International Nuclear Information System (INIS)
Moore, J.R.
1988-03-01
A SQUID-based magnetic susceptometer has been constructed for studying small radioactive samples at temperatures below 350 K and in magnetic fields up to 50 kilogauss. The device has been used to study californium (element 98) in a number of solid-state forms: the dhcp metal, several oxides (Cf 2 O 3 in both the bcc and monoclinic structures, Cf 7 O 12 , CfO 2 and BaCfO 3 ), several monopnictides (CfN, CfAs and CfSb) and the trichloride (in both the hexagonal and orthorhombic structures). All of these materials were studied in polycrystalline form, and hexagonal CfCl 3 was studied in single-crystal form as well. The susceptometer has the sensitivity to measure samples containing less than 10 micrograms of californium. The magnetic susceptibilities of all of the californium materials at temperatures above about 100 K are described well by the Curie-Weiss relationship. This behavior is consistent with the assumption that the magnetic 5f electrons are localized and that the paramagnetic behavior can be interpreted in terms of the properties of the free ion. The measured values of the effective paramagnetic moment, μ/sub eff/, for all the californium materials that were studied are reasonably consistent with theoretical values based on intermediate coupling models. All of the californium materials showed some indications of cooperative magnetic effects. The dhcp metal was observed to order ferromagnetically at 52 K, and all of the californium compounds studied showed signs of antiferromagnetic ordering, mostly at temperatures below 25 K. 91 refs., 50 figs., 19 tabs
Medical applications of californium-252
International Nuclear Information System (INIS)
Oliver, G.D. Jr.
1975-01-01
Primarily, californium-252 sources have been utilized in medicine for the treatment of neoplastic lesions. For five years, a coordinated effort between several cancer research institutions and national laboratories has developed the necessary physics, radiobiology, and engineering skills to establish an evaluation program for californium. Several more years of combined effort are required before it is known whether californium therapy is as good as or better than conventional therapy with sources like radium. Recently, development of diagnostic applications of californium in medicine has received attention. Studies comparing neutron decay activation analysis versus prompt capture gamma ray analysis are in progress. A hopeful application of prompt analysis with reasonable quantities (200 μg) of californium is the elemental analysis of bone in the human body. (U.S.)
Californium-252 progress, report No. 7, April 1971
Energy Technology Data Exchange (ETDEWEB)
1971-12-31
This report contains discusses of the following topics on Californium-252: First sales of californium-252; encapsulation services discussed; three new participants in market evaluation program; summer training programs to use californium; Californium-252 shipping casks available; Californium-252 questions and answers, radiotherapy; neutron radiography; natural resources exploration; nuclear safeguards; process control; dosimetry; neutron radiography; neutron shielding; and nuclear safeguards.
Radiography using californium-252 neutron sources
International Nuclear Information System (INIS)
Ray, J.W.
1975-01-01
The current status in the technology of neutron radiography using californium-252 neutron sources is summarized. Major emphasis is on thermal neutron radiography since it has the widest potential applicability at the present time. Attention is given to four major factors which affect the quality and useability of thermal neutron radiography: source neutron thermalization, neutron beam extraction geometry, neutron collimator dimensions, and neutron imaging methods. Each of these factors has a major effect on the quality of the radiographs which are obtained from a californium source neutron radiography system and the exposure times required to obtain the radiographs; radiograph quality and exposure time in turn affect the practicality of neutron radiography for specific nondestructive inspection applications. A brief discussion of fast neutron radiography using californium-252 neutron sources is also included. (U.S.)
Historical review of californium-252 discovery and development
International Nuclear Information System (INIS)
Stoddard, D.H.
1985-01-01
This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving 252 Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed
Californium-252 sales and loans at Oak Ridge National Laboratory
International Nuclear Information System (INIS)
King, L.J.
1987-01-01
The production and distribution in the United States of 252 Cf has recently been consolidated at the Oak Ridge National Laboratory (ORNL). The 252 Cf Industrial Sales/Loan Program and the 252 Cf University Load Program, which were formerly located at the Savannah River Plant (SRP), have been combined with the californium production and distribution activities of the Transuranium Element Production Program at ORNL. Californium-252 is sold to commercial users in the form of bulk californium oxide, palladium-californium alloy pellets, or alloy wires. Neutron source capsules, which are fabricated for loans to DOE or other US government agencies, are still available in all forms previously available. The consolidation of all 252 Cf distribution activities at the production site is expected to result in better service to users. In particular, customers for neutrons sources will be ale to select from a wider range of neutron source forms, including custom designs, through a single contact point
Fabrication of californium-252 sources in the United Kingdom
International Nuclear Information System (INIS)
Ainsworth, A.; Brady, M.W.; Thornett, W.H.
1975-01-01
The advent of californium-252 in weighable quantities and at a reasonable price has caused some rethinking among neutron source suppliers. To explore this market the Radiochemical Center Ltd. has purchased 2 mg of californium-252, and subdivided this into a wide range of sources. To take advantage of its high specific neutron emission, a small double welded stainless steel capsule 7.8mm diameter x 10mm high was chosen for stock sources and this entailed the use of a microdispensing technique which had to be specially developed. The apparatus and procedure for subdividing milligram amounts of californium-252 are described. Some details of our experience in processing these one milligram shipments are given. 100 sources with activities from 200 microgram to 0.01 microgram have been produced. Losses have been small. Measurement of neutron spectra gamma spectra and dose rates from encapsulated sources has confirmed published data. Though it is early days, little industrial interest in californium-252 sources has been detected, most of the sources have so far been required for research into activation analysis and two examples of this are given. (U.S.)
Biomedical neutron research at the Californium User Facility for neutron science
International Nuclear Information System (INIS)
Martin, R.C.; Byrne, T.E.; Miller, L.F.
1997-01-01
The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact 252 Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with 252 Cf sources. Three projects at the CUF that demonstrate the versatility of 252 Cf for biological and biomedical neutron-based research are described: future establishment of a 252 Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded 252 Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy
Biomedical neutron research at the Californium User Facility for Neutron Science
International Nuclear Information System (INIS)
Martin, R.C.; Byrne, T.E.; Miller, L.F.
1998-01-01
The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact 252 Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with 252 Cf sources. Three projects at the CUF that demonstrate the versatility of 252 Cf for biological and biomedical neutron-based research are described: future establishment of a 252 Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded 252 Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy. (author)
Californium Multiplier. Part I. Design for neutron radiography
International Nuclear Information System (INIS)
Crosbie, K.L.; Preskitt, C.A.; John, J.; Hastings, J.D.
1982-01-01
The Californium Multiplier (CFX) is a subcritical assembly of enriched uranium surrounding a californium-252 neutron source. The function of the CFX is to multiply the neutrons emitted by the source to a number sufficient for neutron radiography. The CFX is designed to provide a collimated beam of thermal neutrons from which the gamma radiation is filtered, and the scattered neutrons are reduced to make it suitable for high resolution radiography. The entire system has inherent safety features, which provide for system and personnel safety, and it operates at moderate cost. In Part I, the CFX and the theory of its operation are described in detail. Part II covers the performance of the Mound Facility CFX
Californium-252 radiotherapy sources for interstitial afterloading
International Nuclear Information System (INIS)
Permar, P.H.; Walker, V.W.
1976-01-01
Californium-252 neutron sources for interstitial afterloading were developed to investigate the value of this radionuclide in cancer therapy. Californium-252 seed assemblies contain essentially point sources of 252 Cf permanently sealed on 1-cm centers within a flexible plastic tube. The seed assemblies are fabricated with remotely operated, specially designed machines. The fabrication process involves the production of a Pt-10 percent Ir-clad wire with a 252 Cf 2 O 3 -Pd cermet core. The wire is swaged and drawn to size, cut to length, and welded in a Pt-10 percent Ir capsule 0.8 mm in diameter and 6 mm long. Each seed capsule contains approximately 0.5 microgram of 252 Cf. Because the effective half-life of 252 Cf is 2.6 years, the seed assemblies are not disposable and must be reused until their activities have decreased to unsuitable levels. The flexible plastic components must therefore have sufficient resistance to radiation damage to survive the neutron-plus-gamma radiation from 252 Cf. On the basis of accelerated irradiation tests with a large 252 Cf source, a recently developed fluoropolymer, ''Tefzel'' (trademark of E. I. du Pont de Nemours and Company) has adequate radiation resistance for this application. Californium-252 seed assembly systems are loaned by the United States Energy Research and Development Administration for clinical investigations under a protocol of the Radiation Therapy Oncology Group, U.S. National Cancer Institute
Uranium standards for Californium Shuffler
International Nuclear Information System (INIS)
Gibbs, A.; Boynton, S.P.
1978-10-01
The Laboratories Department analyzed pieces of a U-Al log which were to be canned and used as a set of standards for the nondestructive Californium Shuffler instrument. Evaluation of this instrument is part of an on-going Safeguards Program and is a joint project between LASL and SRP. A U-Al casting of a nominal 30% to 70% composition was made with enriched uranium (56 wt % 235 U). The log was 6 in. in diameter and approximately 2 ft long. A 1/4-in. slice was made before and after each 1-in. slice taken for use as a standard. The 1-in. slices were scanned nondestructively by collimated gamma pulse height analysis. The 1/4-in. slices were divided into quadrants and one quadrant for each slice was destructively analyzed. Results from these tests showed an approximate 1.5% relative variation in uranium concentration from the high to the low point. Successive pieces showed less than 1% relative difference. The 1-in. pieces have been canned and shipped to LASL for testing and will be returned with the Californium Shuffler. The remaining 1/4-in. slices have been sent to NBL and LASL for destructive analysis
Californium-252: a remarkable versatile radioisotope
International Nuclear Information System (INIS)
Osborne-Lee, I.W.; Alexander, C.W.
1995-01-01
A product of the nuclear age, Californium-252 ( 252 Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, 252 Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of 252 Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the 252 Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, 252 Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of 252 Cf from ORNL is summarized herein
Californium-252: a remarkable versatile radioisotope
Energy Technology Data Exchange (ETDEWEB)
Osborne-Lee, I.W.; Alexander, C.W.
1995-10-10
A product of the nuclear age, Californium-252 ({sup 252}Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, {sup 252}Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of {sup 252}Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the {sup 252}Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, {sup 252}Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of {sup 252}Cf from ORNL is summarized herein.
International Nuclear Information System (INIS)
Dupouy, G.; Bonhoure, I.; Dumas, Th.; Moisy, Ph.; Petit, S.; Den Auwer, Ch.; Conradson, St.D.; Hennig, Ch.; Scheinost, A.C.; Le Naour, C.; Simoni, E.
2011-01-01
Metal hexa-cyanoferrates are well known molecular solids for a large variety of cations, although very little has been described for actinide adducts. Two new members of actinide(III) hexa-cyanoferrates were synthesized with the cations americium and californium. They were structurally characterized by infrared and X-ray absorption spectroscopy. Combined EXAFS data at the iron K edge and actinide L 3 edge provide evidence for a three-dimensional model for these two new compounds. Structural data in terms of bond lengths were compared to those reported for the parent lanthanide(III) compounds, neodymium and gadolinium hexa-cyanoferrates, respectively: the americium compound with (KNd(III)Fe(II)-Fe-III(CN) 6 .4H 2 O and the californium compound with (KGd(III)Fe(II)(CN) . 3.5H 2 O and (KGd(III)Fe(II)(CN) 6 .3H 2 O. This comparison between actinide and lanthanide homologues has been carried out on the basis of ionic radii considerations. The americium and neodymium environments appear to be very similar and are arranged in a tri-capped trigonal prism polyhedron of coordination number 9 (CN: 9), in which the americium atom is bonded to six nitrogen atoms and to three water molecules. For the californium adduct, a similar comparison and bond length and angle values derived from EXAFS studies suggest that the californium cation sits in a bi-capped trigonal prism (CN: 8) as in (KGd(III)Fe(II)(CN) 6 . 3H 2 O. This arrangement differs from that in the structure of (KGd(III)Fe(II)(CN) 6 .3.5H 2 O, in which the gadolinium atom is surrounded by 9 atoms. This is one of the rare pieces of information revealed by EXAFS spectroscopy for americium and californium in comparison to lanthanide atoms in molecular solid compounds. A discussion on the decrease in bond length and coordination number from americium to californium is also provided, on the basis of crystallographic results reported in the literature for actinide(III) and lanthanide(III) hydrate series. (authors)
Proposed Californium-252 User Facility for Neutron Science at Oak Ridge National Laboratory
International Nuclear Information System (INIS)
Martin, R.C.; Laxson, R.R.; Knauer, J.B.
1996-01-01
The Radiochemical Engineering Development Center (REDC) at ORNL has petitioned to establish a Californium-252 User Facility for Neutron Science for academic, industrial, and governmental researchers. The REDC Californium Facility (CF) stores the national inventory of sealed 252 Cf neutron source for university and research loans. Within the CF, the 252 Cf storage pool and two uncontaminated hot cells currently in service for the Californium Program will form the physical basis for the User Facility. Relevant applications include dosimetry and experiments for neutron tumor therapy; fast and thermal neutron activation analysis of materials; experimental configurations for prompt gamma neutron activation analysis; neutron shielding and material damage studies; and hardness testing of radiation detectors, cameras, and electronics. A formal User Facility simplifies working arrangements and agreements between US DOE facilities, academia, and commercial interests
International Nuclear Information System (INIS)
1974-01-01
The offer of the United States to loan Californium-252 sources to the IAEA was made by Dr. Glenn T. Seaborg, then chairman of the USAEC, in his opening statement at the 15th. General Conference of the IAEA held in Vienna in 1971. The purpose of this loan was to make neutron emitting sources available to universities in the Member States for use in educational programmes. The sources, in the form of small needles designed for medical use in radiation therapy, were judged highly suitable for didactic applications due to their small size, limited activity and well documented radiological parameters. Subsequently, in May 1973, the Director General announced the availability of the Californium sources to the Member States. To date, numerous sources have been loaned to universities in Czechoslovakia, Costa Rica, the Federal Republic of Germany, Ghana, India, Iran, Israel, Japan, South Africa, Switzerland, the United Kingdom and Uruguay; additional applications for loans are being processed. It is anticipated that the loan programme will be terminated in 1975 once all the available sources have been distributed. n order to provide guidance for the Member States on the safe exploitation of these sources, a prototype use and storage facility was designed by IAEA staff of the Dosimetry Section of the Division of Life Sciences, and constructed at the IAEA laboratory in Seibersdorf, Austria. Figures 2-5 illustrate some of the details of this container, which is being given to the Ghana Nuclear Centre in support of a training programme for students at the university in Accra. Further advice to users of these sources will be provided by the publication of an instructional syllabus, a laboratory manual for experiments and the safety precautions inherent in the proper handling of neutron emitting radionuclides, authored by Professors Erich J. Hall and Harald H. Rossi of Columbia University. The syllabus and manual will be published as part of the IAEA Technical Series in September
Production, Distribution, and Applications of Californium-252 Neutron Sources
International Nuclear Information System (INIS)
Balo, P.A.; Knauer, J.B.; Martin, R.C.
1999-01-01
The radioisotope 252 Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-year half-life. A source the size of a person's little finger can emit up to 10 11 neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells 252 Cf to commercial reencapsulators domestically and internationally. Sealed 252 Cf sources are also available for loan to agencies and subcontractors of the U.S. government and to universities for educational, research, and medical applications. The REDC has established the Californium User Facility (CUF) for Neutron Science to make its large inventory of 252 Cf sources available to researchers for irradiations inside uncontaminated hot cells. Experiments at the CUF include a land mine detection system, neutron damage testing of solid-state detectors, irradiation of human cancer cells for boron neutron capture therapy experiments, and irradiation of rice to induce genetic mutations
International Nuclear Information System (INIS)
Wallace, C.R.
1995-01-01
In early 1995, the receipt of four sealed californium-252 sources from Oak Ridge National Lab was successfully accomplished by a team comprised of Radiological Engineering, Radiological Operations and Health Physics Instrumentation personnel. A procedure was developed and walked-down by the participants during a Dry Run Evolution. Several special tools were developed during the pre-planning phases of the project which reduced individual and job dose to minimal levels. These included a mobile lifting device for attachment of a transfer ball valve assembly to the undercarriage of the Cannonball Carrier, a transfer tube elbow to ensure proper angle of the source transfer tube, and several tools used during emergency response for remote retrieval and handling of an unshielded source. Lessons were learned in the areas of contamination control, emergency preparedness, and benefits of thorough pre-planning, effectiveness of locally creating and designing special tools to reduce worker dose, and methods of successfully accomplishing source receipt evolutions during extreme or inclement weather
International Nuclear Information System (INIS)
Hobart, D.E.; Varlashkin, P.G.; Samhoun, K.; Haire, R.G.; Peterson, J.R.
1983-01-01
Multimilligram quantities of trivalent curium-248 and californium-249 were investigated by absorption spectroscopy, cyclic voltammetry, and bulk solution electrolysis in concentrated aqueous carbonate-bicarbonate solution. Actinide concentrations between 10 -4 and 10 -2 M were studied in 2 M sodium carbonate and 5.5 M potassium carbonate solutions at pH values from 8 to 14. The solution absorption spectra of Cm(III) and Cf(III) in carbonate media are presented for the first time and compared to literature spectra of these species in noncomplexing aqueous solution. It was anticipated that carbonate complexation of the actinide ions could provide a sufficient negative shift in the formal potentials of the M(IV)/M(III) couples of Cm and Cf to permit the generation and stabilization of their tetravalent states in aqueous carbonate-bicarbonate medium. No conclusive evidence was found in the present work to indicate the existence of any higher oxidation states of curium or californium in carbonate solution. Some possible reasons for our inability to generate and detect oxidized species of curium and californium in this medium are discussed
International Nuclear Information System (INIS)
1975-01-01
This meeting constituted the third phase of a project initiated by the Dosimetry Section of the IAEA in 1973. The first step, early in 1973, consisted of the development of a programme for the loan of Cf-252 sources to the Member States in support of education, training and some limited research. To date, 14 institutions in 13 Member States have participated in this loan programme. In August last year, the Agency published an instructional syllabus and laboratory manual authored by Professors Eric J. Hall and Harald H. Rossi of Columbia University (Californium-252 in Teaching and Research, Technical Reports Series No. 159). The appearance of this publication, including guidance on the design and construction of a storage and use facility, was the second phase of this programme aimed at providing some support to potential users in the fields of radiation biology and dosimetry. The objective of the programme's third phase - the convening of an Educational Seminar - was to provide a forum to bring together participants in the Agency's loan programme and experts in various scientific fields. Specifically, the Seminar consisted of a series of expert presentations in spectrometry, activation and prompt gamma analyses, on-stream analysis, dosimetry, health physics, radiology and radiotherapy. (author)
X-ray-diffraction study of californium metal to 16 GPa
International Nuclear Information System (INIS)
Peterson, J.R.; Benedict, U.; Dufour, C.; Birkel, I.; Haire, R.G.
1983-01-01
The first series of measurements to determine the structural behavior of californium (Cf) metal under pressure has been carried out. The initial dhcp structure transformed sluggishly with increasing pressure to a fcc structure. A bulk modulus of 50(5) GPa was derived for dhcp Cf metal from the relative volume (V/V 0 ) data to 10 GPa
Study of the shielding for spontaneous fission sources of Californium-252
International Nuclear Information System (INIS)
Davila R, I.
1991-06-01
A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)
International Nuclear Information System (INIS)
Landolt, R.R.; Hem, S.L.
1983-01-01
A commercial antacid suspension containing aluminum hydroxide and magnesium hydroxide products was used as a model sample to study the use of a californium-252 thermal neutron activation as a method for quantifying aluminum content as well as for the simultaneous assay of aluminum and magnesium. A 3.5-micrograms californium-252 source was used for the activation, and the induced aluminum-28 and magnesium-27 activity was simultaneously measured by sodium iodide crystal gamma-ray spectrometry using dual single-channel analyzers and scalers. The antacid suspension was contained in a chamber designed with the unique capability of serving as the container for counting the induced radioactivity in addition to being the irradiation chamber itself. This pilot study demonstrated that use of more intense californium-252 sources, which are commonly available, would provide a method that is competitive with the ethylenediaminetetraacetic acid titration method in precision and in other aspects as well
Atlantic Richfield Hanford Company californium multiplier/delayed neutron counter safety analysis
International Nuclear Information System (INIS)
Zimmer, W.H.
1976-08-01
The Californium Multiplier (CFX) is a subcritical assembly of uranium surrounding 252 Cf spontaneously fissioning neutron sources; its function is to multiply the neutron flux to a level useful for activation analysis. This document summarizes the safety analysis aspects of the CFX, DNC, pneumatic transfer system, and instrumentation and to detail all the aspects of the total facility as a starting point for the ARHCO Safety Analysis Review. Recognized hazards and steps already taken to neutralize them are itemized
Californium oxygen system for 1.50 < O/Cf < 1.72
International Nuclear Information System (INIS)
Turcotte, R.P.; Haire, R.G.
1975-01-01
The californium-oxygen system was studied as a function of temperature, oxygen pressure, and stoichiometry by manometric and x-ray diffraction methods. The results establish rhombohedral Cf 7 O 12 as the stable compound obtained by heating Cf 2 O 3 in air. The isobaric oxidation-reduction cycles Cf 2 O 3 → Cf 7 O 12 → Cf 2 O 3 , observed in constant rate of heating (cooling) experiments, occur with large hysteresis. A close parallel to other fluorite related lanthanide and actinide oxide systems is established. (auth)
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Definitions. 255.2 Section 255.2 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES IDENTIFICATION OF REGIONS AND AGENCIES FOR SOLID WASTE MANAGEMENT General Provisions § 255.2 Definitions. The Act contains an...
2010-07-01
... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Banking. 96.255 Section 96.255 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) NOX BUDGET... Tracking System § 96.255 Banking. (a) CAIR SO2 allowances may be banked for future use or transfer in a...
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Fault. 255.11 Section 255.11 Employees... § 255.11 Fault. (a) Before recovery of an overpayment may be waived, it must be determined that the overpaid individual was without fault in causing the overpayment. If recovery is sought from other than the...
Assessment of the neutron component in a neutron-gamma field of a californium-252 source
International Nuclear Information System (INIS)
Tetteh, G.K.
1978-12-01
Experiments have been performed to determine the percentages of the different components in the radiation field of californium-252 which has now some clinical applications. Using Rossi Chambers in conjunction with absorption investigations involving lead and aluminium thimbles, it is observed that the dose rates due to the different components are: neutrons 54%; gammas 30%; betas 16%
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false United States. 65.255 Section 65.255 Agriculture..., PEANUTS, AND GINSENG General Provisions Definitions § 65.255 United States. United States means the 50... United States. ...
29 CFR 1910.255 - Resistance welding.
2010-07-01
... 29 Labor 5 2010-07-01 2010-07-01 false Resistance welding. 1910.255 Section 1910.255 Labor... OCCUPATIONAL SAFETY AND HEALTH STANDARDS Welding, Cutting and Brazing § 1910.255 Resistance welding. (a.... Ignitron tubes used in resistance welding equipment shall be equipped with a thermal protection switch. (3...
Measurements of integral cross sections in the californium-252 fission neutron spectrum
International Nuclear Information System (INIS)
Alberts, W.G.; Guenther, E.; Matzke, M.; Rassl, G.
1977-01-01
In a low-scattering arrangement cross sections averaged over the californium-252 spontaneous fission neutron spectrum were measured. The reactions 27 Al(n,α) 46 Ti, 47 Ti, 48 Ti(n,p), 54 Fe, 56 Fe(n,p), 58 Ni(n,p), 64 Zn(n,p), 115 In(n,n') were studied in order to obtain a consistent set of threshold detectors used in fast neutron flux density measurements. Overall uncertainties between 2 and 2.5% could be achieved; corrections due to neutron scattering in source and samples are discussed
21 CFR 173.255 - Methylene chloride.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Methylene chloride. 173.255 Section 173.255 Food... Solvents, Lubricants, Release Agents and Related Substances § 173.255 Methylene chloride. Methylene chloride may be present in food under the following conditions: (a) In spice oleoresins as a residue from...
20 CFR 632.255 - Program planning.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Program planning. 632.255 Section 632.255... EMPLOYMENT AND TRAINING PROGRAMS Summer Youth Employment and Training Programs § 632.255 Program planning. (a... with its title IV program. (2) Native American grantees shall use the planning process described in...
International Nuclear Information System (INIS)
Shilo, N.A.; Ippolitov, E.G.; Ivanenko, V.V.; Kustov, B.N.; Zheleznov, V.V.; Aristov, G.N.; Kovalenko, V.V.; Kondrat'ev, N.B.
1983-01-01
A facility using a californium neutron source and a method for the neutron activation analysis of gold were developed. The sensitivity of the determination is 0.1 g/t. The causes of random and systematic errors have been studied. It is concluded that in prospection and evaluation of gold ore deposists, the traditional test tube analysis for gold may be replaced with the developed method. (author)
42 CFR 447.255 - Related information.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Related information. 447.255 Section 447.255 Public... Facility Services Payment Rates § 447.255 Related information. The Medicaid agency must submit, with the assurances described in § 447.253(a), the following information: (a) The amount of the estimated average...
International Nuclear Information System (INIS)
Muhammad Fakhrurreza; Kusminanto; Y Sardjono
2014-01-01
In this research has made a reflector design to provide beams of Neutron for BNCT with Californium-252 radioactive source. This collimator is useful to obtain optimum epithermal neutron flux with the smallest impurity radiation (thermal neutron, fast neutron, and gamma). The design process is done using Monte Carlo N-Particle simulation version 5 (MCNP5) code to calculate the neutron flux tally form. The chosen reflector design is the reflectors which use material such as BeO ceramic with 13 cm thick. Moderator use sulfur material with the slope angle of the cone is 30°. From the calculation result, it is obtained that Reflector with 1 gram Californium-252 source can produce a neutron output thermal which has thermal neutron specification 2.23189 x 10 9 n/s.cm 2 , epithermal neutron 3.51548 x 10 9 n/s.cm 2 , and fast neutron 4.82241 x 10 9 n/s.cm 2 From the result, it needs additional collimator because the BNCT requirement. (author)
Calibration of a Modified Californium Shuffler
International Nuclear Information System (INIS)
Sadowski, E.T.; Armstrong, F.; Oldham, R.; Ceo, R.; Williams, N.
