91 (95 % CI 0.786-4.669), 2.61 (95 % CI 0.3258-20.94) and 1.596 (95 % CI 0.427-5.3893) times high respectively in farmers when compared to veterinary practitioners. The present study indicates that exposure to To. canis and Ta. solium is not uncommon among farmers and veterinary practitioners in this part of the country. These results provided evidence of Tr. spiralis among selected human populations in the country and demand more research related to trichinellosis in their respective animal and human hosts. PMID:26345057

  10. Genetic blueprint of the zoonotic pathogen Toxocara canis

    DEFF Research Database (Denmark)

    Zhu, Xing-Quan; Korhonen, Pasi K.; Cai, Huimin;

    2015-01-01

    Toxocara canis is a zoonotic parasite of major socioeconomic importance worldwide. In humans, this nematode causes disease (toxocariasis) mainly in the under-privileged communities in developed and developing countries. Although relatively well studied from clinical and epidemiological perspectives......, to date, there has been no global investigation of the molecular biology of this parasite. Here we use next-generation sequencing to produce a draft genome and transcriptome of T. canis to support future biological and biotechnological investigations. This genome is 317 Mb in size, has a repeat content...

  11. First molecular evidence of Hepatozoon canis infection in red foxes and golden jackals from Hungary

    OpenAIRE

    Farkas, Róbert; Solymosi, Norbert; Takács, Nóra; Hornyák, Ákos; Hornok, Sándor; Nachum-Biala, Yaarit; Baneth, Gad

    2014-01-01

    Background Recently, Hepatozoon canis infection has been detected among shepherd, hunting and stray dogs in the southern part of Hungary, which is considered to be free of Rhipicephalus sanguineus sensu lato and close to the border with Croatia. The aim of this study was to acquire information on the possibility that red foxes and/or golden jackals could play a role in the appearance and spread of H. canis in Hungary. Methods A conventional PCR was used to amplify a 666 bp long fragment of th...

  12. Detection of Ehrlichia canis in Dogs by IFA Test and Dot-ELISA

    OpenAIRE

    ERDEĞER, Jale

    2003-01-01

    Ehrlichia canis is the causative agent of canine monocytic ehrlichiosis (CME). The aim of this study was to detect E. canis antibodies in dogs by the IFA and dot-ELISA techniques. Blood sera from 239 dogs were collected as material. IFA test and dot-ELISA were performed with commercially available test kits. The IFA test was applied according to the procedure in the IFA kit. The Immunocomb test system was used in dot-ELISA. Agreement between these techniques was analysed by the kappa (K) tes...

  13. Uji Efektivitas Beberapa Minyak Atsiri terhadap Pertumbuhan Microsporum canis secara in Vitro

    Directory of Open Access Journals (Sweden)

    Bunga Saridewi Nurmansyah

    2016-01-01

    Full Text Available AbstrakDermatofitosis merupakan masalah kesehatan masyarakat yang penting di daerah tropis. Minyak atsiri merupakan salah satu potensi alam Indonesia yang diketahui memiliki daya antifungi. Tujuan penelitian ini adalah mengetahui efektivitas beberapa minyak atsiri (serai wangi, kayu manis dan cengkeh sebagai antijamur dalam mengendalikan pertumbuhan Microsporum canis penyebab dermatofitosis secara in vitro. Penelitian dilakukan di Laboratorium Fitopatologi KP Balittro Laing Solok dari  Februari sampai April 2014. Studi eksperimental ini dilakukan dengan metode pengenceran disusun  dalam Desain Rancang Acak Lengkap dalam Faktorial. Faktor pertama adalah jenis minyak atsiri (daun serai wangi, daun kayu manis, daun cengkeh. Faktor kedua adalah tingkat konsentrasi minyak atsiri (100 ppm, 250 ppm, 500 ppm, 1000 ppm dan 2000 ppm. Hasil penelitian ini menunjukkan bahwa minyak atsiri daun serai wangi, daun kayu manis dan daun sarasah cengkeh efektif dalam menekan pertumbuhan M. canis secara in vitro. Ketiga minyak atsiri pada konsentrasi 500 ppm telah mampu menghambat pertumbuhan M. canis hingga 100%. Minyak atsiri daun sarasah cengkeh memiliki efek antifungi paling tinggi (89,17%, diikuti minyak atsiri daun serai wangi (80,98% dan kayu manis (77,07%.                Kata kunci: minyak atsiri, serai wangi, cengkeh, kayumanis, microsporum canis AbstractDermatophytosis is an important public health problem in tropical areas. Essential oil is one of natural potential from Indonesia has been predicted as antifungal. The objective of this study was to detect effectivity some essential oils such as citronella, cinnamon and clove as antifungal to control the growth of dermatophyte infections caused by Microsporum canis by in vitro . The study was done  in the Laboratory of Phytopathology KP Balitro of Laing Solok from February until April 2014. This is an experimental study with dilution method arranged in Complete Randomized Design in

  14. ELEVATED TRANS-MAMMARY TRANSMISSION OF Toxocara canis LARVAE IN BALB/c MICE

    Directory of Open Access Journals (Sweden)

    Paula de Lima Telmo

    2015-02-01

    Full Text Available Toxocariasis is a widespread zoonosis and is considered an important worldwide public health problem. The aim of this study was to investigate the frequency of trans-mammary Toxocara canis infection in newborn BALB/c mice nursed by females experimentally infected with 1,200 eggs after delivery. After 50 days of age, the presence of larvae in different organs of the offspring was investigated. Trans-mammary infection was confirmed in 73.9% of the mice that had been nursed by infected females. These data show a high trans-mammary transmission of T. canis and confirm the significance of this transmission route in paratenic hosts.

  15. Differential serodiagnostics of Toxocara canis and Toxocara cati - is it possible?

    DEFF Research Database (Denmark)

    Poulsen, C. S.; Skov, Søren; Yoshida, A.;

    2015-01-01

    One of the most common zoonotic helminth infections is caused by species in the genus Toxocara, particularly Toxocara canis and T. cati (Syn. T. mystax). However, their relative contribution to toxocarosis in humans remains largely unknown because causative larvae are seldom recovered...... and uncertainties regarding the validity of existing serological assays. In this study, we used sera from a pig model experimentally infected with T. canis and T. cati to evaluate whether a Western blot could discriminate between the two species. No proteins were observed that could be used as a diagnostic tool...

  16. Ehrlichia canis infection in a dog with no history of travel outside the United Kingdom.

    Science.gov (United States)

    Wilson, H E; Mugford, A R; Humm, K R; Kellett-Gregory, L M

    2013-08-01

    A two-year-old female neutered Tibetan terrier was referred following a one-month history of lethargy, inappetence and pancytopenia, which had been poorly responsive to immunosuppressive and fluoroquinolone treatment. The dog was diagnosed with pure red cell aplasia and was found to be positive for Ehrlichia canis by both antibody titre measurement and polymerase chain reaction. The dog lived in London and had not travelled outside the UK. The dog was treated with doxycycline, prednisolone and ciclosporin, but died as a result of gastrointestinal tract haemorrhage. To the authors' knowledge, this represents the first reported case of Ehrlichia canis in a dog in the UK with no previous travel history.

  17. Efficacy of SAD (Berne) rabies vaccine given by the oral route in two species of jackal (Canis mesomelas and Canis adustus).

    Science.gov (United States)

    Bingham, J; Kappeler, A; Hill, F W; King, A A; Perry, B D; Foggin, C M

    1995-07-01

    Eight black-backed jackals (Canis mesomelas) and seven side-striped jackals (Canis adustus) were given SAD (Berne) rabies vaccine by direct oral instillation. Three different vaccine doses were used: 10(6.3), 10(6.8) and 10(7.5) median tissue culture infectious doses. Two additional jackals were given vaccine in chicken heads. One group of jackals was challenged with a lethal dose of jackal-derived rabies virus 1 mo after vaccination and a second group 12 mo after vaccination. All 17 vaccinated jackals developed high and persistent serum neutralizing antibody titers. All challenged jackals resisted a lethal dose of rabies virus, whereas three control jackals given the same challenge succumbed to rabies. PMID:8592368

  18. Serological cross-reactivity of Trypanosoma cruzi, Ehrlichia canis, Toxoplasma gondii, Neospora caninum and Babesia canis to Leishmania infantum chagasi tests in dogs

    Directory of Open Access Journals (Sweden)

    Maurício Franco Zanette

    2014-01-01

    Full Text Available Introduction: The aim of this study was to evaluate the serological cross-reactivity between Leishmania sp. and other canine pathogens. Methods: Positive serum samples for Ehrlichia canis, Babesia canis, Toxoplasma gondii, Neospora caninum and Trypanosoma cruzi were tested using three serological methods enzyme linked immunosorbent assay (ELISA, indirect immunofluorescent antibody test (IFAT and Kalazar Detect™, for canine visceral leishmaniasis. Results: Of the 57 dog samples tested, 24 (42.1% tested positive using one of the three serological methods: 10/57 (17.5% for ELISA, 11/57 (19.3% for IFAT and 3/57 (5.3% for Kalazar Detect™. Conclusions: Our results demonstrated that the presence of other infectious agents may lead to cross-reactivity on leishmaniasis serological tests.

  19. Dietary Patterns in Childhood

    DEFF Research Database (Denmark)

    Andersen, Louise Beltoft Borup

    of the complexity in child nutrition both in observational and intervention designs as well as for investigating development of dietary patterns over time. Explorative analyses of indicators for dietary patterns showed that parental, household and child characteristics are associated with dietary patterns in early...

  20. First record of a golden jackal (Canis aureus) in the Savinja Valley (Northern Slovenia): Prvi podatek o pojavljanju šakala (Canis aureus) v Savinjski dolini (S Slovenija):

    OpenAIRE

    Krofel, Miha; Potočnik, Hubert

    2008-01-01

    The article presents the record of an adult female golden jackal (Canis aureus) accidentally shot in 2005 near Gornji Grad in the Upper Savinja Valley, Northern Slovenia (UTM VM82, 980 m a.). Although this individual was most likely a vagrant, it indicates that golden jackals may soon, or perhaps already have, established permanent territories in Slovenia. Further studies are necessary to determine the status and distribution of this protected species in Slovenia, as well as public awareness ...

  1. Molecular detection of Anaplasma platys, Ehrlichia canis, Hepatozoon canis and Rickettsia monacensis in dogs from Maio Island of Cape Verde archipelago.

    Science.gov (United States)

    Lauzi, Stefania; Maia, João P; Epis, Sara; Marcos, Ricardo; Pereira, Cristina; Luzzago, Camilla; Santos, Marta; Puente-Payo, Pablo; Giordano, Alessia; Pajoro, Massimo; Sironi, Giuseppe; Faustino, Augusto

    2016-07-01

    Tick-borne diseases are emerging worldwide and have an important zoonotic relevance. Dogs play an important role in the epidemiology of several zoonotic tick-borne pathogens acting as sentinels and/or reservoirs. This study focused on the molecular identification of tick-borne pathogens in blood samples of 153 autochthonous asymptomatic dogs in Maio Island, Cape Verde archipelago. Eighty-four (54.9%) dogs were positive for one or more pathogens. Fifty-five (35.9%) dogs were infected with Hepatozoon canis, 53 (34.6%) with Anaplasma platys, five (3.3%) with Ehrlichia canis and Rickettsia monacensis, an emerging human pathogen, was also identified in a single dog (0.7%). The former three pathogens cause important canine tick-borne diseases that are transmitted or potentially transmitted by Rhipicephalus sanguineus s.l., the only hard tick identified in Cape Verde. Furthermore, Wolbachia spp. was amplified from the blood of one dog. None of the dogs were positive for Anaplasma phagocytophilum, Borrelia burgdorferi sensu lato, Midichloria mitochondrii, Bartonella spp., Babesia spp. or Theileria spp. Fifty-four (35.3%) animals showed single infections and 30 (19.6%) co-infections, with A. platys and H. canis co-infection being the most frequent (28 dogs, 18.3%). The frequency of E. canis infection was statistically different among age groups (P=0.017), being higher among dogs older than 4 years compared to younger dogs. Infection by A. platys was also statistically different among age groups (P=0.031), being higher in dogs younger than 2 years compared to older dogs. The statistical analyses showed no significant association of PCR positivity with gender or location. The frequency of tick-borne pathogens detected in dogs in Maio Island, including R. monacensis, highlights the need to improve diagnosis and control in order to prevent the risk of transmission of these pathogens among dogs and humans living in or travelling to this touristic island.

  2. Epsilon Canis Majoris and the ionization of the local cloud

    Science.gov (United States)

    Vallerga, J. V.; Welsh, B. Y.

    1995-01-01

    The Lyman continuum radiation from the brightest extreme ultraviolet (EUV) source, the B2 II star epsilon Canis Majoris (Adara), is so intense that it dominates the local stellar EUV radiation field at wavelengths longer than 450 A and therefore sets a lower limit to the ionization of hydrogen in the Local Cloud. Using the EUV (70-730 A) spectrum of epsilon CMa taken with the Extreme Ultraviolet Explorer Satellite (EUVE) and simple models that extrapolate this spectrum to the Lyman edge at 912 A, we have determined the local interstellar hydrogen photionizatin parameter Gamma solely from epsilon CMa to be 1.1 x 10(exp -15)/s. This fiugre is a factor of 7 greater than previous estimates of Gamma calculated for all nearby stars combined (Bruhweiler & Cheng 1988). Using measured values of the density and temperature of neutral interstellar hydrogen gas in the Local Cloud, we derive a particle density of ionized hydrogen n(H(+)) and electrons n(sub e) of 0.015-0.019/cu cm assuming ionization equilibrium and a helium ionization fraction of less than 20%. These values correspond to a hydrogen ionizatin fraction, chi(sub H) from 19% to 15%, respectively. The range of these derived quantities is due to the uncertainties in the local values of the neutral hydrogen and helium interstellar densities derived from both (1) solar backscatter measurements of Ly alpha lines of hydrogen and helium (1216 and 584 A), and (2) the average neutral densities along the line of sight to nearby stars. The local proton density produced by epsilon CMa is enough to allow the ionization mechanism of Ripken & Fahr (1983) to work at the heliopause and explain the discrepancy between the neutral hydrogen density derived from solar backscatter measurements and line-of-sight averages to nearby stars. A large value of electron density in the Local Cloud of n(sub e) is approximately 0.3-0.7/cu cm (T = 7000 K) has recently been reported by Lallement et al. (1994) using observations of Mg II and Mg I

  3. Hair Contamination of Sheepdog and Pet Dogs with Toxocara Canis Eggs

    Directory of Open Access Journals (Sweden)

    AR Khezri

    2012-12-01

    Full Text Available Background: We tried to investigate the hair contamination of pet dogs and farm sheepdog with Toxocara eggs in terms of the different sex and age groups in north-west of Iran (Urmia and its sub­urbs.Methods: Hair samples were collected from a total of 138 pet and farm sheepdogs from November 2008 to June 2009 in Urmia City and the suburb (West Azerbaijan-Iran and examined for the pres­ence of T. canis eggs.Results: T. canis eggs found in 60 samples altogether (pet and shepherd dogs showed a contamina­tion rate of 36.2%. The number of observed T. canis eggs in each microscope field was va­ried from 1 to > 400. The age of the dog was found a significant factor to influence the prevalence and intensity of contamination, with 82% of all the eggs recovered from puppies (six months and younger. Additionally, the numbers of eggs in farm sheepdogs were significantly higher than pet dogs (P<0.05.Conclusions: This report shows that direct contact with T. canis infected dogs, particularly puppies from shepherd dogs, may pose a serious hazard to human. Besides, as they may harbor a considera­ble number of eggs on their hair, they can contaminate the soil and the environment.

  4. Isolation and genetic characterization of Toxoplasma gondii from the gray wolf Canis lupus

    Science.gov (United States)

    Little is known of the genetic diversity of Toxoplasma gondii circulating in wildlife. In the present study feral gray wolf (Canis lupus) from Minnesota were examined for T. gondii infection. Antibodies to T. gondii were detected in 130 (52.4%) of 248 wolves tested by the modified agglutination test...

  5. First identification of Trichinella sp. in golden jackal (Canis aureus) in Romania.

    Science.gov (United States)

    Blaga, R; Gherman, C; Seucom, D; Cozma, V; Boireau, P

    2008-04-01

    Larvae of Trichinella sp. were identified in a golden jackal (Canis aureus) from Romania by both trichinelloscopy and artificial digestion. The larvae were identified as Trichinella britovi using a multiplex polymerase chain reaction biotyping method. This is the first report of Trichinella sp. in a jackal in Romania. PMID:18436679

  6. Seroprevalence of Borrelia burgdorferi, Anaplasma phagocytophilum, Ehrlichia canis, and Dirofilaria immitis among dogs in Canada

    OpenAIRE

    Villeneuve, Alain; Goring, Jonas; Marcotte, Lynne; Overvelde, Sébastien

    2011-01-01

    The seropositivity of dogs to Borrelia burgdorferi, Anaplasma phagocytophilum, and Ehrlichia canis antibodies, and Dirofilaria immitis antigen was assessed in Canada. Borrelia burgdorferi had the highest seroprevalence, while that of Dirofilaria immitis has not changed significantly in the past 20 y. The risk for these vector-borne infectious agents in Canadian dogs is low but widespread with foci of higher prevalence.

  7. Successful treatment of mitral valve endocarditis in a dog associated with 'Actinomyces canis-like' infection.

    Science.gov (United States)

    Balakrishnan, N; Alexander, K; Keene, B; Kolluru, S; Fauls, M L; Rawdon, I; Breitschwerdt, E B

    2016-09-01

    Infective endocarditis, an inflammation of the endocardial surface due to invasion by an infectious agent, is more common in middle sized to large breed dogs. We herein report a case of mitral valve endocarditis in a 9-year-old male-castrated Weimaraner caused by an Actinomyces canis-like bacterium, not previously reported in association with infection in dogs. PMID:27364088

  8. The use of ozonized oil in the treatment of dermatophitosis caused by Microsporum canis in rabbits

    Directory of Open Access Journals (Sweden)

    Fernanda Vasquez Daud

    2011-03-01

    Full Text Available The ozone is effective against most microorganisms due to its high oxidant power. Low concentrations and short-term contact are sufficient to inactivate bacteria, mold, yeast, parasites, seaweeds, protozoa and fungi. Microsporum canis is an important agent of dermatophitosis in human and animal. The aim of the current study was to assess the efficacy of ozonized oil over Microsporum canis in rabbits. Eighteen male New Zealand white rabbits, weight ranging from 2 to 3.2 kg were depilated in the cranial dorso-lateral and right caudal, and cranial and left caudal regions. The regions were inoculated with Microsporum canis, excepting the right caudal region, and were denominated TM, O, OM and M, respectively. After seven days, the treatment of lesions in TM began with 0.12g of terbinaphine 1% cream; in OM and O with 0.12g of ozonized oil; all animals were treated once a day for 28 days. Region M was not treated. Material was collected from those regions for cultivation in Sabouraud agar at day 28 of treatment. In the evolution of the treatment with terbinaphine, of 14 contaminated regions with Microsporum canis ten evolved to cure. With the ozonized oil, of 15 contaminations, four were cured. Clinically, that is, the macroscopic evaluation of lesions showed improvement in the TM and OM treated regions. We can conclude that there was statistical evidence of the protection action of the oil against the dermatophyte.

  9. Gray wolf (Canis lupus) is a natural definitive host for Neospora caninum

    Science.gov (United States)

    The gray wolf (Canis lupus) was found to be a new natural definitive host for Neospora caninum. This finding is based on the recovery of Neospora-like oocysts from the feces of 3 of 73 wolves from Minnesota examined at necropsy, and on successful amplification of N. caninum-specific sequences from ...

  10. BEHAVIORAL AND MEMORY CHANGES IN Mus musculus COINFECTED BY Toxocara canis AND Toxoplasma gondii

    Directory of Open Access Journals (Sweden)

    Flávia Motta Corrêa

    2014-07-01

    Full Text Available Several researchers have stated that parasites can alter the behavior of their hosts, in order to increase the transmission rate, principally when prey-predator relationships are a reliable way of infection transmission. The aim of this study was to verify the occurrence of changes in anxiety and short-term memory patterns in experimentally infected Mus musculus by Toxocara canis and/or Toxoplasma gondii. Forty male Mus musculus (Balb/c eight-week-old were divided into four groups of 10 mice each. One group was infected with 300 eggs of Toxocara canis; a second group was submitted to infection with 10 cysts of Toxoplasma gondii; a third group was concomitantly infected with both parasites with the same inoculums and the last group was maintained without infection. The anxiety levels were evaluated using an elevated plus maze and an actometer; the short-term memory was determined by a two-way active avoidance equipment. The determination of anxiety levels were conducted 40 and 70 days after infection and the short-term memory was evaluated 140 days after infection. Mice chronically infected by Toxoplasma gondii showed impaired learning and short-term memory, but no significant differences were found in mice infected by Toxocara canis or concomitantly infected by Toxocara canis and Toxoplasma gondii when compared to non infected mice.

  11. Characterization and differential expression analysis of Toxocara canis aquaporin-1 gene.

    Science.gov (United States)

    Luo, Yong-Fang; Hu, Ling; Ma, Guang-Xu; Luo, Yong-Li; Yin, Sha-Sha; Xiong, Yi; Zhu, Xing-Quan; Zhou, Rong-Qiong

    2016-09-01

    Toxocara canis is an intestinal nematode of canids with a worldwide distribution, causing an important but neglected parasitic zoonosis in humans. Aquaporins (AQP) are a family of water channel proteins, which function as membrane channels to regulate water homeostasis. In this study, the coding sequence of aquaporin-1 gene of T. canis (Tc-aqp-1) was cloned and characterized. The obtained Tc-aqp-1 coding sequence was 933 bp in length, which predicted to encode 311 amino acids. Two conserved asparagine-proline-alanine (NPA) motifs were identified in the multiple sequence alignments. Phylogenetic analysis revealed the closest relationship between T. canis and Opisthorchis viverrini based on aquaporin-1 amino acid sequence. A structure was predicted with ligand binding sites predicted at H93, N95, N226, L94, I79, and I210 and with active sites predicted at I256 and G207. Gene Ontology (GO) annotations predicted its cellular component term of integral component of plasma membrane (GO: 0005887), molecular function term of channel activity (GO: 0015250), and biological process term of water transport (GO: 0006833). Tissue expression analysis revealed that the Tc-aqp-1 was highly expressed in the intestine of adult male. The findings of the present study provide the basis for further functional studies of T. canis aquaporin-1. PMID:27215210

  12. A gray wolf (Canis lupus) delivers live prey to a pup

    Science.gov (United States)

    Mech, L. David

    2014-01-01

    A two-year-old sibling Gray Wolf (Canis lupus) carefully captured an Arctic Hare (Lepus arcticus) leveret alive on Ellesmere Island, Nunavut, Canada, and delivered it alive to a pup 28–33 days old. This appears to be the first observation of a Gray Wolf delivering live prey to a pup.

  13. Serological survey of Brucella canis in dogs in urban Harare and selected rural communities in Zimbabwe

    Directory of Open Access Journals (Sweden)

    Simbarashe Chinyoka

    2014-02-01

    Full Text Available A cross-sectional study was conducted in order to detect antibodies for Brucella canis (B. canis in dogs from urban Harare and five selected rural communities in Zimbabwe. Sera from randomly selected dogs were tested for antibodies to B. canis using an enzyme-linked immunosorbent assay. Overall, 17.6% of sera samples tested (57/324, 95% CI: 13.5–21.7 were positive for B. canis antibodies. For rural dogs, seroprevalence varied from 11.7% – 37.9%. Rural dogs recorded a higher seroprevalence (20.7%, 95% CI: 15.0–26.4 compared with Harare urban dogs (12.7%, 95% CI: 6.9–18.5 but the difference was not significant (p = 0.07. Female dogs from both sectors had a higher seroprevalence compared with males, but the differences were not significant (p > 0.05. Five and two of the positive rural dogs had titres of 1:800 and 1:1600, respectively, whilst none of the positive urban dogs had a titre above 1:400. This study showed that brucellosis was present and could be considered a risk to dogs from the studied areas. Further studies are recommended in order to give insight into the epidemiology of brucellosis in dogs and its possible zoonotic consequences in Zimbabwe. Screening for other Brucella spp. (Brucella abortus, Brucella melitensis and Brucella suis other than B. canis is also recommended.