1995-01-01
A californium shuffler originally designed to assay hollow cylindrical pieces of UA1 has been modified to assay solid cylinders. Calibration standards were characterized via chemical analysis of the molten UA1 taken during casting of the standards. The melt samples yielded much more reliable characterization data than drill samples taken from standards after the standards had solidified. By normalizing one well-characterized calibration curve to several standards at different enrichments, a relatively small number of standards was required to develop an enrichment-dependent calibration. The precision of this shuffler is 0.65%, and the typical random and systematic uncertainties are 0.53% and 0.73%, respectively, for a six minute assay of an ingot containing approximately 700 grams of 235 U. This paper will discuss (1) the discrepancies encountered when UA1 standards were characterized via melt samples versus drill samples, (2) a calibration methodology employing a small number of standards, and (3) a comparison of results from a previously unused shuffler with an existing shuffler. A small number of UA1 standards have been characterized using samples from the homogeneous molten state and have yielded enrichment-dependent and enrichment-independent calibration curves on two different shufflers
Alpha-gamma decay studies of 255No
International Nuclear Information System (INIS)
Hessberger, F.P.; Ackermann, D.; Kindler, B.; Kojouharov, I.; Kuusiniemi, P.; Lommel, B.; Mann, R.; Hofmann, S.; Antalic, S.; Saro, S.; Streicher, B.; Venhart, M.; Leino, M.; Nishio, K.; Popeko, A.G.; Yeremin, A.V.; Sulignano, B.
2006-01-01
The decay of 255 No was investigated by means of α-γ spectroscopy. The isotope was produced in the reactions 208 Pb( 48 Ca,n) 255 No, 209 Bi( 48 Ca,2n) 255 Lr EC → 255 No, and 238 U( 22 Ne,5n) 255 No. Levels of the daughter nucleus 251 Fm were assigned by α-γ coincidence measurements and on the basis of systematics. Level energies were determined precisely using measured γ-rays. The results are compared with the known level schemes of the lighter N=151 isotones 247 Cm and 249 Cf as well as with data for 253 No. (orig.)
Prompt neutron spectrum of the spontaneous fission of californium-252
International Nuclear Information System (INIS)
Zamyatnin, Yu.S.; Kroshkin, N.I.; Korostylev, V.A.; Nefedov, V.N.; Ryazanov, D.K.; Starostov, B.I.; Semenov, A.F.
1976-01-01
The californium-252 spontaneous fission neutron spectrum was measured in the energy range of 0.01 to 10 MeV by the time-of-flight technique using various neutron detectors. The measurements of 252 Cf neutron spectrum at energies of 0.01 to 5 MeV were performed as a function of fission fragment kinetic energy. The mean neutron spectrum energy in the range of 0.7 to 10 MeV was found from the results of measurements. The irregularity in the 252 Cf neutron spectrum in the neutron energy range of less than 0.7 MeV compared to theoretical values is discussed. The mechanism of 252 Cf neutron emission is also discussed on the basis of neutron yield angle measurements. 12 references
International Nuclear Information System (INIS)
Box, W.D.; Shappert, L.B.; Seagren, R.D.; Klima, B.B.; Jurgensen, M.C.; Hammond, C.R.; Watson, C.D.
1980-01-01
An analytical evaluation of the Oak Ridge National Laboratory TRU Californium Shipping Container was made in order to demonstrate its compliance with the regulations governing off-site shipment of packages that contain radioactive material. The evaluation encompassed five primary categories: structural integrity, thermal resistance, radiation shielding, nuclear criticality safety, and quality assurance. The results of this evaluation demonstrate that the container complies with the applicable regulations
Neutron emission in fission of highly excited californium nuclei (E*=76 MeV)
International Nuclear Information System (INIS)
Blinov, M.V.; Bordyug, V.M.; Kozulin, Eh.M.; Mozhaev, A.N.; Levitovich, M.; Muzychka, Yu.A.; Penionzhkevich, Yu.Eh.; Pustyl'nik, B.I.
1990-01-01
The differential cross sections for neutron production in the fission of highly excited californium nuclei formed in the 238 U+ 12 C (105 MeV) reaction have been measured. From the analysis of the experimental data is follows that the number of pre-fission neutrons substantially exceeds the value obtained in the framework of the standard statistical model. The saddle-to-scission time of the excited nucleus is estimated on the basis of the neutron multiplicity. The dependences of the neutron number and neutron average energies upon the fragment mass are determined
Neutron emission in fission of highly excited californium nuclei (E* = 76 MeV)
International Nuclear Information System (INIS)
Blinov, M.V.; Bordyug, V.M.; Kozulin, E.M.; Levitovich, M.; Mozhaev, A.N.; Muzychka, Yu.A.; Penionzhkevich, Yu.E.; Pustyl'nik, B.I.
1990-01-01
Differential cross sections for neutron production have been measured in fission of excited californium nuclei produced in the reaction 238 U + 12 C (105 MeV). It follows from analysis of the experimental results that the number of neutrons emitted before fission considerably exceeds the number obtained in the framework of the standard statistical model. On the basis of the multiplicity of neutrons they authors have estimated the time of fission of the excited nucleus. The dependence of the number of neutrons and their average energies on the mass of the fragments is determined
2010-07-01
... 39 Postal Service 1 2010-07-01 2010-07-01 false Employment. 255.5 Section 255.5 Postal Service... Employment. No qualified individual with a disability shall, on the basis of disability, be subjected to discrimination in employment with the Postal Service. The definitions, requirements, and procedures of section...
2010-07-01
... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Banking. 97.255 Section 97.255 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) FEDERAL NOX... Banking. (a) CAIR SO2 allowances may be banked for future use or transfer in a compliance account or a...
14 CFR 255.4 - Display of information.
2010-01-01
... REGULATIONS AIRLINE COMPUTER RESERVATIONS SYSTEMS § 255.4 Display of information. (a) All systems shall provide at least one integrated display that includes the schedules, fares, rules, and availability of all... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Display of information. 255.4 Section 255.4...
2010-04-01
... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Terminology. 25.5 Section 25.5 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ENVIRONMENTAL IMPACT...). (12) Legislation (40 CFR 1508.17). (13) Major Federal action (40 CFR 1508.18). (14) Mitigation (40 CFR...
A californium-252 source for radiobiological studies at Hiroshima University
International Nuclear Information System (INIS)
Kato, Kazuo; Takeoka, Seiji; Kuroda, Tokue; Tsujimura, Tomotaka; Kawami, Masaharu; Hoshi, Masaharu; Sawada, Shozo
1987-01-01
A 1.93 Ci (3.6 mg) californium-252 source was installed in the radiation facility of the Research Institute for Nuclear Medicine and Biology, Hiroshima University. This source produces fission neutrons (8.7 x 10 9 n/s at the time of its installation), which are similar to neutron spectrum of the atomic bombs. It is useful for studying biological effects of fission neutrons and neutron dosimetry. An apparatus was dosigned to accomodate this source and to apply it to such studies. It has resulted in profitable fission neutron exposures, while suppressing scattered neutrons and secondary gamma rays. This apparatus incorporates many safety systems, including one which interlocks with all of doors and an elevator serving the exposure room, so as to prevent accidents involving users. (author)
Californium production at the transuranium processing plant
International Nuclear Information System (INIS)
King, L.J.
1976-01-01
The Transuranium Processing Plant (TRU) at ORNL, which is the production, storage, and distribution center for the ERDA heavy element research program, is described. About 0.5 percent of 252 Cf is currently being produced. TRU is a hot-cell, chemical processing facility of advanced design. New concepts have been incorporated into the facility for absolute containment, remote operation, remote equipment installation, and remote maintenance. The facilities include a battery of nine heavily shielded process cells served by master-slave manipulators and eight laboratories, four on each of two floors. Processing includes chemical dissolution of the targets followed by a series of solvent extraction, ion exchange, and precipitation steps to separate and purify the transuranium elements. The transcurium elements Bk, Cf, Es, and Fm are distributed to users. Remote techniques are used to fabricate the Am and Cm into target rods for reirradiation in the HFIR. Californium-252 that is in excess of the needs of the heavy element research program and the Cf sales program is stored at TRU and processed repeatedly to recover the daughter product 248 Cm, which is a highly desirable research material
International Nuclear Information System (INIS)
Sadowski, E.T.; Griffin, J.C.; Rinard, P.M.
1991-01-01
A Scrap Californium Shuffler at the Savannah River Site (SRS) was calibrated to assay the U-Al cores of billets (an intermediate step in the SRS reactor fuel fabrication cycle.) The precision of the Scrap Shuffler over several years has been approximately 0.50%. A typical total uncertainty for the assay of a core on the Scrap Shuffler is approximately 0.33% for a twelve minute assay. The precision over several months and a typical total uncertainty for the Billet Active Well (neutron) Coincidence Counter (BAWCC) are approximately 1.0% and 1.9%, respectively, for a fifteen minute assay. A new Billet Californium Shuffler specifically designed for assaying SRS billets has yielded precision (over one month) and total uncertainty results of 0.40% and 0.69%, respectively, for an eight minute assay. The introduction of a measurement point into the fuel fabrication cycle to replace estimates based upon material weight will greatly enhance material and process control in the Reactor Materials area of SRS. The use of all three instruments provides a comparison of the relative merits of Active Well (neutron) Coincidence Counters (AWCCs) and shufflers for assay of homogeneous and geometrically simple material containing 235 U. The measurement precisions, systematic and random uncertainties, as well as the procurement and operation of each instrument will be compared. 3 refs., 5 figs., 1 tab
Fission of 255,256Es, 255-257Fm, and 258Md at moderate excitation energies
Britt, H.C.; Hoffman, D.C.; Plicht, J. van der; Wilhelmy, J.; Cheifetz, E.; Dupzyk, R.J.; Lougheed, R.W.
1984-01-01
The fission of 255,256Es, 255-257Fm, and 258Md has been studied in the excitation energy range from threshold to 25 MeV. A target of 254Es was used in the direct reaction studies; (d,pf), (t,pf), (3He,df), (3He,pf), and in the compound induced fission reactions formed with p, d, t, and α particle
40 CFR 255.31 - Integration with other acts.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Integration with other acts. 255.31 Section 255.31 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES... Relationship to Other Programs § 255.31 Integration with other acts. The Governor shall integrate the...
40 CFR 255.32 - Coordination with other programs.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Coordination with other programs. 255.32 Section 255.32 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES... Relationship to Other Programs § 255.32 Coordination with other programs. The region and agency identification...
Energy Technology Data Exchange (ETDEWEB)
Fadel, M A; El-Fiki, M A; Eissa, H M; Abdel-Hafez, A; Naguib, S H [National Institute of Standards, Cairo (Egypt)
1996-03-01
Phantom of tissue equivalent material with and without bone was used measuring depth dose distribution of gamma-rays from californium-252 source. The source was positioned at center of perspex walled phantom. Depth dose measurements were recorded for X, Y and Z planes at different distances from source. TLD 700 was used for measuring the dose distribution. Results indicate that implantation of bone in tissue equivalent medium cause changes in the gamma depth dose distribution which varies according to variation in bone geometry. 9 figs.
Czech Academy of Sciences Publication Activity Database
Tačev, T.; Vacek, Antonín; Ptáčková, B.; Strnad, V.
2005-01-01
Roč. 181, č. 5 (2005), s. 273-284 ISSN 0179-7158 Institutional research plan: CEZ:AV0Z50040507 Keywords : cervical carcinoma * hypoxyradiotherapy * californium-252 Subject RIV: BO - Biophysics Impact factor: 3.490, year: 2005
Energy Technology Data Exchange (ETDEWEB)
Amari, S., E-mail: siham_amari@yahoo.fr [Faculté des Sciences de la Nature et de la Vie, Université Hassiba Benbouali, Chlef, 02000 (Algeria); Bouhafs, B. [Laboratoire de Modélisation et Simulation en Sciences des Matériaux, Université Djillali Liabès de Sidi Bel-Abbés, Sidi Bel-Abbés, 22000 (Algeria)
2016-09-15
Based on the first-principles methods, the structural, elastic, electronic, properties and magnetic ordering of californium monopnictides CfX (X = P) have been studied using the full-potential augmented plane wave plus local orbitals (FP-L/APW + lo) method within the framework of density functional theory (DFT). The electronic exchange correlation energy is described by generalized gradient approximation GGA and GGA+U (U is the Hubbard correction). The GGA+U method is applied to the rare-earth 5f states. We have calculated the lattice parameters, bulk modulii and the first pressure derivatives of the bulk modulii. The elastic properties of the studied compounds are only investigated in the most stable calculated phase. In order to gain further information, we have calculated Young’s modulus, shear modulus, anisotropy factor and Kleinman parameter by the aid of the calculated elastic constants. The results mainly show that californium monopnictides CfX (X = P) have an antiferromagnetic spin ordering. Density of states (DOS) and charge densities for both compounds are also computed in the NaCl (B1) structure.
21 CFR 137.255 - Bolted white corn meal.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Bolted white corn meal. 137.255 Section 137.255... Flours and Related Products § 137.255 Bolted white corn meal. (a) Bolted white corn meal is the food prepared by so grinding and sifting cleaned white corn that: (1) Its crude fiber content is less than 1.2...
Energy Technology Data Exchange (ETDEWEB)
Davila R, I
1991-06-15
A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)
International Nuclear Information System (INIS)
Payne, G.F.; Peterson, J.R.
1987-01-01
It appears that we may have prepared Bk(IV) nitrate.nTPAs0 and Bk(IV) perchlorate.nTPAs0 complexes which formed the corresponding Cf(IV) complexes through the beta decay of Bk-249. Definitive proof should come from similar experiments with quantities of Bk-249 large enough to allow spectrophotometric detection of the characteristic f→f transitions in these berkelium and californium species. It is clear, however, that TPAs0 and acetonitrile can play a pivotal role in the stabilization of lanact(IV) species
Experimental studies on californium bioavailability to marine benthic invertebrates
International Nuclear Information System (INIS)
Fowler, S.W.; Carvalho, F.P.; Aston, S.R.
1986-01-01
252 Cf is readily taken up by benthic invertebrates from sea water, reaching whole-body concentration factors of 763 in the polychaete Hermione hystrix, 220 in the shrimp Lysmata seticaudata, 665 in the crab Pilumnus hirtellus and 78 in the bivalve mollusc Venerupis decussata after 3 weeks exposure. Surface sorption plays a predominant role in the uptake process. Depuration in clean sea water was a relatively slow process. The shrimp Lysmata eliminated 252 Cf very rapidly due to moulting. Absorption coefficients for ingested 252 Cf were high, approx. 23% in crabs and approx. 97% in brittlestars. The absorbed fraction was excreted twice as fast from crabs as brittlestars. Exposure of organisms to labelled sediment resulted in low transfer factors that were species dependent. There is some evidence to suggest that uptake from sediments is primarily due to 252 Cf transfer from the pore water. Comparison of these results with published experimental data on other transuranic nuclides in the same or similar species suggests that californium bioavailability is roughly equivalent to that of plutonium and americium. (author)
4 CFR 25.5 - Conformity with signs and directions.
2010-01-01
... 4 Accounts 1 2010-01-01 2010-01-01 false Conformity with signs and directions. 25.5 Section 25.5 Accounts GOVERNMENT ACCOUNTABILITY OFFICE GENERAL PROCEDURES CONDUCT IN THE GOVERNMENT ACCOUNTABILITY OFFICE BUILDING AND ON ITS GROUNDS § 25.5 Conformity with signs and directions. Persons in the GAO...
20 CFR 255.18 - Compromise of overpayments.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Compromise of overpayments. 255.18 Section 255.18 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT... standards which the Board applies in exercising its authority under 31 U.S.C. 3711 to compromise an...
14 CFR 25.255 - Out-of-trim characteristics.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Out-of-trim characteristics. 25.255 Section 25.255 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT...-trim characteristics. (a) From an initial condition with the airplane trimmed at cruise speeds up to...
40 CFR 52.255 - Gasoline transfer vapor control.
2010-07-01
... 40 Protection of Environment 3 2010-07-01 2010-07-01 false Gasoline transfer vapor control. 52.255... (CONTINUED) APPROVAL AND PROMULGATION OF IMPLEMENTATION PLANS California § 52.255 Gasoline transfer vapor control. (a) “Gasoline” means any petroleum distillate having a Reid vapor pressure of 4 pounds or greater...
International Nuclear Information System (INIS)
Lei Xin; Qian Chengyuan; Qing Yi; Zhao Kewei; Yang Zhengzhou; Dai Nan; Zhong Zhaoyang; Tang Cheng; Li Zheng; Gu Xianqing; Zhou Qian; Feng Yan; Xiong Yanli; Shan Jinlu; Wang Dong
2011-01-01
Purpose: To observe, by retrospective analysis, the curative effects and complications due to californium-252 ( 252 Cf) neutron intracavitary brachytherapy (ICBT) combined with external-beam radiotherapy (EBRT) in the treatment of cervical cancer. Methods and Materials: From February 1999 to December 2007, 696 patients with cervical cancer (Stages IB to IIIB) were treated with 252 Cf-ICBT in combination of EBRT. Of all, 31 patients were at Stage IB, 104 at IIA, 363 at IIB, 64 at IIIA, and 134 at IIIB. Californium-252 ICBT was delivered at 7–12 Gy per insertion per week, with a total dose of 29–45 Gy to reference point A in three to five insertions. The whole pelvic cavity was treated with 8-MV X-ray external irradiation at 2 Gy per fraction, four times per week. After 16–38 Gy of external irradiation, the center of the whole pelvic field was blocked with a 4-cm-wide lead shield, with a total external irradiation dose of 44–56 Gy. The total treatment course was 5 to 6 weeks. Results: Overall survival rate at 3 and 5 years for all patients was 76.0% and 64.9%, respectively. Disease-free 3- and 5-year survival rates of patients were 71.2% and 58.4%, respectively. Late complications included vaginal contracture and adhesion, radiation proctitis, radiation cystitis, and inflammatory bowel, which accounted for 5.8%, 7.1%, 6.2%, and 4.9%, respectively. Univariate analysis results showed significant correlation of stage, age, histopathologic grade, and lymph node status with overall survival. Cox multiple regression analysis showed that the independent variables were stage, histopathologic grade, tumor size, and lymphatic metastasis in all patients. Conclusion: Results of this series suggest that the combined use of 252 Cf-ICBT with EBRT is an effective method for treatment of cervical cancer.
Teratogenic effect of Californium-252 irradiation in rats
International Nuclear Information System (INIS)
Satow, Yukio; Lee, Juing-Yi; Hori, Hiroshi; Okuda, Hiroe; Tsuchimoto, Shigeo; Sawada, Shozo; Yokoro, Kenjiro
1989-01-01
The teratogenicity of Californium-252 (Cf-252) irradiation which generates approximately 70% 2.3 MeV fast neutron and 30% gamma rays was evaluated. A single whole body exposure of Cf-252 at various doses was given to pregnant rats on day 8 or 9 of pregnancy, followed by microscopic autopsy of the fetuses at the terminal stage of pregnancy to search for external and internal malformations. For comparison, pregnant rats were irradiated with various doses of Cobalt-60 (Co-60) standard gamma rays at the same dose rate (1 rad/min.). The doses were 20-120 rad of Cf-252 and 80-220 rad of Co-60. Using frequency of radiation induced malformations observed on day 8 of pregnancy as an index, relative biological effectiveness (RBE) of 2.3-2.7 was obtained from the straight line obtained by modifying by the least squares method the frequency curves of malformed fetuses in total implants and in surviving fetuses. The types of malformations induced by Cf-252 and Co-60 irradiation were alike. Using fetal LD 50 as an index, 2.4 was obtained as RBE when irradiated on day 8 of pregnancy and 3.1 as that when irradiated on day 9. The results showed that Cf-252 had stronger a teratogenic effect than Co-60 gamma rays. (author)
24 CFR 255.6 - Method of payment of mortgage insurance premiums.
2010-04-01
... insurance premiums. 255.6 Section 255.6 Housing and Urban Development Regulations Relating to Housing and... PROJECTS § 255.6 Method of payment of mortgage insurance premiums. The provisions of 24 CFR 251.6 shall..., DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT...
20 CFR 255.9 - Individual enrolled under supplementary medical insurance plan.
2010-04-01
... supplementary medical insurance premiums will be applied toward payment of such premiums, and the balance of the... medical insurance plan. 255.9 Section 255.9 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS... supplementary medical insurance plan. Where recovery of the overpayment is by setoff as provided for in § 255.6...
37 CFR 255.4 - Definition of digital phonorecord delivery.
2010-07-01
... phonorecord delivery. 255.4 Section 255.4 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF... delivery. A “digital phonorecord delivery” is each individual delivery of a phonorecord by digital... time or for a specified number of performances. A digital phonorecord delivery includes all...
Energy Technology Data Exchange (ETDEWEB)
Shapiro, A; Lin, B I [Cincinnati Univ., Ohio (USA). Dept. of Chemical and Nuclear Engineering; Windham, J P; Kereiakes, J G
1976-07-01
..gamma.. flux density and dose rate distributions have been calculated about implantable californium-252 sources for an infinite tissue medium. Point source flux densities as a function of energy and position were obtained from a discrete-ordinates calculation, and the flux densities were multiplied by their corresponding kerma factors and added to obtain point source dose rates. The point dose rates were integrated over the line source to obtain line dose rates. Container attenuation was accounted for by evaluating the point dose rate as a function of platinum thickness. Both primary and secondary flux densities and dose rates are presented. The agreement with an independent Monte Carlo calculation was excellent. The data presented should be useful for the design of new source configurations.
17 CFR 256.255 - Accumulated deferred investment tax credits.
2010-04-01
... investment tax credits. 256.255 Section 256.255 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... investment tax credits. (a) This account shall be credited and account 411.5, Investment tax credit, debited with investment tax credits deferred by companies which do not apply such credits as a reduction of the...
40 CFR 255.33 - Inclusion of Federal facilities and Native American Reservations.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Inclusion of Federal facilities and Native American Reservations. 255.33 Section 255.33 Protection of Environment ENVIRONMENTAL PROTECTION... Responsibilities of Identified Agencies and Relationship to Other Programs § 255.33 Inclusion of Federal facilities...
15 CFR 25.5 - Review by the reviewing official.
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Review by the reviewing official. 25.5 Section 25.5 Commerce and Foreign Trade Office of the Secretary of Commerce PROGRAM Fraud Civil Remedies... value of property, services, or other benefits, requested or demanded in violation of § 25.3 of this...
Piper, Roman K; Mozhayev, Andrey V; Murphy, Mark K; Thompson, Alan K
2017-09-01
Evaluations of neutron survey instruments, area monitors, and personal dosimeters rely on reference neutron radiations, which have evolved from the heavy reliance on (α,n) sources to a shared reliance on (α,n) and the spontaneous fission neutrons of californium-252 (Cf). Capable of producing high dose equivalent rates from an almost point source geometry, the characteristics of Cf are generally more favorable when compared to the use of (α,n) and (γ,n) sources or reactor-produced reference neutron radiations. Californium-252 is typically used in two standardized configurations: unmoderated, to yield a fission energy spectrum; or with the capsule placed within a heavy-water moderating sphere to produce a softened spectrum that is generally considered more appropriate for evaluating devices used in nuclear power plant work environments. The U.S. Department of Energy Cf Loan/Lease Program, a longtime origin of affordable Cf sources for research, testing and calibration, was terminated in 2009. Since then, high-activity sources have become increasingly cost-prohibitive for laboratories that formerly benefited from that program. Neutron generators, based on the D-T and D-D fusion reactions, have become economically competitive with Cf and are recognized internationally as important calibration and test standards. Researchers from the National Institute of Standards and Technology and the Pacific Northwest National Laboratory are jointly considering the practicality and technical challenges of implementing neutron generators as calibration standards in the U.S. This article reviews the characteristics of isotope-based neutron sources, possible isotope alternatives to Cf, and the rationale behind the increasing favor of electronically generated neutron options. The evaluation of a D-T system at PNNL has revealed characteristics that must be considered in adapting generators to the task of calibration and testing where accurate determination of a dosimetric quantity is
Neutron activation analysis at the Californium User Facility for Neutron Science
International Nuclear Information System (INIS)
Martin, R.C.; Smith, E.H.; Glasgow, D.C.; Jerde, E.A.; Marsh, D.L.; Zhao, L.
1997-12-01
The Californium User Facility (CUF) for Neutron Science has been established to provide 252 Cf-based neutron irradiation services and research capabilities including neutron activation analysis (NAA). A major advantage of the CUF is its accessibility and controlled experimental conditions compared with those of a reactor environment The CUF maintains the world's largest inventory of compact 252 Cf neutron sources. Neutron source intensities of ≤ 10 11 neutrons/s are available for irradiations within a contamination-free hot cell, capable of providing thermal and fast neutron fluxes exceeding 10 8 cm -2 s -1 at the sample. Total flux of ≥10 9 cm -2 s -1 is feasible for large-volume irradiation rabbits within the 252 Cf storage pool. Neutron and gamma transport calculations have been performed using the Monte Carlo transport code MCNP to estimate irradiation fluxes available for sample activation within the hot cell and storage pool and to design and optimize a prompt gamma NAA (PGNAA) configuration for large sample volumes. Confirmatory NAA irradiations have been performed within the pool. Gamma spectroscopy capabilities including PGNAA are being established within the CUF for sample analysis
Application of californium-252 neutron sources for analytical chemistry
International Nuclear Information System (INIS)
Ishii, Daido
1976-01-01
The researches made for the application of Cf-252 neutron sources to analytical chemistry during the period from 1970 to 1974 including partly 1975 are reviewed. The first part is the introduction to the above. The second part deals with general review of symposia, publications and the like. Attention is directed to ERDA publishing the periodical ''Californium-252 Progress'' and to a study group of Cf-252 utilization held by Japanese Radioisotope Association in 1974. The third part deals with its application for radio activation analysis. The automated absolute activation analysis (AAAA) of Savannha River is briefly explained. The joint experiment of Savannha River operation office with New Brunswick laboratory is mentioned. Cf-252 radiation source was used for the non-destructive analysis of elements in river water. East neutrons of Cf-252 were used for the quantitative analysis of lead in paints. Many applications for industrial control processes have been reported. Attention is drawn to the application of Cf-252 neutron sources for the field search of neutral resources. For example, a logging sonde for searching uranium resources was developed. the fourth part deals with the application of the analysis with gamma ray by capturing neutrons. For example, a bore hole sonde and the process control analysis of sulfur in fuel utilized capture gamma ray. The prompt gamma ray by capturing neutrons may be used for the nondestructive analysis of enrivonment. (Iwakiri, K.)
International Nuclear Information System (INIS)
Belogorlov, E.A.; Britvich, G.I.; Getmanov, V.B.
1985-01-01
Construction of labyrinths in points of communication output from the storage-ring under construction is accompanied by numerous difficulties due to a considerable number of gas and cryogenic pipelines, which require large cross sections at the minimal length of the pipelines proper for their location. It results in unfavourable for radiation attenuation ratios between cross section and length of the labyrinth separate sections. Neutron spectra in a model concrete labyrinth, at the entrance to which a neutron source with fission spectrum (californium-252) and the same source in a polyethylene moderator are located, are measured. On the basis of the spectra obtained the formation of fluence and equivalent dose along the labyrinth geometric axis is analyzed. Conditions permitting actually to reduce radiation dose in the labyrinth (dead end provision, the use of cover materials, construction of diaphragms and shielding plates) are simulated
16 CFR 255.2 - Consumer endorsements.
2010-01-01
... ENDORSEMENTS AND TESTIMONIALS IN ADVERTISING § 255.2 Consumer endorsements. (a) An advertisement employing endorsements by one or more consumers about the performance of an advertised product or service will be... persons in such advertisements are not actual consumers of the advertised product. Example 1: A brochure...
International Nuclear Information System (INIS)
Sharma, S.
1986-01-01
A storage and shielding facility for 300 μg of Californium-252 sources was designed and constructed. Though the safe was in a permanent location, the fact that it consisted of a lead bucket surrounded by polyethylene pellets made it simple, movable and inexpensive. If need be, more quantities of Cf-252 could be added without altering the basic design and sacrificing the radiation protection guidelines. The measured radiation levels from 300 μg of stored Cf-252 in and around the storage vault were lower than the expected dose rates by a factor of 5. The measured radiation levels around the occupied environs of the facility were below the maximum permissible yearly dose of 500mrem for non-occupational workers. A transport vessel was designed and constructed to carry up to 50 μg of Californium-252 sources. It consisted of a standard 55 gallon steel drum on casters containing cylindrical lead shield surrounded by polyethylene pellets. The measured maximum surface dose rates on the drum and at one meter away were within the radiation protection guidelines and were less than the expected dose rates. A portable shield was designed and constructed to protect the body in afterloading operations and handling of the sources. It consisted of polyethylene pellets in an aluminum box and an attached 10 cm thick plexiglass eye shield. The simple design, with the ease of using polyethylene pellets can be extended to construct bedside shields
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Procedures for resolving harmful interference... GHz bands. 25.255 Section 25.255 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Standards § 25.255 Procedures for resolving...
24 CFR 221.255 - Assignment option.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Assignment option. 221.255 Section... Assignment option. (a) A mortgagee holding a mortgage insured pursuant to a conditional or firm commitment issued on or before November 30, 1983 has the option to assign, transfer and deliver to the Commissioner...
Energy Technology Data Exchange (ETDEWEB)
Benker, Dennis [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Delmau, Laetitia Helene [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Dryman, Joshua Cory [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)
2017-07-01
This report presents the studies carried out to demonstrate the possibility of quantitatively extracting trivalent actinides and lanthanides from highly acidic solutions using a neutral ligand-based solvent extraction system. These studies stemmed from the perceived advantage of such systems over cationexchange- based solvent extraction systems that require an extensive feed adjustment to make a low-acid feed. The targeted feed solutions are highly acidic aqueous phases obtained after the dissolution of curium targets during a californium (Cf) campaign. Results obtained with actual Cf campaign solutions, but highly diluted to be manageable in a glove box, are presented, followed by results of tests run in the hot cells with Cf campaign rework solutions. It was demonstrated that a solvent extraction system based on the tetraoctyl diglycolamide molecule is capable of quantitatively extracting trivalent actinides from highly acidic solutions. This system was validated using actual feeds from a Cf campaign.
Neutron activation analysis of the calcium content in vivo, using a 50μg source of californium 252
International Nuclear Information System (INIS)
Guey, A.; Zech, P.Y.; Meary, M.F.; Leitienne, P.
1975-01-01
Owing to the recent commercialisation of californium 252 it is now possible to obtain neutron fluxes strong enough for precise activation of the calcium content of biological targets. After the preliminary measurements necessary to establish the most suitable conditions for irradiating 3 to 5cm thick targets, two parallel sets of experiments were developed. In the first the medium-term total calcium variation was studied in 20 rats, 16 suffering from chronic kidney deficiency. In the second the precision expected as a function of the calcium content of the irradiated target was examined, using 3 sets of tissue equivalent standards of calcium contents 5, 20 and 50g respectively. The first results obtained on calcium 49 in vivo show that a calcium content variation can be followed with a sensitivity threshold below that obtained by conventional methods [fr
Human Factors evaluation of LCS 254 and 255
International Nuclear Information System (INIS)
Goffe, L.; Held, J.E.
1993-01-01
This report includes the results of the Human Factors evaluation of the local control stations (LCS) 254 and 255 performed by Savannah River Technology Center (SRTC) Human Factors. Recommendations are included in order that the panel designs will be upgraded to comply with human engineering design guidelines. Figures 1 and 2 are included as examples of recommended changes. Also, consideration was given to including the proposed engineering changes which are currently on-going for LCS 255. Appendix A identifies the human engineering requirements from NUREG-0700 which were used in the evaluation process, and the areas of the design which do not comply with the guidelines. Those areas of the panel design which fail to comply with the human engineering guidelines are label location, label content, location aids, panel layout, and control display integration. Each of these design deficiencies and proposed corrections are described in this report
International Nuclear Information System (INIS)
Guey, A.; Leitienne, P.; Zech, P.Y.; Traeger, J.; Doyen, J.B.; Breton, J.P.
1979-01-01
With californium-252 it is easy to obtain a high neutron flux of the order of 10 9 n/s. The mean energy of this radiation, which is close on 2 MeV, activates calcium very well. The authors describe a storage and irradiator unit with a 100 μg californium source, with which it will henceforth be possible to develop this technique of measuring the calcium of the hand in a hospital. The test programme has three distinct phases: (1) irradiation of the biological target for 10 min; (2) after a transfer period of 30 s, detection of the radiation emitted by the 49 Ca for 600 s; (3) processing of the numerical data received, which are transmitted on line to a T 1600 calculator. The weight is found by comparing the activity induced in the unknown calcium mass with that induced in a phantom chosen as the activity standard. The reproducibility of the method is of the order of 3% (5% at the worst). The gross standardized result is edited automatically. For physical and clinical reasons, the hand is chosen as the reference part of the body in 70 control subjects. The local irradiation dose is less than 2 rem. The bone calcium content is 14.3+-1.9 g in men and 10.1+-1.3 g in women. In clinical application of the technique it is necessary to differentiate between the normal calcium content and the calcium content found with a pathological state. This makes it necessary to express the measurement in the form of a volume mass (rho). The volume of the hand skeleton (V in cm 3 ) is calculated from the corresponding bone surface (S in cm 2 ) measured by planimetry with the relationship V=8.925 exp 0.0205.S, found after studying 80 hand skeletons. In our control subjects the calcium bone volume mass was 0.288 g/cm 3 in men and 0.282 g/cm 3 in women. There is a very significant difference (p<0.001) in a population of 88 subjects with chronic renal insufficiencies at the terminal stage: rho=0.233 in men and 0.235 in women
Directory of Open Access Journals (Sweden)
Clayton Dickerson
2013-02-01
Full Text Available An electron beam ion source (EBIS will be constructed and used to charge breed ions from the californium rare isotope breeder upgrade (CARIBU for postacceleration into the Argonne tandem linear accelerator system (ATLAS. Simulations of the EBIS charge breeder performance and the related ion transport systems are reported. Propagation of the electron beam through the EBIS was verified, and the anticipated incident power density within the electron collector was identified. The full normalized acceptance of the charge breeder with a 2 A electron beam, 0.024π mm mrad for nominal operating parameters, was determined by simulating ion injection into the EBIS. The optics of the ion transport lines were carefully optimized to achieve well-matched ion injection, to minimize emittance growth of the injected and extracted ion beams, and to enable adequate testing of the charge bred ions prior to installation in ATLAS.
40 CFR 1054.255 - What decisions may EPA make regarding my certificate of conformity?
2010-07-01
... my certificate of conformity? 1054.255 Section 1054.255 Protection of Environment ENVIRONMENTAL... regarding my certificate of conformity? (a) If we determine your application is complete and shows that the... of conformity for your emission family for that model year. We may make the approval subject to...
40 CFR 1060.255 - What decisions may EPA make regarding my certificate of conformity?
2010-07-01
... my certificate of conformity? 1060.255 Section 1060.255 Protection of Environment ENVIRONMENTAL... regarding my certificate of conformity? (a) If we determine your application is complete and shows that the... of conformity for your emission family for that production period. We may make the approval subject...
40 CFR 1045.255 - What decisions may EPA make regarding my certificate of conformity?
2010-07-01
... my certificate of conformity? 1045.255 Section 1045.255 Protection of Environment ENVIRONMENTAL... certificate of conformity? (a) If we determine your application is complete and shows that the engine family meets all the requirements of this part and the Clean Air Act, we will issue a certificate of conformity...
40 CFR 1039.255 - What decisions may EPA make regarding my certificate of conformity?
2010-07-01
... my certificate of conformity? 1039.255 Section 1039.255 Protection of Environment ENVIRONMENTAL... certificate of conformity? (a) If we determine your application is complete and shows that the engine family meets all the requirements of this part and the Act, we will issue a certificate of conformity for your...
40 CFR 1048.255 - What decisions may EPA make regarding my certificate of conformity?
2010-07-01
... my certificate of conformity? 1048.255 Section 1048.255 Protection of Environment ENVIRONMENTAL... of conformity? (a) If we determine your application is complete and shows that the engine family meets all the requirements of this part and the Act, we will issue a certificate of conformity for your...
21 CFR 111.255 - What is the requirement to establish a batch production record?
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false What is the requirement to establish a batch production record? 111.255 Section 111.255 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION CURRENT GOOD MANUFACTURING PRACTICE IN...
40 CFR 1051.255 - What decisions may EPA make regarding my certificate of conformity?
2010-07-01
... my certificate of conformity? 1051.255 Section 1051.255 Protection of Environment ENVIRONMENTAL... conformity? (a) If we determine your application is complete and shows that the engine family meets all the requirements of this part and the Act, we will issue a certificate of conformity for your engine family for...
40 CFR 255.23 - Joint identification of agencies.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Joint identification of agencies. 255... officials to reach a consensus regarding the agency(ies) to be formally identified. (f) When a consensus is... consensus is in agreement with the State opinion, the State should confirm that agreed arrangement, formally...
Long-term effects of an intracavitary treatment with californium-252 on normal tissue
International Nuclear Information System (INIS)
Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.
1976-01-01
About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with 252 Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from 252 Cf and 7000 rad from 226 Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for 252 Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from 252 Cf and 5000 rad from 226 Ra
40 CFR 80.255 - Compliance plans and demonstration of commitment to produce low sulfur gasoline.
2010-07-01
... commitment to produce low sulfur gasoline. 80.255 Section 80.255 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Gasoline Sulfur... gasoline. The requirements of this section apply to any refiner approved for small refiner standards who...
Feasibility and market potential of protein determination of wheat using californium-252
International Nuclear Information System (INIS)
Roberts, T.C. Jr.; Eckhoff, N.D.; Clack, R.W.; Roberts, T.C. Sr.
1976-01-01
To evaluate the feasibility of protein determination by capture gamma-ray analysis using californium-252 neutrons, an in-situ protein analysis system for use by grain handlers has been examined. Three 227 kilogram (approximately) lots of wheat were used to determine the amount of nitrogen present. Protein analyses by the Kjeldahl method were obtained from samples taken before and after the capture gamma-ray analyses. The 5.267-MeV gamma-ray was selected for use in this study as a compromise between efficiency and interference from other elements. The associated counting equipment was a multichannel analyzer with pulse shaping electronic and analysis computing equipment. A linear regression program was used to compare the regions of interest to the Kjeldahl protein averages. The counts composing each peak were summed and normalized using the total count of the hydrogen peak. The normalized nitrogen percentages indicate a significant correlation between the spectral regions and the Kjeldahl analyses. To a first approximation, the value of wheat is the wheat protein. At the present time, protein testing of wheat is destructive, cumbersome, and time-consuming as compared to the potential for capture gamma-ray analysis testing. Assuming that such a protein analysis unit can analyze 42 tonne of wheat per hour, over 120 units would be needed to monitor one-half the U.S. annual wheat production. A 0.5% improvement in processor realizations and grain throughput value of $167.00 per tonne will result in a projected savings of $150,000 per year per unit
33 CFR 106.255 - Security systems and equipment maintenance.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Security systems and equipment... Shelf (OCS) Facility Security Requirements § 106.255 Security systems and equipment maintenance. (a) Security systems and equipment must be in good working order and inspected, tested, calibrated, and...
International Nuclear Information System (INIS)
Cardoso, Antonio
1976-01-01
Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction 55 Mn (n.gamma) 56 Mn, high concentration of manganese in the matrix and short half - life of 56 Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions 56 Fe(n,p) 56 Mn and 59 Co (n, α) 56 were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)
39 CFR 255.4 - Accessibility to electronic and information technology.
2010-07-01
... AND INFORMATION TECHNOLOGY § 255.4 Accessibility to electronic and information technology. (a) In... burden, that the electronic and information technology the agency procures allows— (1) Individuals with... 39 Postal Service 1 2010-07-01 2010-07-01 false Accessibility to electronic and information...
Geometric distortion of F255W for WFPC2 Cycle 12
Kozhurina-Platais, Vera
2003-07-01
The goal of astrometric calibration of the HST WFPC2 is to obtain a coordinate system free of distortion down to the precision level of 1 mas. That precision is necessary for future astrometric work {e.g., on proper motions} involving a combination of the archival WFPC2 and recent ACS images. So far such a calibration has only been obtained for the wide bandpass F555W filter {Anderson and King, 2003}. Recently V. Kozhurina-Platais {ISR, 2003-002} has expanded the analysis of the geometric distortion of WFPC2 as a function of wavelength for two other broadband filters, {F814W and F300W}, and has also established the plate scale and skew parameters {non-perpendicularity of X and Y axes} for these filters. This study points to the importance of astrometric calibration at wavelengths shorter than 400 nanometers. This proposal seeks observations in the FUV filter F255W of the Inner Calibration Field in the globular cluster omega Cen. It is expected that the amount of distortion in the F255W filter with respect to the F555W filter will be higher by 5% but this must be established from observations. A total of four astrometric calibrations in F255W {proposed here}, and F300W, F555, F814W {already completed} will allow us to interpolate such a calibration for any other filter from FUV to near infrared.
41 CFR 102-117.255 - What actions may I take if the TSP's performance is not satisfactory?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What actions may I take if the TSP's performance is not satisfactory? 102-117.255 Section 102-117.255 Public Contracts and... may I take if the TSP's performance is not satisfactory? If the TSP's performance is not satisfactory...
42 CFR 440.255 - Limited services available to certain aliens.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Limited services available to certain aliens. 440... Limits Applicable to All Services § 440.255 Limited services available to certain aliens. (a) FFP for services. FFP is available for services provided to aliens described in this section which are necessary to...
Development of tilted fibre Bragg gratings using highly coherent 255 ...
Indian Academy of Sciences (India)
R&D C-1 Block, Raja Ramanna Centre for Advanced Technology, Indore 452 013, India. ∗. Corresponding author. E-mail: oprakash@rrcat.gov.in. DOI: 10.1007/s12043-013-0672-7; ePublication: 6 February 2014. Abstract. This paper reports the study on development of tilted fibre Bragg gratings using highly coherent 255 ...
18 CFR 367.2550 - Account 255, Accumulated deferred investment tax credits.
2010-04-01
..., Accumulated deferred investment tax credits. 367.2550 Section 367.2550 Conservation of Power and Water... 255, Accumulated deferred investment tax credits. This account must be credited with all investment tax credits deferred by companies that have elected to follow deferral accounting, partial or full...
InP Heterojunction Bipolar Transistor Amplifiers to 255 GHz
Radisic, Vesna; Sawdai, Donald; Scott, Dennis; Deal, William; Dang, Linh; Li, Danny; Cavus, Abdullah; To, Richard; Lai, Richard
2009-01-01
Two single-stage InP heterojunction bipolar transistor (HBT) amplifiers operate at 184 and 255 GHz, using Northrop Grumman Corporation s InP HBT MMIC (monolithic microwave integrated circuit) technology. At the time of this reporting, these are reported to be the highest HBT amplifiers ever created. The purpose of the amplifier design is to evaluate the technology capability for high-frequency designs and verify the model for future development work.
46 CFR 28.255 - Bilge pumps, bilge piping, and dewatering systems.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Bilge pumps, bilge piping, and dewatering systems. 28... the Aleutian Trade § 28.255 Bilge pumps, bilge piping, and dewatering systems. (a) Each vessel must be equipped with a bilge pump and bilge piping capable of draining any watertight compartment, other than...
Design study of a 25.5-MHz split coaxial RFQ
International Nuclear Information System (INIS)
Arai, Shigeaki; Imanishi, Akira; Morimoto, Teruhisa; Shibuya, Shinji; Tojyo, Eiki; Tokuda, Noboru.
1989-08-01
A 25.5-MHz split coaxial RFQ with modulated vanes is now being fabricated. The RFQ, 2.1 m in length and 0.9 m in diameter, will accelerate ions with a charge-to-mass ratio greater than 1/30 from 1 keV/n up to 45.4 keV/n. The design works on beam dynamics and cavity fabrication are reported. (author)
A High Mass & Low Envelope Fraction for the Warm Neptune K2-55b
Dressing, Courtney; Sinukoff, Evan; Fulton, Benjamin; Lopez, Eric; Beichman, Charles; Howard, Andrew; Knutson, Heather; Werner, Michael; Schlieder, Joshua; Benneke, Björn; Crossfield, Ian; Isaacson, Howard; Krick, Jessica; Gorjian, Varoujan; Livingston, John; Petigura, Erik; Akeson, Rachel; Batygin, Konstantin; Christiansen, Jessie; Ciardi, David; Crepp, Justin; Jasmine Gonzales, Erica; Hardegree-Ullman, Kevin; Hirsch, Lea; Kosiarek, Molly; Weiss, Lauren
2018-01-01
The NASA K2 mission is using the Kepler spacecraft to search for transiting planets in multiple fields along the ecliptic plane. One of the planets detected by K2 is K2-55b, a warm Neptune in a short-period orbit (2.8 days) around a late K dwarf. We previously obtained near-infrared spectra from IRTF/SpeX to characterize the system and found that the host star K2-55 has a radius of 0.715 (+0.043/-0.040) solar radii, a mass of 0.668 (+/- 0.069) solar masses, and an effective temperature of 4300K (+100/-107). We then combined our updated stellar properties with new fits to the K2 photometry to estimate a planet radius of 4.38 (+0.29/-0.25) Earth radii, confirmed the transit ephemeris using Spitzer/IRAC (GO 11026, PI Werner), and embarked on radial velocity observations with Keck/HIRES to measure the planet mass. Our RV data suggest that K2-55b is much more massive than expected, indicating that the planet has a high density despite having a relatively high mass. The lack of a significant volatile envelope tests current theories of gas giant formation and indicates that K2-55b may have avoided runaway accretion by migration, delayed formation, or inefficient core accretion. We gratefully acknowledge funding from the NASA Sagan Fellowship Program and the NASA K2 Guest Observer Program. This work is based in part on observations made with the Spitzer Space Telescope, which is operated by the Jet Propulsion Laboratory, California Institute of Technology under a contract with NASA. Support for this work was provided by NASA through an award issued by JPL/Caltech.
Energy Technology Data Exchange (ETDEWEB)
Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.
1976-01-01
About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with /sup 252/Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from /sup 252/Cf and 7000 rad from /sup 226/Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for /sup 252/Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from /sup 252/Cf and 5000 rad from /sup 226/Ra.
International Nuclear Information System (INIS)
Ostroumov, P. N.; Barcikowski, A.; Dickerson, C. A.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. P.; Pikin, A. I.
2015-01-01
The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz
Directory of Open Access Journals (Sweden)
Fantucci Piercarlo
2010-03-01
Full Text Available Abstract Background GPR17 is a hybrid G-protein-coupled receptor (GPCR activated by two unrelated ligand families, extracellular nucleotides and cysteinyl-leukotrienes (cysteinyl-LTs, and involved in brain damage and repair. Its exploitment as a target for novel neuro-reparative strategies depends on the elucidation of the molecular determinants driving binding of purinergic and leukotrienic ligands. Here, we applied docking and molecular dynamics simulations (MD to analyse the binding and the forced unbinding of two GPR17 ligands (the endogenous purinergic agonist UDP and the leukotriene receptor antagonist pranlukast from both the wild-type (WT receptor and a mutant model, where a basic residue hypothesized to be crucial for nucleotide binding had been mutated (R255I to Ile. Results MD suggested that GPR17 nucleotide binding pocket is enclosed between the helical bundle and extracellular loop (EL 2. The driving interaction involves R255 and the UDP phosphate moiety. To support this hypothesis, steered MD experiments showed that the energy required to unbind UDP is higher for the WT receptor than for R255I. Three potential binding sites for pranlukast where instead found and analysed. In one of its preferential docking conformations, pranlukast tetrazole group is close to R255 and phenyl rings are placed into a subpocket highly conserved among GPCRs. Pulling forces developed to break polar and aromatic interactions of pranlukast were comparable. No differences between the WT receptor and the R255I receptor were found for the unbinding of pranlukast. Conclusions These data thus suggest that, in contrast to which has been hypothesized for nucleotides, the lack of the R255 residue doesn't affect the binding of pranlukast a crucial role for R255 in binding of nucleotides to GPR17. Aromatic interactions are instead likely to play a predominant role in the recognition of pranlukast, suggesting that two different binding subsites are present on GPR17.
Wahid, Kareem; Sanchez, Patrick; Hannan, Mohammad
2014-03-01
In the field of nuclear science, neutron flux is an intrinsic property of nuclear reaction facilities that is the basis for experimental irradiation calculations and analysis. In the Rio Grande Valley (Texas), the UTPA Neutron Research Facility (NRF) is currently the only neutron facility available for experimental research purposes. The facility is comprised of a 20-microgram californium-252 neutron source surrounded by a shielding cascade containing different irradiation cavities. Thermal and fast neutron flux values for the UTPA NRF have yet to be fully investigated and may be of particular interest to biomedical studies in low neutron dose applications. Though a variety of techniques exist for the characterization of neutron flux, neutron activation analysis (NAA) of metal and nonmetal foils is a commonly utilized experimental method because of its detection sensitivity and availability. The aim of our current investigation is to employ foil activation in the determination of neutron flux values for the UTPA NSRF for further research purposes. Neutron spectrum unfolding of the acquired experimental data via specialized software and subsequent comparison for consistency with computational models lends confidence to the results.
Evaluation of variable speed limits on I-270/I-255 in St. Louis.
2010-10-01
In May of 2008, MoDOT installed a Variable Speed Limit (VSL) system along the I270/I255 corridor in St. Louis. This project evaluated the VSL system and its potential impacts and benefits to the transportation users. The technical system ...
Maghzal, Ghassan J; Brennan, Stephen O; Fellowes, Andrew P; Spearing, Ruth; George, Peter M
2003-02-21
Sequencing of all three fibrinogen genes from an individual with hypofibrinogenaemia led to the identification of two new point mutations in the Bbeta gene. Family studies showed the mutations Bbeta255 Arg-->His (Fibrinogen Merivale) and Bbeta148 Lys-->Asn (Fibrinogen Merivale II) were on different alleles and that only the Bbeta255 Arg-->His mutation segregated with hypofibrinogenaemia. Three simple heterozygotes for this mutation had mean fibrinogen concentrations of 1.4 mg/ml, while heterozygotes for the Bbeta148 Lys-->Asn mutation had normal fibrinogen concentrations. ESI MS analysis of endoproteinase Asp-N digests of Bbeta chains showed that the Bbeta255 Arg-->His substitution was not expressed in plasma, confirming it as the cause of the hypofibrinogenaemia. The Bbeta148 Lys-->Asn chains, on the other hand, were equally expressed with wild-type Bbeta chains in simple heterozygotes. Genotype analysis failed to detect either substitution in 182 healthy controls. Arg(255) is located in the first strand of the five-stranded sheet that forms the main feature of the betaD domain and appears to form an essential H bond with Gly(414). Both the Arg and Gly are absolutely conserved, not only in all known Bbeta chains, but also in all homologous alphaE and gamma chains and in all fibrinogen-related proteins. Protein instability from loss of this contact could easily explain the association of this mutation with hypofibrinogenaemia.
Efficacy of comprehensive treatment on amblyopia in 255 children
Directory of Open Access Journals (Sweden)
Xing-Hui Xu
2015-11-01
Full Text Available AIM: To study the efficacy of comprehensive treatment on amblyopia in children.METHODS: A total of 255 cases 386 eyes diagnosed as amblyopia were given refractive errors correction, multi-media training system, coveting treatment, CAM treatment and red light stimulation. The relationship of therapeutic effect with age, type and degree of amblyopia was analyzed. RESULTS: The total effective rate was 94%, and total cure rate was 71%. Mild amblyopia, 3~6 years group, ametropia amblyopia had the highest cure rate. CONCLUSION: Efficacy of comprehensive treatment on amblyopia is certain, which is relation with age, type and degree of amblyopia.
7 CFR 2.55 - Deputy Under Secretary for Food, Nutrition, and Consumer Services.
2010-01-01
... the Under Secretary for Food, Nutrition, and Consumer Services § 2.55 Deputy Under Secretary for Food... made by the Under Secretary for Food, Nutrition, and Consumer Services to the Deputy Under Secretary for Food, Nutrition and Consumer Services, to be exercised only during the absence or unavailability...