  14. Short communication: Streptococcus canis is able to establish a persistent udder infection in a dairy herd.

    Science.gov (United States)

    Król, Jarosław; Twardoń, Jan; Mrowiec, Jacek; Podkowik, Magdalena; Dejneka, Grzegorz; Dębski, Bogdan; Nowicki, Tadeusz; Zalewski, Wojciech

    2015-10-01

    Bovine mastitis caused by Streptococcus canis is relatively rare. Consequently, many epidemiologic aspects of the infection, including factors that mediate crossing of host species barriers by the pathogen, infectiousness of the microorganism to the mammary gland, and the course of the disease within a herd, are still not elucidated. Therefore, the aim of the present study was to describe results of a 15-mo observation of subclinical Strep. canis mastitis on a dairy farm housing 76 lactating Holstein-Friesian cows. Upon 3 visits to the farm during a period between April 2013 and June 2014, Strep. canis was cultured from milk samples of 17 (22.4% of the herd), 7 (9.6%), and 8 (11.3%) cows, respectively. The isolates obtained were characterized phenotypically by means of the API Strep identification kit (bioMérieux, Marcy l'Etoile, France), as well as genetically by using random amplified polymorphic DNA and macrorestriction analysis of the chromosomal DNA by pulsed-field gel electrophoresis. All strains displayed the same biochemical features, and the molecular methods revealed that the isolates belonged to a single clone or were very closely related. Results of the study indicate that Strep. canis is capable of causing intramammary infections of long duration, behaving in a contagious manner. Because a persistently infected cow may serve as the source of Strep. canis infection for other animals, effective control of this type of udder infection within a herd may require similar measures to those adopted in Streptococcus agalactiae eradication programs. PMID:26233445

  15. Prevalencia y factores que favorecen la presentación de toxocara canis y ancylostoma caninum en canes de compañía (Prevalence and factors that favor of presentation of toxocara canis and ancylostoma caninum in companion dogs).

    OpenAIRE

    Castillo Cuenca. Julio César; Morales Morales. Alcides; Molina Leyva. Eulises Alexander; Cepero Rodríguez. Omelio; Gutierrez Aguiar. Digna Ibis; Fernández Pérez. Julieta Zonia

    2012-01-01

    RESUMENEl presente trabajo tiene como objetivo determinar la prevalencia de Toxocara canis y Ancylostoma caninum y algunos factores que pudieran favorecer una mayor tasa de infestación por estos nematodos zoonóticosen canes de compañía en los consejos populares Universidad y Camilo Cienfuegos.SUMMARYThe present research aims at determining Toxocara canis and Ancylostoma caninum prevalence and some factors that may favor higher values of infestation in companion dogs from these zoonotic nemath...

  16. Retrospective study of clinical and hematological aspects associated with dogs naturally infected by Hepatozoon canis in Ludhiana, Punjab, India

    Directory of Open Access Journals (Sweden)

    Sushma Chhabra

    2013-06-01

    Conclusions: The findings of this study substantiate that H. canis caused clinical and haematological alterations of the varied intensity in dogs, even with low parasitaemia, should be taken into consideration.

  17. Identification of new 18S rRNA strains of Babesia canis isolated from dogs with subclinical babesiosis.

    Science.gov (United States)

    Łyp, P; Adaszek, Ł; Furmaga, B; Winiarczyk, S

    2015-01-01

    In this study, we used PCR to detect and characterize B. canis from naturally infected dogs in Poland with subclinical babesiosis by amplifying and sequencing a portion of the 18S ribosomal RNA (rRNA) gene. Venous blood samples were collected from ten dogs with subclinical babesiosis. A 559-bp fragment of the B. canis 18S rRNA gene was amplified by PCR. Sequencing of the PCR products led to the identification of a new variant of Babesia canis, differing from the previously detected protozoa genotypes (18S rRNA-A and 18S rRNA-B) with nucleotide substitutions in positions 150 and 151 of the tested gene fragment. The results indicate the emergence within the Polish territory of a new, previously unencountered Babesia canis genotype responsible for the development of subclinical babesiosis.

  18. [THE DEVELOPMENT AND SURVIVAL OF TOXOCARA CANIS EGGS IN THE NATURAL CLIMATIC CONDITIONS OF GORNO-ALTAISK].

    Science.gov (United States)

    Pautova, E A; Shchuchinova, L D; Dovgalev, A S

    2015-01-01

    The time of development and survival of Toxocara canis eggs in the soil of Gorno-Altaisk was experimen- tally investigated in 2011-2014. In July 2011, T.canis eggs matured at 3-5-cm soil depths from the stage of 1-2 blastomeres to invading larva within 12 days at a daily average temperature of +23°C and at a relative humidity of 82%. At 3-5-cm soil depths, more than 70% of invaded T. canis eggs preserved their viability through- out the experimental period (4 years). The paper gives evidence for the seasonal survival of invaded T. canis eggs in relation of the length of soil stay. PMID:26152039

  19. Early detection of Brucella canis via quantitative polymerase chain reaction analysis.

    Science.gov (United States)

    Kauffman, L K; Bjork, J K; Gallup, J M; Boggiatto, P M; Bellaire, B H; Petersen, C A

    2014-02-01

    Canine brucellosis is a reportable zoonotic disease that can lead to canine reproductive losses and human infection through contact with infected urine or other genitourinary secretions. Although many locations require testing and euthanasia of positive dogs, current diagnosis is limited by the time required for seroconversion, for example, presence of B. canis-specific antibodies. The goal of this study was to determine the diagnostic ability of Brucella canis-specific quantitative polymerase chain reaction (qPCR) assay to detect B. canis in field samples prior to serological positivity for faster diagnosis and prevention of transmission within kennels or in households. Two kennels, one of which was located in the owner's home, were sampled following observation of suggestive clinical signs and positive serology of at least one dog. Specimens obtained were comparatively analysed via serology and qPCR analysis. 107 dogs were analysed for B. canis infection via qPCR: 105 via whole-blood samples, 65 via vaginal swab, six via urine and seven via genitourinary tract tissue taken at necropsy. Forty-five dogs were found to be infected with canine brucellosis via qPCR, of which 22 (48.89%) were seropositive. A statistically significant number (P = 0.0228) of qPCR-positive dogs, 5/25 (20.00%), seroconverted within a 30-day interval after initial serologic testing. As compared to serology, qPCR analysis of DNA from vaginal swabs had a sensitivity of 92.31% and specificity of 51.92%, and qPCR analysis of DNA from whole-blood samples had a sensitivity of 16.67% and specificity of 100%. B. canis outer membrane protein 25 DNA qPCR from non-invasive vaginal swab and urine samples provided early detection of B. canis infection in dogs prior to detection of antibodies. This assay provides a critical tool to decrease zoonotic spread of canine brucellosis, its associated clinical presentation(s), and emotional and economic repercussions.

  20. The transmission of canine ehrlichiosis to the Wild Dog Lycaon pictus (Temminck) and Black-backed Jackal Canis mesomelas Schreber.

    Science.gov (United States)

    van Heerden, J

    1979-12-01

    Canine ehrlichiosis was successfully transmitted from the domestic dog to three Wild Dogs Lycaon pictus and three Black-backed Jackals Canis mesomelas. Wild Dogs showed symptoms of anorexia and depression as well as anaemia, leucopaenia and mild thrombocytopaenia. Black-backed Jackals were asymptomatic. Morulae of Ehrlichicia canis were found in peripheral blood smears from all experimental animals. The disease was also successfully transmitted from Black-backed Jackal to the domestic dog. PMID:553960

  1. The transmission of canine ehrlichiosis to the Wild Dog Lycaon pictus (Temminck) and Black-backed Jackal Canis mesomelas Schreber.

    Science.gov (United States)

    van Heerden, J

    1979-12-01

    Canine ehrlichiosis was successfully transmitted from the domestic dog to three Wild Dogs Lycaon pictus and three Black-backed Jackals Canis mesomelas. Wild Dogs showed symptoms of anorexia and depression as well as anaemia, leucopaenia and mild thrombocytopaenia. Black-backed Jackals were asymptomatic. Morulae of Ehrlichicia canis were found in peripheral blood smears from all experimental animals. The disease was also successfully transmitted from Black-backed Jackal to the domestic dog.

  2. Molecular detection of Anaplasma platys, Ehrlichia canis, Hepatozoon canis and Rickettsia monacensis in dogs from Maio Island of Cape Verde archipelago.

    Science.gov (United States)

    Lauzi, Stefania; Maia, João P; Epis, Sara; Marcos, Ricardo; Pereira, Cristina; Luzzago, Camilla; Santos, Marta; Puente-Payo, Pablo; Giordano, Alessia; Pajoro, Massimo; Sironi, Giuseppe; Faustino, Augusto

    2016-07-01

    Tick-borne diseases are emerging worldwide and have an important zoonotic relevance. Dogs play an important role in the epidemiology of several zoonotic tick-borne pathogens acting as sentinels and/or reservoirs. This study focused on the molecular identification of tick-borne pathogens in blood samples of 153 autochthonous asymptomatic dogs in Maio Island, Cape Verde archipelago. Eighty-four (54.9%) dogs were positive for one or more pathogens. Fifty-five (35.9%) dogs were infected with Hepatozoon canis, 53 (34.6%) with Anaplasma platys, five (3.3%) with Ehrlichia canis and Rickettsia monacensis, an emerging human pathogen, was also identified in a single dog (0.7%). The former three pathogens cause important canine tick-borne diseases that are transmitted or potentially transmitted by Rhipicephalus sanguineus s.l., the only hard tick identified in Cape Verde. Furthermore, Wolbachia spp. was amplified from the blood of one dog. None of the dogs were positive for Anaplasma phagocytophilum, Borrelia burgdorferi sensu lato, Midichloria mitochondrii, Bartonella spp., Babesia spp. or Theileria spp. Fifty-four (35.3%) animals showed single infections and 30 (19.6%) co-infections, with A. platys and H. canis co-infection being the most frequent (28 dogs, 18.3%). The frequency of E. canis infection was statistically different among age groups (P=0.017), being higher among dogs older than 4 years compared to younger dogs. Infection by A. platys was also statistically different among age groups (P=0.031), being higher in dogs younger than 2 years compared to older dogs. The statistical analyses showed no significant association of PCR positivity with gender or location. The frequency of tick-borne pathogens detected in dogs in Maio Island, including R. monacensis, highlights the need to improve diagnosis and control in order to prevent the risk of transmission of these pathogens among dogs and humans living in or travelling to this touristic island. PMID:27177475

  3. Seroprevalence and Risk Factors of Ehrlichia canis Infection among Companion Dogs of Mashhad, North East of Iran, 2009–2010

    Directory of Open Access Journals (Sweden)

    Maneli Ansari-Mood

    2015-10-01

    Full Text Available Background: The aims of this study were to determine the seroprevalence of canine ehrlichiosis and risk factors of this disease in companion dogs’ population of Mashhad, North East of Iran. Canine Monocytic Ehrlichiosis (CME is a zoonotic disease transmitted by ticks, Rhipicephalus sanguineus, and caused by an obligate intracellular bacterium, Ehrlichia canis.Methods: During September 2009 until November 2010, 250 companion dogs from Mashhad, North-East of Iran, were examined for serum antibody detection against E. canis by means of immunofluorescence assay test (IFAT and factors associated with a positive antibody response.Results: There was a very low prevalence of anti-E. canis antibodies (0.8%, 2/250 among studied dogs. The antibody titers for two seropositive dogs were 1:80 and 1:160, respectively. One (0.4% of seropositive dogs was infested with, R. sanguineus. In blood smears from one of infested dogs (0.4%, typical morulae of E. canis was observed in lymphocytes. The results confirm that the lowest occurrence of reactive dogs indoors probably related to low tick infestion.Conclusion: This is the first report that describes serological evidences of canine monocytic ehrlichiosis in North- East of Iran. Results suggested that E. canis infection in owned pet dogs from North of Khorasan was not endemic from 2009 to 2010. Additional molecular studies are necessary to confirm E. canis infection and to identify the local strains of the organism.

  4. Serological survey for antibodies reactive with Ehrlichia canis and E. chaffeensis in dogs from the Bloemfontein area, South Africa

    Directory of Open Access Journals (Sweden)

    A-M Pretorius

    1998-07-01

    Full Text Available Sera from 161 dogs in the Bloemfontein area in South Africa were tested for the presence of antibodies reactive with Ehrlichia canis and E. chaffeensis by indirect fluorescent antibody testing. Overall, 68 (42 % of the dogs had significant antibody titres (>1/64 against E. canis and 61 (38 % had significant titres (>1/64 against E. chaffeensis. Seven (11 % dogs had higher titres to E. chaffeensis than E. canis (1/2048 and 1/1024 (2 dogs; 1/1024 and 1/512 (2 dogs; 1/2048 and 1/512; 1/512 and 1/256 and 1/512 and <1/64, respectively. The remaining seropositive dogs had equal (n=26; 42 % or 2- (n=17; 25 %, 3- (n=13; 2% or 4-fold (n= 5; 7 % higher titres against E. canis. Dogs from economically depressed, high-density suburbs (60/112; 48 % had significantly higher prevalences of antibodies against E. canis than those from more affluent, low-density suburbs (8/49; 14 % (c2 19.38, p < 0.001. Higher titres to E. chaffeensis than E. canis were found in dogs from affluent, low-density suburbs (3/49 and in dogs from economically depressed, high-density suburbs (4/112.

  5. A preliminary study to evaluate the immune responses induced by immunization of dogs with inactivated Ehrlichia canis organisms

    Directory of Open Access Journals (Sweden)

    Sunita Mahan

    2005-09-01

    Full Text Available Ehrlichia canis is an intracellular pathogen that causes canine monocytic ehrlichiosis. Although the role of antibody responses cannot be discounted, control of this intracellular pathogen is expected to be by cell mediated immune responses. The immune responses in dogs immunized with inactivated E. canis organisms in combination with Quil A were evaluated. Immunization provoked strong humoral and cellular immune responses, which were demonstrable by Western blotting and lymphocyte proliferation assays. By Western blotting antibodies to several immunodominant E. canis proteins were detected in serum from immunized dogs and antibody titres increased after each immunization. The complement of immunogenic proteins recognized by the antisera were similar to those recognized in serum from infected dogs. Upon challenge with live E. canis, rapid anamnestic humoral responses were detected in the serum of immunized dogs and primary antibody responses were detected in the serum from control dogs. Following immunization, a lymphocyte proliferative response (cellular immunity was detected in peripheral blood mononuclear cells (PBMNs of immunized dogs upon stimulation with E. canis antigens. These responses were absent from non-immunized control dogs until after infection with live E. canis, when antigen specific-lymphocyte proliferation responses were also detected in the PBMNs of the control dogs. It can be thus concluded that immunization against canine monocytic ehrlichiosis may be feasible. However, the immunization regimen needs to be optimized and a detailed investigation needs to be done to determine if this regimen can prevent development of acute and chronic disease.

  6. Relationship between clinical manifestations and pulsed-field gel profiles of Streptococcus canis isolates from dogs and cats.

    Science.gov (United States)

    Kruger, E Freya; Byrne, Barbara A; Pesavento, Patricia; Hurley, Kate F; Lindsay, Leanne L; Sykes, Jane E

    2010-11-20

    Little is known regarding the degree of genotypic relatedness between Streptococcus canis isolates from dogs and cats. The purpose of this study was to determine whether correlations existed between the genotypes of canine and feline S. canis isolates as determined using pulsed-field gel electrophoresis (PFGE) and different clinical manifestations of disease. Eighty-two isolates of S. canis were examined that had been collected from dogs and cats presenting to the University of California, Davis Veterinary Medical Teaching Hospital (VMTH) between 1998 and 2005. Associated clinical manifestations included sepsis, otitis, pyometra, skin infections, necrotizing fasciitis, respiratory disease, and urinary tract infections. In addition, 9 feline isolates from a southern California shelter that experienced an outbreak of S. canis infection manifesting as necrotizing fasciitis and death were examined. Bacterial isolates were characterized by PFGE analysis using the restriction enzyme SmaI. The relationships between banding patterns were analyzed using gel analysis software combined with visual interpretation. The feline shelter isolates of S. canis were 99% similar in bacterial PFGE profile. The remainder of samples had less than 80% similarity in PFGE banding patterns. The relatedness of the PFGE profile in the feline shelter isolates suggested a clonal origin. In the isolates from the VMTH population, there was no relationship between specific disease manifestations and PFGE profile. PFGE typing does not appear to be useful for identifying isolates associated with specific disease presentations; however may be more useful to identify outbreaks of S. canis infections or to detect clonal populations in outbreaks. PMID:20605376

  7. Dietary guidelines in singapore.

    Science.gov (United States)

    Lee, Benjamin Lc

    2011-01-01

    The 2011 Dietary Guidelines were developed with the aim of providing guidance on what dietary strategies can best address increasing rates of obesity and non-communicable chronic disease in Singapore. This set of dietary guidelines was developed with a local expert committee based on a review of scientific literature and data on current dietary patterns from the 2010 National Nutrition Survey. Projected nutrient intakes from a diet adhering to the 2011 Dietary Guidelines were calculated using a local food composition database (FOCOS) and validated against nutrient recommendations. Acknowledging that dietary requirements differ between age groups, different sets of dietary guidelines have been developed and customised for different segments of the population. To date, Singapore has produced dietary guidelines for children and adolescents (focusing on establishing healthy lifelong eating patterns), adults (focusing on preventing obesity and reinforcing healthy eating patterns), and most recently, guidelines for older adults (>50 years of age) that address the issue of potential dietary insufficiency caused by age-related increases in nutrient requirements combined with a reduction in energy requirements. In Singapore, dietary guidelines have been used to inform and direct public policy and promote dietary patterns that meet nutrient requirements while reducing the risk of non-communicable chronic diseases. Examples of public policy include: national guidelines on food advertising and standards for food served in nursing homes; examples of public health promotion programmes include: the Healthier Choice Symbol Programme for packaged food products and programmes encouraging provision of healthier meals in hawker centres, restaurants, and school or workplace canteens. PMID:21859669

  8. Presence of Leishmania and Brucella species in the golden jackal Canis aureus in Serbia.

    Science.gov (United States)

    Cirović, Duško; Chochlakis, Dimosthenis; Tomanović, Snežana; Sukara, Ratko; Penezić, Aleksandra; Tselentis, Yannis; Psaroulaki, Anna

    2014-01-01

    The golden jackal Canis aureus occurs in south-eastern Europe, Asia, the Middle East, the Caucasus, and Africa. In Serbia, jackals neared extinction; however, during the last 30 years, the species started to spread quickly and to increase in number. Few studies in the past have revealed their potential role as carriers of zoonotic diseases. Animal samples were collected over a three-year period (01/2010-02/2013) from 12 sites all over Serbia. Of the tissue samples collected, spleen was chosen as the tissue to proceed; all samples were tested for Leishmania species and Brucella species by real-time PCR. Of the 216 samples collected, 15 (6.9%) were positive for Leishmania species, while four (1.9%) were positive for B. canis. The potential epidemiologic role of the golden jackal in carrying and dispersing zoonotic diseases in Serbia should be taken under consideration when applying surveillance monitoring schemes. PMID:24967397

  9. Diagnostic PCR tests for Microsporum audouinii, M. canis and Trichophyton infections

    DEFF Research Database (Denmark)

    Brillowska-Dabrowska, Anna; Swierkowska, Aleksandra; Lindhardt Saunte, Ditte Marie;

    2010-01-01

    ; 25 routine specimens from patients suspected of having dermatophytosis; 10 hair specimens from guinea pigs experimentally infected with M. canis; and two samples from un-infected control animals. DNA was prepared by a 10-min procedure from pure cultures as previously described. The 302 bp PCR product...... results. Finally, the Microsporum PCR was positive for 10/10 guinea pig specimens from infected animals but for 0/2 of the control animal samples. The evaluation of the two PCR tests indicated excellent sensitivity and specificity.......Since traditional diagnosis of dermatophyte infections is slow, we present a rapid new PCR test for detection of Trichophyton spp., Microsporum canis and M. audouinii infections. The performance of the test was evaluated with: 58 dermatophyte isolates; 10 yeast, mould and human DNA control samples...

  10. RR Lyrae search and stellar populations study in Canis Major: Preliminary Results

    CERN Document Server

    Mateu, C E; Zinn, R; Miller, L; Mateu, Cecilia E.; Zinn, Robert; Miller, Lissa

    2005-01-01

    We present preliminary results of a RR Lyrae star search and stellar populations study performed in the Canis Major overdensity, spanning an area of 8.35sq deg. The observations were made in R and V bands, with the QUEST camera installed in the 1m Jurgen Stock Telescope, at the Venezuela National Observatory. The resulting Hess diagram shows a possible, but weak, red giant branch and no obvious horizontal branch, red clump or main sequence turnoff. After a multi--epoch photometric search, 6 RR Lyrae stars were confirmed with further observations obtained at the 1.0 and 1.3m telescopes of the SMARTS consortium at CTIO. Of these confirmed RR Lyrae stars, 5 have heliocentric distances between 5 and 7 kpc. Confirmation of their physsical association with the Canis Major system awaits for a study of their radial velocities.

  11. Skin impression with acetate tape in Demodex canis and Scarcoptes scabiei var. vulpes diagnosis

    Directory of Open Access Journals (Sweden)

    D.T. Pereira

    2015-02-01

    Full Text Available This study compares the efficacy of skin impression with acetate tape and the deep skin scraping test to find D. canis and S. scabiei in dogs. During six months, 134 samples were collected by both techniques from 115 dogs treated at the dermatology service of the Veterinary Hospital of the Federal University of Santa Maria (HVU-UFSM. Of these patients, 27 had demodicosis and 12 had scabies. The impression with acetate tape test (ITT was shown to be significantly superior to the deep skin scraping test (DSST in finding D. canis and S. scabiei mites (p = 0.007. Based on our results we could conclude that acetate tape impression is a reliable method for diagnosing and monitoring therapy of dermatopathies caused by mites and can be used to replace the traditional deep skin scraping method. In addition, since it is less traumatic for the dog, this method shows more acceptance by the owner.

  12. CANIS LUPUS (MAMMALIA, CANIDAE FROM THE LATE PLEISTOCENE DEPOSIT OF AVETRANA (TARANTO, SOUTHERN ITALY

    Directory of Open Access Journals (Sweden)

    DAVIDE F.BERTÈ

    2014-11-01

    Full Text Available Here we described the remains of Canis lupus from the bed 8 of Avetrana karst filling (Late Pleistocene; Taranto, Southern Italy. The studied specimens are larger than those collected from the early Late Pleistocene Apulian localities and those referred to the recent Italian wolf. Moreover, the remains from Avetrana are morphometrically close to Canis lupus maximus from France and to C. lupus collected from Central and Northern Italian localities, chronologically related to MIS 2 and MIS 3. Morphologically, the studied specimens slightly differ from both C. l. maximus and other Pleistocene Apulian wolves. The dimensional differences between the Avetrana wolves and those collected from the other early Late Pleistocene Apulian localities could be explained through a spread of a large-sized morphotype from the Northern Italy.

  13. Presence of Leishmania and Brucella Species in the Golden Jackal Canis aureus in Serbia

    Directory of Open Access Journals (Sweden)

    Duško Ćirović

    2014-01-01

    Full Text Available The golden jackal Canis aureus occurs in south-eastern Europe, Asia, the Middle East, the Caucasus, and Africa. In Serbia, jackals neared extinction; however, during the last 30 years, the species started to spread quickly and to increase in number. Few studies in the past have revealed their potential role as carriers of zoonotic diseases. Animal samples were collected over a three-year period (01/2010–02/2013 from 12 sites all over Serbia. Of the tissue samples collected, spleen was chosen as the tissue to proceed; all samples were tested for Leishmania species and Brucella species by real-time PCR. Of the 216 samples collected, 15 (6.9% were positive for Leishmania species, while four (1.9% were positive for B. canis. The potential epidemiologic role of the golden jackal in carrying and dispersing zoonotic diseases in Serbia should be taken under consideration when applying surveillance monitoring schemes.

  14. NCBI nr-aa BLAST: CBRC-MDOM-03-0298 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-03-0298 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-154 76% ...

  15. NCBI nr-aa BLAST: CBRC-OLAT-01-0032 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-01-0032 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 7e-61 41% ...

  16. NCBI nr-aa BLAST: CBRC-PHAM-01-0668 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0668 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 2e-51 44% ...

  17. NCBI nr-aa BLAST: CBRC-DRER-11-0014 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-11-0014 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 1e-93 52% ...