Energy Technology Data Exchange (ETDEWEB)
Pereira, C. B.; Drake, N. A.; Roig, F. [Observatório Nacional/MCTIC, Rua Gen. José Cristino 77, Rio de Janeiro, 20921-400 (Brazil); Baella, N. O. [Unidad de Astronomía, Instituto Geofísico del Perú, Lima, Per (Peru); Miranda, L. F., E-mail: claudio@on.br, E-mail: drake@on.br, E-mail: froig@on.br, E-mail: nobar.baella@gmail.com, E-mail: lfm@iaa.es [Instituto de Astrofísica de Andalucía - CSIC, C/Glorieta de la Astronomía s/n, E-18008 Granada (Spain)
2017-05-20
We report on the analysis of high-resolution optical spectra of four symbiotic stars: AS 255, MWC 960, RW Hya, and StH α 32. We employ the local-thermodynamic-equilibrium model atmospheres of Kurucz and the spectral analysis code moog to analyze the spectra. The abundance of barium and carbon was derived using the spectral synthesis technique. The chemical composition of the atmospheres of AS 255 and MWC 960 show that they are metal-poor K giants with metallicities of −1.2 and −1.7 respectively. StH α 32 is a CH star and also a low-metallicity object (−1.4). AS 255 and MWC 960 are yellow symbiotic stars and, like other previously studied yellow symbiotics, are s -process enriched. StH α 32, like other CH stars, is also an s -process and carbon-enriched object. RW Hya has a metallicity of −0.64, a value in accordance with previous determinations, and is not s -process enriched. Based on its position in the 2MASS diagram, we suggest that RW Hya is at an intermediate position between yellow symbiotics and classical S-type symbiotics. We also discuss whether the dilution effect was the mechanism responsible for the absence of the s -process elements overabundance in RW Hya. The luminosity obtained for StH α 32 is below the luminosity of the asymptotic giant branch (AGB) stars that started helium burning (via thermal pulses) and became self-enriched in neutron-capture elements. Therefore, its abundance peculiarities are due to mass transfer from the previous thermally pulsing AGB star (now the white dwarf) that was overabundant in s -process elements. For the stars AS 255 and MWC 960, the determination of their luminosities was not possible due to uncertainties in their distance and interstellar absorption. AS 255 and MWC 960 have a low galactic latitude and could be bulge stars or members of the inner halo population. The heavy-element abundance distribution of AS 255 and MWC 960 is similar to that of the other yellow symbiotics previously analyzed. Their
International Nuclear Information System (INIS)
Pereira, C. B.; Drake, N. A.; Roig, F.; Baella, N. O.; Miranda, L. F.
2017-01-01
We report on the analysis of high-resolution optical spectra of four symbiotic stars: AS 255, MWC 960, RW Hya, and StH α 32. We employ the local-thermodynamic-equilibrium model atmospheres of Kurucz and the spectral analysis code moog to analyze the spectra. The abundance of barium and carbon was derived using the spectral synthesis technique. The chemical composition of the atmospheres of AS 255 and MWC 960 show that they are metal-poor K giants with metallicities of −1.2 and −1.7 respectively. StH α 32 is a CH star and also a low-metallicity object (−1.4). AS 255 and MWC 960 are yellow symbiotic stars and, like other previously studied yellow symbiotics, are s -process enriched. StH α 32, like other CH stars, is also an s -process and carbon-enriched object. RW Hya has a metallicity of −0.64, a value in accordance with previous determinations, and is not s -process enriched. Based on its position in the 2MASS diagram, we suggest that RW Hya is at an intermediate position between yellow symbiotics and classical S-type symbiotics. We also discuss whether the dilution effect was the mechanism responsible for the absence of the s -process elements overabundance in RW Hya. The luminosity obtained for StH α 32 is below the luminosity of the asymptotic giant branch (AGB) stars that started helium burning (via thermal pulses) and became self-enriched in neutron-capture elements. Therefore, its abundance peculiarities are due to mass transfer from the previous thermally pulsing AGB star (now the white dwarf) that was overabundant in s -process elements. For the stars AS 255 and MWC 960, the determination of their luminosities was not possible due to uncertainties in their distance and interstellar absorption. AS 255 and MWC 960 have a low galactic latitude and could be bulge stars or members of the inner halo population. The heavy-element abundance distribution of AS 255 and MWC 960 is similar to that of the other yellow symbiotics previously analyzed. Their
Appendices : evaluation of variable speed limits on I-270/I-255 in St. Louis.
2010-10-01
In May of 2008, MoDOT installed a Variable Speed Limit (VSL) system along the I-270/I-255 corridor in : St. Louis. This project evaluated the VSL system and its potential impacts and benefits to the : transportation users. The technical system ...
Retrospective Evaluation Of MRI Findings Of Knee Joint In 255 Patients
Directory of Open Access Journals (Sweden)
Ahmet Mete
2003-03-01
Full Text Available Retrospective evaluation of knee MRI obtained from 255 cases and to demonstrate most common knee joint pathologies in our region.In our study knee joints of 255 cases who admitted to different clinics of our hospital with various complains of knee between October 1996 and December 1998 were examined in wide spectrum with MRI. Via 1.0 Tesla MRI device and special knee coil in sagittal, coronal and axial plains MRI images were obtained. The number of male and female patients were 173 and 82 and their ages were ranged between 14 and 70, and the mean age was 3413.The most common knee pathologies were intra-articular fluid (%58.04, medial (%46,66 and lateral (%12.55 meniscal injuries, anterior cruciate ligament injury (%17.25 and osteoarthritis (%14.9. The other important lesions were degeneration of medial and lateral meniscus, Baker’s cyst, bursitis, posterior cruciate ligament injury , medial and lateral collateral ligament injuries, synovial hypertrophy, chondromalasia of patella, and contusion.In our images of knee the most common lesions were injuries of meniscus and ligament. Because of being noninvasive technique for knee joint pathologies, capacity of multiplanar imaging, high contrast resolution and chance of detailed anatomic evaluation MR imaging was found to be most appropriate imaging technique for knee joint pathologies.
Acceleration tests of the INS 25.5-MHz split coaxial RFQ
International Nuclear Information System (INIS)
Arai, S.; Imanishi, A.; Morimoto, T.; Tojyo, E.; Tokuda, N.; Shibuya, S.
1991-05-01
The INS 25.5-MHz split coaxial RFQ, a linac that accelerates ions with a charge-to-mass ratio greater than 1/30 from 1 to 45.4 keV/u, is now undergoing acceleration tests with a beam of molecular nitrogen (N 2 + ) ions. Results so far obtained show that the RFQ operates in accordance with the design. Presented are preliminary results on the beam performance: emittances of the in- and output beams, output energy and its spread, and beam transmission. (author)
Directory of Open Access Journals (Sweden)
Pedro Jacquez
Full Text Available Anthrax toxin receptors act as molecular clamps or switches that control anthrax toxin entry, pH-dependent pore formation, and translocation of enzymatic moieties across the endosomal membranes. We previously reported that reduction of the disulfide bonds in the immunoglobulin-like (Ig domain of the anthrax toxin receptor 2 (ANTXR2 inhibited the function of the protective antigen (PA pore. In the present study, the disulfide linkage in the Ig domain was identified as Cys255-Cys279 and Cys230-Cys315. Specific disulfide bond deletion mutants were achieved by replacing Cys residues with Ala residues. Deletion of the disulfide bond C255-C279, but not C230-C315, inhibited the PA pore-induced release of the fluorescence dyes from the liposomes, suggesting that C255-C279 is essential for PA pore function. Furthermore, we found that deletion of C255-C279 did not affect PA prepore-to-pore conversion, but inhibited PA pore membrane insertion by trapping the PA membrane-inserting loops in proteinaceous hydrophobic pockets. Fluorescence spectra of Trp59, a residue adjacent to the PA-binding motif in von Willebrand factor A (VWA domain of ANTXR2, showed that deletion of C255-C279 resulted in a significant conformational change on the receptor ectodomain. The disulfide deletion-induced conformational change on the VWA domain was further confirmed by single-particle 3D reconstruction of the negatively stained PA-receptor heptameric complexes. Together, the biochemical and structural data obtained in this study provides a mechanistic insight into the role of the receptor disulfide bond C255-C279 in anthrax toxin action. Manipulation of the redox states of the receptor, specifically targeting to C255-C279, may become a novel strategy to treat anthrax.
Laser parameters of a Fe : ZnSe crystal in the 85-255-K temperature range
Voronov, AA; Kozlovskii, [No Value; Korostelin, YV; Podmar'kov, YP; Frolov, MP
The temperature dependence of the efficiency of a laser based on a Fe:ZnSe crystal grown from the vapour phase by the free-growth method is studied in the 85-255-K temperature range. As the temperature was increased, the slope efficiency of the laser with respect to absorbed energy decreased from
International Nuclear Information System (INIS)
Henzlova, D.; Menlove, H.O.; Rael, C.D.; Trellue, H.R.; Tobin, S.J.; Park, Se-Hwan; Oh, Jong-Myeong; Lee, Seung-Kyu; Ahn, Seong-Kyu; Kwon, In-Chan; Kim, Ho-Dong
2016-01-01
This paper presents results of the first experimental demonstration of the Californium Interrogation Prompt Neutron (CIPN) instrument developed within a multi-year effort launched by the Next Generation Safeguards Initiative Spent Fuel Project of the United States Department of Energy. The goals of this project focused on developing viable non-destructive assay techniques with capabilities to improve an independent verification of spent fuel assembly characteristics. For this purpose, the CIPN instrument combines active and passive neutron interrogation, along with passive gamma-ray measurements, to provide three independent observables. This paper describes the initial feasibility demonstration of the CIPN instrument, which involved measurements of four pressurized-water-reactor spent fuel assemblies with different levels of burnup and two initial enrichments. The measurements were performed at the Post-Irradiation Examination Facility at the Korea Atomic Energy Institute in the Republic of Korea. The key aim of the demonstration was to evaluate CIPN instrument performance under realistic deployment conditions, with the focus on a detailed assessment of systematic uncertainties that are best evaluated experimentally. The measurements revealed good positioning reproducibility, as well as a high degree of insensitivity of the CIPN instrument's response to irregularities in a radial burnup profile. Systematic uncertainty of individual CIPN instrument signals due to assembly rotation was found to be <4.5%, even for assemblies with fairly extreme gradients in the radial burnup profile. These features suggest that the CIPN instrument is capable of providing a good representation of assembly average characteristics, independent of assembly orientation in the instrument.
Energy Technology Data Exchange (ETDEWEB)
Henzlova, D., E-mail: henzlova@lanl.gov [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Menlove, H.O.; Rael, C.D.; Trellue, H.R.; Tobin, S.J. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Park, Se-Hwan; Oh, Jong-Myeong; Lee, Seung-Kyu; Ahn, Seong-Kyu; Kwon, In-Chan; Kim, Ho-Dong [Korea Atomic Energy Research Institute, Daejeong (Korea, Republic of)
2016-01-11
This paper presents results of the first experimental demonstration of the Californium Interrogation Prompt Neutron (CIPN) instrument developed within a multi-year effort launched by the Next Generation Safeguards Initiative Spent Fuel Project of the United States Department of Energy. The goals of this project focused on developing viable non-destructive assay techniques with capabilities to improve an independent verification of spent fuel assembly characteristics. For this purpose, the CIPN instrument combines active and passive neutron interrogation, along with passive gamma-ray measurements, to provide three independent observables. This paper describes the initial feasibility demonstration of the CIPN instrument, which involved measurements of four pressurized-water-reactor spent fuel assemblies with different levels of burnup and two initial enrichments. The measurements were performed at the Post-Irradiation Examination Facility at the Korea Atomic Energy Institute in the Republic of Korea. The key aim of the demonstration was to evaluate CIPN instrument performance under realistic deployment conditions, with the focus on a detailed assessment of systematic uncertainties that are best evaluated experimentally. The measurements revealed good positioning reproducibility, as well as a high degree of insensitivity of the CIPN instrument's response to irregularities in a radial burnup profile. Systematic uncertainty of individual CIPN instrument signals due to assembly rotation was found to be <4.5%, even for assemblies with fairly extreme gradients in the radial burnup profile. These features suggest that the CIPN instrument is capable of providing a good representation of assembly average characteristics, independent of assembly orientation in the instrument.
RF tests on the INS 25.5-MHz split coaxial RFQ
International Nuclear Information System (INIS)
Shibuya, S.; Arai, S.; Imanishi, A.; Morimoto, T.; Tojyo, E.; Tokuda, N.
1990-09-01
A 25.5-MHz split coaxial RFQ with modulated vanes has been constructed. This RFQ will accelerate heavy ions with a charge-to-mass ratio greater than 1/30. We have finished field measurements and obtained the following results: the field strengths between neighboring vanes are same within ±0.6 % over the vane length; the distribution of the intervane voltage in the axial direction is almost flat. Through high power tests so far conducted, we have attained an intervane voltage of 110 kV under a pulse operation with a peak power of 70 kW and a duty factor of 0.9 %. The cavity is thus almost ready for acceleration tests. (author)
2010-07-01
... estimated fair market value. Where hazardous substance activity is identified, see §§ 102-75.340 and 102-75... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are disposal....255 Public Contracts and Property Management Federal Property Management Regulations System (Continued...
Reactor production of 252Cf and transcurium isotopes
International Nuclear Information System (INIS)
Alexander, C.W.; Halperin, J.; Walker, R.L.; Bigelow, J.E.
1990-01-01
Berkelium, californium, einsteinium, and fermium are currently produced in the High Flux Isotope Reactor (HFIR) and recovered in the Radiochemical Engineering Development Center (REDC) at the Oak Ridge National Laboratory (ORNL). All the isotopes are used for research. In addition, 252 Cf, 253 Es, and 255 Fm have been considered or are used for industrial or medical applications. ORNL is the sole producer of these transcurium isotopes in the western world. A wide range of actinide samples were irradiated in special test assemblies at the Fast Flux Test Facility (FFTF) at Hanford, Washington. The purpose of the experiments was to evaluate the usefulness of the two-group flux model for transmutations in the special assemblies with an eventual goal of determining the feasibility of producing macro amounts of transcurium isotopes in the FFTF. Preliminary results from the production of 254g Es from 252 Cf will be discussed. 14 refs., 5 tabs
First studies of 500-nm Cherenkov radiation from 255-MeV electrons in a diamond crystal
Energy Technology Data Exchange (ETDEWEB)
Takabayashi, Y., E-mail: takabayashi@saga-ls.jp [SAGA Light Source, 8-7 Yayoigaoka, Tosu, Saga 841-0005 (Japan); Fiks, E.I. [National Research Tomsk Polytechnic University, 634050 Tomsk (Russian Federation); Pivovarov, Yu.L. [National Research Tomsk Polytechnic University, 634050 Tomsk (Russian Federation); National Research Tomsk State University, 634050 Tomsk (Russian Federation)
2015-06-12
The first experiment on Cherenkov light from 255-MeV electrons passing through a 50-μm-thick diamond crystal in a special geometry allowing extraction of 500-nm Cherenkov light at a right angle with respect to the electron beam direction has been performed at the injector linac of SAGA Light Source accelerator facility. The dependence of 500-nm Cherenkov light intensity (separated by a band-pass filter) on the crystal rotation angle was measured by a CCD detector. The experimentally obtained rocking curve with an intense maximum is theoretically explained as the projector effect of Cherenkov light deflected by the exit surface of the crystal. The width of the rocking curve is explained by the convolution of the standard Tamm–Frank angular distribution of Cherenkov radiation with chromatic aberration, the multiple scattering of electrons in a crystal, and initial electron beam angular divergence. In addition, it is found that the Cherenkov light intensity did not change under the (220) planar channeling condition, which is consistent with a recent theory. - Highlights: • Cherenkov light from 255-MeV electrons in a diamond crystal has been investigated. • The Cherenkov light from channeled electrons has been observed for the first time. • The experimental results are in good agreement with theory.
Freeze drying method for preparing radiation source material
International Nuclear Information System (INIS)
Mosley, W.C.; Smith, P.K.
1976-01-01
Fabrication of a neutron source is specifically claimed. A palladium/californium solution is freeze dried to form a powder which, through conventional powder metallurgy, is shaped into a source containing the californium evenly distributed through a palladium metal matrix. (E.C.B.)
International Nuclear Information System (INIS)
Oswald, R.A.; Lanzl, L.H.; Rozenfeld, M.
1981-01-01
Fission track detectors were applied to a unique problem in neutron dosimetry. Measurements of neutron doses were required at locations within a tumor of 1 cm diameter implanted on the back of a mouse and surrounded by a square array of four 252 Cf medical sources. Measurements made in a tissue-equivalent mouse phantom showed that the neutron dose rate to the center of the tumor was 2.18 rads mg -1 h -1 +- 8.4%. The spatial variation of neutron dose to the tumor ranged from 1.88 to 2.55 rads mg -1 h -1 . These measurements agree with calculated values of neutron dose to those locations in the phantom. Fission track detectors have been found to be a reliable tool for neutron dosimetry for geometries in which one wishes to know neutron dose values which may vary considerably over distances of 1 cm or less
International Nuclear Information System (INIS)
Oswald, R.A.; Lanzl, L.H.; Rozenfeld, M.
1981-01-01
Fission track detectors were applied to a unique problem in neutron dosimetry. Measurements of neutron doses were required at locations within a tumor of 1 cm diameter implanted on the back of a mouse and surrounded by a square array of four 252 Cf medical sources. Measurements made in a tissue-equivalent mouse phantom showed that the neutron dose rate to the center of the tumor was 2.18 rads micrograms-1 h-1 +/- 8.4%. The spatial variation of neutron dose to the tumor ranged from 1.88 to 2.55 rads micrograms-1 h-1. These measurements agree with calculated values of neutron dose to those locations in the phantom. Fission track detectors have been found to be a reliable tool for neutron dosimetry for geometries in which one wishes to know neutron dose values which may vary considerably over distances of 1 cm or less
Intraoperative electrocortical stimulation of Brodman area 4: a 10-year analysis of 255 cases
Directory of Open Access Journals (Sweden)
Brock Mario
2006-07-01
Full Text Available Abstract Background Brain tumor surgery is limited by the risk of postoperative neurological deficits. Intraoperative neurophysiological examination techniques, which are based on the electrical excitability of the human brain cortex, are thus still indispensable for surgery in eloquent areas such as the primary motor cortex (Brodman Area 4. Methods This study analyzed the data obtained from a total of 255 cerebral interventions for lesions with direct contact to (121 or immediately adjacent to (134 Brodman Area 4 in order to optimize stimulation parameters and to search for direct correlation between intraoperative potential changes and specific surgical maneuvers when using monopolar cortex stimulation (MCS for electrocortical mapping and continuous intraoperative neurophysiological monitoring. Results Compound muscle action potentials (CMAPs were recorded from the thenar muscles and forearm flexors in accordance with the large representational area of the hand and forearm in Brodman Area 4. By optimizing the stimulation parameters in two steps (step 1: stimulation frequency and step 2: train sequence MCS was successful in 91% (232/255 of the cases. Statistical analysis of the parameters latency, potential width and amplitude showed spontaneous latency prolongations and abrupt amplitude reductions as a reliable warning signal for direct involvement of the motor cortex or motor pathways. Conclusion MCS must be considered a stimulation technique that enables reliable qualitative analysis of the recorded potentials, which may thus be regarded as directly predictive. Nevertheless, like other intraoperative neurophysiological examination techniques, MCS has technical, anatomical and neurophysiological limitations. A variety of surgical and non-surgical influences can be reason for false positive or false negative measurements.
Una Rilettura di Polibio XXXI 25.5
Directory of Open Access Journals (Sweden)
Francesco Maria Ferrara
2017-12-01
Full Text Available L’articolo si propone di ricostruire la fisionomia testuale di un luogo delle Storie di Polibio (II sec. a.C. – XXXI 25.5 nell’edizione polibiana di Büttner-Wobst, p. 349 –, che è tramandato soltanto dagli Excerpta Constantiniana (X sec.: in una forma più breve dagli Excerpta de Virtutibus et Vitiis [n. 104], nella sezione degli estratti dal XXXI libro che raccoglie la lunga digressione su Scipione Emiliano (testimone: Tours, Bibl. munic., 980 C, del X sec., [P], noto e utilizzato dal XVII sec.; e in una forma più ampia dagli Excerpta de Sententiis [n. 137] (testimone: Città del Vaticano, BAV, gr. 73, del X sec., [M], palinsesto, riscoperto nel 1827, edito dal 1846. Per la conoscenza della pagina polibiana disponiamo anche di Ateneo (fine II sec. d.C., che ne citò il contenuto nel vi libro dei Deipnosophistai (vi 274f-275a, e di due ulteriori estratti costantiniani, questa volta da libri non tramandati dell’opera dello storico Diodoro (I sec. a.C., che attinse anche alle Storie di Polibio: Exc. de Sententiis n. 365 [Diod. xxxi fr. 36 Goukowsky] e n. 436 [Diod. xxxvii fr. 3 Goukowsky]. Attraverso una riflessione sull’affidabilità dei testi di Ateneo e Diodoro in rapporto con quello delle Storie, e un costante confronto con tutta l’opera polibiana volto ad indagare lingua e stile dell’autore, l’articolo giunge a una ricostruzione in parte diversa da quella del Büttner-Wobst, il cui testo riproducono tutte le edizioni moderne.
Observation of 2A1415+255 /NGC 5548/ by OSO-7
Rothschild, R. E.; Baity, W. A.; Peterson, L. E.; Mushotzky, R. F.; Wheaton, W. A.
1979-01-01
Results are reported for OSO 7 X-ray observations of the Seyfert galaxy NGC 5548, which has been positively identified with the X-ray source 2A1415+255, over the energy range from 5 to 350 keV. The best-fit power-law spectrum is found to have an index of 1.78 + or - 0.25 for the data from 5.4 to 100 keV. This best-fit model is used to calculate a 2-10-keV flux of (4.2 + or - 2.1) x 10 to the -10th erg/sq cm-sec on the assumption of no low-energy absorption. The observed variability is shown to imply an active region whose extent is of the order of a light year. This, in turn, implies that the bulk of the emission originates at the core of the galaxy, which would support a synchrotron self-Compton model.
Trends in radioisotope development and utilization in the United States
Energy Technology Data Exchange (ETDEWEB)
Mott, W E [Energy Research and Development Administration, Washington, D.C. (USA)
1976-06-01
The current trends in radioisotope and radiation technology in the United States are overviewed with emphasis on the developments since the 1973 Conference. The comments focus primarily on the research and development activities receiving the most attention today from the various agencies of the Government. Among the many available radionuclides, technetium-99m has played the single most important role for making possible the developments in the field of nuclear medicine. Many other short lived medium-lived nuclides are applied in the fields of nuclear medicine, cardiac pacemaker, artificial heart, and blood irradiator. Radiation processing is now firmly established in the United States. The trends in sewage treatment, polymer-impregnated materials, bioengineering, and food irradiation are reviewed. The programs for californium-252, strontium-90, cesium-137, plutonium-238, and krypton-85 are also reviewed. The author concludes this paper with the acknowledgement that Japanese researchers have contributed to and have been closely involved in many of the programs discussed. Of particular note is the participation in the clinical phase of the californium-252 radiotherapy program. Several Japanese hospitals have been cooperating with the United States since the very beginning of the californium-252 program in determining the value of the californium-252 neutron therapy. The research being performed is unique, and will contribute greatly to the decisions on the ultimate future of californium-252 for therapeutic purposes.
G25.5 + 0.2: a very young supernova remnant or a galactic planetary nebula?
International Nuclear Information System (INIS)
White, R.L.; Becker, R.H.
1990-01-01
G25.5 + 0.2, a radio source suggested by previous authors to be a very young galactic supernova remnant, is more likely to be a planetary nebula. Its IRAS colours and fluxes and its radio spectrum and morphology are all consistent with the properties of planetary nebulae; its radio flux and distance imply a large mass of ionized gas, which is expected from a Type I planetary nebula lying in the galactic plane. We suggest some definitive observations which should be able to determine whether this interesting object is a planetary nebula or a supernova remnant. (author)
Energy Technology Data Exchange (ETDEWEB)
Hiramoto, Roberto Mitsuyoshi; Galisteo Juniorm Andres Jimenez; Nascimento, Nanci do; Andrade Junior, Heitor Franco de [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil). Lab. de Biologia Molecular]. E-mail: rmhiramoto@bol.com.br; hfandrad@usp.br
2002-07-01
Toxoplasmosis can cause ocular lesions in normal individuals and several diseases in foetus, HIV infection and transplants. Toxoplasma gondii has a complex life cycle, involving cats, as the definitive host, and warm blood species, as intermediated hosts. The infection occurs by ingestion of food and water contaminated with infected cat faeces, contaminated milk and cheese or raw and undercook meat of the intermediated hosts. To date, there is no commercial vaccine of use in humans. In this work, tachyzoites of T. gondii RH strain were irradiated with 255 Gy and inoculated in C57Bl/6j mice (3 doses, biweekly), after mice were challenged with 1, 5, 10, 20 and 25 cysts of ME-49 by oral gavage. The lesions and cysts in the brain were analyzed in all mice, after 4-week post infection. The mortality was 20% in control mice (ME-49 cysts only) and not one in immunized mice. The number of cysts was high in the control group, but low in immunized 255 Gy mice (n<100). Immunized mice showed less cerebral pathology and necrosis foci. Ionizing radiation is an important tool in the study toxoplasmosis and vaccine development. (author)
Acceleration performance of a 50-MHz split coaxial RFQ and the design of a 25.5-MHz prototype
International Nuclear Information System (INIS)
Tokuda, N.; Arai, S.; Fukushima, T.; Morimoto, T.; Tojyo, E.
1989-03-01
Acceleration tests on a 50-MHz split coaxial RFQ have been conducted at INS. The 2-m long RFQ has accelerated protons from 2 to 60 keV. The experimental results concerning beam emittance and transmission efficiency agree with predictions of a computer simulation. Following this success, we are fabricating a 25.5-MHz prototype of 2-m long. The issues of the study are to establish a structure standing a high-power operation and to accelerate heavy ions with a charge-to-mass ratio larger than 1/30. (author)
Energy Technology Data Exchange (ETDEWEB)
Cardoso, Antonio
1976-07-01
Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)
Energy Technology Data Exchange (ETDEWEB)
Cardoso, Antonio
1976-07-01
Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)
Source storage and transfer cask: Users Guide
International Nuclear Information System (INIS)
Eccleston, G.W.; Speir, L.G.; Garcia, D.C.
1985-04-01
The storage and shield cask for the dual californium source is designed to shield and transport up to 3.7 mg (2 Ci) of 252 Cf. the cask meets Department of Transportation (DOT) license requirements for Type A materials (DOT-7A). The cask is designed to transfer sources to and from the Flourinel and Fuel Storage (FAST) facility delayed-neutron interrogator. Californium sources placed in the cask must be encapsulated in the SR-CF-100 package and attached to Teleflex cables. The cask contains two source locations. Each location contains a gear box that allows a Teleflex cable to be remotely moved by a hand crank into and out of the cask. This transfer procedure permits sources to be easily removed and inserted into the delayed-neutron interrogator and reduces personnel radiation exposure during transfer. The radiation dose rate with the maximum allowable quantity of californium (3.7 mg) in the cask is 30 mR/h at the surface and less than 2 mR/h 1 m from the cask surface. This manual contains information about the cask, californium sources, describes the method to ship the cask, and how to insert and remove sources from the cask. 28 figs
International Nuclear Information System (INIS)
Taylor, G.N.
1985-01-01
Studies are being conducted in mice comparing the toxicity of radium-226, plutonium-239, americium-241, californium-249 and californium-252 in C57B1/Do (albino) mice and the toxicity of americium-241, plutonium-239 and radium-226 in deer mice (Peromyscus maniculatus) and grasshopper mice (Onychomys leucogaster). These experiments will ultimately enable comparison of the toxicity of the above actinide toxicity in man to be made using radium toxicity as the baseline
International Nuclear Information System (INIS)
Bashir, S.; Bashir, J.
2014-01-01
Objective: To determine the frequency of primary uterine malignancy in hysterectomy specimens in women with postmenopausal bleeding. Study Design: A descriptive cross-sectional study. Place and Duration of study: It was conducted in the department of histopathology at Combined Military Hospital, Peshawar from 1st September 2010 to 31st May 2011. Material and Methods: A total of 255 hysterectomy specimens of postmenopausal women were examined grossly and microscopically to analyse the underlying pathology. Results: The mean age of patients with malignant diseases was 56.4 years and with benign diseases 49.3 years. Out of 255 patients 215 (95.6%) were found to have benign pathologies and 10 (4.4%) had malignant lesions. The frequency and histological pattern of primary uterine malignancy was; endometrial carcinoma 3.1%, cervical carcinoma 0.9% and leiomyosarcoma 0.4%. The benign pathologies included leiomyoma 35.6%, atrophic endometritis 16.4%, endometrial hyperplasia 15.1%, adenomysis 11.1%, endometrial polyp 10.2%, adenomyoma 6.7% and endometrial stromal nodule 0.4%. Conclusion: This study shows that frequency of malignancy in postmenopausal women is low in our set up and most of the underlying pathologies are benign. The most frequent malignancy found in postmenopausal women is endometrial carcinoma followed by cervical carcinoma. (author)
Quantum-chemical consideration of extermal valent forms of actinides
International Nuclear Information System (INIS)
Ionova, G.V.; Pershina, V.G.; Spitsyn, V.I.
1982-01-01
Stability of valent forms of actinides that has not yet studied experimentally, is considered within the framework of quantum-chemical considerations. Oxidizing potentials E 0 for actinide elements are determined theoretically. A dependence of the definite valent state stability on relativistic effect is shown. A conclusion is made that oxidizing potential E 0 (4-5) for americium should be higher than E 0 (4-5) for plutonium. A relatively small oxidizing potential E 0 (4-5) for curium speaks about principle possibility of production of five-valent curium in solution, though it is less stable than the six-valent one. Oxidizing potential corresponding to transition of three-valent californium into the four-valent state should be less than the value adopted in literature. A relatively small oxidizing potential of californium E 0 (4-5) speaks about possible existence of five-valent californium in solution
Energy Technology Data Exchange (ETDEWEB)
Delgado H, C. E.; Vega C, H. R. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Sajo B, L., E-mail: ce_delgado89@hotmail.com [Universidad Simon Bolivar, Laboratorio de Fisica Nuclear, Apdo. 89000, 1080A Caracas (Venezuela, Bolivarian Republic of)
2015-10-15
Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U{sup 233} when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO{sub 2}(NO{sub 3}){sub 4} and 18% of thorium Th(NO{sub 3}){sub 4} as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 10{sup 7} s{sup -1}. In the design the value of the effective multiplication factor, whose value turned out k{sub eff} <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)
International Nuclear Information System (INIS)
Hiramoto, Roberto Mitsuyoshi; Galisteo Juniorm Andres Jimenez; Nascimento, Nanci do; Andrade Junior, Heitor Franco de
2002-01-01
Toxoplasmosis can cause ocular lesions in normal individuals and several diseases in foetus, HIV infection and transplants. Toxoplasma gondii has a complex life cycle, involving cats, as the definitive host, and warm blood species, as intermediated hosts. The infection occurs by ingestion of food and water contaminated with infected cat faeces, contaminated milk and cheese or raw and undercook meat of the intermediated hosts. To date, there is no commercial vaccine of use in humans. In this work, tachyzoites of T. gondii RH strain were irradiated with 255 Gy and inoculated in C57Bl/6j mice (3 doses, biweekly), after mice were challenged with 1, 5, 10, 20 and 25 cysts of ME-49 by oral gavage. The lesions and cysts in the brain were analyzed in all mice, after 4-week post infection. The mortality was 20% in control mice (ME-49 cysts only) and not one in immunized mice. The number of cysts was high in the control group, but low in immunized 255 Gy mice (n<100). Immunized mice showed less cerebral pathology and necrosis foci. Ionizing radiation is an important tool in the study toxoplasmosis and vaccine development. (author)
Characterization of the enzymes present in the cellulase system of Thielavia terrestris 255B
Energy Technology Data Exchange (ETDEWEB)
Gilbert, Michel; Breuil, Colette; Saddler, J N [Forintek Canada Corp., Ottawa, ON (CA). Dept. of Biotechnology and Chemistry
1992-01-01
The authors initiated a study of the cellulases from the thermophilic fungus Thielavia terrestris 255B to see how they compared with enzymes derived from mesophilic fungi such as Trichoderma. To try to obtain maximum production of a complete cellulase system, the fungus was first grown on a variety of soluble and insoluble substrates. As well as assaying the culture filtrates for cellulase activity and protein concentration, the enzyme profiles were compared using non-denaturing electrophoretic techniques (IEF and native-PAGE). The separation by native-PAGE and IEF was followed by activity staining methods to detect endoglucanase and xylanase activities. Native-PAGE could not be used to determine accurately the M{sub r} of the cellulases because of possible differences in mass/charge ratios. Bands with apparent M{sub r} values above 200000 were reproducibly detected. This suggested that the various cellulase components may be organized into high molecular weight complexes. (author).
Li, X; Chen, J; Zhang, L; Liu, H; Wang, S; Chen, X; Fang, J; Wang, S; Zhang, W
2015-03-01
To analyse the pattern and factors that influence the incidence of adverse drug reactions (ADRs) induced by non-ionic iodinated contrast media and to evaluate their safety profiles. Data from 109,255 cases who underwent enhanced CT examination from 1 January 2008 to 31 August 2013 were analysed. ADRs were classified according to the criteria issued by the American College of Radiology and the Chinese Society of Radiology. A total of 375 (0.34%) patients had ADRs, including 281 mild (0.26%); 80 moderate (0.07%); and 14 severe (0.01%) ADRs; no death was found. 302 (80.53%) of the ADRs occurred within 15 min after examination. Patients aged 40-49 years (204 cases, 0.43%; p contrast media are mainly mild ones, while moderate or severe ADRs are relatively rare, suggesting that enhanced CT examination with non-ionic iodinated contrast media is highly safe, and severe adverse events will seldom occur under appropriate care. The study included 109,255 patients enrolled in various types of enhanced CT examinations, which could reflect ADR conditions and regulations in Chinese population accurately and reliably.
International Nuclear Information System (INIS)
Samhoun, K.
1976-01-01
The amalgamation of 5f elements from Am to Fm has been studied by using 241 Am, 244 Cm, 249 Bk, 249 Cf, 252 Cf, 253 Es, 254 Es, 252 Fm and 255 Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10 -16 M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M 3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E 0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E 0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65 [fr
Definitive Brachytherapy for Kaposi's Sarcoma
International Nuclear Information System (INIS)
Williams, A.; Ezzell, G.; Zalupski, M.; Fontanesi, J.
1996-01-01
Purpose: To assess the efficacy and possible complications in patients diagnosed with Kaposi's sarcoma and treated with definitive brachytherapy. Methods and Materials: Between January, 1995 and December, 1995, four patients with Kaposi's sarcoma (KS) were treated with brachytherapy. Three patients, all with positive HIV status were treated using Iridium 192 (Ir-192) sources via a high-dose rate remote afterloader. One patient with endemic KS was treated using the application of catheters loaded with Californium 252. Eight sites were treated and included scalp, feet, nose, penis, hand, neck, and back. Dose rate for Ir-192 was 330cGy/fx to a total dose of 990cGy. The Californium was delivered as 100nGy/b.i.d. to a total dose of 900nGy. Follow-up as ranged from 2-6 months. Results: All four patients remain alive. Seven of eight sites have had complete clinical response and each patient has reported durable pain relief that has not subsided through last follow-up of 1/96. Two of eight sites, both treated with surface mold technique with Californium 252 developed moist desquamation. The remaining six sites did not demonstrate significant toxicity. Conclusion: Brachytherapy can offer Kaposi's sarcoma patients results that are equivalent to external beam radiation therapy, with minimal complications, a shorter treatment time and potential cost effectiveness
Californium Recovery from Palladium Wire
Energy Technology Data Exchange (ETDEWEB)
Burns, Jon D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)
2014-08-01
The recovery of 252Cf from palladium-252Cf cermet wires was investigated to determine the feasibility of implementing it into the cermet wire production operation at Oak Ridge National Laboratory’s Radiochemical Engineering Development Center. The dissolution of Pd wire in 8 M HNO3 and trace amounts of HCl was studied at both ambient and elevated temperatures. These studies showed that it took days to dissolve the wire at ambient temperature and only 2 hours at 60°C. Adjusting the ratio of the volume of solvent to the mass of the wire segment showed little change in the kinetics of dissolution, which ranged from 0.176 mL/mg down to 0.019 mL/mg. A successful chromatographic separation of 153Gd, a surrogate for 252Cf, from Pd was demonstrated using AG 50x8 cation exchange resin with a bed volume of 0.5 mL and an internal diameter of 0.8 cm.
Californium-252 Program Equipment Evaluation
Energy Technology Data Exchange (ETDEWEB)
Chattin, Fred Rhea [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Wilson, Kenton [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Ezold, Julie G. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)
2017-12-01
To successfully continue the 252Cf production and meet the needs of the customers, a comprehensive evaluation of the Building 7920 processing equipment was requested to identify equipment critical to the operational continuity of the program.
Measurement of the magnetic neutron form factor at a four-momentum transfer of Q2 = 0.255 (GeV/c)2
International Nuclear Information System (INIS)
Reike, H.
1993-12-01
The Electron Stretcher Accelerator ELSA of Bonn University delivers an external electron beam with a duty factor of up to 55%. Thus nonmagnetic detectors can be used to perform electron nucleon coincidence experiments with high precision. The magnetic form factor of the neutron G m n is determined by the so-called ratio method, i.e. G m n is extracted from the measured ratio of the cross sections of the d(e,e'n) and d(e,e'p) reactions in a region of quasi-free kinematics. Protons and neutrons are detected simultaneously in the same scintillation counter, so many systematic errors cancel out. The neutron detection efficiency is measured in situ by the associated particle method using the p(γ,π + n) reaction. For this reaction the high energy part of the photons produced by the electron beam in the target is used. The value of G m n found at a four momentum transfer of Q 2 = 0.255 (GeV/c) 2 is (10.1 ± 3.8)% higher than the dipole value. (orig.)
Californium Cf-252 for pelvic radiotherapy
Energy Technology Data Exchange (ETDEWEB)
Maruyama, Y; Feola, J M; Tai, D; Wilson, L C; Van Nagell, J R; Yoneda, J
1978-01-01
Clinical data about therapy concerning tumors of the female gynecological cancers of the cervix, vagina and uterus are reviewed. Dosimetric, laboratory and radiobiological research data form the basis for an approach to such tumors using Cf-252 as a form of boost brachytherapy. Extreme personnel hazards are a real and important consideration and indicate that maximal containment and isolation procedures should be exercised in its use.
Electric form factor of the neutron from the 2H(e-->,e'n-->)1H reaction at Q2=0.255 (GeV/c)2
International Nuclear Information System (INIS)
T. Eden; R. Madey; W.-M. Zhang; B. D. Anderson; H. Arenhvel; A. R. Baldwin; D. Barkhuff; K. B. Beard; W. Bertozzi; J. M. Cameron; C. C. Chang; G. W. Dodson; K. Dow; M. Farkhondeh; J. M. Finn; B. S. Flanders; C. Hyde-Wright; W.-D. Jiang; D. Keane; J. J. Kelly; W. Korsch; S. Kowalski; R. Lourie; D. M. Manley; P. Markowitz; J. Mougey; B. Ni; T. Payerle; P. J. Pella; T. Reichelt; P. M. Rutt; M. Spraker; D. Tieger; W. Turchinetz; P. E. Ulmer; S. Van Verst; J. W. Watson; L. B. Weinstein; and R. R. Whitney
1994-01-01
We determined the electric form factor GnE of the neutron from the quasielastic 2H(e-->,e'n-->)1H reaction at a central squared four-momentum transfer Q2=0.255 (GeV/c)2 with a longitudinally polarized electron beam of 868 MeV and a low (∼0.8%) duty factor. A neutron polarimeter designed and constructed specifically for this experiment was used to measure the sideways polarization of the recoil neutron, which was detected in coincidence with the scattered electron. Theoretical calculations have established that this polarization-transfer technique for quasielastic scattering produces a value of GnE that shows little sensitivity to the influence of final-state interactions, meson-exchange currents, isobar configurations, and deuteron structure. The value for GnE from this measurement is 0.066 ± 0.036 ± 0.009
Neutron spectra from radionuclide sources for cardiac pacemakers
International Nuclear Information System (INIS)
Kluge, H.
1975-01-01
Neutron spectra from Plutonium 238 radioisotope batteries powering cardiac pacemakers are measured in the energy range above 0.7 MeV. The results are used to calculate radiation doses within a cylindrical phantom. There are only minor differences between the different types of plutonium 238-batteries and californium 252-batteries
Single-event burnout of power MOSFET devices for satellite application
International Nuclear Information System (INIS)
Xue Yuxiong; Tian Kai; Cao Zhou; Yang Shiyu; Liu Gang; Cai Xiaowu; Lu Jiang
2008-01-01
Single-event burnout (SEB) sensitivity was tested for power MOSFET devices, JTMCS081 and JTMCS062, which were made in Institute of Microelectronics, Chinese Academy of Sciences, using californium-252 simulation source. SEB voltage threshold was found for devices under test (DUT). It is helpful for engineers to choose devices used in satellites. (authors)
Radioactive materials production
International Nuclear Information System (INIS)
Anon.
1985-01-01
The Radiochemical Processing Plant (RPP) at ORNL has served as the national repository and distribution center for 233 U for > 20 years. Several hundred kilograms of uranium, containing approximately 90 to 98% 233 U, are stored there in the form of metal, oxides, and nitrate solutions. All of these uranium materials contain small, but significant, concentrations of 232 U, ranging from 2 to 225 ppm. Most of the radioactivity associated with the 233 U comes from the decay daughters of 232 U (74-year half-life). The 252 Cf Industrial Sales/Loan Program involves loans of 252 Cf neutron sources to agencies of the US Government and sales of 252 Cf as the bulk oxide and as palladium-californium alloy pellets and wires. The program has been operated since 1968 in temporary facilities at the Savannah River Laboratory (SRL). The obsolete hot-cell facilities at SRL are now being decommissioned, and the program activities are being transferred to ORNL's Californium Facility in Bldg. 7930, which is managed by the staff of the Transuranium Processing Plant
International Nuclear Information System (INIS)
Magen, C; Ritter, C; Morellon, L; Algarabel, P A; Ibarra, M R
2004-01-01
The compounds Nd 5 Si 1.45 Ge 2.55 and Pr 5 Si 1.5 Ge 2.5 have been investigated by means of magnetization measurements and neutron powder diffraction techniques. These alloys present a room-temperature monoclinic Gd 5 Si 2 Ge 2 -type crystallographic structure and, on cooling, both systems order ferromagnetically, at T C = 56 and 32 K, respectively, from a high-temperature paramagnetic to a low-temperature complex canted ferromagnetic state. The monoclinic crystallographic structure remains unchanged upon cooling down to 4 K, demonstrating the existence of a monoclinic ferromagnetic phase, and the possibility of a full decoupling of magnetic and crystallographic degrees of freedom in the 5:4 lanthanide intermetallic compounds
International Nuclear Information System (INIS)
Valentine, T.E.; Mihalczo, J.T.
1995-01-01
This paper describes calculations performed to validate the modified version of the MCNP code, the MCNP-DSP, used for: the neutron and photon spectra of the spontaneous fission of californium 252; the representation of the detection processes for scattering detectors; the timing of the detection process; and the calculation of the frequency analysis parameters for the MCNP-DSP code
International Nuclear Information System (INIS)
Huray, P.G.; Nave, S.E.
1984-01-01
Measurements of the magnetic properties of dhcp californium-249 metal indicated the presence of three regions of differing magnetic character. Additional measurements are also reported. Magnetic moments and valence states of terbium in TbF 3 , BaTbO 3 , and TbO 1 8 are discussed. Progress on high-field operation of the micro-magnetic susceptometer is reported
Doom, Jenalee R; Georgieff, Michael K; Gunnar, Megan R
2015-05-01
Increased ADHD symptomology and lower IQ have been reported in internationally adopted (IA) children compared to non-adopted peers (Hostinar, Stellern, Schaefer, Carlson & Gunnar, 2012; Kreppner, O'Connor & Rutter, 2001). However, it is unclear whether these outcomes are due to institutional deprivation specifically or to co-occurring micronutrient deficiencies that disrupt brain development (Fuglestad, Rao & Georgieff, 2008b). In this study, IA children were compared to children raised in their biological families to examine differences in ADHD symptomology and IQ 2.5-5 years post-adoption and to assess the contributions of iron deficiency (ID) and duration of deprivation to these cognitive outcomes. ADHD symptoms (parent- and experimenter-reported) and IQ were evaluated in 88 IA (M = 62.1 months, SD = 2.4) and 35 non-adopted children (M = 61.4 months, SD = 1.6). IA children were assessed 29-64 months post-adoption (M = 41.9 months, SD = 10.2). ID was assessed during the initial post-adoption medical visit in 69 children, and children were classified into four groups by iron status, ranging from normal to ID anemia (most severe). IA children had greater ADHD symptomology, p IQ, p = .001, than non-adopted children. Within the IA group, children with more severe ID at adoption had greater ADHD symptomology, r(69) = 0.40, p = .001, and lower IQ, r(68) = -0.28, p IQ, r(85) = -.08, p = .52. Longitudinal results indicate improvement in IQ from 12 months post-adoption to age 5 for children with greater ID severity at adoption and longer duration of institutional care but no improvement in ADHD symptoms. These results signify continuing effects of early deprivation and ID on ADHD symptoms and IQ years after adoption. A video abstract of this article can be viewed at http://www.youtube.com/watch?v=vUFDAS3DD1c. © 2014 John Wiley & Sons Ltd.
Preparation and study of elemental californium-249
International Nuclear Information System (INIS)
Noe, M.; Peterson, J.R.
1975-01-01
Bulk samples of 249 Cf metal were prepared on the 10 μg scale via the Li metal vapor reduction of 249 CfF 3 . Above about 725 0 C elemental Cf exhibits a face-centered cubic (fcc) structure with an average, room-temperature lattice parameter of 5.75(1)A. Between about 600 0 C and 725 0 C, the stable form of Cf metal is another fcc structure with an average, room-temperature lattice parameter of 4.94(1)A. Below 600 0 C metallic Cf exhibits a double hexagonal closest packed (dhcp) structure with average, room temperature lattice parameters of a 0 = 3.39(1)A and c 0 = 11.01(5)A. By comparison of the metallic radii calculated for these three forms with those of the receding transuranium elements, it is suggested that the two, lower temperature modifications represent Cf with a metallic valence of three, while the highest temperature form represents a metallic valence of two. Although the data reported here are from the most complete study to date of elemental Cf, the limitations accompanying such microscale research are duly noted. (U.S.)
Energy Technology Data Exchange (ETDEWEB)
Rozhdestvenskyy, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2017-08-09
This work iterates on the first demonstration of a solid-state neutron multiplicity counting system developed at Lawrence Livermore National Laboratory by using commercial off-the-shelf detectors. The system was demonstrated to determine the mass of a californium-252 neutron source within 20% error requiring only one-hour measurement time with 20 cm2 of active detector area.
Citric complexes of trivalent cerium and berkelium
International Nuclear Information System (INIS)
Boulhassa, S.
1977-01-01
The extraction by thenoyltrifluoroacetone (TTA) in benzene of trivalent cerium, berkelium and californium, at the indicator scale, hydrolysis and complexation by citric acid of these cations are studied. The radionuclides used were 144 Ce, 249 Bk and 249 Cf respectively γ, β and α emitters. The solvent extraction technique of the elements by TTA in benzene from a perchloric medium at the ionic stength 0.1 was employed. The distribution coefficients D were measured by the γ, β or α radiometry. Cerium and berkelium, which have a comparable redox behavior, show in solution a relatively stable valency IV. Therefore the study by solvent extraction of their trivalent form required the standing up of complete reducing conditions of these elements and their stabilization in solution at the valency III. The thermodynamic data obtained for berkelium and californium contribute to understand the chemistry of these elements and permit to complete the third 'tetrad branch' of 5f elements from Cm 3+ to Es 3+ . This tetrad effect is a manifestation of thermodynamic consequence of the 'nephelauxetic effect'. As for Ce(III), the data confirm the pronounced acid property and may be show no neglected ligand effect for f 1 configuration [fr
Directed evolution of the periodic table: probing the electronic structure of late actinides.
Marsh, M L; Albrecht-Schmitt, T E
2017-07-25
Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.
International Nuclear Information System (INIS)
1987-03-01
The Conference presentations were divided into sessions devoted to the following topics: white neutron sources, primarily pulsed (6 papers); fast neutron fields (5 papers); Californium-252 prompt fission neutron spectra (14 papers); monoenergetic sources and filtered beams (11 papers); 14 MeV neutron sources (10 papers); selected special application (one paper); and a general interest session (4 papers). Individual abstracts were prepared separately for the papers
Energy Technology Data Exchange (ETDEWEB)
Galisteo Junior, Andres Jimenez; Alves, Janaina Baptista [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil). Lab. de Biologia Molecular]. E-mail: galisteo@usp.br; Hiramoto, Roberto Mitsuyoshi [Instituto Adolfo Lutz, Sao Paulo, SP (Brazil). Secao de Parasitoses Sistemicas]. E-mail: hiramoto@usp.br; Carmo, Claudia Villano do; Andrade Junior, Heitor Franco de [Instituto de Medicina Tropical de Sao Paulo, Sao Paulo, SP (Brazil). Lab. de Protozoologia]. E-mail: hfandrad@usp.br
2005-07-01
Toxoplasmosis, a prevalent widespread infection in man and animals, occurs mainly through ingestion of water and food contaminated with oocyst from cat feces, causing usually benign disease in humans, except in intrauterine fetal infection or in immunodeficient patients. We study the oral route for the development of a vaccine for toxoplasmosis, using parasites irradiated with 60 Cobalt, as an alternative for vaccine development to this worldwide parasitic infection. We evaluated the development of immunity at serum or mucosal levels, and their efficiency in protect the mice against challenge with oral cysts of the ME-49 strain. C57Bl/6j isogenic mice were immunized by oral route with 10{sup 7} 255 Gy irradiated tachyzoites from RH strain, at several protocols using milk as anti-peptic adjuvant and alum hydroxide as antacid. The preparations of irradiated tachyzoites induced production of serum IgG and IgA in immunized mice, as determined by ELISA, with IgG2a as the dominant subclass, similar to chronic infection. Their use with adjuvant allowed the excretion of significant amounts of IgA in stools also IgG, despite a lesser extent. All oral preparations induced some quantitative protection against challenge, which was similar to the parenteral route only isolated alum hydroxide was used as adjuvant. All these data support the possibility of the development of an oral vaccine against toxoplasmosis, using irradiated tachyzoites, which would be possible tool in near future for use in field baits, for immunizing either domestic or wild felids. (author)
International Nuclear Information System (INIS)
Galisteo Junior, Andres Jimenez; Alves, Janaina Baptista; Hiramoto, Roberto Mitsuyoshi; Carmo, Claudia Villano do; Andrade Junior, Heitor Franco de
2005-01-01
Toxoplasmosis, a prevalent widespread infection in man and animals, occurs mainly through ingestion of water and food contaminated with oocyst from cat feces, causing usually benign disease in humans, except in intrauterine fetal infection or in immunodeficient patients. We study the oral route for the development of a vaccine for toxoplasmosis, using parasites irradiated with 60 Cobalt, as an alternative for vaccine development to this worldwide parasitic infection. We evaluated the development of immunity at serum or mucosal levels, and their efficiency in protect the mice against challenge with oral cysts of the ME-49 strain. C57Bl/6j isogenic mice were immunized by oral route with 10 7 255 Gy irradiated tachyzoites from RH strain, at several protocols using milk as anti-peptic adjuvant and alum hydroxide as antacid. The preparations of irradiated tachyzoites induced production of serum IgG and IgA in immunized mice, as determined by ELISA, with IgG2a as the dominant subclass, similar to chronic infection. Their use with adjuvant allowed the excretion of significant amounts of IgA in stools also IgG, despite a lesser extent. All oral preparations induced some quantitative protection against challenge, which was similar to the parenteral route only isolated alum hydroxide was used as adjuvant. All these data support the possibility of the development of an oral vaccine against toxoplasmosis, using irradiated tachyzoites, which would be possible tool in near future for use in field baits, for immunizing either domestic or wild felids. (author)
Computer-assisted nuclear fuel manufacture
International Nuclear Information System (INIS)
Maloney, J.P.; Schaumann, S.M.; Stone, E.