  18. NCBI nr-aa BLAST: CBRC-MMUS-03-0082 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-03-0082 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 87% ...

  19. NCBI nr-aa BLAST: CBRC-OPRI-01-0017 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0017 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 4e-37 39% ...

  20. NCBI nr-aa BLAST: CBRC-RNOR-23-0122 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-23-0122 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 86% ...

  1. NCBI nr-aa BLAST: CBRC-VPAC-01-1422 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1422 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 5e-72 48% ...

  2. NCBI nr-aa BLAST: CBRC-PHAM-01-0668 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0668 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 2e-78 59% ...

  3. NCBI nr-aa BLAST: CBRC-ACAR-01-1017 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1017 ref|NP_001093415.1| growth hormone secretagogue receptor [Canis lupus... familiaris] gb|ABQ01981.1| ghrelin receptor [Canis lupus familiaris] NP_001093415.1 1e-80 48% ...

  4. NCBI nr-aa BLAST: CBRC-PVAM-01-0863 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0863 ref|NP_001138978.1| bitter taste receptor Cafa-T2R5 [Canis lupus ...familiaris] dbj|BAE80331.1| bitter taste receptor [Canis lupus familiaris] NP_001138978.1 1e-124 73% ...

  5. NCBI nr-aa BLAST: CBRC-XTRO-01-3354 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3354 ref|NP_001093415.1| growth hormone secretagogue receptor [Canis lupus... familiaris] gb|ABQ01981.1| ghrelin receptor [Canis lupus familiaris] NP_001093415.1 9e-94 49% ...

  6. NCBI nr-aa BLAST: CBRC-LAFR-01-3130 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-3130 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 91% ...

  7. NCBI nr-aa BLAST: CBRC-DNOV-01-3056 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-3056 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 6e-38 86% ...

  8. NCBI nr-aa BLAST: CBRC-PVAM-01-0808 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0808 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 1e-102 62% ...

  9. NCBI nr-aa BLAST: CBRC-PVAM-01-1222 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-1222 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 92% ...

  10. NCBI nr-aa BLAST: CBRC-MEUG-01-1975 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1975 ref|NP_001003054.1| prostaglandin E2 receptor EP4 subtype [Canis lupus... familiaris] gb|AAF00470.1|AF177934_1 prostaglandin E2 receptor EP4 subtype [Canis lupus familiaris] NP_001003054.1 0.0 78% ...

  11. NCBI nr-aa BLAST: CBRC-OGAR-01-0872 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OGAR-01-0872 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-171 89% ...

  12. NCBI nr-aa BLAST: CBRC-MMUR-01-1296 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-1296 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-158 84% ...

  13. NCBI nr-aa BLAST: CBRC-VPAC-01-1568 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1568 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-163 88% ...

  14. NCBI nr-aa BLAST: CBRC-GGOR-01-0987 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0987 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-104 88% ...

  15. NCBI nr-aa BLAST: CBRC-STRI-01-2573 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2573 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-116 76% ...

  16. NCBI nr-aa BLAST: CBRC-HSAP-06-0078 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-06-0078 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-173 90% ...

  17. NCBI nr-aa BLAST: CBRC-PTRO-07-0072 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-07-0072 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-173 90% ...

  18. NCBI nr-aa BLAST: CBRC-DRER-16-0068 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-16-0068 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-119 65% ...

  19. NCBI nr-aa BLAST: CBRC-CFAM-12-0019 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-12-0019 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 0.0 99% ...

  20. NCBI nr-aa BLAST: CBRC-TTRU-01-1057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1057 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-158 84% ...

  1. NCBI nr-aa BLAST: CBRC-LAFR-01-3535 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-3535 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-109 74% ...

  2. NCBI nr-aa BLAST: CBRC-TSYR-01-1188 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1188 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-145 89% ...

  3. NCBI nr-aa BLAST: CBRC-MLUC-01-1005 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-1005 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-134 87% ...

  4. NCBI nr-aa BLAST: CBRC-CJAC-01-0081 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0081 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-172 90% ...

  5. NCBI nr-aa BLAST: CBRC-RMAC-04-0054 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RMAC-04-0054 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-174 91% ...

  6. NCBI nr-aa BLAST: CBRC-PABE-07-0060 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PABE-07-0060 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-174 91% ...

  7. NCBI nr-aa BLAST: CBRC-PCAP-01-1445 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-1445 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-164 87% ...

  8. NCBI nr-aa BLAST: CBRC-SARA-01-1922 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1922 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-126 73% ...

  9. NCBI nr-aa BLAST: CBRC-TBEL-01-2041 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TBEL-01-2041 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-123 91% ...

  10. NCBI nr-aa BLAST: CBRC-BTAU-01-2271 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-2271 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-144 78% ...

  11. NCBI nr-aa BLAST: CBRC-PHAM-01-1272 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1272 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-119 88% ...

  12. NCBI nr-aa BLAST: CBRC-MLUC-01-1082 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-1082 ref|XP_848356.1| PREDICTED: similar to adiponectin receptor 1 iso...form 2 [Canis familiaris] ref|XP_537118.2| PREDICTED: similar to adiponectin receptor 1 isoform 1 [Canis familiaris] XP_848356.1 0.0 88% ...

  13. NCBI nr-aa BLAST: CBRC-STRI-01-2923 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2923 ref|XP_848356.1| PREDICTED: similar to adiponectin receptor 1 iso...form 2 [Canis familiaris] ref|XP_537118.2| PREDICTED: similar to adiponectin receptor 1 isoform 1 [Canis familiaris] XP_848356.1 1e-157 86% ...

  14. NCBI nr-aa BLAST: CBRC-OGAR-01-1050 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OGAR-01-1050 ref|XP_848356.1| PREDICTED: similar to adiponectin receptor 1 iso...form 2 [Canis familiaris] ref|XP_537118.2| PREDICTED: similar to adiponectin receptor 1 isoform 1 [Canis familiaris] XP_848356.1 0.0 93% ...

  15. NCBI nr-aa BLAST: CBRC-OPRI-01-0681 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0681 ref|XP_848356.1| PREDICTED: similar to adiponectin receptor 1 iso...form 2 [Canis familiaris] ref|XP_537118.2| PREDICTED: similar to adiponectin receptor 1 isoform 1 [Canis familiaris] XP_848356.1 1e-134 91% ...

  16. NCBI nr-aa BLAST: CBRC-SARA-01-1167 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1167 ref|XP_848356.1| PREDICTED: similar to adiponectin receptor 1 iso...form 2 [Canis familiaris] ref|XP_537118.2| PREDICTED: similar to adiponectin receptor 1 isoform 1 [Canis familiaris] XP_848356.1 1e-138 67% ...

  17. Dicty_cDB: Contig-U06288-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available d:none) Canis familiaris prostatic steroid... 60 5e-08 (Q8AVI9) RecName: Full=3-oxo-5-alpha-steroid 4-dehydr...7_1( EF537017 |pid:none) Oryzias latipes steroid 5-alpha-re... 58 1e-07 AF136720_1( AF136720 |pid:none) Canis familiaris prostatic

  18. NCBI nr-aa BLAST: CBRC-DNOV-01-3127 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-3127 ref|XP_548857.2| PREDICTED: similar to midline 1 isoform alpha is...oform 2 [Canis familiaris] ref|XP_856213.1| PREDICTED: similar to midline 1 isoform alpha isoform 3 [Canis familiaris] XP_548857.2 0.52 31% ...

  19. NCBI nr-aa BLAST: CBRC-DNOV-01-3127 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-3127 ref|XP_856332.1| PREDICTED: similar to midline 1 isoform alpha is...oform 6 [Canis familiaris] ref|XP_856376.1| PREDICTED: similar to midline 1 isoform alpha isoform 7 [Canis familiaris] XP_856332.1 0.52 31% ...

  20. Dicty_cDB: Contig-U04369-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( BV347056 ) S230P6400RH7.T0 Rottweiler Canis familiaris STS g... 34 4.1 2 ( FB5... hubrichti mitochondrion, complete ge... 44 6.3 1 ( BV348868 ) S230P6384RC8.T0 Rottweiler Canis familiaris S

  1. Dicty_cDB: Contig-U04716-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Canis familiari... 38 0.035 2 ( BV333322 ) S230P6512FE5.T0 Rottweiler Canis familiaris STS g... 38 0.035 2 (...um chromosome 12 clone PFYACB8... 40 0.035 5 ( BV346896 ) S230P6454FD1.T0 Rottweiler

  2. NCBI nr-aa BLAST: CBRC-BTAU-01-0683 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ycystic kidney disease 1 [Canis familiaris] NP_001006651.1 0.0 81% ... ...CBRC-BTAU-01-0683 ref|NP_001006651.1| polycystin 1 [Canis lupus familiaris] gb|AAM45378.1| polycystin 1; pol

  3. NCBI nr-aa BLAST: CBRC-PCAP-01-0105 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0105 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 7e-97 62% ...

  4. NCBI nr-aa BLAST: CBRC-TSYR-01-1175 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1175 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 1e-133 73% ...

  5. NCBI nr-aa BLAST: CBRC-MDOM-08-0132 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0132 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 2e-71 48% ...

  6. NCBI nr-aa BLAST: CBRC-MMUR-01-1514 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-1514 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 1e-141 78% ...

  7. NCBI nr-aa BLAST: CBRC-BTAU-01-0308 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-0308 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-165 87% ...

  8. NCBI nr-aa BLAST: CBRC-CFAM-06-0037 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-06-0037 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 100% ...

  9. NCBI nr-aa BLAST: CBRC-STRI-01-1844 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-1844 ref|NP_001013440.1| similar to CfOLF4 [Canis lupus familiaris] sp...|Q95157|OLF4_CANFA RecName: Full=Olfactory receptor-like protein OLF4 gb|AAB37242.1| CfOLF4 [Canis lupus familiaris] NP_001013440.1 1e-132 76% ...

  10. NCBI nr-aa BLAST: CBRC-CPOR-01-1678 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CPOR-01-1678 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 3e-62 89% ...

  11. NCBI nr-aa BLAST: CBRC-PHAM-01-1147 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1147 ref|NP_001138973.1| bitter taste receptor Cafa-T2R12 [Canis lupus... familiaris] dbj|BAE80334.1| bitter taste receptor [Canis lupus familiaris] NP_001138973.1 1e-37 35% ...

  12. NCBI nr-aa BLAST: CBRC-PCAP-01-0028 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0028 ref|NP_001077101.1| cOR51P3 olfactory receptor family 51 subfamily P-like [Canis lupus... familiaris] gb|ABO36682.1| 52P3 olfactory receptor protein [Canis lupus familiaris] NP_001077101.1 1e-149 89% ...

  13. NCBI nr-aa BLAST: CBRC-PCAP-01-0086 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0086 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-29 72% ...

  14. NCBI nr-aa BLAST: CBRC-LAFR-01-3197 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-3197 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-149 81% ...

  15. NCBI nr-aa BLAST: CBRC-MDOM-08-0128 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0128 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 8e-62 45% ...

  16. NCBI nr-aa BLAST: CBRC-VPAC-01-0140 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-0140 ref|NP_001138979.1| bitter taste receptor Cafa-T2R43 [Canis lupus... familiaris] dbj|BAE80339.1| bitter taste receptor [Canis lupus familiaris] NP_001138979.1 4e-68 57% ...

  17. NCBI nr-aa BLAST: CBRC-MEUG-01-0329 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0329 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus familiar...is] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 1e-160 73% ...

  18. NCBI nr-aa BLAST: CBRC-ACAR-01-1165 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1165 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 6e-76 41% ...

  19. NCBI nr-aa BLAST: CBRC-GGOR-01-0259 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0259 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 2e-53 47% ...

  20. NCBI nr-aa BLAST: CBRC-MEUG-01-1162 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1162 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 1e-70 47% ...

  1. NCBI nr-aa BLAST: CBRC-MEUG-01-1732 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1732 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 1e-178 83% ...

  2. NCBI nr-aa BLAST: CBRC-PCAP-01-0075 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0075 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-64 83% ...

  3. NCBI nr-aa BLAST: CBRC-PVAM-01-1085 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-1085 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 1e-130 71% ...

  4. NCBI nr-aa BLAST: CBRC-MEUG-01-0428 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0428 ref|NP_001074192.1| taste receptor, type 2, member 41 [Canis lupus... familiaris] dbj|BAE80338.1| bitter taste receptor [Canis lupus familiaris] NP_001074192.1 4e-99 59% ...

  5. NCBI nr-aa BLAST: CBRC-MDOM-02-0507 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-02-0507 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 4e-71 45% ...

  6. NCBI nr-aa BLAST: CBRC-STRI-01-1304 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-1304 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus familiar...is] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 3e-77 78% ...

  7. NCBI nr-aa BLAST: CBRC-GGOR-01-0009 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0009 ref|NP_001138976.1| bitter taste receptor Cafa-T2R2 [Canis lupus ...familiaris] dbj|BAE80328.1| bitter taste receptor [Canis lupus familiaris] NP_001138976.1 1e-108 77% ...

  8. NCBI nr-aa BLAST: CBRC-TTRU-01-0756 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0756 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-171 86% ...

  9. NCBI nr-aa BLAST: CBRC-MEUG-01-1061 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1061 ref|NP_001138977.1| bitter taste receptor Cafa-T2R1 [Canis lupus ...familiaris] dbj|BAE80327.1| bitter taste receptor [Canis lupus familiaris] NP_001138977.1 2e-61 44% ...

  10. NCBI nr-aa BLAST: CBRC-TTRU-01-0899 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0899 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 86% ...

  11. NCBI nr-aa BLAST: CBRC-GACU-08-0023 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GACU-08-0023 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 7e-91 47% ...

  12. NCBI nr-aa BLAST: CBRC-OPRI-01-1304 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1304 ref|NP_001013868.1| cholecystokinin B receptor [Canis lupus famil...iaris] gb|AAB87706.1| gastrin/CCK-B receptor [Canis lupus familiaris] NP_001013868.1 0.0 91% ...

  13. NCBI nr-aa BLAST: CBRC-TSYR-01-0145 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-0145 ref|NP_001013440.1| similar to CfOLF4 [Canis lupus familiaris] sp...|Q95157|OLF4_CANFA RecName: Full=Olfactory receptor-like protein OLF4 gb|AAB37242.1| CfOLF4 [Canis lupus familiaris] NP_001013440.1 4e-82 61% ...

  14. NCBI nr-aa BLAST: CBRC-PVAM-01-0471 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0471 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 1e-136 75% ...

  15. NCBI nr-aa BLAST: CBRC-MDOM-08-0125 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0125 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 2e-22 38% ...

  16. NCBI nr-aa BLAST: CBRC-VPAC-01-1411 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1411 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 4e-31 37% ...

  17. NCBI nr-aa BLAST: CBRC-TSYR-01-1404 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1404 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 1e-81 51% ...

  18. NCBI nr-aa BLAST: CBRC-MLUC-01-1134 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-1134 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 1e-137 77% ...

  19. NCBI nr-aa BLAST: CBRC-TSYR-01-1050 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1050 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 1e-97 56% ...

  20. NCBI nr-aa BLAST: CBRC-MEUG-01-0602 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0602 ref|NP_001138976.1| bitter taste receptor Cafa-T2R2 [Canis lupus ...familiaris] dbj|BAE80328.1| bitter taste receptor [Canis lupus familiaris] NP_001138976.1 6e-42 44% ...

  1. NCBI nr-aa BLAST: CBRC-MLUC-01-0118 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0118 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 4e-64 52% ...

  2. NCBI nr-aa BLAST: CBRC-MLUC-01-0701 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0701 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-157 74% ...

  3. NCBI nr-aa BLAST: CBRC-STRI-01-2061 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2061 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 3e-54 83% ...

  4. NCBI nr-aa BLAST: CBRC-MDOM-08-0127 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0127 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 5e-77 45% ...

  5. NCBI nr-aa BLAST: CBRC-MEUG-01-1021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1021 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 4e-62 43% ...

  6. NCBI nr-aa BLAST: CBRC-VPAC-01-1422 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1422 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 1e-101 64% ...

  7. NCBI nr-aa BLAST: CBRC-OPRI-01-0447 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0447 ref|NP_001138979.1| bitter taste receptor Cafa-T2R43 [Canis lupus... familiaris] dbj|BAE80339.1| bitter taste receptor [Canis lupus familiaris] NP_001138979.1 5e-63 48% ...

  8. NCBI nr-aa BLAST: CBRC-PVAM-01-0869 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0869 ref|NP_001138973.1| bitter taste receptor Cafa-T2R12 [Canis lupus... familiaris] dbj|BAE80334.1| bitter taste receptor [Canis lupus familiaris] NP_001138973.1 2e-30 37% ...

  9. NCBI nr-aa BLAST: CBRC-GGOR-01-0320 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0320 ref|NP_001003054.1| prostaglandin E2 receptor EP4 subtype [Canis lupus... familiaris] gb|AAF00470.1|AF177934_1 prostaglandin E2 receptor EP4 subtype [Canis lupus familiaris] NP_001003054.1 3e-91 87% ...

  10. NCBI nr-aa BLAST: CBRC-FCAT-01-1055 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FCAT-01-1055 ref|NP_001093415.1| growth hormone secretagogue receptor [Canis lupus... familiaris] gb|ABQ01981.1| ghrelin receptor [Canis lupus familiaris] NP_001093415.1 4e-61 46% ...

  11. NCBI nr-aa BLAST: CBRC-PCAP-01-1446 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-1446 ref|NP_001033695.1| chemokine (C-C motif) receptor 1 [Canis lupus... familiaris] dbj|BAE66670.1| chemokine (C-C motif) receptor 1 [Canis lupus familiaris] NP_001033695.1 1e-155 77% ...

  12. NCBI nr-aa BLAST: CBRC-PVAM-01-1133 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-1133 ref|NP_001077101.1| cOR51P3 olfactory receptor family 51 subfamily P-like [Canis lupus... familiaris] gb|ABO36682.1| 52P3 olfactory receptor protein [Canis lupus familiaris] NP_001077101.1 2e-61 92% ...

  13. NCBI nr-aa BLAST: CBRC-MMUR-01-0910 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0910 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus familiar...is] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 0.0 90% ...

  14. NCBI nr-aa BLAST: CBRC-OPRI-01-0260 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0260 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-146 75% ...

  15. NCBI nr-aa BLAST: CBRC-RMAC-14-0161 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RMAC-14-0161 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 9e-90 72% ...

  16. NCBI nr-aa BLAST: CBRC-MLUC-01-0637 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0637 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus familiar...is] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 1e-165 90% ...

  17. NCBI nr-aa BLAST: CBRC-MLUC-01-0321 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0321 ref|NP_001138969.1| bitter taste receptor Cafa-T2R10 [Canis lupus... familiaris] dbj|BAE80333.1| bitter taste receptor [Canis lupus familiaris] NP_001138969.1 1e-121 75% ...

  18. NCBI nr-aa BLAST: CBRC-BTAU-01-2143 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-2143 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-128 71% ...

  19. NCBI nr-aa BLAST: CBRC-MLUC-01-0442 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0442 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 5e-84 52% ...

  20. NCBI nr-aa BLAST: CBRC-OPRI-01-0599 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0599 ref|NP_001138976.1| bitter taste receptor Cafa-T2R2 [Canis lupus ...familiaris] dbj|BAE80328.1| bitter taste receptor [Canis lupus familiaris] NP_001138976.1 1e-108 65% ...

  1. NCBI nr-aa BLAST: CBRC-PVAM-01-0808 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0808 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 4e-64 44% ...

  2. NCBI nr-aa BLAST: CBRC-MEUG-01-1930 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1930 ref|NP_001074192.1| taste receptor, type 2, member 41 [Canis lupus... familiaris] dbj|BAE80338.1| bitter taste receptor [Canis lupus familiaris] NP_001074192.1 4e-69 59% ...

  3. NCBI nr-aa BLAST: CBRC-XTRO-01-1851 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-1851 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 1e-147 73% ...

  4. NCBI nr-aa BLAST: CBRC-MEUG-01-2326 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2326 ref|NP_001138978.1| bitter taste receptor Cafa-T2R5 [Canis lupus ...familiaris] dbj|BAE80331.1| bitter taste receptor [Canis lupus familiaris] NP_001138978.1 3e-36 56% ...

  5. NCBI nr-aa BLAST: CBRC-DNOV-01-3181 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-3181 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 1e-153 94% ...

  6. NCBI nr-aa BLAST: CBRC-OPRI-01-1433 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1433 ref|NP_001041572.1| G protein-coupled receptor 44 [Canis lupus fa...miliaris] emb|CAJ77887.1| G-protein coupled receptor [Canis lupus familiaris] NP_001041572.1 1e-133 66% ...

  7. NCBI nr-aa BLAST: CBRC-OPRI-01-1469 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1469 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 1e-122 83% ...

  8. NCBI nr-aa BLAST: CBRC-LAFR-01-2049 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-2049 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-113 78% ...

  9. NCBI nr-aa BLAST: CBRC-MMUR-01-0421 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0421 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 7e-75 50% ...

  10. NCBI nr-aa BLAST: CBRC-OPRI-01-1398 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1398 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 1e-139 81% ...

  11. NCBI nr-aa BLAST: CBRC-CPOR-01-1448 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CPOR-01-1448 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 1e-141 93% ...

  12. NCBI nr-aa BLAST: CBRC-PHAM-01-0220 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0220 ref|NP_001077101.1| cOR51P3 olfactory receptor family 51 subfamily P-like [Canis lupus... familiaris] gb|ABO36682.1| 52P3 olfactory receptor protein [Canis lupus familiaris] NP_001077101.1 1e-153 89% ...

  13. NCBI nr-aa BLAST: CBRC-GGOR-01-0988 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0988 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 6e-98 78% ...

  14. Dietary determinants of obesity

    NARCIS (Netherlands)

    Huaidong, D.U.; Feskens, E.J.M.

    2010-01-01

    Obesity has become a serious public health problem worldwide, and dietary composition can play a role in its prevention and treatment. However, available literature on the impacts of different dietary factors on weight change is inconsistent, or even conflicting. In this review, we briefly summarize

  15. Dietary intake of phytoestrogens

    NARCIS (Netherlands)

    Bakker MI; SIR

    2004-01-01

    The dietary intake of phytoestrogens supposedly influences a variety of diseases, both in terms of beneficial and adverse effects. This report describes current knowledge on dietary intakes of phytoestrogens in Western countries, and briefly summarizes the evidence for health effects. The predominan

  16. First record of a golden jackal (Canis aureus) in the Savinja Valley (NorthernSlovenia)

    OpenAIRE

    Potočnik, Hubert; Krofel, Miha

    2015-01-01

    The article presents the record of an adult female golden jackal (Canis aureus) accidentally shot in 2005 near Gornji Grad in the Upper Savinja Valley, Northern Slovenia (UTM VM82, 980 m a.s.l.). Although this individual was most likely a vagrant, it indicates that golden jackals may soon, or perhaps already have, established permanent territories in Slovenia. Further studies are necessary to determine the status and distribution of this protected species in Slovenia, as well as public awaren...

  17. Occurence of Streptococcus canis, Staphylococcus aureus and intermedius in dog breeding in Berlin and surround areas

    OpenAIRE

    Mellert, Simone

    2010-01-01

    Staphylococcus intermedius, Staphylococcus aureus and Streptococcus canis are suspected as the most important bacterial pathogens for puppies losses. In the presented study the occurrence of these bacterial species was investigated in newborn puppies, their bitches and in the environment of these animals. Fourteen bitches and their litters were included in the study. The animals were sampled at a number of sites using swabs. Further environmental samples were collected. The bitches were s...

  18. Role of golden jackals (Canis aureus) as natural reservoirs of Dirofilaria spp. in Romania

    OpenAIRE

    Ionică, Angela Monica; Matei, Ioana Adriana; D’Amico, Gianluca; Daskalaki, Aikaterini Alexandra; Juránková, Jana; Ionescu, Dan Traian; Mihalca, Andrei Daniel; Modrý, David; Gherman, Călin Mircea

    2016-01-01

    Background Dirofilaria immitis and Dirofilaria repens are mosquito-transmitted zoonotic nematodes, causing heartworm disease and skin lesions, respectively, in carnivores. In Europe, the domestic dog is apparently the main definitive host, but patent infections occur also in other species of carnivores. The rapid spread of the golden jackals (Canis aureus) throughout Europe opens a question of involvement of this species in the sylvatic cycle of pathogens in the colonised territories, includi...