1976-01-01
At the ERDA Savannah River Plant, a process monitor, which incorporates an online digital computer, assists in manufacturing fuel elements used to produce nuclides such as plutonium, tritium, and californium in the plant's nuclear reactors. Also, inventory functions assist in safeguarding fissile material and protecting against accidental nuclear criticality. Terminals at strategic locations throughout the process area enable production operators to send and receive instructions and information on each manufacturing step
Automated absolute activation analysis with californium-252 sources
International Nuclear Information System (INIS)
MacMurdo, K.W.; Bowman, W.W.
1978-09-01
A 100-mg 252 Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from 17 O. Detection sensitivities of 239 Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level
Savannah River Plant californium-252 Shuffler electronics manual
International Nuclear Information System (INIS)
Bourret, S.C.; Crane, T.W.; Eccleston, G.W.; Gallegos, E.A.; Garcia, D.L.
1980-03-01
Detailed information is presented in this report, an electronics manual for the Savannah River Plant Shuffler, about the electronics associated with the various control and data acquisition functions of the Shuffler subsystems. Circuit diagrams, interconnection information, and details about computer control and programming are included
Savannah River Plant Californium-252 Shuffler software manual
International Nuclear Information System (INIS)
Johnson, S.S.; Crane, T.W.; Eccleston, G.W.
1979-03-01
A software manual for operating the Savannah River Plant Shuffler nondestructive assay instrument is presented. The procedures for starting up the instrument, making assays, calibrating, and checking the performance of the hardware units are described. A list of the error messages with an explanation of the circumstances prompting the message and possible corrective measures is given. A summary of the software package is included showing the names and contents of the files and subroutines. The procedure for modifying the software package is outlined
Computer-assisted nuclear fuel manufacture
International Nuclear Information System (INIS)
Maloney, J.P.; Schaumann, C.M.; Stone, E.
1976-06-01
At the ERDA Savannah River Plant, a process monitor, which incorporates an online digital computer, assists in manufacturing fuel elements used to produce nuclides such as plutonium, tritium, and californium in the plant's nuclear reactors. Also, inventory functions assist in safeguarding fissile material and protecting against accidental nuclear criticality. Terminals at strategic locations throughout the process area enable production operators to send and receive instructions and information on each manufacturing step. 11 fig
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFC255 (Link to dictyBase) - - - Contig-U16272-1 VFC255P (Link... to Original site) VFC255F 198 VFC255Z 525 VFC255P 723 - - Show VFC255 Library VF (Link to library) Clone ID VFC255 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16272-1 Original site URL http://dict...oducing significant alignments: (bits) Value N L08391 |L08391.1 Dictyostelium discoideum ribosomal protein (...ic 32.0 %: nuclear 4.0 %: Golgi 4.0 %: mitochondrial >> prediction for VFC255 is cyt 5' end seq. ID VFC255F
Energy Technology Data Exchange (ETDEWEB)
Sontag, R; Berger, R [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires
1967-07-01
The alpha, beta, gamma, neutron cell which is described in the present paper is devoted to the transplutonium element production and study. It is located at the CEN in Fontenay-aux-Roses (France). The 4 feet ordinary concrete shielding made of stacked blocs allows the manipulation of radioactive sources as high as 1000 curies of 1 MeV gamma rays and with a fast neutrons flux of 10{sup 9} n.cm{sup -2}.s{sup -1}. The airtight alpha containment box is equipped with two transfer systems, one consists of a parallelepiped shaped airtight box located in a turntable, the other uses standard cylindrical containers made of polyethylene. The general equipment and the main setting up are also described. (authors) [French] La cellule alpha, beta, gamma, neutron, qui fait l'objet du present article, est destinee a la production et a l'etude des elements transplutoniens. Elle est construite au C.E.N. de Fontenay-aux-Roses (France). La protection biologique, calculee pour une activite de 1000 curies de rayonnement gamma d'energie 1 MeV accompagnee d'un flux de neutrons rapides de 10{sup 9}/cm{sup 2}s, est constituee par des parois en beton de 1,20 m d'epaisseur. L'enceinte alpha est une boite etanche qui comporte devx systemes de transferts: l'un consiste en une boite parallelepipedique etanche logee dans un barillet, l'autre fait appel a des recipients cylindriques standard en polyethylene. L'equipement general et les installations les plus importantes sont ensuite decrits. (auteurs)
Heavy ion tests on programmable VLSI
International Nuclear Information System (INIS)
Provost-Grellier, A.
1989-11-01
The radiation from space environment induces operation damages in onboard computers systems. The definition of a strategy, for the Very Large Scale Integrated Circuitry (VLSI) qualification and choice, is needed. The 'upset' phenomena is known to be the most critical integrated circuit radiation effect. The strategies for testing integrated circuits are reviewed. A method and a test device were developed and applied to space applications candidate circuits. Cyclotron, synchrotron and Californium source experiments were carried out [fr
Charge breeding of radioactive isotopes at the CARIBU facility with an electron beam ion source
Vondrasek, R. C.; Dickerson, C. A.; Hendricks, M.; Ostroumov, P.; Pardo, R.; Savard, G.; Scott, R.; Zinkann, G.
2018-05-01
An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed at Argonne National Laboratory as part of the californium rare ion breeder upgrade. For the past year, the EBIS-CB has been undergoing commissioning as part of the ATLAS accelerator complex. It has delivered both stable and radioactive beams with A/Q 18% into a single charge state. The operation of this device, challenges during the commissioning phase, and future improvements will be discussed.
Safety analysis report for packaging: neutron shipping cask, model 0.5T
International Nuclear Information System (INIS)
Peterson, R.T.
1976-01-01
The Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The shipping cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual
NWIS casting measurements taken during demonstrations to Russian visitors
International Nuclear Information System (INIS)
Mullens, J.A.; Valentine, T.E.; Mihalczo, J.T.
1998-01-01
This report describes a set of NWIS measurements made during demonstrations to Russian visitors on August 28, 1997. These measurements will be given to the Russian visitors from Arzamus-16 as part of their NWIS training (part of a DOE laboratory-to-laboratory exchange program). These measurements are made on standard highly enriched Uranium annular castings (as used for storage). Associated NWIS calibration runs were made in air (no casting, just the NWIS Californium source and detectors)
Health physics aspects of 252Cf
International Nuclear Information System (INIS)
Bhagwat, A.M.
1974-01-01
After briefly describing the methods of production, radioactive, chemical and biological properties of californium-252, its health physics aspects are reviewed in detail. Its external and internal radiation hazards can be minimised through control of radiation and contamination and proper shield design. Use of various shielding materials is evaluated. The following aspects are also discussed : (1) radiation detectors for neutrons and gamma radiation (2) personnel monitoring techniques (3) bioassay and (4) storage and transportation. (M.G.B.)
Survey of potential markets for devices using Californium-252
International Nuclear Information System (INIS)
Permar, P.H.
1975-01-01
Potential applications for devices or systems containing 252 Cf in the years from 1975 to 1980 are estimated. The estimated number of devices and associated business value were derived from a survey of 46 industrial, educational and governmental organizations conducted from Jan. to May, 1975. Applications for devices and systems based on 252 Cf are expected to increase by a factor of 7 in the 6-y period from 1975 to 1980. The annual business value of 252 Cf devices should increase from 1.5 million dollars in 1975 to 10.8 million dollars in 1980. The potential European market should be several times as large as the US market, based on actual sales of 252 Cf, which have been two to four times greater in Europe than in the US
Californium-252 interstitial implants in carcinoma of the tongue
International Nuclear Information System (INIS)
Vtyurin, B.M.; Ivanov, V.N.; Medvedev, V.S.; Galantseva, G.F.; Abdulkadyrov, S.A.; Ivanova, L.F.; Petrovskaya, G.A.; Plichko, V.I.
1985-01-01
A clinical study using 252 Cf sources in brachytherapy of tumors began in the Research Institute of Medical Radiology of the Academy of Medical Sciences of the USSR in 1973. 252 Cf afterloading cells were utilized by the method of simple afterloading. Dosimetry and radiation protection of medical personnel were developed. To substantiate optimal therapeutic doses of 252 Cf neutrons, a correlation of dose, time, and treatment volume factors with clinical results of 252 Cf interstitial implants in carcinoma of the tongue for 47 patients with a minimum follow-up period of 1 year was studied. Forty-nine interstitial implants have been performed. Seventeen patients received 252 Cf implants alone (Group I), 17 other patients received 252 Cf implants in combination with external radiation (Group II), and 15 patients were treated with interstitial implants for recurrent or residual tumors (Groups III). Complete regression of carcinoma of the tongue was obtained in 48 patients (98%). Thirteen patients (27%) developed radiation necrosis. The therapeutic dose of neutron radiation from 252 Cf sources in interstitial radiotherapy of primary tongue carcinomas (Group I) was found to be 7 to 9 Gy. Optimal therapeutic neutron dose in combined interstitial and external radiotherapy of primary tumors (Group II) was 5 to 6 Gy with an external radiation dose of 40 Gy. For recurrent and residual tumors (Group III), favorable results were obtained with tumor doses of 6.5 to 7 Gy
Undergraduate experiments using the neutron radiation from californium-252
International Nuclear Information System (INIS)
Rossel, J.; Golecki, I.
1976-01-01
Three experiments designed to demonstrate and measure several properties of the neutron radiation emitted by a 3μg 252 Cf source are described. The experiments constitute a special project carried out by a third-year undergraduate student at the Institute of Physics of the University of Neuchatel. The 252 Cf source is enclosed in a shield which allows a pencil of fast neutrons to pass through a central tube, while reducing the ambient radiation below the tolerance level. The shield consists of layers of borated paraffin wax, iron and cadmium. The first experiment uses an air-alcohol diffusion cloud chamber for the demonstration of tracks of recoil protons produced by the neutrons. Semi-quantitative measurements of track lengths give the correct order of magnitude of the proton energies. In the second experiment a liquid scintillator detector is used to scan the beam profile across the radiation shield enclosing the source. A pulse-shape-discrimination system discriminates between neutrons and gamma photons. The third experiment makes use of the nuclear emulsion technique to study the neutron energy distribution of 252 Cf. Preliminary results are compared with published values. (author)
Asana, Olubunmi O; Ayvaci, Emine R; Pollio, David E; Hong, Barry A; North, Carol S
2018-03-29
Homeless individuals with alcohol use disorders have multiple comorbidities and therefore various service needs. Despite need for services, homeless individuals face numerous barriers to treatment. Little is known about the associations of specific services in relation to homelessness in the context of alcohol problems. The current study analyzed 2-year prospective longitudinal data on a homeless sample, examining relationships between alcohol use disorder, alcohol use, housing status, and service use over time. 255 of 400 individuals recruited systematically from shelters and street locations completed 3 annual assessments (69% completion). Data on lifetime and current psychiatric disorders, housing status, and past year service use were obtained and merged with service use data gathered from local agencies. GEE models were created to predict dependent outcome variables of stable housing, alcohol use, and service use in both follow-up years. Lifetime alcohol use disorder was positively associated with substance and medical service use. Alcohol problems did not hinder attainment of stable housing, and placement in housing did not necessarily increase risk for alcohol use. Stable housing was negatively associated with psychiatric and substance service use. In the second year, when alcohol use was finally associated with receiving substance services, it appears that these services provided a gateway to psychiatric services. The psychiatric services in turn appeared to provide a gateway to medical services. Alcohol use acted differently compared to lifetime alcohol use disorder in relation to service use. Lack of association between alcohol use and housing supports Housing First policy. Obtaining housing may have ameliorative effects on mental health, diminishing perceived need for psychiatric services. Services may also be more accessible during homelessness. Obtaining substance treatment may provide a gateway for those who use alcohol after becoming homeless to
Energy Technology Data Exchange (ETDEWEB)
Boycott, K.M.; Bech-Hansen, N.T. [Univ. of Calgary, Alberta (Canada); Halley, G.R.; Schlessinger, D. [Washington Univ. School of Medicine, St. Louis, MO (United States)
1996-05-01
A comprehensive physical contig of yeast artificial chromosomes (YACs) and cosmid clones between ZNF21 and DXS255 has been constructed, spanning 2 Mb within the region Xp11.23-p11.22. As a portion of the region was found to be particularly unstable in yeast, the integrity of the contig is dependent on additional information provided by the sequence-tagged site (STS) content of cosmid clones and DNA marker retention in conventional and radiation hybrids. The contig was formatted with 43 DNA markers, including 19 new STSs from YAC insert ends and an internal Alu-PCR product. The density of STSs across the contig ranges from one marker every 20 kb to one every 60 kb, with an average density of one marker every 50 kb. The relative order of previously known gene and expressed sequence tags in this region is predicted to be Xpter-ZNF21-DXS7465E (MG66)-DXS7927E (MG81)-WASP, DXS1011E, DXS7467E (MG21)-DXS-7466E (MG44)-GATA1-DXS7469E (Xp664)-TFE3-SYP (DXS1007E)-Xcen. This contig extends the coverage in Xp11 and provides a framework for the future identification and mapping of new genes, as well as the resources for developing DNA sequencing templates. 47 refs., 1 fig., 4 tabs.
Gangoiti, Joana; Pijning, Tjaard; Dijkhuizen, Lubbert
2016-01-15
The glycoside hydrolase 70 (GH70) family originally was established for glucansucrase enzymes found solely in lactic acid bacteria synthesizing α-glucan polysaccharides from sucrose (e.g., GtfA). In recent years, we have characterized GtfB and related Lactobacillus enzymes as 4,6-α-glucanotransferase enzymes. These GtfB-type enzymes constitute the first GH70 subfamily of enzymes that are unable to act on sucrose as a substrate but are active with maltodextrins and starch, cleave α1→4 linkages, and synthesize linear α1→6-glucan chains. The GtfB disproportionating type of activity results in the conversion of malto-oligosaccharides into isomalto/malto-polysaccharides with a relatively high percentage of α1→6 linkages. This paper reports the identification of the members of a second GH70 subfamily (designated GtfC enzymes) and the characterization of the Exiguobacterium sibiricum 255-15 GtfC enzyme, which is also inactive with sucrose and displays 4,6-α-glucanotransferase activity with malto-oligosaccharides. GtfC differs from GtfB in synthesizing isomalto/malto-oligosaccharides. Biochemically, the GtfB- and GtfC-type enzymes are related, but phylogenetically, they clearly constitute different GH70 subfamilies, displaying only 30% sequence identity. Whereas the GtfB-type enzyme largely has the same domain order as glucansucrases (with α-amylase domains A, B, and C plus domains IV and V), this GtfC-type enzyme differs in the order of these domains and completely lacks domain V. In GtfC, the sequence of conserved regions I to IV of clan GH-H is identical to that in GH13 (I-II-III-IV) but different from that in GH70 (II-III-IV-I because of a circular permutation of the (β/α)8 barrel. The GtfC 4,6-α-glucanotransferase enzymes thus represent structurally and functionally very interesting evolutionary intermediates between α-amylase and glucansucrase enzymes. Copyright © 2016, American Society for Microbiology. All Rights Reserved.
Safety analysis report for packaging: neutron shipping cask, model 4T
International Nuclear Information System (INIS)
Peterson, R.T.
1977-01-01
This Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual, Safety Standards for the Packaging of Fissile and Other Radioactive Materials
Mändmaa, Kristjan, 1973-
2008-01-01
Võistlusest "25 kaunimat Eesti raamatut" on autori arvates saanud "kitsa ringi ettevõtmine, kus ühed ja samad keskpärased ja keskealised Eesti raamatukujundajad kordamööda žüriisid moodustades üritavad keskpärasest Eesti raamatukujundustoodangust 25 kandidaati välja sõeluda", autori ettepanekutest ürituse kaasajastamiseks, lisaks omapoolne pingerida
2010-01-01
.... Integrated display means any display that includes the schedules, fares, rules, or availability of all or a... in displays with respect to the seats a carrier holds out as available for sale on a particular... directly in the operation of aircraft in passenger air transportation. Display means the system's...
Method for measuring multiple scattering corrections between liquid scintillators
Energy Technology Data Exchange (ETDEWEB)
Verbeke, J.M., E-mail: verbeke2@llnl.gov; Glenn, A.M., E-mail: glenn22@llnl.gov; Keefer, G.J., E-mail: keefer1@llnl.gov; Wurtz, R.E., E-mail: wurtz1@llnl.gov
2016-07-21
A time-of-flight method is proposed to experimentally quantify the fractions of neutrons scattering between scintillators. An array of scintillators is characterized in terms of crosstalk with this method by measuring a californium source, for different neutron energy thresholds. The spectral information recorded by the scintillators can be used to estimate the fractions of neutrons multiple scattering. With the help of a correction to Feynman's point model theory to account for multiple scattering, these fractions can in turn improve the mass reconstruction of fissile materials under investigation.
International Nuclear Information System (INIS)
Reynolds, G.; Bozorganesh, H.; Elias, E.; Gozani, T.; Maung, T.; Orphan, V.
1979-01-01
Using californium-252 as a source of exciting neutrons, prompt gamma photons emitted by elemental nuclei in the coal have been measured using several detectors, including sodium--iodide and germanium--lithium. Several coal types, including bituminous, subbituminous lignite and anthracite were crushed to various top sizes and analyzed carefully be traditional ASTM wet chemistry techniques at two or three different laboratories. The elements (sulfur, hydrogen, carbon, aluminum, silicon, iron, calcium, sodium, nitrogen, and chlorine) were determined by prompt neutron activations and the quantities compared with those of the wet chemical analyses
International Nuclear Information System (INIS)
Martinot, L.; Fuger, J.
1985-01-01
The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables
Ekstrand, Jan; Lee, Justin C; Healy, Jeremiah C
2016-06-01
The present study evaluated whether the MRI parameters of hamstring injuries in male professional football players correlate with time to return to play (RTP). 46 elite European football teams were followed prospectively for hamstring injuries between 2007 and 2014. Club medical staff recorded individual player exposure and time-loss after hamstring injury. MRI parameters were evaluated by two independent radiologists and correlated with the RTP data. A total of 255 grade 1 and 2 injuries were evaluated in this study. RTP was longer for grade 2 than grade 1 injuries (24±13, 95% CI 21 to 26 days vs 18±15, 95% CI 16 to 20 days; mean difference: 6, 95% CI 2 to 9 days, p=0.004, d=0.39). 84% of injuries affected the biceps femoris (BF) muscle, whereas 12% and 4% affected the semimembranosus (SM) and semitendinosus (ST), respectively. No difference in lay-off time was found for injuries to the three different muscles (BF 20±15 days, SM 18±11 days, ST 23±14 days; p=0.83). The recurrence rate was higher for BF injuries than for SM and ST injuries combined (18% vs 2%, p=0.009). The size of the oedema weakly correlated with time to RTP (r(2)=6-12%). No correlation was found between location of injury and time to RTP. The majority of the intramuscular injuries affected the MT junction (56% in grade 1 and 2 injuries), but no difference in lay-off time was found between the different types of injuries. The radiological grade and size of the oedema correlate with time to RTP for both, grade 1 and 2 injuries. No correlations were found between time to RTP and the location and type of injury. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/
Directory of Open Access Journals (Sweden)
Robert Y. L. Zee
2018-01-01
Full Text Available Recent studies have demonstrated the importance of endoplasmic reticulum aminopeptidase (ERAP in blood pressure (BP homeostasis. To date, no large prospective, genetic–epidemiological data are available on genetic variation within ERAP and hypertension risk. The association of 45 genetic variants of ERAP1 and ERAP2 was investigated in 17,255 Caucasian female participants from the Women’s Genome Health Study. All subjects were free of hypertension at baseline. During an 18-year follow-up period, 10,216 incident hypertensive cases were identified. Multivariable linear, logistic, and Cox regression analyses were performed to assess the relationship of genotypes with baseline BP levels, BP progression at 48 months, and incident hypertension assuming an additive genetic model. Linear regression analyses showed associations of four tSNPs (ERAP1: rs27524; ERAP2: rs3733904, rs4869315, and rs2549782; all p<0.05 with baseline systolic BP levels. Three tSNPs (ERAP1: rs27851, rs27429, and rs34736, all p<0.05 were associated with baseline diastolic BP levels. Multivariable logistic regression analysis showed that ERAP1 rs27772 was associated with BP progression at 48 months (p=0.0366. Multivariable Cox regression analysis showed an association of three tSNPs (ERAP1: rs469783 and rs10050860; ERAP2: rs2927615; all p<0.05 with risk of incident hypertension. Analyses of dbGaP for genotype–phenotype association and GTEx Portal for gene expression quantitative trait loci revealed five tSNPs with differential association of BP and nine tSNPs with lower ERAP1 and ERAP2 mRNA expression levels, respectively. The present study suggests that ERAP1 and ERAP2 gene variation may be useful for risk assessment of BP progression and the development of hypertension.
The protective cell petrus for the production of californium 252
International Nuclear Information System (INIS)
Sontag, R.; Berger, R.
1967-01-01
The alpha, beta, gamma, neutron cell which is described in the present paper is devoted to the transplutonium element production and study. It is located at the CEN in Fontenay-aux-Roses (France). The 4 feet ordinary concrete shielding made of stacked blocs allows the manipulation of radioactive sources as high as 1000 curies of 1 MeV gamma rays and with a fast neutrons flux of 10 9 n.cm -2 .s -1 . The airtight alpha containment box is equipped with two transfer systems, one consists of a parallelepiped shaped airtight box located in a turntable, the other uses standard cylindrical containers made of polyethylene. The general equipment and the main setting up are also described. (authors) [fr
The Design of a Navigator for a Testbed Autonomous Underwater Vehicle
1989-12-01
AD-A231 733 NAVAL POSTGRADUATE SCHOOL Monterey, California DTC C ’S B’- i I A VDI ELECTE 1i EB 0 6 991| D THESIS E THE DESIGN OF A NAVIGATOR FOR A...255,255,0); /* yellow (512-1023) * for (i= 1024; i< 2048 ; ++i) mapcolor(i,255 ,0,255); 1* magenta (1024-2047 )*/ color(BLACK); clearo; swapbufferso; 1
Structural study of Sr0.3Ba0.7Nb2O6 and La0.030Sr0.255Ba0.700Nb2O6 ceramic systems
International Nuclear Information System (INIS)
Luna-Lopez, J.A.; Portelles, J.; Raymond, O.; Siqueiros, J.M.
2009-01-01
Sr 0.3 Ba 0.7 Nb 2 O 6 (SBN) and La 0.030 Sr 0.255 Ba 0.700 Nb 2 O 6 (LSBN) ceramic compounds have been prepared using the traditional ceramic method at two different calcination temperatures (900 and 1000 deg. C) and later sintered both at 1400 deg. C. A study of the effects of the calcination temperatures and La substitution on the morphological, compositional, and structural properties of SBN and LSBN is presented using scanning electronic microscopy (SEM), energy dispersive spectroscopy (EDS), and X-ray diffraction (XRD) analysis. From Rietveld refinement processes, the XRD patterns were interpreted to evaluate such effects in the structural parameters and the site occupation factors of the heavy metals and oxygen atoms. The effect of the incorporation of La resulted in a 0.25% cell contraction and turned out to be higher than the 0.08% dilation effect produced by the increase of calcination temperature. The La ion with similar effective ionic radius and higher electronegativity is incorporated into the structure occupying the A 1 site just like the Sr ions in the SBN compound. Differences in the site occupation factors between the SBN and LSBN samples lead to substantial changes in the physical properties such as temperature of relative dielectric constant maximum, relative dielectric constant, and dielectric loss, correlated with the distortion and the relative orientation of the oxygen octahedra.
International Nuclear Information System (INIS)
Anon.
1999-01-01
These radiation protection data sheet are devoted to responsible persons and employees of various laboratories or medical, pharmaceutical, university and industrial departments where radionuclides are handled as well as all the persons who attend to satisfy in this field. They contain the essential radiation protection data for the use of unsealed sources: physical characteristics, risk assessment, administrative procedures, recommendations, regulations and bibliography. This new series includes the following radionuclides: californium 252, curium 244, gallium 67, indium 113m, plutonium 238, plutonium 239, polonium 210, potassium 42, radium 226, thorium 232, uranium 238 and zinc 65. (O.M.)
International Nuclear Information System (INIS)
Bobrov, A. A.; Glushkov, E. S.; Zimin, A. A.; Kapitonova, A. V.; Kompaniets, G. V.; Nosov, V. I.; Petrushenko, R. P.; Smirnov, O. N.
2012-01-01
A method for experimental determination of the relative power density distribution in a heterogeneous reactor based on measurements of fuel reactivity effects and importance of neutrons from a californium source is proposed. The method was perfected on two critical assembly configurations at the NARCISS facility of the Kurchatov Institute, which simulated a small-size heterogeneous nuclear reactor. The neutron importance measurements were performed on subcritical and critical assemblies. It is shown that, along with traditionally used activation methods, the developed method can be applied to experimental studies of special features of the power density distribution in critical assemblies and reactors.
Strategic Design of an Effective beta-Lactamase Inhibitor
Energy Technology Data Exchange (ETDEWEB)
Pattanaik, P.; Bethel, C; Hujer, A; Hujer, K; Distler, A; Taracila, M; Anderson, V; Fritsche, T; Jones, R; et. al.