  19. Parasite species of the endangered Iberian wolf (Canis lupus signatus) and a sympatric widespread carnivore

    OpenAIRE

    Figueiredo, Ana; Oliveira, Lucia; Madeira de Carvalho, Luís; Fonseca, Carlos; Torres, Rita Tinoco

    2016-01-01

    Parasites have a profound impact on wildlife population dynamics. However, until some years ago, studies on the occurrence and prevalence of wildlife parasites were neglected comparatively with the studies on humans and domestic animals. In this study, we determined the parasite prevalence of two sympatric wild canids: the endangered Iberian wolf (Canis lupus signatus) and the widespread red fox (Vulpes vulpes), in central Portugal. From November 2014 to July 2015, fresh fecal samples from bo...

  20. Space Use and Habitat Selection by Resident and Transient Coyotes (Canis latrans)

    OpenAIRE

    Joseph W. Hinton; van Manen, Frank T; Chamberlain, Michael J.

    2015-01-01

    Little information exists on coyote (Canis latrans) space use and habitat selection in the southeastern United States and most studies conducted in the Southeast have been carried out within small study areas (e.g., ≤1,000 km2). Therefore, studying the placement, size, and habitat composition of coyote home ranges over broad geographic areas could provide relevant insights regarding how coyote populations adjust to regionally varying ecological conditions. Despite an increasing number of stud...

  1. Antigenisitas, Sensitivitas, dan Spesifisitas Protein Toxocara canis pada Pemeriksaan Antibodi Serum Mencit dengan Indirect-ELISA

    OpenAIRE

    Sri Subekti Bendryman; Kusnoto .; Tutik Juniastuti

    2015-01-01

    The aim of this research were to determine antigenicity, sensitivity, and specificity of Toxocara canisprotein used as antigen in indirect-ELISA for the detection antibody against the worm in the infected hostin order to proper diagnose kit. The design used was true experimental, with Post-test Only ControlGroups Design. Mouse was immunized with various worm homogenates used to antigenicity, sensitivityand specificity tests of T. canis protein with indirect-ELISA technique. The independence v...

  2. Weight changes in wild Wolves, Canis lupus, from ages 2 to 24 months

    Science.gov (United States)

    David, Mech L.

    2008-01-01

    Weights of 118 female and 141 male Minnesota Wolves (Canis lupus) aged 2-24 months increased almost linearly from about 8 kg for females and 10 kg for males at 3 months to 30 kg for females and 32 kg for males at 10-12 months and then tended to increase much more slowly in an overall curvilinear trend. Considerable variation was apparent for both sexes during their first year.

  3. Ecological Changes in Coyotes (Canis latrans) in Response to the Ice Age Megafaunal Extinctions

    OpenAIRE

    Meachen, Julie A.; Adrianna C Janowicz; Jori E Avery; Rudyard W Sadleir

    2014-01-01

    Coyotes (Canis latrans) are an important species in human-inhabited areas. They control pests and are the apex predators in many ecosystems. Because of their importance it is imperative to understand how environmental change will affect this species. The end of the Pleistocene Ice Age brought with it many ecological changes for coyotes and here we statistically determine the changes that occurred in coyotes, when these changes occurred, and what the ecological consequences were of these chang...

  4. Playing at bullying: The postmodern ethic of Bully (Canis Canem Edit)

    OpenAIRE

    Clare Bradford

    2009-01-01

    This essay discusses Bully (Canis Canem Edit), considering the game’s antecedents (narratives involving young people in school settings) and the features which set it apart from other teen texts. It discusses the controversy surrounding the game and comes to the conclusion that the principal reason for unease on the part of parents and educational authorities is that Bully’s postmodernist ethic evades the binaries of liberal humanism and calls into question the foundations on which convention...

  5. Restricted evaluation of Trichodectes canis (Phthiraptera: Trichodectidae detection methods in Alaska gray wolves

    Directory of Open Access Journals (Sweden)

    Theresa M. Woldstad

    2014-12-01

    Full Text Available Trichodectes canis (Phthiraptera: Trichodectidae was first documented on Alaska (USA gray wolves (Canis lupus on the Kenai Peninsula in 1981. In subsequent years, numerous wolves exhibited visually apparent, moderate to severe infestations. Currently, the Alaska Department of Fish and Game utilizes visual inspection, histopathology, and potassium hydroxide (KOH hide digestion for T. canis detection. Our objective was to determine optimal sampling locations for T. canis detection. Wolf hides were subjected to lice enumeration using KOH hide digestion. Thirty nine of the 120 wolves examined had lice. Of these 39, total louse burdens ranged from 14 to an extrapolated 80,000. The hides of 12 infested animals were divided into 10 cm by 10 cm subsections and the lice enumerated on a subsection from each of four regions: neck; shoulder; groin; and rump. Combining the data from these 12 wolves, the highest mean proportions of the total louse burdens on individual wolves were found on the rump and differed significantly from the lowest mean proportion on the neck. However, examination of the four subsections failed to detect all infested wolves. Hides from 16 of the 39 infested animals were cut into left and right sides, and each side then cut into four, approximately equal sections: neck and shoulder; chest; abdomen; and rump. Half hides were totally digested from 11 wolves, and whole hides from 5. For these 21 half hides, the highest mean proportions of total louse burdens were found on the rump, and this section had the highest sensitivity for louse detection, regardless of burden. However, removal of this large section from a hide would likely be opposed by hunters and trappers.

  6. Seroprevalence of Ehrlichia canis, Ehrlichia chaffeensis and Ehrlichia ewingii in dogs in North America

    Directory of Open Access Journals (Sweden)

    Beall Melissa J

    2012-02-01

    Full Text Available Abstract Background This study evaluated the exposure of dogs to three different Ehrlichia spp. in the south and central regions of the United States where vector-borne disease prevalence has been previously difficult to ascertain, particularly beyond the metropolitan areas. Methods Dog blood samples (n = 8,662 were submitted from 14 veterinary colleges, 6 private veterinary practices and 4 diagnostic laboratories across this region. Samples were tested for E. canis, E. chaffeensis and E. ewingii specific antibodies using peptide microtiter ELISAs. Results Overall, E. canis, E. chaffeensis and E. ewingii seroprevalence was 0.8%, 2.8%, and 5.1%, respectively. The highest E. canis seroprevalence (2.3% was found in a region encompassing Arkansas, Louisiana, Oklahoma, Tennessee and Texas. E. chaffeensis seroreactivity was 6.6% in the central region (Arkansas, Kansas, Missouri, and Oklahoma and 4.6% in the southeast region (Georgia, Maryland, North Carolina, South Carolina, Tennessee and Virginia. Seroreactivity to E. ewingii was also highest in the central region (14.6% followed by the southeast region (5.9%. The geospatial pattern derived from E. chaffeensis and E. ewingii seropositive samples was similar to previous reports based on E. chaffeensis seroreactivity in white-tailed deer and the distribution of human monocytic ehrlichiosis (HME cases reported by the CDC. Conclusions The results of this study provide the first large scale regional documentation of exposure to E. canis, E. chaffeensis and E. ewingii in pet dogs, highlighting regional differences in seroprevalence and providing the basis for heightened awareness of these emerging vector-borne pathogens by veterinarians and public health agencies.

  7. Immunolocalization of arginine kinase (AK) in Toxocara canis, Toxocara vitulorum, and Ascaris lumbricoides.

    Science.gov (United States)

    Kulathunga, D G R S; Wickramasinghe, Susiji; Rajapakse, R P V J; Yatawara, Lalani; Jayaweera, W R; Agatsuma, Takeshi

    2012-08-01

    Arginine kinase (AK) is a member of the phosphagen kinase family. AK plays a major role in cellular energy metabolism in invertebrates including nematodes. In the present study, we performed the direct immunofluorescence test to determine the immunolocalization of AK in different stages of the life cycle (eggs, larvae, and adult worms) of Toxocara canis, Toxocara vitulorum, and Ascaris lumbricoides. Our results indicated variable levels of expression of AK in different stages. Moreover, strong fluorescence was observed in cleaving eggs than in dormant eggs. The highest activity of the enzyme was observed in the fully developed eggs. This may be due to high expression of AK in embryonic development, which is associated with increased energy demand due to cleavage and cellular differentiation. Surprisingly, expression of AK is significantly higher in the middle part and posterior end compared to anterior end of the larvae. In addition, AK is highly concentrated in cellular and metabolically active parts of the body such as hypodermis, muscle, intestine, ovaries, oviducts, and uterus, while it is absent in noncellular areas like cuticle. The present study revealed the presence of AK in T. canis, A. lumbricoides, and T. vitulorum and that it plays a major role in energy metabolism of these nematodes. Interestingly, antiserum was prepared against the recombinant T. canis AK and reacts with the native AKs of T. canis, A. lumbricoides, and T. vitulorum. AK levels could vary in relation to maximum potential rates of ATP turnover, oxidative capacity, and energy output. Further studies on subcellular localization of AK in these important helminths provide new information for researchers to develop effective anthelmintics against the parasites of veterinary and of public health importance.

  8. Duplex quantitative real-time PCR assay for the detection and discrimination of the eggs of Toxocara canis and Toxocara cati (Nematoda, Ascaridoidea) in soil and fecal samples

    OpenAIRE

    Durant Jean-Francois; Irenge Leonid M; Fogt-Wyrwas Renata; Dumont Catherine; Doucet Jean-Pierre; Mignon Bernard; Losson Bertrand; Gala Jean-Luc

    2012-01-01

    Abstract Background Toxocarosis is a zoonotic disease caused by Toxocara canis (T. canis) and/or Toxocara cati (T. cati), two worldwide distributed roundworms which are parasites of canids and felids, respectively. Infections of humans occur through ingestion of embryonated eggs of T. canis or T. cati, when playing with soils contaminated with dogs or cats feces. Accordingly, the assessment of potential contamination of these areas with these roundworms eggs is paramount. Methods A duplex qua...

  9. Diagnostic PCR tests for Microsporum audouinii, M. canis and Trichophyton infections

    DEFF Research Database (Denmark)

    Brillowska-Dabrowska, Anna; Swierkowska, Aleksandra; Lindhardt Saunte, Ditte Marie;

    2010-01-01

    Since traditional diagnosis of dermatophyte infections is slow, we present a rapid new PCR test for detection of Trichophyton spp., Microsporum canis and M. audouinii infections. The performance of the test was evaluated with: 58 dermatophyte isolates; 10 yeast, mould and human DNA control sample...... results. Finally, the Microsporum PCR was positive for 10/10 guinea pig specimens from infected animals but for 0/2 of the control animal samples. The evaluation of the two PCR tests indicated excellent sensitivity and specificity.......Since traditional diagnosis of dermatophyte infections is slow, we present a rapid new PCR test for detection of Trichophyton spp., Microsporum canis and M. audouinii infections. The performance of the test was evaluated with: 58 dermatophyte isolates; 10 yeast, mould and human DNA control samples......; 25 routine specimens from patients suspected of having dermatophytosis; 10 hair specimens from guinea pigs experimentally infected with M. canis; and two samples from un-infected control animals. DNA was prepared by a 10-min procedure from pure cultures as previously described. The 302 bp PCR product...

  10. Use of cranial characters in taxonomy of the Minnesota wolf (Canis sp.)

    Science.gov (United States)

    Mech, L. David; Nowak, Ronald M.; Weisberg, Sanford

    2011-01-01

    Minnesota wolves (Canis sp.) sometimes are reported to have affinity to a small, narrow-skulled eastern form (Canis lupus lycaon Schreber, 1775) and sometimes to a larger, broader western form (Canis lupus nubilus Say, 1823). We found that pre-1950 Minnesota wolf skulls were similar in size to those of wolves from southeastern Ontario and smaller than those of western wolves. However, Minnesota wolf skulls during 1970–1976 showed a shift to the larger, western form. Although Minnesota skull measurements after 1976 were unavailable, rostral ratios from 1969 through 1999 were consistent with hybridization between the smaller eastern wolf and the western form. Our findings help resolve the different taxonomic interpretations of Minnesota skull morphology and are consistent with molecular evidence of recent hybridization or intergradation of the two forms of wolves in Minnesota. Together these data indicate that eastern- and western-type wolves historically mixed and hybridized in Minnesota and continue to do so. Our findings are relevant to a recent government proposal to delist wolves from the endangered species list in Minnesota and surrounding states.

  11. Identification of toxocara canis antigens by Western blot in experimentally infected rabbits

    Directory of Open Access Journals (Sweden)

    MORALES Olga Lucía

    2002-01-01

    Full Text Available Toxocariasis is a frequent helminthiasis that can cause visceral and ocular damage in humans specially in children. The identification of specific antigens of Toxocara canis is important in order to develop better diagnostic techniques. Ten rabbits were infected orally with a dose of 5000 Toxocara canis embryonated eggs. Rabbits were bled periodically and an ELISA assay was performed to determine levels of specific Toxocara IgG antibodies. ELISA detected antibodies at day 15 after infection. Western blot (WB assay was performed using excretory/secretory antigens (E/S of T. canis second stage larvae. Different antigen concentrations were evaluated: 150, 200, 250 and 300 µg/mL. The concentration of 250 µg/mL was retained for analysis. Rabbit sera were diluted 1:100. Secondary antibody was used at a dilution of 1:1000. Results of WB indicated that in the first month after infection specific antibodies against the 200 KDa, 116 KDa, 92 KDa and 35 KDa antigens were detected; antibodies against the 92 KDa, 80 KDa, 66 KDa, 45 KDa, 31 KDa and 28 KDa antigens appeared later. All positive sera in the ELISA test were also positive in WB. Two antigen bands, 92 KDa and 35 KDa, were identified since the beginning and throughout the course of infection. These antigens merit further evaluation as candidates for use in diagnosis.

  12. Study of cross-reactivity in serum samples from dogs positive for Leishmania sp., Babesia canis and Ehrlichia canis in enzyme-linked immunosorbent assay and indirect fluorescent antibody test Estudo da reatividade cruzada em amostras de soro de cães positivos para Leishmania sp., Babesia canis e Ehrlichia canis, pelo ensaio imunoenzimático indireto e pela reação de imunofluorescência indireta

    Directory of Open Access Journals (Sweden)

    Trícia Maria F. de Sousa Oliveira

    2008-03-01

    Full Text Available To verify the presence of cross-reaction among leishmaniosis, ehrlichiosis and babesiosis in serological diagnostics used in human visceral leishmaniasis control programs, serum samples from leishmaniasis endemic and non-endemic areas were collected and tested by Indirect Fluorescent Antibody (IFAT and Enzyme-linked immunosorbent assay (ELISA. All serum samples from endemic areas were positive for Leishmania sp., by ELISA and IFAT, 51% positive for Babesia canis and 43% for Ehrlichia canis by IFAT. None of the serum samples from non-endemic areas were positive for Leishmania sp., by IFAT, but 67% were positive for B. canis and 78% for E. canis using the same test. When tested by ELISA for Leishmania sp., four samples from non-endemic area were positive. These dogs were then located and no clinical signs, parasites or antibody was detected in new tests for a six month period. Only one of these 4 samples was positive for B. canis by IFAT and ELISA and three for E. canis by IFAT. The results of the work suggest a co-infection in the endemic area and no serological cross-reaction among these parasites by IFAT and ELISA.Para verificar a existência de reação cruzada entre leishmaniose visceral, erliquiose e babesiose, nos testes sorológicos utilizados em programas de controle da leishmaniose visceral humana, amostras de soro canino provenientes de áreas endêmicas e não endêmicas para essa enfermidade, foram testadas pela Reação de Imunofluorescência (RIFI e Ensaio imunoenzimático (ELISA. Todos os soros provenientes de área endêmica foram positivos para Leishmania sp pelo ELISA e RIFI, 51% para Babesia canis e 43% para Ehrlichia canis pela RIFI. Pela RIFI, nenhum dos soros provenientes de área não endêmica foi positivo para Leishmania sp, sendo 67% positivos para B. canis e 78% para E. canis pelo mesmo teste. Quando testados pelo ELISA para Leishmania sp., quatro soros da área não endêmica foram positivos. Os cães foram localizados

  13. Surtos interespecíficos de dermatomicoses por Microsporum canis e Microsporum gypseum Human and animal dermatomycosis: outbreaks of Microsporum canis and Microsporum gypseum

    Directory of Open Access Journals (Sweden)

    E.O. Costa

    1994-10-01

    Full Text Available As dermatomicoses dos animais domésticos constituem zoonoses importantes, urna vez que estes mantêm estreito contato com a espécie humana, dada a alta infectividade observada nesses processos. Relata-se a ocorrência de sete surtos de dermatomicoses, um por M. gypseum envolvendo um gato e um indivíduo do sexo feminino e os outros por M. canis envolvendo 20 indivíduos da espécie humana (adultos, jovens e crianças de ambos os sexos, 5 cães, 16 gatos e um macaco gibão (Hylobates lar.Dermatomycosis in domestic animals are important zoonosis in view of the fact that they maintain close contact with human beings. Seven ringworm outbreaks are here described, one of M. gypseum involving a cat and a women and the remainder of M. canis involving 20 human beings (adults, young people and children, 5 dogs, 16 cats and a gibbon-monkey (Hylobates lar.

  14. Descripción de características reproductivas en tres perros seropositivos a Brucella canis Description of reproductive characteristics of three Brucella canis seropositive dogs

    Directory of Open Access Journals (Sweden)

    C. BORIE

    2002-01-01

    Full Text Available Se describen las características reproductivas a nivel histológico y seminal en tres perros seropositivos a Brucella canis. A nivel seminal se observaron alteraciones en volumen y en la morfología espermática, encontrándose en un perro ausencia total de espermatozoides. Esta situación concordó con los estudios histológicos, donde se encontró alteración de la línea espermatogénica, además de infiltración eritrocitaria tubular indicativo de alteración de la barrera hematotesticular. Los resultados confirman el impacto negativo de esta bacteria sobre la funcionalidad reproductiva, alterando seriamente la fertilidadSeminal and histological reproductive characteristics in three Brucella canis seropositive dogs are described. Seminal volume and sperm morphology were altered and no sperm was seen in one dog. This agrees with histological findings where spermatozoid development was altered and eritrocites inside tubular lumen were seen indicating hemo-testicular barrier failure. These results confirm the negative impact of the disease on reproductive performance with subsequent infertility

  15. Food habits and temporal activity patterns of the Golden Jackal Canis aureus and the Jungle Cat Felis chaos in Pench Tiger Reserve, Madhya Pradesh

    Directory of Open Access Journals (Sweden)

    A. Majumder

    2011-11-01

    Full Text Available The food habits and temporal activity patterns of the Golden Jackal Canis aureus and the Jungle Cat Felis chaus were studied between January 2008 and June 2009 in Pench Tiger Reserve (PTR, Madhya Pradesh. A total of 50 jackal scats and 85 jungle cat scats were collected where-ever encountered in the study area. Information on activity pattern was obtained using camera traps. Fifty-two pair self-triggered analog cameras were deployed in each 2 x 2 km² across the study area (> 250 km² close to animal trails which were set to work on a continuous 24 hour period. Rodents contributed maximum in the diet of these two species (65% golden jackal scats and 56% jungle cat scats. Eight thousand five hundred and sixty camera-trap nights revealed 189 jungle cat captures and 49 golden jackal captures. The activity of golden jackal had a more homogeneous distribution in time. Present study showed that although some degree of overlap is observed between the two sympatric species, an overall difference in dietary composition and activity patterns enabled them to coexist in PTR.

  16. Cardiac markers: profile in rats experimentally infected with Toxocara canis Marcadores cardíacos: perfil em ratos infectados experimentalmente com Toxocara canis

    Directory of Open Access Journals (Sweden)

    Cecília Braga Laposy

    2012-09-01

    Full Text Available The aim of this study was to evaluate the profile of the enzymes creatine kinase (CK, creatine kinase MB (CK-MB and lactate dehydrogenase (LDH in Wistar rats infected with 250 (GI, n = 24 or 1000 (GII, n = 24 Toxocara canis eggs. Animals were evaluated on days 7, 15, 30, 60, 120 and 180 post-infection (DPI. Only the GI rats showed an increase in CK and CK-MB, at 15 and 30 DPI, respectively. Anti-Toxocara spp. antibodies were detected by ELISA in infected animals. Despite of the presence of eosinophilic infiltrate in the heart of three infected animals, none larva was recovered from the organ neither by acid digestion nor by Baermann procedure. Eosinophilia was observed in both groups but there was no significant difference in the eosinophil counts between GI and GII (p = 0.2239. It is possible to consider that cardiac lesion is an eventual finding in murine model for toxocariasis.O objetivo do presente estudo foi avaliar o perfil das enzimas creatinoquinase (CK, creatinoquinase-MB (CK-MB e lactato desidrogenase (LDH em ratos Wistar infectados com 250 (GI, n = 24 ou 1000 (GII, n = 24 ovos de Toxocara canis. Os animais foram avaliados nos dias 7, 15, 30, 60, 120 e 180 pós-infecção (DPI. Observou-se que apenas os animais do GI apresentaram aumento da atividade de CK e CK-MB aos 15 e 30 DPI, respectivamente. Anticorpos anti-T. canis foram detectados por ELISA nos animais infectados. Apesar da presença de infiltrado eosinofílico em três animais infectados, nenhuma larva foi recuperada do coração pela digestão ácida ou pela técnica de Baermann. Eosinofilia foi observada em todos os momentos em GI e GII, sem diferença significativa entre os grupos (p = 0,2239. Pode-se considerar que as lesões cardíacas foram um achado eventual no modelo murino para toxocaríase.

  17. Dietary Supplements for Toddlers

    Science.gov (United States)

    ... Listen Español Text Size Email Print Share Dietary Supplements for Toddlers Page Content Article Body If you ... a diet recommended for children), she may need supplements of vitamins B12 and D as well as ...

  18. Incontinence Treatment: Dietary Tips

    Science.gov (United States)

    ... sorbitol, commonly used as a sweetener in many dietetic foods, candies, and gums; and fructose, also used ... everyone. A physician can take a brief dietary history and with a 2–3 week diary of ...

  19. Retrospective study of clinical and hematological aspects associated with dogs naturally infected by Hepatozoon canis in Ludhiana, Punjab, India

    Institute of Scientific and Technical Information of China (English)

    Sushma Chhabra; Sanjeev Kumar Uppal; Lachhman Das Singla

    2013-01-01

    To evaluate clinical and hematological aspects of dogs naturally infected withHepatozoon canis (H. canis) presented at the Small Animal Clinics of Guru Angad Dev Veterinary and Animal Sciences University, Ludhiana. Methods: Blood films of 34 naturally infected dogs were examined for haematological alterations and parasitaemia. Signalment and clinical signs were recorded from the animals. Clinical histories were filled out during the consultation. Results: Of the 34 positive dogs by Giemsa stained peripheral blood films, 88.23% presented parasitaemia by H. canis only, while 11.77% had the combination ofH. canis, Babesia sp. and Ehrlichia sp. Young male dogs less than one-year-old, of non-descript breed, were the most commonly affected. And 26.47% were presented with anorexia/inappetence as the only clinical symptom. Other clinical symptoms were mild to moderate fever, pale mucosae and lethargy; a few were also showing the signs of vomiting and diarrhoea. Haematological alterations showed mainly normochromic-normocytic anaemia, leukocytosis and neutrophilia. Conclusions: The findings of this study substantiate that H. canis caused clinical and haematological alterations of the varied intensity in dogs, even with low parasitaemia, should be taken into consideration.

  20. Fecal shedding of Toxocara canis and other parasites in foxes and coyotes on Prince Edward Island, Canada.

    Science.gov (United States)

    Wapenaar, Wendela; Barkema, Herman W; O'Handley, Ryan

    2013-04-01

    Knowledge of parasites shed by wild canids can assist in recognizing risk to human and domestic animal health. Our aim was to estimate the prevalence of patent infections with Toxocara canis and other parasites in foxes (Vulpes vulpes) and coyotes (Canis latrans) in Prince Edward Island, Canada. Identification of parasite species was based on microscopic examination of feces, with the use of a sucrose fecal flotation method. Sample collection was performed in winter on carcasses of 271 and 185 hunted or trapped foxes and coyotes, respectively. One or more parasite species were observed in 242 (89%) foxes and 128 (69%) coyotes. Toxocara canis, Uncinaria stenocephala, Capillaria spp., Mesocestoides, Taenidd spp., Alaria spp., Cryptocotyle lingua, Sarcocystis spp., Neospora caninum-like coccidia, and other coccidia were identified. A third of juvenile foxes were shedding T. canis and had a high prevalence of Capillaria spp., especially in juvenile foxes (69%). Taenidd eggs, Alaria spp. and Sarcocystis spp. were more common in coyotes (24, 18, and 9%, respectively) than foxes (8, 11, and 1%, respectively). Despite the limitations of fecal flotation to identify parasite species, the high prevalence of T. canis warrants the attention of public health professionals. PMID:23568915

  1. Dietary treatment of nephrolithiasis

    OpenAIRE

    Nouvenne, Antonio; Meschi, Tiziana; Guerra, Angela; Allegri, Franca; Prati, Beatrice; Borghi, Loris

    2008-01-01

    The prevalence of idiopathic nephrolithiasis is increasing in rich countries. Dietary manipulation could contribute to the prevention of both its first appearance and the recurrence of the disease. The target of dietary treatment is to decrease the “urinary lithogenic risk factors” such as low urine volume, hypercalciuria, hyperoxaluria, hyperuricosuria, hyperphosphaturia, hypocitraturia, hypomagnesuria and excessively alkaline or acid urinary pH. Due to the lack of randomized controlled tria...

  2. Soroepidemiologia da brucelose canina causada por Brucella canis e Brucella abortus na cidade de Alfenas, MG Seroepidemiology of canine brucellosis caused by Brucella canis and Brucella abortus in Alfenas, MG, Brazil

    Directory of Open Access Journals (Sweden)

    A.C. Almeida

    2004-04-01

    Full Text Available The prevalence of canine brucellosis was evaluated in the city of Alfenas, MG through the technique of agarose gel imunodifusion for Brucella canis and slow serum agglutination test with 2-mercaptoetanol for Brucella abortus. The prevalence was of 14.2% and 2.8%, respectively, for B. canis and B. abortus. The positives, characterized by animals above one year of age (77.8%, and mongrel dogs (56.2%, showed a prevalence of 50 and 48% for males and females, respectively. The canine brucellosis was prevalent in the city principally in dogs of outskirts.

  3. Prevalencia y factores que favorecen la presentación de toxocara canis y ancylostoma caninum en canes de compañía (Prevalence and factors that favor of presentation of toxocara canis and ancylostoma caninum in companion dogs.

    Directory of Open Access Journals (Sweden)

    Castillo Cuenca. Julio César

    2012-06-01

    Full Text Available RESUMENEl presente trabajo tiene como objetivo determinar la prevalencia de Toxocara canis y Ancylostoma caninum y algunos factores que pudieran favorecer una mayor tasa de infestación por estos nematodos zoonóticosen canes de compañía en los consejos populares Universidad y Camilo Cienfuegos.SUMMARYThe present research aims at determining Toxocara canis and Ancylostoma caninum prevalence and some factors that may favor higher values of infestation in companion dogs from these zoonotic nemathods in the University and Camilo Cienfuegos county.

  4. Modulation of IL-12 and IFNγ by probiotic supplementation promotes protection against Toxocara canis infection in mice.

    Science.gov (United States)

    de Avila, L F D C; de Leon, P M M; de Moura, M Q; Berne, M E A; Scaini, C J; Leivas Leite, F P

    2016-05-01

    In this study, supplementation with the probiotic Saccharomyces boulardii promoted a reduction in intensity of infection by Toxocara canis and modulates cytokines mRNA expression in experimentally infected mice. IL-12 gene transcription had 40-fold increase in S. boulardii supplemented uninfected mice and sevenfold increase in supplemented infected mice comparing with not supplemented group. Regarding IFNγ, similar results were observed, since probiotic supplementation induced approximately 43-fold increase, but only in uninfected mice (P canis infection upregulated IL-10 expression while S. boulardii downregulated it and no change was observed for IL-4. Thus, based in these findings; we suggest that one possible mechanism responsible for S. boulardii protection effect against T. canis infection is by the modulation of cytokines expression, especially IL-12. PMID:26971490

  5. Toxocara canis glycans influence antigen recognition by mouse IgG1 and IgM antibodies.

    Science.gov (United States)

    Długosz, Ewa; Wiśniewski, Marcin

    2016-01-01

    The impact of sugar moieties of Toxocara canis glycoprotein antigens on their recognition by infected mouse antibodies was investigated in this study. Native TES and recombinant Toxocara mucins generated in Pichia pastoris yeast as well as their deglycosylated forms were used in ELISA. TES and recombinant mucins were equally recognized by T. canis infected mouse IgG1 antibodies. IgM immunoglobulins predominantly recognized TES antigens. Among mucins recognition of Tc-MUC-4 was the most significant. Deglycosylation of antigens resulted in significant loss of IgM and IgG1 reactivity to TES, mucins, Tc-MUC-3 and Tc-MUC-4. The presence of sugar moieties had no influence on IgE binding to native or recombinant T. canis antigens. Our results suggest that glycans are involved in epitope formation what should be taken into consideration in production of recombinant helminth antigens for diagnostic purposes. PMID:26751891

  6. Evaluation of an Immunochromatographic Test to the Diagnosis of Canine Brucellosis Caused by Brucella canis.

    Science.gov (United States)

    Keid, L B; Diniz, J A; Oliveira, T M F S; Ferreira, H L; Soares, R M

    2015-12-01

    This study evaluated the performance of an immunochromatographic test (ICT) for the diagnosis of canine brucellosis caused by Brucella canis, comparing its results with that of the rapid slide agglutination test with and without the use of 2-mercaptoethanol and the agar gel immunodiffusion test (AGID). The microbiological culture, PCR and clinical examination were used as reference. According to the results obtained in clinical examination, blood culture, culture of semen and vaginal swab and PCR in blood, semen and vaginal swab, a total of 102 dogs were divided into three groups: B. canis-infected dogs (Group 1), B. canis-non-infected dogs (Group 2) and dogs with suspected brucellosis (Group 3). The diagnostic sensitivity of RSAT, 2ME-RSAT, AGID and ICT in Group 1 was, respectively, 75%, 37.5%, 27.8% and 89.58%. The diagnostic specificity of RSAT, 2ME-RSAT, AGID and ICT in Group 2 was, respectively, 91%, 100%, 100%, and 100%. In dogs with suspected brucellosis, 9.67% were RSAT positive, none was positive by 2ME-RSAT, 3.22% were AGID positive and 6.45% were ICT positive. The main drawback concerning canine brucellosis diagnosis is the lack of a highly sensitive serological assay to be used as a screening test to the rapid identification of infected animals. The ICT showed a high diagnostic specificity and a diagnostic sensitivity value greater than that observed in the RSAT, 2ME-RSAT and AGID. However, 10.41% of infected dogs had negative results by ICT. These dogs were positive by microbiological culture and/or PCR, indicating active infection and consequently a higher potential of spreading Brucella. Although rapid and simple to perform, the ICT lacked sensitivity to be used as a screening test.

  7. A protected area influences genotype-specific survival and the structure of a Canis hybrid zone.

    Science.gov (United States)

    Benson, John F; Patterson, Brent R; Mahoney, Peter J

    2014-02-01

    It is widely recognized that protected areas can strongly influence ecological systems and that hybridization is an important conservation issue. However, previous studies have not explicitly considered the influence of protected areas on hybridization dynamics. Eastern wolves are a species of special concern and their distribution is largely restricted to a protected population in Algonquin Provincial Park (APP), Ontario, Canada, where they are the numerically dominant canid. We studied intrinsic and extrinsic factors influencing survival and cause-specific mortality of hybrid and parental canids in the three-species hybrid zone between eastern wolves, eastern coyotes, and gray wolves in and adjacent to APP. Mortality risk for eastern wolves in areas adjacent to APP was significantly higher than for other sympatric Canis types outside of APP, and for eastern wolves and other canids within APP. Outside of APP, the annual mortality rate of all canids by harvest (24%) was higher than for other causes of death (4-7%). Furthermore, eastern wolves (hazard ratio = 3.5) and nonresidents (transients and dispersing animals, hazard ratio = 2.7) were more likely to die from harvest relative to other Canis types and residents, respectively. Thus, eastern wolves dispersing from APP were especially vulnerable to harvest mortality. For residents, eastern wolf survival was more negatively influenced by increased road density than for other Canis types, further highlighting the sensitivity of eastern wolves to human disturbance. A cycle of dispersal from APP followed by high rates of mortality and hybridization appears to maintain eastern wolves at low density adjacent to APP, limiting the potential for expansion beyond the protected area. However, high survival and numerical dominance of eastern wolves within APP suggest that protected areas can allow rare hybridizing species to persist even if their demographic performance is compromised and barriers to hybridization are largely

  8. Flotation and adherence characteristics of Toxocara canis and T. cati and a reliable method for recovering Toxocara eggs from soil.

    Science.gov (United States)

    Kleine, Annika; Janecek, Elisabeth; Waindok, Patrick; Strube, Christina

    2016-08-30

    Toxocara canis and T. cati are worldwide distributed intestinal nematodes of canids and felids and pose a threat to public health due to possible clinical manifestations in humans. Different methods for detection of Toxocara eggs in soil have been described, but conducted studies deal with egg recovery rates of T. canis or "Toxocara spp." only whereas T. cati egg recovery has not been taken into consideration. Thus, flotation properties in sodium chloride solution and adherence characteristics to different substrates possibly coming into contact with Toxocara eggs before or during purification from soil were evaluated for both, T. canis and T. cati eggs. No significant difference was observed in flotation characteristics, but comparison of adherence properties revealed significantly less adherence of T. cati eggs on almost all evaluated substrates ("sand", side sealed bags, glass beaker, centrifuge tube) and different washing solutions (tap water, Tween(®) 80, Triton™ X-100). Mean adhesion rates of T. cati eggs ranged from 15.9% to 68.9%, those of T. canis eggs from 28.3% to 83.9%. While adherence of T. cati eggs on any substrate was significantly reduced when rinsing with Tween(®) 80 solution, no effect on T. canis eggs could be observed. Generally, Toxocara eggs adhere better on plastic than on glass. Evaluation of a method including only non-hazardous substances for purification of Toxocara eggs from soil resulted in a statistically significant higher recovery rate of T. canis (42.6% recovered eggs) compared to T. cati eggs (30.9% recovered eggs). As these percentages are above average for described methods to recover Toxocara eggs from soil, the presented method is considered reliable for prevalence studies. PMID:27523935

  9. Presence of Leishmania and Brucella Species in the Golden Jackal Canis aureus in Serbia

    OpenAIRE

    Duško Ćirović; Dimosthenis Chochlakis; Snežana Tomanović; Ratko Sukara; Aleksandra Penezić; Yannis Tselentis; Anna Psaroulaki

    2014-01-01

    The golden jackal Canis aureus occurs in south-eastern Europe, Asia, the Middle East, the Caucasus, and Africa. In Serbia, jackals neared extinction; however, during the last 30 years, the species started to spread quickly and to increase in number. Few studies in the past have revealed their potential role as carriers of zoonotic diseases. Animal samples were collected over a three-year period (01/2010–02/2013) from 12 sites all over Serbia. Of the tissue samples collected, spleen was ch...

  10. Population Genetic Structure of Golden Jackal, Canis aureus in Gujarat, India

    OpenAIRE

    Tripti Negi; Y.V. Jhala

    2015-01-01

    Genetic diversity of Golden Jackal, Canis aureus was estimated to understand the role of Rann of Kachchh in their movement between Kachchh region and the mainland of Gujarat, a western state in India. A total of 30 samples were collected and genotyped with 10 polymorphic microsatellite loci. The analysis was done within and between the Golden Jackal populations in Bhal and Kachchh region of the state. Altogether, 78 distinct alleles were found with mean allelic number of 8.8 (±2.33)....

  11. Ruptured aortic aneurysm in a coyote (Canis latrans) from South Carolina.

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Debra, Lee; Schrecengost, Joshua; Kilgo, John; Ray, Scott; Miller, Karl V.

    2007-07-01

    Abstract – A radio-collared adult female coyote (Canis latrans) from South Carolina was found dead with no apparent signs of trauma or struggle. Necropsy revealed a ruptured aortic aneurysm within the thoracic cavity as well as severe heartworm infection, with paracites present in the caudal vena cava. Histologically, inflammatory cell infiltrates were frequent in the aneurysm and consisted of eosinophils, neutrophils, lymphocytes, plasma cells, and macrophages. Bacteria, fungi, and paracites were not found in the aneurysm. Death was due to exsanguinations. This represents a first report of an aneurysm in a coyote.

  12. White-tailed Deer (Odocoileus virginianus) fawn risk from Gray Wolf (Canis lupus) predation during summer

    Science.gov (United States)

    Mech, L. David; Morris, Aaron; Barber-Meyer, Shannon M.

    2015-01-01

    Little is known about how often various prey animals are at risk of predation by Gray Wolves (Canis lupus). We used a system to monitor the presence during the day of two radio-collared Gray Wolves within 2 km of a radio-collared White-tailed Deer (Odocoileus virginianus) with a fawn or fawns in August 2013 in the Superior National Forest of northeastern Minnesota. We concluded that the fawn or fawns were at risk of predation by at least one wolf at least daily.

  13. The influence of social and endocrine factors on urine-marking by captive wolves (Canis lupus)

    Science.gov (United States)

    Asa, C.S.; Mech, L.D.; Seal, U.S.; Plotka, E.D.

    1990-01-01

    Although serum hormones varied seasonally in all adult animals, only dominant male and female wolves urine-marked. Serum testosterone and urine-marking rates, which increased during the fall/winter breeding season, were positively correlated in both male and female dominant wolves. Estradiol, which increased in conjunction with proestrus and estrus, was not correlated with female urine-marking. These findings suggest that hormonal influence on urine-marking in the wolf is modulated by social factors and contrast with those for both domestic dogs and coyotes, two other members of the genus Canis.

  14. Dietary ecology of human

    International Nuclear Information System (INIS)

    The dietary life of humans varies with the environment where they live and has been changing with time. It has become possible to examine such changes by using stable carbon and nitrogen isotope composition as a chemical tool. The present report outlines recent developments in the application of this tool and compares the dietary ecologies of various human groups from the viewpoint of isotope geochemistry. The history of the application of this tool to dietary analysis is summarized first, and features of the carbon and nitrogen isotope composition in animals and their relations with the food chain are outlined. The dietary ecology of the current people is then discussed in relation to the isotope composition in food, the isotope composition in hair of the current people, and determination of food habit of specific groups of people from such isotope compositions. For prediction of dietary composition, the report presents a flow chart for an algorism which is based on the Monte Carlo method. It also outlines processes for analyzing food habits of people in the prehistoric age, focusing on distribution of isotope composition in humans over the world. (N.K.)

  15. Dietary advanced glycation endproducts

    DEFF Research Database (Denmark)

    Poulsen, Malene Wibe

    sensitivity and markers of inflammation and oxidative stress were found. In conclusion, results from this PhD thesis suggest that diets prepared by low heat may reduce risk markers for type 2 diabetes and cardiovascular disease. However, it can currently not be concluded that AGEs are responsible...... complications. A potential pathophysiological role of dietary AGEs in type 2 diabetes and cardiovascular disease has been discussed, as the contribution of dietary AGEs has been estimated to be larger than the amount of endogenously formed AGEs. Furthermore, the increased mortality associated with type 2...... diabetes and cardiovascular disease underlines the importance of identifying possible risk factors in the Western lifestyle. The overall aim of this thesis was to investigate if intake of dietary AGEs increases risk markers for type 2 diabetes and cardiovascular disease. In an acute meal study, effects...

  16. Promoting dietary change.

    Science.gov (United States)

    Crawford, S

    1995-01-01

    The discouraging failure rate of counselling patients for dietary change suggests that traditional methods require some reconsideration. These have been frequently based on generalized assumptions regarding patients' health values, their need for knowledge, level of literacy, and ability to translate abstract concepts into daily food. Similarly, both patient and counsellor often insufficiently examine the environmental context of the dietary changes to determine whether or not they are feasible. This brief overview examines ways in which nutrition counselling can be enhanced to ensure that patients are enabled to develop a heart-healthy diet through active problem solving and directed development of self-efficacy in the skills they will need for lasting change.

  17. Purification and characterization of a 43.5 kDa keratinolytic metalloprotease from Microsporum canis.

    Science.gov (United States)

    Brouta, F; Descamps, F; Fett, T; Losson, B; Gerday, C; Mignon, B

    2001-06-01

    A keratinolytic protease secreted by a feline clinical isolate of Microsporum canis cultivated in a broth containing feline keratin as the sole nitrogen source was purified from the culture filtrate by affinity chromatography on bacitracin-agarose and by hydrophobic chromatography on octyl-agarose. The enzyme had an apparent molecular mass of 43.5 kDa and the pI was 7.7. It had a significant activity against keratin azure, elastin-Congo red and denatured type I collagen (azocoll). Using the latter substrate, the optimum pH was around 8 and the apparent optimum temperature around 50 degrees C. The protease was strongly inhibited by 1,10-phenanthroline, phosphoramidon and EDTA. The first 13 N-terminal amino acid sequence showed a 61% homology with that of the extracellular metalloprotease of Aspergillus fumigatus and with the neutral protease I of A. oryzae, confirming that this 43.5 kDa keratinase is a metalloprotease. This keratinolytic metalloprotease could be a virulence-related factor involved in pathophysiological mechanisms of M. canis dermatophytosis.

  18. Detection of Ehrlichia canis in domestic cats in the central-western region of Brazil

    Directory of Open Access Journals (Sweden)

    Ísis Assis Braga

    2014-06-01

    Full Text Available Ehrlichiosis is a worldwide distributed disease caused by different bacteria of the Ehrlichia genus that are transmitted by arthropod vectors. Its occurrence in dogs is considered endemic in several regions of Brazil. Regarding cats, however, few studies have been done and, consequently, there is not enough data available. In order to detect Ehrlichia spp. in cats from the central-western region of Brazil, blood and serum samples were collected from a regional population of 212 individuals originated from the cities of Cuiabá and Várzea Grande. These animals were tested by the Immunofluorescence Assay (IFA and the Polymerase Chain Reaction (PCR designed to amplify a 409 bp fragment of the dsb gene. The results obtained show that 88 (41.5% cats were seropositive by IFA and 20 (9.4% cats were positive by PCR. The partial DNA sequence obtained from PCR products yielded twenty samples that were found to match perfectly the Ehrlichia canis sequences deposited on GenBank. The natural transmission of Ehrlichia in cats has not been fully established. Furthermore, tick infestation was not observed in the evaluated cats and was not observed any association between age, gender and positivity of cats in both tests. The present study reports the first serological and molecular detection of E. canis in domestic cats located in the endemic area previously mentioned.

  19. Parasite species of the endangered Iberian wolf (Canis lupus signatus and a sympatric widespread carnivore

    Directory of Open Access Journals (Sweden)

    Ana Figueiredo

    2016-08-01

    Full Text Available Parasites have a profound impact on wildlife population dynamics. However, until some years ago, studies on the occurrence and prevalence of wildlife parasites were neglected comparatively with the studies on humans and domestic animals. In this study, we determined the parasite prevalence of two sympatric wild canids: the endangered Iberian wolf (Canis lupus signatus and the widespread red fox (Vulpes vulpes, in central Portugal. From November 2014 to July 2015, fresh fecal samples from both species were collected monthly in several transects distributed throughout the study area. All samples were submitted to several coprological techniques. In total, 6 helminth parasites (Crenosoma vulpis, Angiostrongylus vasorum, Toxocara canis, Trichuris vulpis, Ancylostomatidae, Toxascaris leonina, and a protozoa (Balantidium coli were identified based on size and morphology. The red fox was infected by seven different parasites while the Iberian wolf was infected by four. All parasites present in wolf were also present in the red fox. C. vulpis had the higher prevalence in red fox, while Ancylostomatidae were the most prevalent parasites in wolf. To our knowledge, this is the first study in this isolated subpopulation of the Iberian wolf. Our results show that both carnivores carry parasites that are of concern as they are pathogenic to humans and other wild and domestic animals. We suggest that surveillance programs must also include monitoring protocols of wildlife; particularly endangered species.

  20. Parasite species of the endangered Iberian wolf (Canis lupus signatus) and a sympatric widespread carnivore.

    Science.gov (United States)

    Figueiredo, Ana; Oliveira, Lucia; Madeira de Carvalho, Luís; Fonseca, Carlos; Torres, Rita Tinoco

    2016-08-01

    Parasites have a profound impact on wildlife population dynamics. However, until some years ago, studies on the occurrence and prevalence of wildlife parasites were neglected comparatively with the studies on humans and domestic animals. In this study, we determined the parasite prevalence of two sympatric wild canids: the endangered Iberian wolf (Canis lupus signatus) and the widespread red fox (Vulpes vulpes), in central Portugal. From November 2014 to July 2015, fresh fecal samples from both species were collected monthly in several transects distributed throughout the study area. All samples were submitted to several coprological techniques. In total, 6 helminth parasites (Crenosoma vulpis, Angiostrongylus vasorum, Toxocara canis, Trichuris vulpis, Ancylostomatidae, Toxascaris leonina), and a protozoa (Balantidium coli) were identified based on size and morphology. The red fox was infected by seven different parasites while the Iberian wolf was infected by four. All parasites present in wolf were also present in the red fox. C. vulpis had the higher prevalence in red fox, while Ancylostomatidae were the most prevalent parasites in wolf. To our knowledge, this is the first study in this isolated subpopulation of the Iberian wolf. Our results show that both carnivores carry parasites that are of concern as they are pathogenic to humans and other wild and domestic animals. We suggest that surveillance programs must also include monitoring protocols of wildlife; particularly endangered species. PMID:27358768

  1. ANTHELMINTIC ACTIVITY OF LAPACHOL, β-LAPACHONE AND ITS DERIVATIVES AGAINST Toxocara canis LARVAE.

    Science.gov (United States)

    Mata-Santos, Taís; Pinto, Nitza França; Mata-Santos, Hilton Antônio; De Moura, Kelly Gallan; Carneiro, Paula Fernandes; Carvalho, Tatiane Dos Santos; Del Rio, Karina Pena; Pinto, Maria do Carmo Freire Ribeiro; Martins, Lourdes Rodrigues; Fenalti, Juliana Montelli; Da Silva, Pedro Eduardo Almeida; Scaini, Carlos James

    2015-01-01

    Anthelmintics used for intestinal helminthiasis treatment are generally effective; however, their effectiveness in tissue parasitosis (i.e. visceral toxocariasis) is moderate. The aim of this study was to evaluate the in vitro activity of lapachol, β-lapachone and phenazines in relation to the viability of Toxocara canis larvae. A concentration of 2 mg/mL (in duplicate) of the compounds was tested using microculture plates containing Toxocara canis larvae in an RPMI-1640 environment, incubated at 37 °C in 5% CO2 tension for 48 hours. In the 2 mg/mL concentration, four phenazines, lapachol and three of its derivatives presented a larvicide/larvistatic activity of 100%. Then, the minimum larvicide/larvistatic concentration (MLC) test was conducted. The compounds that presented the best results were nor-lapachol (MLC, 1 mg/mL), lapachol (MLC 0.5 mg/mL), β-lapachone, and β-C-allyl-lawsone (MLC, 0.25 mg/mL). The larvae exposed to the compounds, at best MLC with 100% in vitro activity larvicide, were inoculated into healthy BALB/c mice and were not capable of causing infection, confirming the larvicide potential in vitro of these compounds.

  2. The genome of obligately intracellular Ehrlichia canis revealsthemes of complex membrane structure and immune evasion strategies

    Energy Technology Data Exchange (ETDEWEB)

    Mavromatis, K.; Kuyler Doyle, C.; Lykidis, A.; Ivanova, N.; Francino, P.; Chain, P.; Shin, M.; Malfatti, S.; Larimer, F.; Copeland,A.; Detter, J.C.; Land, M.; Richardson, P.M.; Yu, X.J.; Walker, D.H.; McBride, J.W.; Kyrpides, N.C.

    2005-09-01

    Ehrlichia canis, a small obligately intracellular, tick-transmitted, gram-negative, a-proteobacterium is the primary etiologic agent of globally distributed canine monocytic ehrlichiosis. Complete genome sequencing revealed that the E. canis genome consists of a single circular chromosome of 1,315,030 bp predicted to encode 925 proteins, 40 stable RNA species, and 17 putative pseudogenes, and a substantial proportion of non-coding sequence (27 percent). Interesting genome features include a large set of proteins with transmembrane helices and/or signal sequences, and a unique serine-threonine bias associated with the potential for O-glycosylation that was prominent in proteins associated with pathogen-host interactions. Furthermore, two paralogous protein families associated with immune evasion were identified, one of which contains poly G:C tracts, suggesting that they may play a role in phase variation and facilitation of persistent infections. Proteins associated with pathogen-host interactions were identified including a small group of proteins (12) with tandem repeats and another with eukaryotic-like ankyrin domains (7).