2009-01-01
In an effort to devise strategies for overcoming bacterial beta-lactamases, we studied LN-1-255, a 6-alkylidene-2'-substituted penicillin sulfone inhibitor. By possessing a catecholic functionality that resembles a natural bacterial siderophore, LN-1-255 is unique among beta-lactamase inhibitors. LN-1-255 combined with piperacillin was more potent against Escherichia coli DH10B strains bearing bla(SHV) extended-spectrum and inhibitor-resistant beta-lactamases than an equivalent amount of tazobactam and piperacillin. In addition, LN-1-255 significantly enhanced the activity of ceftazidime and cefpirome against extended-spectrum cephalosporin and Sme-1 containing carbapenem-resistant clinical strains. LN-1-255 inhibited SHV-1 and SHV-2 beta-lactamases with nm affinity (K(I) = 110 +/- 10 and 100 +/- 10 nm, respectively). When LN-1-255 inactivated SHV beta-lactamases, a single intermediate was detected by mass spectrometry. The crystal structure of LN-1-255 in complex with SHV-1 was determined at 1.55A resolution. Interestingly, this novel inhibitor forms a bicyclic aromatic intermediate with its carbonyl oxygen pointing out of the oxyanion hole and forming hydrogen bonds with Lys-234 and Ser-130 in the active site. Electron density for the 'tail' of LN-1-255 is less ordered and modeled in two conformations. Both conformations have the LN-1-255 carboxyl group interacting with Arg-244, yet the remaining tails of the two conformations diverge. The observed presence of the bicyclic aromatic intermediate with its carbonyl oxygen positioned outside of the oxyanion hole provides a rationale for the stability of this inhibitory intermediate. The 2'-substituted penicillin sulfone, LN-1-255, is proving to be an important lead compound for novel beta-lactamase inhibitor design.
76 FR 27079 - Agency Information Collection Activities: Declaration of Unaccompanied Articles
2011-05-10
... Activities: Declaration of Unaccompanied Articles AGENCY: U.S. Customs and Border Protection, Department of...: Declaration of Unaccompanied Articles (CBP Form 255). This is a proposed extension of an information... Articles. OMB Number: 1651-0030. Form Number: CBP Form 255. Abstract: CBP Form 255 is completed by...
Publications | Page 255 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. ... Journal articles ... to the advantages of chemical input- intensive green revolution technology.
16 CFR 255.1 - General considerations.
2010-01-01
... an uncooked chicken in the oven roasting bag and places the bag in one oven. He then takes a chicken roasting bag from a second oven, removes from the bag what appears to be a perfectly cooked chicken, tastes... conduct. Example 4: A well-known celebrity appears in an infomercial for an oven roasting bag that...
Reference: 255 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available ases, AtIPK1 and AtIPK2beta, for the later steps of phytate synthesis in Arabidopsis thaliana. Coincident disruption...olyphosphate kinases in phosphate signaling biology. Generation of phytate-free seeds in Arabidopsis through disruption
24 CFR 983.255 - Tenant screening.
2010-04-01
... peaceful enjoyment of their housing; (iv) Drug-related criminal activity or other criminal activity that is... criminal activity by family members. (3) The PHA must give the family a description of the PHA policy on... information to all owners. (d) The protections for victims of domestic violence, dating violence, and stalking...
16 CFR 255.3 - Expert endorsements.
2010-01-01
... packaging -is neither relevant nor available to consumers, and the basis for the hospital's decision is not..., take into account factors not within his or her expertise (e.g., matters of taste or price), the... characteristics with respect to which he or she is expert and which are relevant to an ordinary consumer's use of...
Directory of Open Access Journals (Sweden)
Diez Claudius
2006-10-01
Full Text Available Abstract Background It is not clear how prevalent Internet use among cardiopathic patients in Germany is and what impact it has on the health care utilisation. We measured the extent of Internet use among cardiopathic patients and examined the effects that Internet use has on users' knowledge about their cardiac disease, health care matters and their use of the health care system. Methods We conducted a prospective survey among 255 cardiopathic patients at a German university hospital. Results Forty seven respondents (18 % used the internet and 8,8 % (n = 23 went online more than 20 hours per month. The most frequent reason for not using the internet was disinterest (52,3 %. Fourteen patients (5,4 % searched for specific disease-related information and valued the retrieved information on an analogous scale (1 = not relevant, 5 = very relevant on median with 4,0. Internet use is age and education dependent. Only 36 (14,1 % respondents found the internet useful, whereas the vast majority would not use it. Electronic scheduling for ambulatory visits or postoperative telemedical monitoring were rather disapproved. Conclusion We conclude that Internet use is infrequent among our study population and the search for relevant health and disease related information is not well established.
International Nuclear Information System (INIS)
Lamaze, G.P.; Schima, F.J.; Eisenhauer, C.M.; Spiegel, V.
1988-01-01
Because of the similarity in energy dependence of the /sup 103/Rh(n,n') differential cross section to the kerma muscle response function for neutrons, rhodium may be useful as a neutron kerma monitor. In support of its use as a neutron monitor, the spectrum-averaged cross section σ-bar has been measured for a /sup 252/Cf fission neutron spectrum. Pairs of thin rhodium samples were irradiated on opposite sides of a thinly encapsulated /sup 252/Cf neutron source. The neutron emission rate of the /sup 252/Cf source was determined by the manganous sulfate (MnSO/sub 4/) bath technique. In this method, the californium source emission rate is determined by comparison to the known emission rate of NBS-I, a standard radium-beryllium neutron source. The neutron fluence incident on the rhodium samples is determined from the californium source strength, average sample-to-source distance, and the duration of the irradiation. Corrections are made for neutron scattering saturation of activity, and attenuation of the X rays by the sample during counting. The X rays were detected with an intrinsic germanium detector designed specifically for low-energy X-ray detection. The activity was not determined by absolute counting so that the final results depend on the value of P/sub Κx/, to total Κ X-ray emission probability. The results of five separate irradiations yield a value of σ-bar . P/sub Κx/ = 62.3 +- 1.9 mb. Using the most recently published value of P/sub Κx/ gives a value of σ-bar = 739 +- 22 mb. A discussion of systematic uncertainties is given
Multiple Robots Localization Via Data Sharing
2015-09-01
multiple humans, each with specialized skills complementing each other, work to create the solution. Hence, there is a motivation to think in terms of...pygame.Color(255,255,255) COLORBLACK = pygame.Color(0,0,0) F. AUTOMATE.PY The automate.py file is a helper file to assist in running multiple simulation
Lee, PY; Knight, R; Smit, JM; Wilschut, J; Griffin, DE
The amino acid at position 55 of the E2 glycoprotein (E2(55)) of Sindbis virus (SV) is a critical determinant of SV neurovirulence in mice. Recombinant virus strain TE (E2(55) = histidine) differs only at this position from virus strain 633 (E2(55) = glutamine), yet TE is considerably more
Use of californium-252 sources in Hungary for teaching and research
International Nuclear Information System (INIS)
Csikai, J.
1976-01-01
An activation facility was designed to accommodate up to 50 mg of 252 Cf; it contains at present a 500 μg source. The absolute values of thermal, epithermal and fast neutron fluxes were determined by the foil activation method using In, Dy, Au, Al and Fe detectors. Cross-sections averaged for unmoderated 252 Cf neutrons were determined for 22 different reactions for elements with atomic weights lying between A=27 and 204. The sensitivity for determination of Al, Ti, Cu, As, Sr, Mo, In, Cd, Ba, Au, Hg and Pb was calculated for NaI(Tl) and Ge(Li) detectors. Average (n,2n) cross-sections for 252 Cf spectrum were calculated for 49 nuclei lying between A=14 and 204. Angular distributions and cross-sections for the fragments from 252 Cf neutron-induced fission of 232 Th and 238 U were measured. Titanium in bauxite and manganese in aluminium alloys were determined with a 252 Cf source. The applicability of solid-state track detectors for neutron dosimetry, radiography and for the determination of fuel burn-up were investigated using 252 Cf neutron and fragment sources. Characteristics of a jumping spark counter for counting fission fragments were studied with 252 Cf sources. (author)
International Nuclear Information System (INIS)
Fabry, A.; McElroy, W.N.; Kellogg, L.S.; Lippincott, E.P.; Grundl, J.A.; Gilliam, D.M.; Hansen, G.E.
1976-01-01
This paper is intended to review and critically discuss microscopic integral cross section measurement and calculation data for fundamental reactor dosimetry benchmark neutron fields. Specifically the review covers the following fundamental benchmarks: the spontaneous californium-252 fission neutron spectrum standard field; the thermal-neutron induced uranium-235 fission neutron spectrum standard field; the (secondary) intermediate-energy standard neutron field at the center of the Mol-ΣΣ, NISUS, and ITN-ΣΣ facilities; the reference neutron field at the center of the Coupled Fast Reactor Measurement Facility; the reference neutron field at the center of the 10% enriched uranium metal, cylindrical, fast critical; the (primary) Intermediate-Energy Standard Neutron Field
Development of a transportable neutron radiography system for non-destructive tests application
International Nuclear Information System (INIS)
Silva, Ademir X. da; Crispim, Verginia R.
1999-01-01
This paper presents a study of a transportable neutron radiography system utilizing californium-252. Studies about moderation, collimation and shielding are showed. A Monte Carlo Code, MCNP3b, has been used to obtain a maximum and more homogeneous thermal neutron flux in the collimator outlet next to the image plain, and an adequate radiation shielding to attend radiological protection rules. With the presented collimator, it was possible to obtain for the thermal neutron flux, at the collimator outlet and next to the image plain, a L/D ratio 7,5, for neutron flux up to 6 X 10 -6 cm -2 .s -1 per neutron source. (author)
Neutron crosstalk between liquid scintillators
Energy Technology Data Exchange (ETDEWEB)
Verbeke, J.M., E-mail: verbeke2@llnl.gov; Prasad, M.K., E-mail: prasad1@llnl.gov; Snyderman, N.J., E-mail: snyderman1@llnl.gov
2015-09-11
A method is proposed to quantify the fractions of neutrons scattering between liquid scintillators. Using a spontaneous fission source, this method can be utilized to quickly characterize an array of liquid scintillators in terms of crosstalk. The point model theory due to Feynman is corrected to account for these multiple scatterings. Using spectral information measured by the liquid scintillators, fractions of multiple scattering can be estimated, and mass reconstruction of fissile materials under investigation can be improved. Monte Carlo simulations of mono-energetic neutron sources were performed to estimate neutron crosstalk. A californium source in an array of liquid scintillators was modeled to illustrate the improvement of the mass reconstruction.
Neutron crosstalk between liquid scintillators
International Nuclear Information System (INIS)
Verbeke, J.M.; Prasad, M.K.; Snyderman, N.J.
2015-01-01
A method is proposed to quantify the fractions of neutrons scattering between liquid scintillators. Using a spontaneous fission source, this method can be utilized to quickly characterize an array of liquid scintillators in terms of crosstalk. The point model theory due to Feynman is corrected to account for these multiple scatterings. Using spectral information measured by the liquid scintillators, fractions of multiple scattering can be estimated, and mass reconstruction of fissile materials under investigation can be improved. Monte Carlo simulations of mono-energetic neutron sources were performed to estimate neutron crosstalk. A californium source in an array of liquid scintillators was modeled to illustrate the improvement of the mass reconstruction
International Nuclear Information System (INIS)
Haynes, C.E.
1976-01-01
The Transuranium Research Laboratory (TRL) is the central facility at Oak Ridge National Laboratory (ORNL) for chemical and physical research involving transuranium elements. Transuranium Research Laboratory investigations are about equally divided between studies of inorganic and structural chemistry of the heavy elements and nuclear structure and properties of their isotopes. Elements studied include neptunium, plutonium, americium, curium, berkelium, californium, and einsteinium, each in microgram-to-gram quantities depending upon availability and experimental requirements. This paper describes an eight-step safety procedure followed in planning and approving individual research projects. This procedure should provide an optimum margin of safety and should permit the accomplishment of successful research
International Nuclear Information System (INIS)
Romeyer Dherbey, J.; Lacruche, G.; Berne, R.; Auge, J.; Martin Deidier, L.; Butez, M.
1990-01-01
The Quantitative control (determination of heavy nuclides and alpha activity) of alpha radioactive wastes is necessary, particularly to determine if the waste is in accordance with the surface storage limits. In order to reduce the uncertainty on the alpha activity resulting from unknown isotopic composition, inhomogeneity of heavy nuclides in the matrix, combination of several methods is necessary. In the paper we present the Cadarache development work in the NDA of solid waste using the Californium shuffler, 14 Mev neutron generator, and also passive techniques such as neutron emission measurement and gamma spectrometry. Experimental systems combining active and passive methods are presented (COSAC, BANCO, DANAIDE, PROMETHEE)
Beam test of a grid-less multi-harmonic buncher
International Nuclear Information System (INIS)
Ostroumov, P.N.; Aseev, V.N.; Barcikowski, A.; Clifft, B.; Pardo, R.; Sharamentov, S.I.; Sengupta, M.
2008-01-01
The Argonne Tandem Linear Accelerator System (ATLAS) is the first superconducting heavy-ion linac in the world. Currently ATLAS is being upgraded with the Californium Rare Ion Breeder Upgrade (CARIBU). The latter is a funded project to expand the range of shortlived, neutron-rich rare isotope beams available for nuclear physics research at ATLAS. To avoid beam losses associated with the existing gridded multi-harmonic buncher (MHB), we have developed and built a grid-less four-harmonic buncher with fundamental frequency of 12.125 MHz. In this paper, we report the results of the MHB commissioning and ATLAS beam performance with the new buncher.
Composition containing transuranic elements for use in the homeopathic treatment of aids
International Nuclear Information System (INIS)
Lustig, D.
1996-01-01
A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)
Energy Technology Data Exchange (ETDEWEB)
Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert
1976-07-01
This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.
Energy Technology Data Exchange (ETDEWEB)
Albrecht-Schmitt, Thomas
2012-03-01
This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.
Triton and alpha-particle contribution from LiF converter for neutron dosimeter
Camacho, M E; Balcazar, M
1999-01-01
A personnel neutron dosimeter prototype based on chemical and electrochemical etched CR-39 detector, combined with LiF converter, has been calibrated using an ICRP-like phantom, under a heavy-water moderated Californium source neutron spectra; A conversion factor of 1.052+-126 spots cm sup - sup 2 mSv sup - sup 1 was obtained. The sealing properties of the detector holder showed a ten-fold reduction in radon background when it was tested in a high radon atmosphere. A convenient mechanical shock resistance was achieved in LiF converters by sintering to 11 tons pressure LiF powder at 650 deg. C, during one hour.
Study of reproducibility of measurements with the spectrometer of Bonner multispheres
International Nuclear Information System (INIS)
Azevedo, G.A.; Pereira, W.W.; Patrao, K.C.S.; Fonseca, E.S.
2013-01-01
This work aims to study the metrological behavior of the Bonner Multisphere Spectrometer (BMS) of the LN / LNMRI / IRD - Laboratorio Metrologia de Neutrons / Laboratorio Nacional de Metrologia e Radiacao Ionizante / Instituto de Radioprotecao e Dosimetria, for measurements in repeatability and reproducibility conditions. Initially, a simulation was done by applying the Monte Carlo method, using the MCNP code and respecting the ISO 8529-1 (2001), using the sources of Californium ( 252 Cf), Americium-Beryllium ( 241 AmBe) and californium in heavy water (Cf + D 2 O), all located at a distance of 100 cm from the neutron detector ( 6 Li (Eu) - crystal scintillator). In this program, the counting of neutrons that are captured by the detector was made. The source is located in the center of a sphere of radius 300 cm. Analyzes the impact of these neutrons in a point of the sphere wall, which in this case acted as a neutron detector and from there, it is estimated the number of neutrons that collide in the whole sphere. The purpose is to obtain the neutron count for different energy bands in a solid field of neutrons, since they have a spectrum ranging from a low to a high energy that can also vary within a particular environment. Wishes to obtain new fields with different sources and moderators materials to be used as new reference fields. Measurements are being conducted for these fields, with the aim of analyzing the variability conditions of the measurement (repeatability and reproducibility) in LEN - Laboratorio de Espectrometria de Neutrons of the LN/LMNRI/IRD. Thus, the spectrometer will be used to improve both the knowledge of the spectrum as the standard of neutrons of the lab, proving that a spectrometry is essential for correct measurement
Energy Technology Data Exchange (ETDEWEB)
Jones, C.G.
1990-08-01
This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs.
Alternative irradiation system for efficiency manganese bath determination
Energy Technology Data Exchange (ETDEWEB)
Passos Leite, Sandro, E-mail: sandro@ird.gov.b [Programa de Engenharia Nuclear/COPPE, Universidade Federal do Rio de Janeiro, Ilha do Fundao, Caixa Postal 68509, 21945-970, Rio de Janeiro, RJ (Brazil); Wagner Pereira, Walsan, E-mail: walsan@ird.gov.b [Instituto de Radioprotecao e Dosimetria LNMRI/IRD/CNEN, Av. Salvador Allende, s/no, Recreio dos Bandeirantes, CEP: 22780-160, Rio de Janeiro (Brazil); Xavier da Silva, Ademir, E-mail: ademir@con.ufrj.b [Programa de Engenharia Nuclear/COPPE, Universidade Federal do Rio de Janeiro, Ilha do Fundao, Caixa Postal 68509, 21945-970, Rio de Janeiro, RJ (Brazil); Simoes da Fonseca, Evaldo, E-mail: evaldo@ird.gov.b [Instituto de Radioprotecao e Dosimetria LNMRI/IRD/CNEN, Av. Salvador Allende, s/no, Recreio dos Bandeirantes, CEP: 22780-160, Rio de Janeiro (Brazil); Souza Patrao, Karla Cristina de, E-mail: karla@ird.gov.b [Instituto de Radioprotecao e Dosimetria LNMRI/IRD/CNEN, Av. Salvador Allende, s/no, Recreio dos Bandeirantes, CEP: 22780-160, Rio de Janeiro (Brazil)
2010-12-15
An alternative irradiation system, which works with a radionuclide neutron source and manganese sulphate solution volume have been proposed for efficiency determination of a Manganese Bath System (MBS). This irradiation system was designed by simulation with MCNP5 code, considering a californium neutron source in several manganese sulphate volumes and different neutron reflectors. Although its solution specific activity are less than those in nuclear reactors, the simulation results have showed that the irradiation system proposed takes a manganese neutron capture increase up to 200 times when it compared to manganese neutron capture from a MBS whose diameter is about 100 cm. That becomes possible to use those samples for some of the absolute specific activity measuring methods.
Experimental survey of the potential energy surfaces associated with fission
International Nuclear Information System (INIS)
Britt, H.C.
1980-01-01
Progress in the experimental determination of the properties of the potential energy surface associated with fission is reviewed. The importance of nuclear symmetry effects on the calculation of fission widths is demonstrated. Evidence is presented for the fragmentation of the mass-asymmetric second barrier in the thorium region and the axial asymmetric first barrier in the californium region. Detailed analyses of experimental data suggest the presence of two parallel second barriers; the normal mass-asymmetric, axial-symmetric barrier and a slightly higher mass-symmetric, axial-asymmetric barrier. Experimental barrier parameters are determined systematically and compared with calculations from various theoretical models. Techniques for expanding fission probability measurements to higher energies are discussed. (author)
International Nuclear Information System (INIS)
Jones, C.G.
1990-08-01
This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs
International Nuclear Information System (INIS)
Fabry, A.; McElroy, W.N.; Kellogg, L.S.; Lippincott, E.P.; Grundl, J.A.; Gilliam, D.M.; Hansen, G.E.
1976-10-01
The paper is intended to review and critically discuss microscopic integral cross section measurement and calculation data for fundamental reactor dosimetry benchmark neutron fields. Specifically the review covers the following fundamental benchmarks: (1) the spontaneous californium-252 fission neutron spectrum standard field; (2) the thermal-neutron induced uranium-235 fission neutron spectrum standard field; (3) the (secondary) intermediate-energy standard neutron field at the center of the Mol-ΣΣ, NISUS, and ITN--ΣΣ facilities; (4) the reference neutron field at the center of the Coupled Fast Reactor Measurement Facility (CFRMF); (5) the reference neutron field at the center of the 10 percent enriched uranium metal, cylindrical, fast critical; and (6) the (primary) Intermediate-Energy Standard Neutron Field
7 CFR 1944.255 - Eligible supportive services.
2010-01-01
... 802(k)(16) and in section 1944.105. (c) Meal services shall meet the following guidelines: (1) Type of... conditions such as diabetes and hypertension. Grantees should attempt to meet the dietary needs of varying... dietary allowances as established by the Food and Nutrition Board of the National Academy of Sciences...
6 CFR 25.5 - Obligations of seller.
2010-01-01
... liability insurance required, the Under Secretary may consider any factor, including, but not limited to... liability insurance offered on the world market; (vi) Data and history regarding mass casualty losses; (vii... price of the product, and the possible consequences thereof for development, production, or deployment...
16 CFR 255.0 - Purpose and definitions.
2010-01-01
... represent administrative interpretations of laws enforced by the Federal Trade Commission for the guidance... individuals generally acquire. Example 1: A film critic's review of a movie is excerpted in an advertisement...
24 CFR 203.255 - Insurance of mortgage.
2010-04-01
... Mortgage Scorecard is used by the mortgagee, and the TOTAL Mortgage Scorecard has determined that the application represents an acceptable risk under terms and conditions agreed to by the FHA, a Direct... also applicable to the use of the TOTAL Mortgage Scorecard: (i) Mortgagees and vendors must certify to...
40 CFR 255.1 - Scope and purpose.
2010-07-01
... improper solid waste disposal including protection of surface and ground water quality, air quality and the... types (residential and commercial solid waste, hazardous wastes, industrial sludges and pretreatment residues, municipal sewage sludge, air pollution control residue, septage, mining and agricultural waste...
Californium-252 neutron activation analysis of high-level processed nuclear tank waste
International Nuclear Information System (INIS)
Troyer, G.L.; Purcell, M.A.
2000-01-01
The basis for production assessment of the vitrification of Hanford nuclear fuel reprocessing wastes will be high-precision measurements of the elemental sodium content. However, the chemical analysis of both radioactive and nonradioactive components in nuclear waste can be challenged by high radiation dose rates. The dose rates compromise many analytical techniques as well as pose personnel dosimetry risks. In many cases, reduction of dose rates through dilution compromises the precision and sensitivity for certain key components. The use of neutron activation analysis (NAA) provides a method of analysis that avoids the need for dilutions or extensive sample preparation. These waste materials also contain trace quantities of fissionable isotopes, which, through neutron activation, can be estimated by delayed neutron counting of fissioned fragments
Californium-252: isotope for modern radiotherapy of cervix, uterine and vaginal carcinomas
International Nuclear Information System (INIS)
Maruyama, J.; Beach, J.L.; Nagell, J.R. van
1984-01-01
Cf-252 is an isotope that can easily be afterloaded into available gynecological applicators and used for bulky cervix, uterus or vaginal cancer therapy. It is economical, time and cost effective in use, and can be applied to the therapy of many patients throughout the world. It is more effective for neutron therapy than machine fast neutron therapy and is the only form of neutron therapy producing consistent complication-free 5-year cure of advanced cancers currently available. Cf-252 is an isotope for modern gynecological tumor therapy for the future. Isodose curves for Cf-252 implants revealed dose distributions conforming well to tumor. (orig.) [de
NCBI nr-aa BLAST: CBRC-AGAM-02-0116 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-AGAM-02-0116 ref|ZP_00539486.1| Gluconate transporter [Exiguobacterium sibiric...um 255-15] gb|EAM87290.1| Gluconate transporter [Exiguobacterium sibiricum 255-15] ZP_00539486.1 1.8 41% ...
A new type-B cask design for transporting 252Cf
International Nuclear Information System (INIS)
Simmons, C.M.
2000-01-01
A project to design, certify, and build a new US Department of Energy (DOE) Type B container for transporting >5 mg of 252 Cf is more than halfway to completion. This project was necessitated by the fact that the existing Oak Ridge National Laboratory (ORNL) Type B containers were designed and built many years ago and thus do not have the records and supporting data that current regulations require. Once the new cask is available, it will replace the existing Type B containers. The cask design is driven by the unique properties of 252 Cf, which is a very intense spontaneous fission neutron source and necessitates a large amount of neutron shielding. The cask is designed to contain up to 60 mg of 252 Cf in the form of californium oxide or californium oxysulfate, in pellet, wire, or sintered material forms that are sealed inside small special-form capsules. The new cask will be capable of all modes of transport (land, sea, and air). The ORNL team, composed of technical and purchasing personnel and using rigorous selection criteria, chose NAC, International (NAC), as the subcontractor for the project. In January 1997, NAC started work on developing the conceptual design and performing the analyses. The original design concept was for a tungsten alloy gamma shield surrounded by two concentric shells of NS-4-FR neutron shield material. A visit to US Nuclear Regulatory Commission (NRC) regulators in November 1997 to present the conceptual design for their comments resulted in a design modification when the question of potential straight-line cracking in the NS-4-FR neutron shield material arose. NAC's modified design includes offset, wedgelike segments of the neutron shield material. The new geometry eliminates concerns about straight-line cracking but increases the weight of the packaging and makes the fabrication more complex. NAC has now completed the cask design and performed the analyses (shielding, structural, thermal, etc.) necessary to certify the cask. The cask
NCBI nr-aa BLAST: CBRC-DSIM-02-0067 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DSIM-02-0067 ref|ZP_00538033.1| conserved hypothetical protein [Exiguobacterium sibi...ricum 255-15] gb|EAM88856.1| conserved hypothetical protein [Exiguobacterium sibiricum 255-15] ZP_00538033.1 2.9 36% ...
NCBI nr-aa BLAST: CBRC-TGUT-17-0007 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TGUT-17-0007 ref|ZP_00539638.1| Cytochrome-c oxidase [Exiguobacterium sibiricu...m 255-15] gb|EAM87238.1| Cytochrome-c oxidase [Exiguobacterium sibiricum 255-15] ZP_00539638.1 0.040 31% ...
Optimal severance payment: theory and practice
Czech Academy of Sciences Publication Activity Database
Jeong, Byeongju
-, č. 255 (2005), s. 1-22 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : severance payment * optimal separation Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp255.pdf
Environmental influences on the trawl catches in a bay-estuarine system of Goa, west coast of India
Digital Repository Service at National Institute of Oceanography (India)
Ansari, Z.A.; Sreepada, R.A.; Dalal, S.G.; Ingole, B.S.; Chatterji, A.
) Mean sediment pH; microphytob enthic biomass (SC hl a ; l gg C255 1 ); org anic carbo n (%); macro benth ic biomass (g m C255 2 ) and macro benthic de nsity (ind m C255 2 ). Vertical bars represen t standar d deviat ion ( n ¼ 6). proportion..., 1989; Blaber & Blaber, 1980; Blaber & Milton, 1990; Day & Yanez-Arancibia, 1985; Lenanton, 1982; Potter, Beckley, Whitefield, & Lenanton, 1990; Qasim, 1973). Almost 60% of the world fish catch is taken from these coastal ecosystems (Lie, 1983...