  3. Isolation of Aureimonas altamirensis, a Brucella canis-like bacterium, from an edematous canine testicle.

    Science.gov (United States)

    Reilly, Thomas J; Calcutt, Michael J; Wennerdahl, Laura A; Williams, Fred; Evans, Tim J; Ganjam, Irene K; Bowman, Jesse W; Fales, William H

    2014-11-01

    Microbiological and histological analysis of a sample from a swollen testicle of a 2-year-old Border Collie dog revealed a mixed infection of the fungus Blastomyces dermatitidis and the Gram-negative bacterium Aureimonas altamirensis. When subjected to an automated microbial identification system, the latter isolate was provisionally identified as Psychrobacter phenylpyruvicus, but the organism shared several biochemical features with Brucella canis and exhibited agglutination, albeit weakly, with anti-B. canis antiserum. Unequivocal identification of the organism was only achieved by 16S ribosomal RNA gene sequencing, ultimately establishing the identity as A. altamirensis. Since its first description in 2006, this organism has been isolated infrequently from human clinical samples, but, to the authors' knowledge, has not been reported from a veterinary clinical sample. While of unknown clinical significance with respect to the pathology observed for the polymicrobial infection described herein, it highlights the critical importance to unambiguously identify the microbe for diagnostic, epidemiological, infection control, and public health purposes. PMID:25292192

  4. Case report of canine co-infection with Leishmania infantum and Ehrlichia canis

    Directory of Open Access Journals (Sweden)

    Stefanovska Jovana

    2011-05-01

    Full Text Available Canine leishmaniasis (CanL due to Leishmania infantum and canine monocytic ehrilichiosis (CME due to Ehrlichia canis are common diseases with zoonotic potential in the Mediterranean area. Their prevalence in R. Macedonia as a neighboring Mediterranean county is expected. In both diseases similar clinical symptoms can be manifested in dogs such as: lethargy, anorexia, weight loss, epistaxis, fever, pale mucous membranes, enlarged lymph nodes, splenomegaly, ocular signs. This case report present an atypical case of 11 year old female Samoyed with starting single clinical symptom epistaxys. Initial diagnostic procedures revealed the presence only of CanL, which was diagnosed using indirect immunofluorescence method and ELISA. First laboratory findings showed normal hematological and renal profiles. Dog was put on a treatment with Allopurinol (20mg/kg, p/o for at least 9 months. Termination of the therapy after 6 months brought a numerous clinical symptoms involving weakness, dehydration, pale mucous membranes lost pupilar reflex, uremic breath and biochemical parameters revealed a renal failure. Using a commercial ELISA kit Ehrlichia canis as a co infection was diagnosed. Most probably the second infectious agent was induced in the past 6 months, causing more severe pathological effects than CanL infection alone.

  5. Ancient Himalayan wolf (Canis lupus chanco) lineage in Upper Mustang of the Annapurna Conservation Area, Nepal.

    Science.gov (United States)

    Chetri, Madhu; Jhala, Yadvendradev V; Jnawali, Shant R; Subedi, Naresh; Dhakal, Maheshwar; Yumnam, Bibek

    2016-01-01

    The taxonomic status of the wolf (Canis lupus) in Nepal's Trans-Himalaya is poorly understood. Recent genetic studies have revealed the existence of three lineages of wolves in the Indian sub-continent. Of these, the Himalayan wolf, Canis lupus chanco, has been reported to be the most ancient lineage historically distributed within the Nepal Himalaya. These wolves residing in the Trans-Himalayan region have been suggested to be smaller and very different from the European wolf. During October 2011, six fecal samples suspected to have originated from wolves were collected from Upper Mustang in the Annapurna Conservation Area of Nepal. DNA extraction and amplification of the mitochondrial (mt) control region (CR) locus yielded sequences from five out of six samples. One sample matched domestic dog sequences in GenBank, while the remaining four samples were aligned within the monophyletic and ancient Himalayan wolf clade. These four sequences which matched each other, were new and represented a novel Himalayan wolf haplotype. This result confirms that the endangered ancient Himalayan wolf is extant in Nepal. Detailed genomic study covering Nepal's entire Himalayan landscape is recommended in order to understand their distribution, taxonomy and, genetic relatedness with other wolves potentially sharing the same landscape. PMID:27199590

  6. ANTHELMINTIC ACTIVITY OF LAPACHOL, β-LAPACHONE AND ITS DERIVATIVES AGAINST Toxocara canis LARVAE

    Directory of Open Access Journals (Sweden)

    Taís MATA-SANTOS

    2015-06-01

    Full Text Available Anthelmintics used for intestinal helminthiasis treatment are generally effective; however, their effectiveness in tissue parasitosis (i.e. visceral toxocariasis is moderate. The aim of this study was to evaluate the in vitro activity of lapachol, β-lapachone and phenazines in relation to the viability of Toxocara canis larvae. A concentration of 2 mg/mL (in duplicate of the compounds was tested using microculture plates containing Toxocara canis larvae in an RPMI-1640 environment, incubated at 37 °C in 5% CO2 tension for 48 hours. In the 2 mg/mL concentration, four phenazines, lapachol and three of its derivatives presented a larvicide/larvistatic activity of 100%. Then, the minimum larvicide/larvistatic concentration (MLC test was conducted. The compounds that presented the best results were nor-lapachol (MLC, 1 mg/mL, lapachol (MLC 0.5 mg/mL, β-lapachone, and β-C-allyl-lawsone (MLC, 0.25 mg/mL. The larvae exposed to the compounds, at best MLC with 100% in vitro activity larvicide, were inoculated into healthy BALB/c mice and were not capable of causing infection, confirming the larvicide potential in vitro of these compounds.

  7. Determination of anthelmintic efficacy against Toxocara canis in dogs by use of capsule endoscopy.

    Science.gov (United States)

    Lee, Alice C Y; Epe, Christian; Bowman, Dwight D

    2015-09-15

    Industry guidelines for anthelmintic testing call for postmortem inspection of animals to verify treatment efficacy. A previous study showed that capsule endoscopy (CE) can be performed on dogs in vivo to quantify hookworms in the small intestine. Adoption of a minimally invasive procedure such as this could reduce the need for necropsy in efficacy trials. The present study employed CE to enumerate Toxocara canis in dogs, with two main goals: to determine if multiple capsule examinations improves the accuracy of worm counts compared to a single examination, and to establish if the efficacy of an anthelmintic compound is the same whether calculated using CE or necropsy data. To avoid needless animal sacrifice, the study was carried out on beagle dogs already in a product development trial with a planned terminal endpoint. Dogs were infected by oral inoculation with T. canis eggs. Untreated control dogs (n=8) were evaluated by CE three times while dogs treated with test compounds (3 groups of 4) were examined only once. Utilizing either the average count or just the last complete capsule examination, a robust correlation was found between CE and postmortem numbers (r=0.94, pcanis parasiticide trials. PMID:26321133

  8. Effects of irradiation on the biology of the infective larvae of Toxocara canis in the mouse

    Energy Technology Data Exchange (ETDEWEB)

    Barriga, O.O.; Myser, W.C.

    1987-02-01

    Mice were infected with either 2000 normal or irradiated embryonated eggs of Toxocara canis and the number of larvae in their livers, lungs, brains, and carcasses investigated at 5, 20, and 33 days of infection. Mortality of mice infected with normal eggs was 33% between day 4 and 8 postinfection but there was no mortality among mice infected with irradiated eggs. Irradiation with 60, 90, or 150 kr of X-rays inhibited the migration of larvae from the livers and lungs and their accumulation in brain and carcass in proportion to the irradiation dose. By day 33 of infection, the ratio of larvae in liver and lungs to larvae in brain and carcass was 0.16 in normal mice, 0.42 in 60-kr mice, 0.98 in 90-kr mice, and 23.3 in 150-kr mice. Irradiated larvae, particularly those migrating through the peritoneal cavity, died faster than normal larvae until day 20. Irradiation favored survival after day 20. By days 20 and 33 postinfection the total parasite load was 29% and 8%, respectively, of the administered dose in control mice, 18% and 12% in 60-kr mice, 8% and 4% in 90-kr mice, and 0.9% and 0.3% in 150-kr mice. Irradiation of infective T. canis larvae, then, reduces their pathogenicity, inhibits their migration from liver and lungs, kills some of the parasites during the first 3 weeks of infection, but favors their late survival in the host.

  9. Colorimetric Detection of Ehrlichia Canis via Nucleic Acid Hybridization in Gold Nano-Colloids

    Directory of Open Access Journals (Sweden)

    Ajima Muangchuen

    2014-08-01

    Full Text Available Canine monocytic ehrlichiosis (CME is a major thick-bone disease of dog caused by Ehrlichia canis. Detection of this causal agent outside the laboratory using conventional methods is not effective enough. Thus an assay for E. canis detection based on the p30 outer membrane protein gene was developed. It was based on the p30 gene amplification using loop-mediated isothermal DNA amplification (LAMP. The primer set specific to six areas within the target gene were designed and tested for their sensitivity and specificity. Detection of DNA signals was based on modulation of gold nanoparticles’ surface properties and performing DNA/DNA hybridization using an oligonucleotide probe. Presence of target DNA affected the gold colloid nanoparticles in terms of particle aggregation with a plasmonic color change of the gold colloids from ruby red to purple, visible by the naked eye. All the assay steps were completed within 90 min including DNA extraction without relying on standard laboratory facilities. This method was very specific to target bacteria. Its sensitivity with probe hybridization was sufficient to detect 50 copies of target DNA. This method should provide an alternative choice for point of care control and management of the disease.

  10. Ecological changes in Coyotes (Canis latrans) in response to the ice age megafaunal extinctions.

    Science.gov (United States)

    Meachen, Julie A; Janowicz, Adrianna C; Avery, Jori E; Sadleir, Rudyard W

    2014-01-01

    Coyotes (Canis latrans) are an important species in human-inhabited areas. They control pests and are the apex predators in many ecosystems. Because of their importance it is imperative to understand how environmental change will affect this species. The end of the Pleistocene Ice Age brought with it many ecological changes for coyotes and here we statistically determine the changes that occurred in coyotes, when these changes occurred, and what the ecological consequences were of these changes. We examined the mandibles of three coyote populations: Pleistocene Rancho La Brean (13-29 Ka), earliest Holocene Rancho La Brean (8-10 Ka), and Recent from North America, using 2D geometric morphometrics to determine the morphological differences among them. Our results show that these three populations were morphologically distinct. The Pleistocene coyotes had an overall robust mandible with an increased shearing arcade and a decreased grinding arcade, adapted for carnivory and killing larger prey; whereas the modern populations show a gracile morphology with a tendency toward omnivory or grinding. The earliest Holocene populations are intermediate in morphology and smallest in size. These findings indicate that a niche shift occurred in coyotes at the Pleistocene/Holocene boundary - from a hunter of large prey to a small prey/more omnivorous animal. Species interactions between Canis were the most likely cause of this transition. This study shows that the Pleistocene extinction event affected species that did not go extinct as well as those that did. PMID:25551387

  11. Microsporum canis infection in three familial cases with tinea capitis and tinea corporis.

    Science.gov (United States)

    Yin, Bin; Xiao, Yuling; Ran, Yuping; Kang, Daoxian; Dai, Yaling; Lama, Jebina

    2013-10-01

    We report a familial infection caused by Microsporum canis. The first two patients were a 30-year-old female and her son, a 5-year-old boy, who came in contact with a pet dog at a farm house. The boy then suffered from hair loss for 3 months. There were circular and patchy alopecia with diffuse scaling on his scalp. Meanwhile, his mother also developed patchy erythema and scaling on her face. Several weeks later, the boy's sister, a 4-year-old girl, was noted to have inconspicuous scaly plaques in the center of her scalp. The development of tinea capitis in the two children and tinea corporis in their mother were diagnosed based on the positive KOH examination. Morphologic characteristics and sequencing of the internal transcribed spacers 1 and 2, amplified from primary culture isolates, confirmed that their infections were caused by the zoophilic M. canis. Repetitive sequence-based molecular typing using the DiversiLab system secreted enzymatic activity analysis, and antifungal susceptibility indicated that these isolates might share the same source. The boy and girl were cured by the treatment with oral itraconazole and topical naftifine-ketoconazole cream after washing the hair with 2 % ketoconazole shampoo, and their mother was successfully treated by terbinafine orally in combination with topical application of naftifine-ketoconazole cream.

  12. Ecological changes in Coyotes (Canis latrans in response to the ice age megafaunal extinctions.

    Directory of Open Access Journals (Sweden)

    Julie A Meachen

    Full Text Available Coyotes (Canis latrans are an important species in human-inhabited areas. They control pests and are the apex predators in many ecosystems. Because of their importance it is imperative to understand how environmental change will affect this species. The end of the Pleistocene Ice Age brought with it many ecological changes for coyotes and here we statistically determine the changes that occurred in coyotes, when these changes occurred, and what the ecological consequences were of these changes. We examined the mandibles of three coyote populations: Pleistocene Rancho La Brean (13-29 Ka, earliest Holocene Rancho La Brean (8-10 Ka, and Recent from North America, using 2D geometric morphometrics to determine the morphological differences among them. Our results show that these three populations were morphologically distinct. The Pleistocene coyotes had an overall robust mandible with an increased shearing arcade and a decreased grinding arcade, adapted for carnivory and killing larger prey; whereas the modern populations show a gracile morphology with a tendency toward omnivory or grinding. The earliest Holocene populations are intermediate in morphology and smallest in size. These findings indicate that a niche shift occurred in coyotes at the Pleistocene/Holocene boundary - from a hunter of large prey to a small prey/more omnivorous animal. Species interactions between Canis were the most likely cause of this transition. This study shows that the Pleistocene extinction event affected species that did not go extinct as well as those that did.

  13. Microsporum canis infection in three familial cases with tinea capitis and tinea corporis.

    Science.gov (United States)

    Yin, Bin; Xiao, Yuling; Ran, Yuping; Kang, Daoxian; Dai, Yaling; Lama, Jebina

    2013-10-01

    We report a familial infection caused by Microsporum canis. The first two patients were a 30-year-old female and her son, a 5-year-old boy, who came in contact with a pet dog at a farm house. The boy then suffered from hair loss for 3 months. There were circular and patchy alopecia with diffuse scaling on his scalp. Meanwhile, his mother also developed patchy erythema and scaling on her face. Several weeks later, the boy's sister, a 4-year-old girl, was noted to have inconspicuous scaly plaques in the center of her scalp. The development of tinea capitis in the two children and tinea corporis in their mother were diagnosed based on the positive KOH examination. Morphologic characteristics and sequencing of the internal transcribed spacers 1 and 2, amplified from primary culture isolates, confirmed that their infections were caused by the zoophilic M. canis. Repetitive sequence-based molecular typing using the DiversiLab system secreted enzymatic activity analysis, and antifungal susceptibility indicated that these isolates might share the same source. The boy and girl were cured by the treatment with oral itraconazole and topical naftifine-ketoconazole cream after washing the hair with 2 % ketoconazole shampoo, and their mother was successfully treated by terbinafine orally in combination with topical application of naftifine-ketoconazole cream. PMID:23918090

  14. ANTHELMINTIC ACTIVITY OF LAPACHOL, β-LAPACHONE AND ITS DERIVATIVES AGAINST Toxocara canis LARVAE.

    Science.gov (United States)

    Mata-Santos, Taís; Pinto, Nitza França; Mata-Santos, Hilton Antônio; De Moura, Kelly Gallan; Carneiro, Paula Fernandes; Carvalho, Tatiane Dos Santos; Del Rio, Karina Pena; Pinto, Maria do Carmo Freire Ribeiro; Martins, Lourdes Rodrigues; Fenalti, Juliana Montelli; Da Silva, Pedro Eduardo Almeida; Scaini, Carlos James

    2015-01-01

    Anthelmintics used for intestinal helminthiasis treatment are generally effective; however, their effectiveness in tissue parasitosis (i.e. visceral toxocariasis) is moderate. The aim of this study was to evaluate the in vitro activity of lapachol, β-lapachone and phenazines in relation to the viability of Toxocara canis larvae. A concentration of 2 mg/mL (in duplicate) of the compounds was tested using microculture plates containing Toxocara canis larvae in an RPMI-1640 environment, incubated at 37 °C in 5% CO2 tension for 48 hours. In the 2 mg/mL concentration, four phenazines, lapachol and three of its derivatives presented a larvicide/larvistatic activity of 100%. Then, the minimum larvicide/larvistatic concentration (MLC) test was conducted. The compounds that presented the best results were nor-lapachol (MLC, 1 mg/mL), lapachol (MLC 0.5 mg/mL), β-lapachone, and β-C-allyl-lawsone (MLC, 0.25 mg/mL). The larvae exposed to the compounds, at best MLC with 100% in vitro activity larvicide, were inoculated into healthy BALB/c mice and were not capable of causing infection, confirming the larvicide potential in vitro of these compounds. PMID:26200958

  15. Dietary Supplements: What Is Safe?

    Science.gov (United States)

    ... articles window. My Saved Articles » My ACS » Dietary Supplements: What Is Safe? Download Printable Version [PDF] » Dietary supplements include things like vitamins, minerals, herbs, or products ...

  16. A line-profile analysis of the large-amplitude beta Cephei star xi1 Canis Majoris

    NARCIS (Netherlands)

    Saesen, S.; Briquet, M.; Aerts, C.C.

    2006-01-01

    We present a detailed line-profile study of the beta Cephei star xi1 Canis Majoris, for which we have assembled numerous high-resolution spectra over a period of 4.5 years. It is the first time that the line-profile variations of this star have been analysed. We focused on the Si III line profiles c

  17. Loop-mediated isothermal amplification assay for the detection of Ehrlichia canis DNA in blood samples from dogs

    Directory of Open Access Journals (Sweden)

    SA Faggion

    2013-01-01

    Full Text Available The rickettsial bacterium Ehrlichia canis is the etiological agent of canine monocytic ehrlichiosis, one of the most important canine tick-borne diseases in the world. In this study, a loop-mediated isothermal amplification (LAMP assay was developed for detection of E. canis DNA using LAMP primers targeting the groESL operon. Reactions were performed at 60°C for 60 min and the results were visualized by gel electrophoresis. Successful amplification was obtained using plasmid DNA containing a fragment of the groESL operon and DNA extracted from blood samples that tested positive for E. canis by real-time PCR. The specificity of amplification was confirmed by EcoRI restriction of internal sites in the LAMP primers and no cross-reactivity with blood samples positive for Babesia spp., another common tick-borne pathogen, was observed. The high cost of nucleic acid tests (NAT is one of the disadvantages for their large-scale use as routine diagnostic tests. The E. canis LAMP assay developed here is an interesting alternative to PCR since it does not require a thermocycler, thus reducing costs for the veterinary clinical laboratory.

  18. Kinetics and avidity of anti-Toxocara antibodies (IgG) in rabbits experimentally infected with Toxocara canis.

    Science.gov (United States)

    Bin, Lundia Luara Cavalcante; Santarém, Vamilton Alvares; Laposy, Cecília Braga; Rubinsky-Elefant, Guita; Roldán, William Henry; Giuffrida, Rogério

    2016-01-01

    An evaluation was made of the kinetics and avidity of anti-Toxocara antibodies (IgG) in rabbits experimentally infected with embryonated Toxocara canis eggs. Seventeen four month old New Zealand White rabbits were distributed into two groups. In the experimental group, twelve rabbits were infected orally with 1,000 embryonated T. canis eggs. A second group (n = 5), uninfected, was used as a control. Serum samples were collected for analysis on days 7, 14, 21, 28 and 60 post-infection (DPI). An indirect ELISA test was performed to evaluate the reactivity index (RI) of IgG anti-T. canis antibodies and to calculate the avidity index (AI). The animals showed seroconversion from the 14th DPI, with high AI (over 50%) except for one animal, which presented an intermediate AI. At 60 DPI, all the animals were seropositive and maintained a high AI. The data indicated that specific IgG antibodies formed early (14 DPI) in rabbits infected with T. canis, with a high avidity index that persisted throughout the course of the infection. PMID:27027550

  19. Evidence for eosinophil recruitment, leukotriene B4 production and mast cell hyperplasia following Toxocara canis infection in rats

    Directory of Open Access Journals (Sweden)

    D. Carlos

    2011-04-01

    Full Text Available It is well known that eosinophilia is a key pathogenetic component of toxocariasis. The objective of the present study was to determine if there is an association between peritoneal and blood eosinophil influx, mast cell hyperplasia and leukotriene B4 (LTB4 production after Toxocara canis infection. Oral inoculation of 56-day-old Wistar rats (N = 5-7 per group with 1000 embryonated eggs containing third-stage (L3 T. canis larvae led to a robust accumulation of total leukocytes in blood beginning on day 3 and peaking on day 18, mainly characterized by eosinophils and accompanied by higher serum LTB4 levels. At that time, we also noted increased eosinophil numbers in the peritoneal cavity. In addition, we observed increased peritoneal mast cell number in the peritoneal cavity, which correlated with the time course of eosinophilia during toxocariasis. We also demonstrated that mast cell hyperplasia in the intestines and lungs began soon after the T. canis larvae migrated to these compartments, reaching maximal levels on day 24, which correlated with the complete elimination of the parasite. Therefore, mast cells appear to be involved in peritoneal and blood eosinophil infiltration through an LTB4-dependent mechanism following T. canis infection in rats. Our data also demonstrate a tight association between larval migratory stages and intestinal and pulmonary mast cell hyperplasia in the toxocariasis model.

  20. Killing and caching of an adult White-tailed deer, Odocoileus virginianus, by a single Gray Wolf, Canis lupus

    Science.gov (United States)

    Nelson, Michael E.

    2011-01-01

    A single Gray Wolf (Canis lupus) killed an adult male White-tailed Deer (Odocoileus virginianus) and cached the intact carcass in 76 cm of snow. The carcass was revisited and entirely consumed between four and seven days later. This is the first recorded observation of a Gray Wolf caching an entire adult deer.

  1. Dietary fat and carcinogenesis

    NARCIS (Netherlands)

    Woutersen, R.A.; Appel, M.J.; Garderen-Hoetmer, A. van; Wijnands, M.V.W.

    1999-01-01

    Epidemiologic investigations have suggested a relationship between dietary fat intake and various types of cancer incidences. Furthermore, epidemiologic studies as well as studies with animal models have demonstrated that not only the amount but also the type of fat consumed is important. At present

  2. Determinants of dietary supplement use - healthy individuals use dietary supplements

    DEFF Research Database (Denmark)

    Kofoed, Christina L F; Christensen, Jane; Dragsted, Lars Ove;

    2015-01-01

    The prevalence of dietary supplement use varies largely among populations, and previous studies have indicated that it is high in the Danish population compared with other European countries. The diversity in supplement use across countries indicates that cultural and environmental factors could...... influence the use of dietary supplements. Only few studies investigating the use of dietary supplements have been conducted in the Danish population. The present cross-sectional study is based on 54 948 Danes, aged 50-64 years, who completed self-administrated questionnaires on diet, dietary supplements...... to the intake of dietary supplements. We found that 71 % of the participants were dietary supplement users; female sex, older age groups and higher educated participants were more likely to be users of any dietary supplements. One additional point in the health index was associated with 19, 16 and 9 % higher...

  3. Dietary supplements in sport.

    Science.gov (United States)

    Burke, L M; Read, R S

    1993-01-01

    Studies of the dietary practices of athletes report that nutritional supplements are commonly used. Supplementation practices vary between sports and individual athletes; however, there is evidence that at least some athletes use a large number of supplements concurrently, often in doses that are very high in comparison with normal dietary intakes. In exploring supplementation practices we propose a classification system separating the supplements into dietary supplements and nutritional erogogenic aids. The dietary supplement is characterised as a product which can be used to address physiological or nutritional issues arising in sport. It may provide a convenient or practical means of consuming special nutrient requirements for exercise, or it may be used to prevent/reverse nutritional deficiencies that commonly occur among athletes. The basis of the dietary supplement is an understanding of nutritional requirements and physiological effects of exercise. When the supplement is used to successfully meet a physiological/nutritional goal arising in sport it may be demonstrated to improve sports performance. While there is some interest in refining the composition or formulation of some dietary supplements, the real interest belongs to the use or application of the supplement; i.e. educating athletes to understand and achieve their nutritional needs in a specific sports situation. The sports drink (carbohydrate-electrolyte replacement drink) is a well known example of a dietary supplement. Scientific attitudes towards the sports drink have changed over the past 20 years. Initial caution that carbohydrate-electrolyte fluids compromise gastric emptying during exercise has now been shown to be unjustified. Numerous studies have shown that 5 to 10% solutions of glucose, glucose polymers (maltodextrins) and other simple sugars all have suitable gastric emptying characteristics for the delivery of fluid and moderate amounts of carbohydrate substrate. The optimal

  4. Factores asociados a la infección por Ehrlichia canis en perros infestados con garrapatas en la ciudad de Huánuco, Perú

    OpenAIRE

    Edward Huerto-Medina; Bernardo Dámaso-Mata

    2015-01-01

    El objetivo del estudio fue determinar la frecuencia y factores asociados a la infección por Ehrlichia canis en perros. Se recolectaron muestras de sangre de 150 perros infestados con garrapatas en 10 consultorios veterinarios de la ciudad de Huánuco en Perú, los perros fueron seleccionados al azar sin distinción de raza, edad ni sexo. Se detectó anticuerpos contra Ehrlichia canis mediante inmunoensayo cromatográfico. El 51,3% de perros estuvieron infectados por Ehrlichia canis. En el análisi...

  5. Seroprevalence of Ehrlichia canis in dogs referred to Veterinary Hospital of Shahid Chamran University of Ahvaz, Iran

    Directory of Open Access Journals (Sweden)

    Avizeh, R.

    2010-01-01

    Full Text Available Canine ehrlichiosis is a zoonotic rickettsial disease transmitted by ticks. In the present study, 198 companion dogs of different ages were examined for serum antibody detection against Ehrlichia canis by means of immunochromatography assay. The dogs were selected among referred cases to Veterinary Hospital of Shahid Chamran University of Ahvaz, Southwestern Iran from November 2008 to March 2010. The studied dogs were classified based on age, sex, breed, region and season. Nineteen of 198 serum samples (9.6% had antibody against E. canis. Prevalence was significantly higher in adult dogs more than 3 year-old (16.18% (P= 0.002 and 1 – 3 years (11.86% (P= 0.016 compared with young dogs less than 1 year-old (1.41%. Prevalence was higher in male dogs (10.62% than female dogs (8.24%, in the summer (11.32% and west region (11.11%. There were not significant differences between the prevalence of infection and host gender, season and region (P>0.05. Typical morulae of E. canis were observed in monocytes of four infected dogs (2.02%. Five out of 24 (20.83% of the thrombocytopenic dogs and 14 out of 174 (8.05% of the non-thrombocytopenic dogs were positive for ehrlichiosis. Of 19 seropositive dogs, six (31.58% had anemia, four (21.05% hypoalbuminemia and five (26.32% leukopenia. There were not statistically significant differences between hematological findings and prevalence of infection (P> 0.05. This is the first report indicating the presence of E. canis in companion dogs of Ahvaz district. However, the sources of infection in these dogs were not clear. Finally, the role of companion dogs in the epizootiology of E. canis infection needs to be further explored.

  6. Spatial genetic and morphologic structure of wolves and coyotes in relation to environmental heterogeneity in a Canis hybrid zone.

    Science.gov (United States)

    Benson, John F; Patterson, Brent R; Wheeldon, Tyler J

    2012-12-01

    Eastern wolves have hybridized extensively with coyotes and gray wolves and are listed as a 'species of special concern' in Canada. However, a distinct population of eastern wolves has been identified in Algonquin Provincial Park (APP) in Ontario. Previous studies of the diverse Canis hybrid zone adjacent to APP have not linked genetic analysis with field data to investigate genotype-specific morphology or determine how resident animals of different ancestry are distributed across the landscape in relation to heterogeneous environmental conditions. Accordingly, we studied resident wolves and coyotes in and adjacent to APP to identify distinct Canis types, clarify the extent of the APP eastern wolf population beyond the park boundaries and investigate fine-scale spatial genetic structure and landscape-genotype associations in the hybrid zone. We documented three genetically distinct Canis types within the APP region that also differed morphologically, corresponding to putative gray wolves, eastern wolves and coyotes. We also documented a substantial number of hybrid individuals (36%) that were admixed between 2 or 3 of the Canis types. Breeding eastern wolves were less common outside of APP, but occurred in some unprotected areas where they were sympatric with a diverse combination of coyotes, gray wolves and hybrids. We found significant spatial genetic structure and identified a steep cline extending west from APP where the dominant genotype shifted abruptly from eastern wolves to coyotes and hybrids. The genotypic pattern to the south and northwest was a more complex mosaic of alternating genotypes. We modelled genetic ancestry in response to prey availability and human disturbance and found that individuals with greater wolf ancestry occupied areas of higher moose density and fewer roads. Our results clarify the structure of the Canis hybrid zone adjacent to APP and provide unique insight into environmental conditions influencing hybridization dynamics between

  7. A Molecular survey of Anaplasma spp., Rickettsia spp., Ehrlichia canis and Babesia microti in foxes and fleas from Sicily.

    Science.gov (United States)

    Torina, A; Blanda, V; Antoci, F; Scimeca, S; D'Agostino, R; Scariano, E; Piazza, A; Galluzzo, P; Giudice, E; Caracappa, S

    2013-11-01

    Fleas (Insecta: Siphonaptera) are obligate bloodsucking insects, which parasitize birds and mammals, and are distributed throughout the world. Several species have been implicated in pathogen transmission. This study aimed to monitor red foxes and the fleas isolated from them in the Palermo and Ragusa provinces of Sicily, Italy, as these organisms are potential reservoirs and vectors of pathogens. Thirteen foxes (Vulpes vulpes) and 110 fleas were analysed by polymerase chain reaction (PCR) to detect DNA of the pathogens Ehrlichia canis, Babesia microti, Rickettsia spp., Anaplasma phagocytophilum, Anaplasma platys, Anaplasma marginale and Anaplasma ovis. In the foxes, A. ovis was detected in only one animal, whereas the prevalence of the E. canis pathogen was 31%. B. microti and Rickettsia spp. were not detected. Of all of the collected fleas, 75 belonged to the species Xenopsylla cheopis, 32 belonged to Ctenocephalides canis, two belonged to Ctenocephalides felis and one belonged to Cediopsylla inaequalis. In the fleas, the following pathogens were found: A. ovis (prevalence 25%), A. marginale (1%), A. phagocytophilum (1%), Rickettsia felis (2%) and E. canis (3%). X. cheopis was the flea species most frequently infected with Anaplasma, in particular A. ovis (33%), A. marginale (1%) and A. phagocytophilum (1%). Both C. felis exemplars were positive for R. felis. E. canis was found in the lone C. inaequalis and also in 3% of the X. cheopis specimens. No fleas were positive for B. microti or A. platys. As foxes often live in proximity to domestic areas, they may constitute potential reservoirs for human and animal parasites. Further studies should be performed on fleas to determine their vectorial capacity.

  8. Dietary Acculturation among Filipino Americans

    Directory of Open Access Journals (Sweden)

    Persephone Vargas

    2015-12-01

    Full Text Available Acculturation, the subsequent changes that occur in one culture after continuous first hand contact with another culture, impacts the dietary habits and health risks of individuals. This study examines the acculturation, dietary habits and anthropometric measurements in a sample of 210 first generation Filipino American immigrants in New Jersey (NJ. Acculturation was measured using the Short Acculturation Scale for Filipino Americans (ASASFA. Dietary acculturation was measured using the Dietary Acculturation Questionnaire for Filipino Americans (DAQFA and dietary intake was determined using the Block’s Brief Food Frequency Questionnaire (BFFQ. Anthropometric measurements were obtained including weight, height and waist circumference. Acculturation had a significant negative relationship with Filipino Dietary acculturation. Western dietary acculturation was significantly correlated with caloric intake (r(208 = 0.193, p < 0.01, percentage fat intake (r(208 = 0.154, p < 0.05, percentage carbohydrate intake (r(208 = −0.172, p < 0.05, Body Mass Index (BMI (r(208 = 0.216, p < 0.01 and waist circumference (r(208 = 0.161, p < 0.01. There was no significant correlation between Filipino dietary acculturation, dietary intake and anthropometric measurements. The results showed that Filipino American immigrants have increased risks including increased BMI, waist circumference and increased fat intake. Over all, this research highlighted some dietary changes and their effects on dietary intake and health status.

  9. Prevalencia de Toxocara canis y otros parásitos gastrointestinales en caninos ambulantes de Sogamoso

    Directory of Open Access Journals (Sweden)

    Erika Sarmiento-Medina

    2011-02-01

    Full Text Available Durante los últimos años ha crecido la población de  caninos,  especialmente  los  ambulantes,  los cuales  son portadores de una  gran  variedad de parásitos gastrointestinales zoonóticos, destacándose la presencia de helmintos como la Toxocara canis. Este parásito, cuando  infesta al hombre, puede producir una afección por localización errática denominada “larva migrans”, por ser huésped  inespecífico. Esta enfermedad es particularmente importante en niños, ancianos y en personas  inmuno-deprimidas; se adquiere por la ingesta de huevos viables de Toxocara spp. (Grodsinky, 2003. Así, el objetivo de este estudio  fue hacer una prevalencia para determinar la presencia de T canis y otros helmintos parásitos en el tracto digestivo de perros ambulantes, en la ciudad de Sogamoso, de los cuales, aleatoriamente en  los cinco puntos cardinales y teniendo en cuenta la edad y el sexo de los caninos se colectaron 150 muestras por toma de pellizco en las heces, a las cuales se les reali-zó  la  técnica de concentración de Richi-Frick, que se escogió por  su  especificidad para huevos de Toxocara spp. Los resultados arrojaron  los siguientes resultados: el 67,3% (101 de las muestras se encontraron contaminadas con al menos un tipo de entidad parasitaria;  la presencia de Toxocara canis como entidad sola o en infestación combi- nada  fue del 52,6%  (79. En cuanto la edad, en caninos de menos de uno año fue de 56,9 % y en adultos  jóvenes fue del 37,9%; respecto del sexo, las hembras  obtuvieron  el  25,3%, mientras  los machos el 74,7%. De acuerdo con los resultados obtenidos, con el  fin de evitar la transmisión de parasitosis zoonóticas es necesario fomentar campañas de desparasitación y manejo adecuado delas heces de los caninos.

  10. Wolf, Canis lupus, visits towhite-tailed deer, Odocoileus virginianus, summer ranges: Optimal foraging?

    Science.gov (United States)

    Demma, D.J.; Mech, L.D.

    2009-01-01

    We tested whether Wolf (Canis lupus) visits to individual female White-tailed Deer (Odocoileus virginianus) summer ranges during 2003 and 2004 in northeastern Minnesota were in accord with optimal-foraging theory. Using GPS collars with 10- to 30-minute location attempts on four Wolves and five female deer, plus eleven VHF-collared female deer in the Wolves' territory, provided new insights into the frequency of Wolf visits to summer ranges of female deer. Wolves made a mean 0.055 visits/day to summer ranges of deer three years and older, significantly more than their 0.032 mean visits/day to ranges of two-year-old deer, which generally produce fewer fawns, and most Wolf visits to ranges of older deer were much longer than those to ranges of younger deer. Because fawns comprise the major part of the Wolf's summer diet, this Wolf behavior accords with optimal-foraging theory.

  11. [Leishmania infantum MON-1 isolated from a golden jackal (Canis aureus) in Grande Kabylie (Algeria)].

    Science.gov (United States)

    Bessad, A; Mouloua, K; Kherrachi, I; Benbetka, S; Benikhlef, R; Mezai, G; Harrat, Z

    2012-02-01

    In the north of Algeria, Leishmania infantum is responsible for two clinical forms of leishmaniasis: visceral and cutaneous leishmaniasis, for which dogs are the only proven reservoir host. In this study, the authors report, for the first time, the isolation of L. infantum from a golden jackal (Canis aureus) trapped in the Illoulen ou Malou region (Grande Kabylie). Two isolates were thus obtained from bone marrow and spleen and were identified by starch gel isoenzyme electrophoresis as L. infantum MON-1, the widespread zymodeme in the north of the country. Leishmania parasites have also been detected by polymerase chain reaction (PCR) in the biopsy of the spleen. The golden jackal, a prevalent wild canid in Northern Africa, could play a predominant role in the sylvatic foci of leishmaniasis and in the dissemination of the parasite in this region. PMID:21874583

  12. Morphology of the lingual papillae of the black-backed jackal (Canis mesomelas).

    Science.gov (United States)

    Emura, Shoichi; Sugiyama, Kazue

    2014-01-01

    We examined the dorsal lingual surface of an adult black-backed jackal (Canis mesomelas) by using scanning electron microscopy. The filiform papilla on the lingual apex exhibited a crown-like shape with several pointed processes. The connective tissue core of the filiform papilla was U-shaped. The filiform papillae on the lingual body had several pointed processes. The connective tissue core of the filiform papillae consisted of one large and several small conical papillae. The fungiform papillae on the lingual apex and body had a smooth surface. The connective tissue core of the fungiform papillae was not hollow and did not have processes. The vallate papillae were surrounded by a groove and pad with many processes on the surface. The connective tissue core of the vallate papillae had many ditches. Thus, the tongue of the black-backed jackal more closely resembles that of the bush dog than those of the raccoon dog or fox. PMID:25274405

  13. Echinococcus multilocularis and Trichinella spiralis in golden jackals (Canis aureus) of Hungary.

    Science.gov (United States)

    Széll, Z; Marucci, G; Pozio, E; Sréter, T

    2013-10-18

    Over the last decades the distribution area of the golden jackal (Canis aureus) has increased significantly in Europe, particularly in the Balkan Peninsula and in Central Europe. Vagrant individuals were described in many European countries. Herein, we report Echinococcus multilocularis (total worm count: 412) and Trichinella spiralis (101 larvae/g for muscles of the lower forelimb) infections in two golden jackals shot in Hungary. It is a new host record of E. multilocularis and T. spiralis in Europe and Hungary, respectively. As jackals migrate for long distances through natural ecological corridors (e.g., river valleys), they may play a significant role in the long distance spread of zoonotic parasites into non-endemic areas of Europe. Therefore, monitoring zoonotic parasites in this host species can be recommended in the European Union. PMID:23688637

  14. Zoonotic enteric parasites transmitted from dogs in Egypt with special concern to Toxocara canis infection

    Science.gov (United States)

    Awadallah, Maysa A. I.; Salem, Lobna M. A.

    2015-01-01

    Aim: This work aimed to study the role played by dogs in transmitting zoonotic enteric parasites to humans in Egypt and to analyze the risk factors associated with the occurrence of such infection in dogs. Serodiagnosis of anti-Toxocara immunoglobulin G (IgG) antibodies among human beings as well as analyzing risk factors predispose to Toxocara canis infection in human beings are another objectives of this study. Materials and Methods: From June to December 2013, a total of 130 fecal samples from 4 dog populations (Military, nomadic and domiciled dogs from rural and high standard districts) and 150 stool samples of 6 occupational groups were examined for the presence of enteric parasitic infection. Moreover, 150 serum samples were collected from humans from whom stool samples were collected and examined for the presence of anti-T. canis antibodies. Results: Enteric parasites were detected in 30% of fecal samples from 4 dog populations in Egypt. High infectivity had been reported in nomadic dogs (63.33%) (Crude odds ratios [COR]=67.36, 95% confidence interval [CI]=8.09-560.8, pParagonimus spp. (0.77%, each). Univariate logestic regression revealed significant association of age (COR=4.73, 95% CI=2.13-10.53, p0.05) did not seem to have a significant association among the examined dogs. Enteric parasitic infection was reported in 31/150 human stools (20.67%). Students were the most affected groups (37.14%), followed by nomadic people (24%), house wives (20%), house guarders and military workers (12%, each), and employees (10%). The identified parasites were Cryptosporidium spp. (9.33%), Ascaris lumbercoides (3.33%), Heterophyes spp. and Ancylostoma spp. (2.66%, each) and Paragonimus spp. and Hymenolepis nana (1.33%, each). Toxocara IgG antibodies were detected in 36/150 (24%) serum samples investigated. Toxocara IgG antibodies were more prevalent in males (26.66%) than females (20%). Seroprevalence was highest (17/35, 48.57%) in 7-15 years old (COR=6.93, 95% CI=1

  15. Serologic survey for cross-species pathogens in urban coyotes (Canis latrans), Colorado, USA.

    Science.gov (United States)

    Malmlov, Ashley; Breck, Stewart; Fry, Tricia; Duncan, Colleen

    2014-10-01

    Abstract As coyotes (Canis latrans) adapt to living in urban environments, the opportunity for cross-species transmission of pathogens may increase. We investigated the prevalence of antibodies to pathogens that are either zoonotic or affect multiple animal species in urban coyotes in the Denver metropolitan area, Colorado, USA, in 2012. We assayed for antibodies to canine parvovirus-2, canine distemper virus, rabies virus, Toxoplasma gondii, Yersinia pestis, and serotypes of Leptospira interrogans. Overall, 84% of the animals had antibodies to canine parvovirus-2, 44% for canine distemper virus, 20% for T. gondii (IgG), 28% for Y. pestis, and 4% for L. interrogans serotype Grippotyphosa. No neutralizing antibodies were detected to rabies virus, T. gondii (IgM), or L. interrogans serotypes other than Grippotyphosa. With 88% of animals exposed to at least one pathogen, our results suggest that coyotes may serve as important reservoirs and sentinels for etiologic agents. PMID:25121408

  16. Yellowstone wolf (Canis lupus) denisty predicted by elk (Cervus elaphus) biomass

    Science.gov (United States)

    Mech, L. David; Barber-Meyer, Shannon

    2015-01-01

    The Northern Range (NR) of Yellowstone National Park (YNP) hosts a higher prey biomass density in the form of elk (Cervus elaphus L., 1758) than any other system of gray wolves (Canis lupus L., 1758) and prey reported. Therefore, it is important to determine whether that wolf–prey system fits a long-standing model relating wolf density to prey biomass. Using data from 2005 to 2012 after elk population fluctuations dampened 10 years subsequent to wolf reintroduction, we found that NR prey biomass predicted wolf density. This finding and the trajectory of the regression extend the validity of the model to prey densities 19% higher than previous data and suggest that the model would apply to wolf–prey systems of even higher prey biomass.

  17. Gray Wolf (Canis lupus) dyad monthly association rates by demographic group.

    Science.gov (United States)

    Barber-Meyer, Shannon M.; Mech, L. David

    2015-01-01

    Preliminary data from GPS-collared wolves (Canis lupus) in the Superior National Forest of northeastern Minnesota indicated wolves had low association rates with packmates during summer. However, aerial-telemetry locations of very high frequency (VHF)-radioed wolves in this same area showed high associations among packmates during winter. We analyzed aerial-telemetry-location data from VHF-collared wolves in several packs (n=18 dyads) in this same area from 1994-2012 by month, and found lowest association rates occurred during June. While other studies have found low association among wolf packmates during summer, information on differences in association patterns depending on the wolf associates’ demographics is sparse. During May-July, association rates were greatest for breeding pairs, followed by sibling dyads, and lowest for parent– offspring dyads. Our findings improve our understanding of how individual wolf relationships affect monthly association rates. We highlight some important remaining questions regarding wolf packmate associations.

  18. Characteristics, immunological events, and diagnostics of Babesia spp. infection, with emphasis on Babesia canis

    Directory of Open Access Journals (Sweden)

    Kostro Krzysztof

    2015-12-01

    Full Text Available Vector-borne infection constitutes a significant health issue in dogs worldwide. Recent reports point to an increasing number of canine vector-borne disease cases in European countries, including Poland. Canine babesiosis caused by various Babesia species is a protozoal tick-borne disease with worldwide distribution and significant veterinary importance. The development and application of molecular methods have increased our knowledge about canine babesiosis, its prevalence, and clinical and pathological aspects of the infection. Parasitologists and veterinary surgeons need an accurate description of the species responsible for canine babesiosis to improve diagnostic and therapeutic methods, as well as predictions for the course of the disease. Therefore, we decided to summarise recent knowledge concerning Babesia species and B. canis.

  19. Playing at bullying: The postmodern ethic of Bully (Canis Canem Edit

    Directory of Open Access Journals (Sweden)

    Clare Bradford

    2009-05-01

    Full Text Available This essay discusses Bully (Canis Canem Edit, considering the game’s antecedents (narratives involving young people in school settings and the features which set it apart from other teen texts. It discusses the controversy surrounding the game and comes to the conclusion that the principal reason for unease on the part of parents and educational authorities is that Bully’s postmodernist ethic evades the binaries of liberal humanism and calls into question the foundations on which conventional ethical systems are based. The paper considers several episodes from the game to flesh out its arguments about how the game manifests features of postmodernist textuality in its propensity for simultaneously deploying and interrogating references to historical and contemporary cultural practices.

  20. No Excess of RR Lyrae Stars in the Canis Major Overdensity

    CERN Document Server

    Mateu, Cecilia; Zinn, Robert; Miller, Lissa; Abad, Carlos

    2009-01-01

    Our multi-epoch survey of ~20 sq. deg. of the Canis Major overdensity has detected only 10 RR Lyrae stars (RRLS). We show that this number is consistent with the number expected from the Galactic halo and thick disk populations alone, leaving no excess that can be attributed to the dwarf spheroidal (dSph) galaxy that some authors have proposed as the origin of the CMa overdensity. If this galaxy resembles the dSph satellites of the Milky Way and of M31 and has the putative Mv~-14.5, our survey should have detected several tens of RRLS. Even if Mv10, which is not observed. Either the old stellar population of this galaxy has unique properties or, as others have argued before, the CMa overdensity is produced by the thin and thick disk and spiral arm populations of the Milky Way and not by a collision with a dSph satellite galaxy.

  1. The Canis Major dwarf galaxy as the progenitor of the Monoceros tidal stream

    CERN Document Server

    Martínez-Delgado, D; Dinescu, D I; Butler, D J; Rix, H W; Martinez-Delgado, David; Penarrubia, Jorge

    2005-01-01

    The Sloan Digital Sky Survey has recently discovered a coherent ring of stars at low galactic latitude that is believed to be the tidal stream of a merging dwarf galaxy in the Galactic plane (named the Monoceros tidal stream). The existence and location of the core of its progenitor galaxy is still controversial. The best candidate is the Canis Major dwarf galaxy, a distinct overdensity of red stars discovered in the 2MASS survey, but also interpreted as the signature of the Galactic warp viewed in projection. In this paper, we report a variety of new observational evidence that supports the notion that CMa is the remnant of a partially disrupted core of a dwarf satellite. The comparison of the orbit derived from our theoretical model for the parent galaxy of this ring-like structure with an accurate determination of CMa orbit leads to the conclusion that this satellite is the best candidate for the progenitor of the Monoceros tidal stream.

  2. Mercury in gray wolves (Canis lupus) in Alaska: Increased exposure through consumption of marine prey

    Science.gov (United States)

    McGrew, Ashley K.; Ballweber, Lora R.; Moses, Sara K.; Stricker, Craig A.; Beckmen, Kimberlee B.; Salman, Mo D.; O’Hara, Todd M.

    2013-01-01

    Mercury (Hg) bioaccumulates in the tissues of organismsand biomagnifies within food-webs. Graywolves (Canis lupus) in Alaska primarily acquire Hg through diet; therefore, comparing the extent of Hg exposure inwolves, in conjunction with stable isotopes, from interior and coastal regions of Alaska offers important insight into their feeding ecology. Liver, kidney, and skeletal muscle samples from 162 graywolves were analyzed for total mercury (THg) concentrations and stable isotopic signatures (δ13C, δ15N, and δ34S).Median hepatic THg concentrations were significantly higher in wolves with coastal access compared to wolves from interior Alaska. Stable isotope ratios, in conjunction with THg concentrations, provide strong evidence that coastal wolves are utilizing marine prey representing several trophic levels. The utilization of cross-ecosystem food resources by coastal wolves is clearly contributing to increased THg exposure, and may ultimately have negative health implications for these animals.

  3. Dietary Macronutrients and Sleep.

    Science.gov (United States)

    Lindseth, Glenda; Murray, Ashley

    2016-08-01

    This study examined the effects of macronutrient diets on sleep quantity and quality. Using a repeated-measures, randomized crossover study design, 36 young adults served as their own control, and consumed high protein, carbohydrate, fat, and control diets. Treatment orders were counterbalanced across the dietary groups. Following consumption of the study diets, sleep measures were examined for within-subject differences. Fatty acid intakes and serum lipids were further analyzed for differences. Sleep actigraphs indicated wake times and wake minutes (after sleep onset) were significantly different when comparing consumption of macronutrient diets and a control diet. Post hoc testing indicated high carbohydrate intakes were associated with significantly shorter (p Sleep Quality Index© post hoc results indicated high fat intake was associated with significantly better (p sleep in comparison with the other diets. These results highlight the effects that dietary manipulations may have on sleep. PMID:27170039

  4. Ehrlichia canis and Anaplasma platys in ticks of dogs in Cuiaba, Mato GrossoEhrlichia canis e Anaplasma platys em carrapatos de cães de Cuiabá, Mato Grosso

    Directory of Open Access Journals (Sweden)

    Valéria Dutra

    2012-06-01

    Full Text Available Diseases transmitted by arthropods such as Rhipicephalus sanguineus, are caused by a spectrum of pathogens. Among these are the canine monocytic ehrlichiosis and cyclical thrombocytopenia with a cosmopolitan distribution. Aiming to verify the presence of DNA of Anaplasma platys and Ehrlichia canis in ticks R. sanguineus collected in the period 2008 to 2009 of 380 infected dogs. Ticks, after maceration, were subjected to DNA extraction and then nested PCR was performed for amplification of A. platys and E. canis. Of these, 81 (29.7% amplified DNA from ehrlichiais agents, where 38 (17.9% amplified in E. canis and 32 (15.7% for A. platys. The observation of two pathogens, combined with worldwide distribution of the tick R. sanguineus, demonstrates the high risk of infection with these pathogens in dogs in the city of Cuiaba. Doenças transmitidas por artrópodes, como o Rhipicephalus sanguineus, são causadas por um espectro de patógenos. Dentre estas, estão a erliquiose monocítica canina e trombocitopenia cíclica com distribuição cosmopolita. Com o objetivo de verificar a presença de DNA de Anaplasma platys e Ehrlichia canis em carrapatos R. sanguineus coletados no período de 2008 a 2009 de 380 cães infestados. Os carrapatos, após a maceração, foram submetidos a extração de DNA e, em seguida, foi realizada a Nested PCR para a amplificação da espécie A. platys e E. canis. Destes, 81 (29.7% amplificaram o DNA dos agentes ehrlichiais, onde 38 (17.9% amplificaram para E. canis e 32 (15.7% para A. platys. A observação dos dois patógenos, combinado com distribuição mundial do carrapato R. sanguineus, demonstra o elevado risco de infecção por esses patógenos de cães na cidade de Cuiabá.

  5. Detection of Ehrlichia canis in bone marrow aspirates of experimentally infected dogs Detecção de Ehrlichia canis em aspirados de medula óssea de cães experimentalmente infectados

    Directory of Open Access Journals (Sweden)

    Simone Magela Moreira

    2005-08-01

    Full Text Available The present work describes the detection of infected cells in the bone marrow aspirates of dogs experimentally infected with a Brazilian isolate of Ehrlichia canis. Dogs were monitored twice a day by clinical evaluation and peripheral blood smear examination. Every three days, blood samples were collected for cell counts. Weekly, aspirates from the bone marrow were examined and serum samples were tested by IFAT. The clinical signs observed were fever, pallid membranes, lymphadenopathy, serous nasal secretions, and pronounced weight loss. Hematological alterations included normocytic normochromic anemia, decrease of neutrophils and lymphocytes, and thrombocytopenia. Few E. canis infected cells were seen in blood smears. However, stages of E. canis were visualized in bone marrow aspirates 15 days post infection.O presente trabalho descreve a detecção de células infectadas em aspirados de medula óssea de cães experimentalmente infectados com uma amostra brasileira de Ehrlichia canis. Os cães foram monitorados duas vezes por dia através de avaliação clínica e exames de esfregaços de sangue periférico. A cada três dias, amostras de sangue foram coletadas para contagem celular. Semanalmente foram feitas punções de medula óssea para exame microscópico direto do material aspirado e coleta de sangue para exames sorológicos através da reação de imunofluorescência indireta. Os sinais clínicos observados foram febre, membranas pálidas, linfadenopatias, secreções nasais serosas e acentuada perda de peso. As alterações hematológicas incluíram anemia normocítica normocrômica, redução de neutrófilos e linfócitos e trombocitopenia. Poucas células infectadas com E. canis foram observadas em esfregaços sanguíneos, entretanto várias formas de desenvolvimento de E. canis foram visualizadas em aspirados de medula óssea 15 dias após a infecção.

  6. Hybridization among three native North American Canis species in a region of natural sympatry.

    Directory of Open Access Journals (Sweden)

    Frank Hailer

    Full Text Available BACKGROUND: Population densities of many species throughout the world are changing due to direct persecution as well as anthropogenic habitat modification. These changes may induce or increase the frequency of hybridization among taxa. If extensive, hybridization can threaten the genetic integrity or survival of endangered species. Three native species of the genus Canis, coyote (C. latrans, Mexican wolf (C. lupus baileyi and red wolf (C. rufus, were historically sympatric in Texas, United States. Human impacts caused the latter two to go extinct in the wild, although they survived in captive breeding programs. Morphological data demonstrate historic reproductive isolation between all three taxa. While the red wolf population was impacted by introgressive hybridization with coyotes as it went extinct in the wild, the impact of hybridization on the Texas populations of the other species is not clear. METHODOLOGY/ PRINCIPAL FINDINGS: We surveyed variation at maternally and paternally inherited genetic markers (mitochondrial control region sequence and Y chromosome microsatellites in coyotes from Texas, Mexican wolves and red wolves from the captive breeding programs, and a reference population of coyotes from outside the historic red wolf range. Levels of variation and phylogenetic analyses suggest that hybridization has occasionally taken place between all three species, but that the impact on the coyote population is very small. CONCLUSION/SIGNIFICANCE: Our results demonstrate that the factors driving introgressive hybridization in sympatric Texan Canis are multiple and complex. Hybridization is not solely determined by body size or sex, and density-dependent effects do not fully explain the observed pattern either. No evidence of hybridization was identified in the Mexican wolf captive breeding program, but introgression appears to have had a greater impact on the captive red wolves.

  7. EFFICACY OF NITAZOXANIDE AGAINST Toxocara canis: LARVAL RECOVERY AND HUMORAL IMMUNE RESPONSE IN EXPERIMENTALLY INFECTED MICE.

    Science.gov (United States)

    Lescano, Susana A Zevallos; Santos, Sergio Vieira dos; Assis, Jesiel Maurício Lemos; Chieffi, Pedro Paulo

    2015-01-01

    The efficacy of nitazoxanide (NTZ) against toxocariasis was investigated in an experimental murine model and results were compared to those obtained using mebendazole. Sixty male BALB/c mice, aged six to eight weeks-old, were divided into groups of 10 each; fifty were orally infected with 300 larvaed eggs of T. canis and grouped as follows, G I: infected untreated mice; G II: infected mice treated with MBZ (15 mg/kg/day) 10 days postinfection (dpi); G III: infected mice treated with NTZ (20 mg/kg/day) 10 dpi; G IV: infected mice treated with MBZ 60 dpi; G V: infected mice treated with NTZ 60 dpi; GVI: control group comprising uninfected mice. Mice were bled via retro-orbital plexus on four occasions between 30 and 120 dpi. Sera were processed using the ELISA technique to detect IgG anti- Toxocara antibodies. At 120 dpi, mice were sacrificed for larval recovery in the CNS, liver, lungs, kidneys, eyes and carcass. Results showed similar levels of anti- Toxocara IgG antibodies among mice infected but not submitted to treatment and groups treated with MBZ or NTZ, 10 and 60 dpi. Larval recovery showed similar values in groups treated with NTZ and MBZ 10 dpi. MBZ showed better efficacy 60 dpi, with a 72.6% reduction in the parasite load compared with NTZ, which showed only 46.5% reduction. We conclude that administration of these anthelmintics did not modify the humoral response in experimental infection by T. canis. No parasitological cure was observed with either drug; however, a greater reduction in parasite load was achieved following treatment with MBZ. PMID:26422159

  8. Dietary Teatment of Galactosemia

    OpenAIRE

    H. Ehsani; M Kabiri

    1986-01-01

    For the time being, dietary treatment is the only available therapy for Galactosemia. This article indicates, with regard to the daily requirements of normal infants and children for protein, carbohydrates, fat, minerals and vitamins, the possibilities of preparing appropriate diets for Galactosemic patients. Few instructions for preparing lactose and galactose free infant foods using MBF formula have been given. A list of foods not allowed for Galactosemic patients is also presented.

  9. Carbohydrates and dietary fiber.

    Science.gov (United States)

    Suter, P M

    2005-01-01

    The most widely spread eating habit is characterized by a reduced intake of dietary fiber, an increased intake of simple sugars, a high intake of refined grain products, an altered fat composition of the diet, and a dietary pattern characterized by a high glycemic load, an increased body weight and reduced physical activity. In this chapter the effects of this eating pattern on disease risk will be outlined. There are no epidemiological studies showing that the increase of glucose, fructose or sucrose intake is directly and independently associated with an increased risk of atherosclerosis or coronary heart disease (CHD). On the other hand a large number of studies has reported a reduction of fatal and non-fatal CHD events as a function of the intake of complex carbohydrates--respectively 'dietary fiber' or selected fiber-rich food (e.g., whole grain cereals). It seems that eating too much 'fast' carbohydrate [i.e., carbohydrates with a high glycemic index (GI)] may have deleterious long-term consequences. Indeed the last decades have shown that a low fat (and consecutively high carbohydrate) diet alone is not the best strategy to combat modern diseases including atherosclerosis. Quantity and quality issues in carbohydrate nutrient content are as important as they are for fat. Multiple lines of evidence suggest that for cardiovascular disease prevention a high sugar intake should be avoided. There is growing evidence of the high impact of dietary fiber and foods with a low GI on single risk factors (e.g., lipid pattern, diabetes, inflammation, endothelial function etc.) as well as also the development of the endpoints of atherosclerosis especially CHD. PMID:16596802

  10. Dietary Therapies for Epilepsy

    OpenAIRE

    Kossoff, Eric H.; Huei-Shyong Wang

    2013-01-01

    Since their introduction in 1921, high-fat, low-carbohydrate "ketogenic" diets have been used worldwide for refractory childhood epilepsy. Approximately half of the children have at least half their seizures reduced, including 15% who are seizure free. The mechanisms of action of dietary therapies are under active investigation and appear to involve mitochondria. Once perceived as a last resort, modifications to initiation and maintenance, as well as the widespread use of pre-made ketogenic f...

  11. Dietary Acculturation among Filipino Americans.

    Science.gov (United States)

    Vargas, Persephone; Jurado, Leo-Felix

    2015-12-22

    Acculturation, the subsequent changes that occur in one culture after continuous first hand contact with another culture, impacts the dietary habits and health risks of individuals. This study examines the acculturation, dietary habits and anthropometric measurements in a sample of 210 first generation Filipino American immigrants in New Jersey (NJ). Acculturation was measured using the Short Acculturation Scale for Filipino Americans (ASASFA). Dietary acculturation was measured using the Dietary Acculturation Questionnaire for Filipino Americans (DAQFA) and dietary intake was determined using the Block's Brief Food Frequency Questionnaire (BFFQ). Anthropometric measurements were obtained including weight, height and waist circumference. Acculturation had a significant negative relationship with Filipino Dietary acculturation. Western dietary acculturation was significantly correlated with caloric intake (r(208) = 0.193, p acculturation, dietary intake and anthropometric measurements. The results showed that Filipino American immigrants have increased risks including increased BMI, waist circumference and increased fat intake. Over all, this research highlighted some dietary changes and their effects on dietary intake and health status.

  12. Dietary treatments of obesity.

    Science.gov (United States)

    Bennett, W

    1987-01-01

    Dietary treatment of obesity is based on one or another of two premises: that the obese eat too much or that they eat the wrong things. The first is a tautology lacking explanatory power. The second is a meaningful and promising hypothesis but has yet to be effectively applied. At present, virtually all outpatient treatments of obesity, including behavior modification, are based on the first premise and consist of strategies for reducing the subject's caloric intake. Most such interventions produce short-term weight loss. Regain after the end of treatment remains the usual outcome. A survey of studies published in the period 1977-1986 and reporting on dietary or behavioral treatment of obesity reveals that the maximum percentage of body weight lost is, on average, 8.5 percent--no different from the value, 8.9%, in similar studies from 1966-1976, as reviewed by Wing and Jeffery. The principal determinant of success in such programs appears to be the intake weight of the subjects: the higher the intake weight, the more successful the intervention will appear to be. The goals and research methods of studies on dietary treatments for obesity are overdue for ethical as well as scientific reevaluation. The same may be said for the numerous programs providing such treatment outside the context of research.

  13. Zoonotic enteric parasites transmitted from dogs in Egypt with special concern to Toxocara canis infection

    Directory of Open Access Journals (Sweden)

    Maysa A. I. Awadallah

    2015-08-01

    Full Text Available Aim: This work aimed to study the role played by dogs in transmitting zoonotic enteric parasites to humans in Egypt and to analyze the risk factors associated with the occurrence of such infection in dogs. Serodiagnosis of anti-Toxocara immunoglobulin G (IgG antibodies among human beings as well as analyzing risk factors predispose to Toxocara canis infection in human beings are another objectives of this study. Materials and Methods: From June to December 2013, a total of 130 fecal samples from 4 dog populations (Military, nomadic and domiciled dogs from rural and high standard districts and 150 stool samples of 6 occupational groups were examined for the presence of enteric parasitic infection. Moreover, 150 serum samples were collected from humans from whom stool samples were collected and examined for the presence of anti-T. canis antibodies. Results: Enteric parasites were detected in 30% of fecal samples from 4 dog populations in Egypt. High infectivity had been reported in nomadic dogs (63.33% (Crude odds ratios [COR]=67.36, 95% confidence interval [CI]=8.09-560.8, p˂0.000, followed by domiciled dogs from rural areas (40% (COR=26, 95% CI=3.14-215.54, p=0.003, domiciled dogs from high standard areas (23.33% (COR=11.87, 95% CI=1.37-102.69, p=0.025 and military dogs (2.5%. Twelve species of enteric parasites were identified, Ancylostomatidae (6.15%, T. canis and Cryptosporidium spp. (5.38%, each, Heterophyes spp. (3.85%, Toxocara leonina and Blastocystis spp. (3.07%, Taenidae eggs (2.31%, Hymenolepis diminuta (1.54% and Entamoeba canis, Cyclospora cayetanensis, and Paragonimus spp. (0.77%, each. Univariate logestic regression revealed significant association of age (COR=4.73, 95% CI=2.13-10.53, p˂0.000, gender (COR=2.63, 95% CI=1.22-5.68, p˂0.014, housing system (COR=5.10, 95% CI=2.04-12.75, p˂0.000 with enteric parasitic infection in dogs. However, breeds (COR=6.91, 95% CI=0.88-54.52, p=0.067 and type of feeding (COR ranged from 3.5 to

  14. Dicty_cDB: CHR644 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 93104 |DU493104.1 1098415727216 CHORI-243 Ovis aries genomic clone CH243-335I21, genomic survey sequence. 54...ulentum genomic clone LE_HBa0074J17 5, genomic survey sequence. 34 0.18 3 CE248491 |CE248491.1 tigr-gss-dog-...17000335422026 Dog Library Canis familiaris genomic, genomic survey sequence. 42 0.28 2 CE289638 |CE289638.1... tigr-gss-dog-17000333838157 Dog Library Canis familiaris genomic, genomic survey... sequence. 42 0.33 2 CE336138 |CE336138.1 tigr-gss-dog-17000334037705 Dog Library Canis familiaris genomic, genomic survey

  15. From Sanger to NGS: Detecting MHC (Major Histocompatibility Complex) Class II and OR (Olfactory Receptors) Genetic Variability in Italian Wolves (Canis Lupus) and relative Canids

    OpenAIRE

    Lapalombella, Silvana

    2016-01-01

    In this PhD thesis I will describe different aspects of conservation genetics and genomics of two wild Canidae species, the wolf (Canis lupus) and the golden jackal (Canis aureus), through the study of two of the most variable gene families: the Major Histocompatibility Complex genes (MHC), and Olfactory Receptors genes (OR). In order to perform these studies both Sanger and next generation sequencing (NGS) DNA techniques have been used. The background of the thesis is described in the “Gener...

  16. Pesquisa de aglutininas anti Brucella canis em soros humanos na cidade de São Paulo, Brasil Research on agglutinins for Brucella canis in human sera in the city of S. Paulo, Brazil

    Directory of Open Access Journals (Sweden)

    Maria Helena Matiko Akao Larsson

    1980-09-01

    Full Text Available De 330 soros humanos examinados pela prova de soroaglutinação lenta em tubos, 4(1,21% apresentaram aglutininas anti Brucella canis em diluição 1:100 (1 reagente com título 100, 2 reagentes com título 200 e 1 reagente com título 400.Of the 330 human sera tested by tube agglutination test, 4 (1.21% were positive for Brucella canis antibodies with tilers 1:100 or higher (1 reagent with titer of 1:100, 2 reagents with titer of 1:200, and 1 reagent with tiler of 1:400.

  17. Occurrence of Ehrlichia canis and Anaplasma platys in household dogs from northern Parana Ocorrência de Ehrlichia canis e Anaplasma platys em cães domiciliados da região norte do Paraná

    Directory of Open Access Journals (Sweden)

    Gislaine Cristina Ferreira da Silva

    2012-12-01

    Full Text Available Canine monocytic ehrlichiosis caused primarily by Ehrlichia canis and canine thrombocytic anaplasmosis induced by Anaplasma platys are important emerging zoonotic tick-borne diseases of dogs. There is evidence that these pathogens can also affect humans. This study evaluated the presence of E. canis and A. platys in blood samples collected from 256 domiciled dogs in the municipality of Jataizinho, located in north region of the State of Parana, Brazil, by PCR assay. The occurrence of E. canis and A. platys was 16.4% (42/256 and 19.4% (49/256, respectively; while 5.47% (14/256 of the dogs evaluated were co-infected by these two organisms. The presence of E. canis and A. platys was not significantly associated with the variables evaluated (sex, age, outdoor access, and presence of ticks during blood collection. Infection of dogs by E. canis was associated with anemia and thrombocytopenia, while infection induced by A. platys was related only to thrombocytopenia. Canine monocytic ehrlichiosis and canine thrombocytic anaplasmosis should be included in the differential diagnoses when these hematological alterations are observed during routine laboratory evaluation of dogs.Erliquiose monocítica canina, causada principalmente por Ehrlichia canis, e anaplasmose trombocítica canina, devida a infecção com Anaplasma platys, são importantes doenças transmitidas por carrapatos que acometem os cães, com evidências que podem também acometer o homem. O presente estudo avaliou a ocorrência desses agentes em amostras de sangue de 256 cães domiciliados na cidade de Jataizinho, na região Norte do Paraná, Brasil, utilizando a técnica da Reação em Cadeia da Polimerase (PCR. A ocorrência de E. canis e A. platys foi de 16,4% (42/256 e 19,4% (49/256, respectivamente, com 5,47% (14/256 dos animais apresentando coinfecção. Não foi observada associação significativa com as variáveis sexo, idade, acesso à rua e presença de carrapatos no momento da

  18. Apoptose na infecção experimental de cães domésticos com Ehrlichia canis Apoptosis in experimental infection with Ehrlichia canis in domestic dogs

    Directory of Open Access Journals (Sweden)

    Irma Ximena Barbosa Sanchez

    2012-08-01

    Full Text Available A Erliquiose canina é uma zoonose causada pela Ehrlichia canis, bactéria Gram negativa de distribuição mundial. Alguns cães com erliquiose se tornam portadores assintomáticos enquanto outros desenvolvem uma doença aguda com morte rápida. A apoptose pode ser importante na eliminação de patógenos intracelulares, podendo, nas infecções por Ehrlichia sp. e Anaplasma sp., ocorrer modulação da apoptose celular para prolongar a sobrevivência desses organismos. Para avaliação do papel da apoptose na erliquiose canina, sete cães foram distribuídos em dois grupos. No Grupo inoculado, realizou-se a infecção por via intravenosa com sangue infectado com E. canis (isolado Jaboticabal, sendo realizada a inoculação com PBS estéril nos animais pertencentes ao Grupo Controle. Semanalmente e até 35 dias pós-inoculação, amostras de sangue foram coletadas e submetidas a n-PCR e reação de imunofluorescência (RIFI para confirmação da infecção. No 36° dia pós-inoculação, os animais foram eutanasiados, sendo as amostras de baço, linfonodo, rim e fígado coletadas e processadas para as técnicas de TUNEL e imunohistoquímica (Bcl-2, Bax. Verificou-se pela n-PCR que os animais inoculados se tornaram positivos para E. canis a partir da segunda semana. Pela RIFI, verificou-se animais com sorologia positiva a partir da terceira semana pós-inoculação. No grupo controle, todos os testes realizados foram negativos para E. canis. Apesar da reação de TUNEL mostrar maior incidência de apoptose no Grupo Inoculado, sendo o baço e os linfonodos os órgãos que apresentaram maior marcação, os resultados da imunohistoquímica para Bcl-2 e Bax indicam que a via intrínseca de apoptose não é importante nos órgãos analisados.Some dogs infected with Ehrlichia canis become asymptomatic while others develop an acute illness followed by quick death. Apoptosis may be an important mechanism for elimination of intracellular pathogens. Also

  19. Persistence of specific antibody response in different experimental infections of mice with Toxocara canis larvae Persistência da resposta humoral em camundongos experimentalmente infectados com larvas de Toxocara canis

    Directory of Open Access Journals (Sweden)

    Pedro Paulo Chieffi

    1995-06-01

    Full Text Available Anti-Toxocara antibody production and persistence were studied in experimental infections of BALB/c mice, according to three different schedules: Group I (GI - 25 mice infected with 200 T. canis eggs in a single dose; Group II (GII 25 mice infected with 150 T. canis eggs given in three occasions, 50 in the 1st, 50 in the 5th and 50 in the 8th days; Group III (GIII - 25 mice also infected with 150 T. canis eggs, in three 50 eggs portions given in the 1st, 14th and 28th days. A 15 mice control group (GIV was maintained without infection. In the 30th, 50th, 60th, 75th, 105th and 180th post-infection days three mice of the GI, GII and GIII groups and two mice of the control group had been sacrificed and exsanguinated for sera obtention. In the 360th day the remainder mice of the four groups were, in the same way, killed and processed. The obtained sera were searched for the presence of anti-Toxocara antibodies by an ELISA technique, using T. canis larvae excretion-secretion antigen. In the GI and GII, but not in the GIII, anti-Toxocara antibodies had been found, at least, up to the 180th post-infection day. The GIII only showed anti-Toxocara antibodies, at significant level, in the 30th post-infection day.Estudou-se a cinética de anticorpos anti-Toxocara em camundongos BALB/c infectados experimentalmente segundo três esquemas: Grupo I (GI: 25 camundongos infectados com dose única de 200 ovos embrionados de T. canis; grupo II (GII: 25 camundongos infectados com 150 ovos embrionados de T. canis, divididos em três doses de 50 ovos, administrados no 1º, 5º e 8º dias; Grupo III (GIII: 25 camundongos infectados com 150 ovos embrionados de T. canis, administrados em três doses de 50 ovos no 1º, 14º e 28º dias. Um grupo de 15 camundongos foi mantido nas mesmas condições, porém sem infecção, constituindo o grupo controle (GIV. No 30º, 50º, 60º, 75º, 105º e 180º dias pós-infecção três camundongos dos grupos GI, GII e GIII e dois do

  20. Health effects of dietary fiber

    OpenAIRE

    Semih Ötles; Selin Ozgoz

    2014-01-01

    Dietary fi bre is a group of food components which is resistant to digestive enzymes and found mainly in cereals, fruits and vegetables. Dietary fi ber and whole grains contain a unique blend of bioactive components including resistant starches, vitamins, minerals, phytochemicals and antioxidants. Dietary fi ber which indigestible in human small intestinal, on the other hand digested completely or partially fermented in the large intestine, is examined in two groups: water-soluble and water i...