NCBI nr-aa BLAST: CBRC-ACAR-01-0074 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0074 ref|YP_317715.1| hypothetical protein Nwi_1101 [Nitrobacter winogradsky...i Nb-255] gb|ABA04363.1| conserved hypothetical protein [Nitrobacter winogradskyi Nb-255] YP_317715.1 6.5 24% ...
International Nuclear Information System (INIS)
Peterson, J.R.
1987-01-01
New knowledge is being accumulated in the role of the 5f electrons in the bonding in actinide elements and compounds, the relationships of metallic structures to metallic valence and radius, the extent and magnitude of the actinide contraction, the magnetic, thermodynamic, spectroscopic, and crystallographic properties of these materials as related to general theories, the effect of self-irradiation on chemical and physical properties, the chemical and physical consequences of radioactive decay in the bulk-phase solid state, and in general, the range of validity of the actinide hypothesis. Separate reports are given on: spectrophotometric studies of Cf(III) ions in lanthanide trihalide hosts, new ternary transplutonium chalcogenide halides, Raman spectrometric studies of lanthanide trihalides as function of T or P, and solution calorimetry of californium halides
International Nuclear Information System (INIS)
Galle, P.
1982-01-01
The aim of this symposium was to review the radionuclide toxicity problems. Five topics were discussed: (1) natural and artificial radionuclides (origin, presence or emission in the environment, human irradiation); (2) environmental behaviour of radionuclides and transfer to man; (3) metabolism and toxicity of radionuclides (radioiodine, strontium, rare gas released from nuclear power plants, ruthenium-activation metals, rare earths, tritium, carbon 14, plutonium, americium, curium and einsteinium, neptunium, californium, uranium) cancerogenous effects of radon 222 and of its danghter products; (4) comparison of the hazards of various types of energy; (5) human epidemiology of radionuclide toxicity (bone cancer induction by radium, lung cancer induction by radon daughter products, liver cancer and leukaemia following the use of Thorotrast, thyroid cancer; other site of cancer induction by radionuclides) [fr
International Nuclear Information System (INIS)
Bigelow, J.E.; Cagle, E.B.; Knauer, J.B.
1987-01-01
The Transuranium Processing Plant (TPP) at ORNL has been requested by the Food and Drug Administration (FDA) to furnish 200 mg of 252 Cf for use in their new activation analysis facility. This paper discusses the procedure to be employed in fabricating the californium into four neutron sources, each containing a nominal 50-mg of 252 Cf. The ORNL Model LSD (Large, Stainless steel, Doubly encapsulated) neutron source consists of a 6.33-mm-diam aluminum pellet doubly encapsulated in Type 304L stainless steel. The pellet is comprised of an aluminum tube holding Cf 2 O 2 SO 4 microspheres confined by pressed aluminum powder. The microspheres are prepared in a separate vessel and then transferred into the specially designed aluminum tube prior to pressing
NCBI nr-aa BLAST: CBRC-RNOR-14-0028 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RNOR-14-0028 ref|YP_319008.1| hypothetical protein Nwi_2402 [Nitrobacter winogradsky...i Nb-255] gb|ABA05656.1| hypothetical protein Nwi_2402 [Nitrobacter winogradskyi Nb-255] YP_319008.1 0.59 24% ...
NCBI nr-aa BLAST: CBRC-LAFR-01-2180 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-LAFR-01-2180 ref|ZP_00540137.1| Carbon starvation protein CstA [Exiguobacterium sibi...ricum 255-15] gb|EAM86697.1| Carbon starvation protein CstA [Exiguobacterium sibiricum 255-15] ZP_00540137.1 1.4 28% ...
Genetic diversity of taro, Colocasia esculenta (L.) Schott, in Southeast Asia and the Pacific
Kreike, N.; Eck, van H.J.; Lebot, V.
2004-01-01
The genetic diversity of 255 taro (Colocasia esculenta) accessions from Vietnam, Thailand, Malaysia, Indonesia, the Philippines, Papua New Guinea and Vanuatu was studied using AFLPs. Three AFLP primer combinations generated a total of 465 scorable amplification products. The 255 accessions were
NCBI nr-aa BLAST: CBRC-CBRE-01-1515 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CBRE-01-1515 ref|ZP_00539266.1| Protein of unknown function UPF0118 [Exiguobacterium sibi...ricum 255-15] gb|EAM87555.1| Protein of unknown function UPF0118 [Exiguobacterium sibiricum 255-15] ZP_00539266.1 8e-66 34% ...
NCBI nr-aa BLAST: CBRC-CBRE-01-1515 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CBRE-01-1515 ref|ZP_00538423.1| Protein of unknown function UPF0118 [Exiguobacterium sibi...ricum 255-15] gb|EAM88432.1| Protein of unknown function UPF0118 [Exiguobacterium sibiricum 255-15] ZP_00538423.1 2e-68 34% ...
76 FR 11254 - Agency Information Collection Activities: Declaration of Unaccompanied Articles
2011-03-01
... Activities: Declaration of Unaccompanied Articles AGENCY: U.S. Customs and Border Protection (CBP... collection requirement concerning the Declaration of Unaccompanied Articles (CBP Form 255). This request for...: Title: Declaration of Unaccompanied Articles. OMB Number: 1651-0030. Form Number: CBP Form 255. Abstract...
Primary productivity of the Arabian Sea
Digital Repository Service at National Institute of Oceanography (India)
Pant, A.
stream_size 13 stream_content_type text/plain stream_name Trop_Ecosyst_Ecol_Manage_1992_255.pdf.txt stream_source_info Trop_Ecosyst_Ecol_Manage_1992_255.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...
Determination of the average number of neutrons per fission event for californium-252
International Nuclear Information System (INIS)
Aleksandrov, B.M.; Belov, L.M.; Drapchinskij, L.V.
1982-01-01
By means of a separate determination of neutron yields and fission event rates, the value of #betta#-bar( 252 Cf) has been measured for a series of new high-purity sources. The improved quality of the source active layers has reduced the error in determining the fission rate to 0.35%. The value obtained for #betta#-bar( 252 Cf) is 3.747+-0.036. A description is given of the design and the parameters of a spherical manganese bath in which the work on refining the value of #betta#-bar( 252 Cf) will be continued. (author)
Energy Technology Data Exchange (ETDEWEB)
Benker, D.E.; Chattin, F.R.; Collins, E.D.; Knauer, J.B.; Orr, P.B.; Ross, R.G.; Wiggins, J.T.
1980-01-01
Decigram quantities of highly radioactive transplutonium elements are routinely partitioned at TRU by chromatographic elution from cation resin using AHIB eluent. By using two high-pressure ion exchange columns, a small one for the initial loading of the feed and a large one for the elution, batch runs containing up to 200 mg of /sup 252/Cf can be made in about 5 hours (2 hours to load the feed and 3 hours for the elution). The number of effluent product fractions and the amount of actinides that must be collected in intermediate fractions are minimized by monitoring response from a flow-through alpha-detector. This process has been reliable and relatively easy to operate, and will continue to be used for partitioning transplutonium elements at TRU.
NCBI nr-aa BLAST: CBRC-TNIG-22-0185 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TNIG-22-0185 ref|YP_318524.1| putative manganese transport protein MntH [Nitrobacter winogradsky...i Nb-255] gb|ABA05172.1| Mn2+ and Fe2+ transporters of the NRAMP family [Nitrobacter winogradskyi Nb-255] YP_318524.1 0.15 28% ...
International Nuclear Information System (INIS)
King, L.J.; Bigelow, J.E.; Collins, E.D.
1976-03-01
During the period January 1, 1975, through June 30, 1975, the following amounts of transuranium elements were recovered from 22 irradiated HFIR targets: 2g 243 Am, 59 g 244 Cm, 51 mg 249 Bk, 465 mg 252 Cf, 2.5 mg 253 Es, and 1.4 pg 257 Fm. In addition, 45 mg of high-purity 248 Cm was operated from 252 Cf which had been recovered and purified during earlier periods, and 56 mg of a lower-quality 248 Cm was separated from californium purification rework solutions. Five HFIR targets, each containing approximately 9 g of actinides (predominantly curium), were fabricated. A new long-term projection showed that 252 Cf production in the TRU-HFIR complex could increase to as much as 2.5 g/year. During the next 18 months, we expect to recover totals of 46 mg of 249 Bk, 520 mg of 252 Cf, 2.0 mg of 253 Es (in a mixture of isotopes), 220 μg of high-purity 253 Es, and 1.6 pg of 257 Fm. We also expect to obtain 125 mg of high-purity 248 Cm from purified californium now in storage. There are no plans to process any of the remaining SRP Pu-Al tubes or to irradiate any plutonium targets in the HFIR; thus, we do not expect to recover any 244 Pu. Two neutron sources were fabricated, bringing the total fabricated to 77. Two sources that had been used previously in various projects were returned to the TRU inventory and are available for reassignment. In special projects, we (1) produced about 1 mg of 250 Cf by irradiation of 249 Bk in HFIR rabbits, and (2) processed some irradiated 248 Cm samples and obtained yield and isotopic composition data for use in determining the capture cross section of 249 Cm in the HFIR. The values that are currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated in the Appendix
Lifescience Database Archive (English)
Full Text Available ne:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration Library To...34 |CN206834.1 Tor7258 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA
40 CFR 255.11 - Criteria for identifying agencies.
2010-07-01
... priority consideration for future planning responsibilities when they otherwise meet these criteria. (b) An... need and consider methods such as franchising or public utility controls to assure an adequate supply. ...
7 CFR 1901.255 - Historical and archeological assessments.
2010-01-01
... professional archeologist/historian conducting the survey provides his written opinion as to the eligibility of... archeologist/historian recommends recovery, protection, or preservation of identified properties, the National...
24 CFR 1720.255 - Amendments and supplemental pleadings.
2010-04-01
... proceedings are tried by express or implied consent of the parties, they shall be treated in all respects as...) Supplemental pleadings. The administrative law judge may, upon reasonable notice and such terms as are just...
China Report, Agriculture, No. 255, 1981 Agricultural Yearbook.
1983-04-28
Prevention and Control of Forest Insect Pests 161 Animal Husbandry Industry 162 The Rise of China’s Beef Cattle Industry 162 Quickening Development...and Research on Sichuan’s Peng [2766] Ducks Enterprise 477 Research on Gosling Plague 477 Medicinal Techniques for Livestock Castration 478 Forestry...inventory rate percent 62.1 62.3 2. Beef cattle sold or 10,000 slaughtered for per- head 332.2 296.8 35.4 11.9 sonal use during year 3. Mutton sheep
16 CFR 255.5 - Disclosure of material connections.
2010-01-01
... take away from her story that her experience was typical of those who undergo the same procedure at the... online message board designated for discussions of new music download technology is frequented by MP3...
27 CFR 24.255 - Bottling or packing wine.
2010-04-01
... in the same tax class when that wine is removed from bond, without benefit of tolerance, when the... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Bottling or packing wine..., DEPARTMENT OF THE TREASURY LIQUORS WINE Storage, Treatment and Finishing of Wine Bottling, Packing, and...
40 CFR 255.10 - Criteria for identifying regions.
2010-07-01
... institutional gaps or inadequacies are found, regions should be identified keeping in mind which agencies would... section 208 of the Federal Water Pollution Control Act, with underground injection control agencies...
Decay Curves and Half-Lives of Gamma-Emitting States from a Study of Prompt Fission Gamma Radiation
Energy Technology Data Exchange (ETDEWEB)
Albinsson, H [Chalmers Univ. of Technology, Goeteborg (SE)
1971-04-15
Measurements were made on the time distributions of the prompt gamma radiation emitted from fragments in the thermal-neutron induced fission of 235U. The gamma radiation emitted during different time intervals after the fission event was studied with the help of a collimator, the position of which was changed along the path of the fragments. In this way decay curves were obtained from which half-lives could be estimated. Time components with half-lives of 7.5, 18 and 60 ps were found and their relative intensities were calculated. Half-lives and associated intensities are in good agreement with earlier data from uranium and californium fission. Problems involved in this type of study are discussed. The collimator technique has proved to be effective for determination of half lives down to less than 10 ps
Neutron radiography for nondestructive testing
International Nuclear Information System (INIS)
John, J.
1979-01-01
Neutron radiography is similar to X-ray inspection in that both depend upon use of radiation that penetrates some materials and is absorbed by others to provide a contrast image of conditions not readily available for visual inspection. X-rays are absorbed by dense materials, such as metals, whereas neutrons readily penetrate metals, but are absorbed by materials containing hydrogen. The neutron radiography has been successfully applied to a number of inspection situations. These include the inspection of explosives, advanced composites, adhesively bonded structures and a number of aircraft engine components. With the availability of Californium-252, it has become feasible to construct mobile neutron radiography systems suitable for field use. Such systems have been used for in-situ inspection of flight line aircraft, particularly to locate and measure hidden corrosion
The CARIBU EBIS control and synchronization system
Dickerson, Clayton; Peters, Christopher
2015-01-01
The Californium Rare Isotope Breeder Upgrade (CARIBU) Electron Beam Ion Source (EBIS) charge breeder has been built and tested. The bases of the CARIBU EBIS electrical system are four voltage platforms on which both DC and pulsed high voltage outputs are controlled. The high voltage output pulses are created with either a combination of a function generator and a high voltage amplifier, or two high voltage DC power supplies and a high voltage solid state switch. Proper synchronization of the pulsed voltages, fundamental to optimizing the charge breeding performance, is achieved with triggering from a digital delay pulse generator. The control system is based on National Instruments realtime controllers and LabVIEW software implementing Functional Global Variables (FGV) to store and access instrument parameters. Fiber optic converters enable network communication and triggering across the platforms.
Directory of Open Access Journals (Sweden)
Stanković Koviljka
2009-01-01
Full Text Available The wide-spread use of semiconductor and gas-filled diodes for non-linear over-voltage protection results in a variety of possible working conditions. It is therefore essential to have a thorough insight into their reliability in exploitation environments which imply exposure to ionizing radiation. The aim of this paper is to investigate the influence of irradiation on over-voltage diode characteristics by exposing the diodes to californium-252 combined neutron/gamma radiation field. The irradiation of semiconductor over-voltage diodes causes severe degradation of their protection characteristics. On the other hand, gas-filled over-voltage diodes exhibit a temporal improvement of performance. The results are presented with the accompanying theoretical interpretations of the observed changes in over-voltage diode behaviour, based on the interaction of radiation with materials constituting the diodes.
Designing on-line analyzer for coal on belt conveyor using neutron activation technique
International Nuclear Information System (INIS)
Rony Djokorayono; Agus Cahyono
2014-01-01
Basic design of on-line analyzer for coal on belt conveyor using neutron activation technique has been carried out. Compared with sampling technique, this neutron activation technique has some advantages in term of analysis accuracy and time. The design activities performed include the establishment of design requirements, functional requirements, technical requirements, technical specification, detection sub-system design, data acquisition subsystem design, and operator computer console design. This program will use Nal(Tl) scintillation detector to detect gamma-rays emitted by elements in coal due to neutron activation of a neutron source, "2"5"2Cf (Californium-252). This basic design of on-line analyzer for coal on belt conveyor using neutron activation technique should be followed up with the development of detailed design, prototype construction, and field testing. (author)
Nuclear assay of coal. Volume 8. Continuous nuclear assay of coal (CONAC). Final report
International Nuclear Information System (INIS)
Lagarias, J.; Irminger, P.; Dodson, W.
1979-01-01
Using californium-252 as a source of exciting neutrons, prompt gamma photons emitted by elemental nuclei in the coal have been measured using several detectors, including sodium-iodide and germanium-lithium. Several coal types, including bituminous, subbituminous lignite and anthracite were crushed to various top sizes and analyzed carefully by traditional ASTM wet chemistry techniques at two or three different laboratories. The elements (sulfur, hydrogen, carbon, aluminum, silicon, iron, calcium, sodium, nitrogen, and chlorine) were determined by prompt neutron activations and the quantities compared with those of the wet chemical analyses. Since satisfactory correlation has been obtained at bench-scale level using 100 to 200 kG samples, an apparatus has been designed to analyze a coal stream of up to 50 ton/hour, at an electric power generating station
Neutron dosimetry and spectrometry with Bonner spheres. Working out a log-normal reference matrix
International Nuclear Information System (INIS)
Zaborowski, Henrick.
1981-11-01
From the experimental and theoretical studies made upon the BONNER's spheres System with a I 6 Li(Eu) crystal and with a miniaturized 3 He counter we get the normalized energy response functions R*sub(i)(E). This normalization is obtained by the mathematization of the Resolution Function R*(i,E) in the Log-Normal distribution hypothesis to mono energetic neutrons given in April 1976 to the International Symposium on Californium 252. The fit of the Log-Normal Hypothesis with the experimental and Theoretical data is very satisfactory. The parameter's tabulated values allow a precise interpolation, at all energies between 0.4 eV and 15 MeV and for all spheres diameters between 2 and 12 inches, of the discretized R*sub(ij) Reference Matrix for the applications to neutron dosimetry and spectrometry [fr
The CARIBU EBIS control and synchronization system
Energy Technology Data Exchange (ETDEWEB)
Dickerson, Clayton, E-mail: cdickerson@anl.gov; Peters, Christopher, E-mail: cdickerson@anl.gov [Argonne National Laboratory, Argonne, IL 60439 (United States)
2015-01-09
The Californium Rare Isotope Breeder Upgrade (CARIBU) Electron Beam Ion Source (EBIS) charge breeder has been built and tested. The bases of the CARIBU EBIS electrical system are four voltage platforms on which both DC and pulsed high voltage outputs are controlled. The high voltage output pulses are created with either a combination of a function generator and a high voltage amplifier, or two high voltage DC power supplies and a high voltage solid state switch. Proper synchronization of the pulsed voltages, fundamental to optimizing the charge breeding performance, is achieved with triggering from a digital delay pulse generator. The control system is based on National Instruments realtime controllers and LabVIEW software implementing Functional Global Variables (FGV) to store and access instrument parameters. Fiber optic converters enable network communication and triggering across the platforms.
International Nuclear Information System (INIS)
Young, J.P.; Haire, R.G.; Peterson, J.R.; Ensor, D.D.; Fellows, R.L.
1980-01-01
Spectrophotometric and x-ray powder diffraction methods have been applied to a study of the ingrowth of californium-249 by β - decay of berkelium-249 in crystalline 249 BkBr 3 . It was found that the Cf daughter grows in with the same oxidation state and crystal structure as the parent. Thus, six-coordinate BkBr 3 (AlCl 3 -type monoclinic structure) generates six-coordinate CfBr 3 , and eight-coordinate BkBr 3 (PuBr 3 -type orthorhombic structure) generates eight-coordinate CfBr 3 , a previously unknown form of CfBr 3 . It was also found that the daughter Cf(III) in the BkBr 3 parent compound can be reduced to Cf(II) by treatment with H 2 , as it can in pure CfBr 3 . 5 figures
Provenance and composition study on Terengganu inscribed stone using in-situ nuclear technology
International Nuclear Information System (INIS)
Jaafar Abdullah; Roslan Yahya; Hearie Hassan; Engku Mohd Fahmi Engku Chik; Mohamad Rabaie Shari; Airwan Affendi Mahmood; Abdul Quddoss Abu Bakar; Ainul Mardhiah Terry
2012-01-01
This paper focused on the analysis of trace elements and provenance study of the Inscribed Stone of Terengganu (BBPT) using Neutron-induced Prompt Gamma-Ray Techniques (NIPGAT). In this study, portable NIPGAT system was designed and developed by using volume-based measurement. It is a nondestructive testing technique for the samples. This system uses low activity of isotopic neutron radioactive source from californium-252 (Cf-252) as an irradiation source. Gamma ray spectroscopy as well as specialized computer software has been utilized to conduct the research. The study has determined that the stone was a dolerite stone based on the composition of the stone elements. Although most of the scientific data for this study have been collected, this project is still running to complete the scope of provenance study. (author)
Nuclear fission and the transuranium elements
International Nuclear Information System (INIS)
Seaborg, G.T.
1989-02-01
Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs
Nuclear fission and the transuranium elements
Energy Technology Data Exchange (ETDEWEB)
Seaborg, G.T.
1989-02-01
Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.
Double spin asymmetry in exclusive rho(0) muoproduction at COMPASS
Czech Academy of Sciences Publication Activity Database
Alekseev, M.; Alexakhin, V. Yu.; Alexandrov, Yu.; Alexeev, G. D.; Amoroso, A.; Arbuzov, A.; Badelek, B.; Balestra, F.; Ball, J.; Baum, G.; Barth, J.; Bedfer, Y.; Bernet, C.; Bertini, R.; Bettinelli, M.; Birsa, R.; Bisplinghoff, J.; Bordalo, P.; Bradamante, F.; Bravar, A.; Bressan, A.; Brona, G.; Burtin, E.; Bussa, M.; Chapiro, A.; Chiosso, M.; Cicuttin, A.; Colantoni, M.; Costa, S.; Crespo, M.; d'Hose, N.; Dalla Torre, S.; Das, S.; Dasgupta, S. S.; De Masi, R.; Dedek, N.; Denisov, O.; Dhara, L.; Diaz, V.; Dinkelbach, A.; Donskov, S.; Dorofeev, V.; Doshita, N.; Duic, V.; Dünnweber, W.; Eversheim, P.; Eyrich, W.; Fabro, M.; Faessler, M.; Falaleev, V.; Ferrero, A.; Ferrero, L.; Finger, M.; Finger jr., M.; Fischer, H.; Franco, C.; Franz, J.; Friedrich, J.; Frolov, V.; Garfagnini, R.; Gautheron, F.; Gavrichtchouk, O.; Gazda, R.; Gerassimov, S.; Geyer, R.; Giorgi, M.; Gobbo, B.; Goertz, S.; Gorin, A. M.; Grabmüller, S.; Grajek, O.; Grasso, A.; Grube, B.; Gushterski, R.; Guskov, A.; Haas, F.; Hannappel, J.; von Harrach, D.; Hasegawa, T.; Heckmann, J.; Hedicke, S.; Heinsius, F.; Hermann, R.; Hess, C.; Hinterberger, F.; von Hodenberg, M.; Horikawa, N.; Horikawa, S.; Ilgner, C.; Ioukaev, A.; Ishimoto, S.; Ivanov, O.; Ivanshin, Yu.; Iwata, T.; Jahn, R.; Janata, A.; Jasinski, P.; Joosten, R.; Jouravlev, N. I.; Kabuss, E.; Kang, D.; Ketzer, B.; Khaustov, G.; Khokhlov, Y.; Kisselev, Y.; Klein, F.; Klimaszewski, K.; Koblitz, S.; Koivuniemi, J.; Kolosov, V.; Komissarov, E.; Kondo, K.; Königsmann, K.; Konorov, I.; Konstantinov, V.; Korentchenko, A.; Korzenev, A.; Kotzinian, A.; Koutchinski, N.; Kouznetsov, O.; Kravchuk, N.; Kral, A.; Kroumchtein, Z.; Kuhn, R.; Kunne, F.; Kurek, K.; Ladygin, M.; Lamanna, M.; Le Goff, J.; Lednev, A.; Lehmann, A.; Lichtenstadt, J.; Liska, T.; Ludwig, I.; Maggiora, A.; Maggiora, M.; Magnon, A.; Mallot, G.; Mann, A.; Marchand, C.; Marroncle, J.; Martin, A.; Marzec, J.; Massmann, F.; Matsuda, T.; Maximov, A.; Meyer, W.; Mielech, A.; Mikhailov, Y.; Moinester, M.; Mutter, M.; Nähle, O.; Nagaytsev, A.; Nagel, T.; Nassalski, J.; Neliba, S.; Nerling, F.; Neubert, S.; Neyret, D.; Nikolaenko, V.; Nikolaev, K.; Olshevsky, A.; Ostrick, M.; Padee, A.; Pagano, P.; Panebianco, S.; Panknin, R.; Panzieri, D.; Paul, S.; Pawlukiewicz-Kaminska, B.; Peshekhonov, D.; Peshekhonov, V.; Piragino, G.; Platchkov, S.; Pochodzalla, J.; Polak, J.; Polyakov, V.; Pretz, J.; Procureur, S.; Quintans, C.; Rajotte, J.; Rapatsky, V.; Ramos, S.; Reicherz, G.; Richter, A.; Robinet, F.; Rocco, E.; Rondio, E.; Rozhdestvensky, A.; Ryabchikov, D.; Samoylenko, V.; Sandacz, A.; Santos, H.; Sapozhnikov, M.; Sarkar, S.; Savin, I.; Schiavon, P.; Schill, C.; Schmitt, L.; Schönmeier, P.; Schröder, W.; Shevchenko, O.; Siebert, H.; Silva, L.; Sinha, L.; Sissakian, A.; Slunecka, M.; Smirnov, G.; Sosio, S.; Sozzi, F.; Sugonyaev, V.; Srnka, Aleš; Stinzing, F.; Stolarski, M.; Sulc, M.; Sulej, R.; Takabayashi, N.; Tchalishev, V.; Tessaro, S.; Tessarotto, F.; Teufel, A.; Tkatchev, L.; Venugopal, G.; Virius, M.; Vlassov, N.; Vossen, A.; Webb, R.; Weise, E.; Weitzel, Q.; Windmolders, R.; Wirth, S.; Wislicki, W.; Zaremba, K.; Zavertyaev, M.; Zemlyanichkina, E.; Zhao, J.; Ziegler, R.; Zvyagin, A.
2007-01-01
Roč. 52, č. 2 (2007), s. 255-265 ISSN 1434-6044 R&D Projects: GA MŠk ME 492 Institutional research plan: CEZ:AV0Z20650511 Keywords : double spin asymmetry * polarized deuterons * scattering * COMPASS Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 3.255, year: 2007
Journal of Astrophysics and Astronomy | Indian Academy of Sciences
Indian Academy of Sciences (India)
2016-01-27
Jan 27, 2016 ... Home; Journals; Journal of Astrophysics and Astronomy; Volume 36; Issue 2. Issue front cover thumbnail. Volume 36, Issue 2. June 2015, pages 255-334. pp 255-268. Modeling the Emission from Turbulent Relativistic Jets in Active Galactic Nuclei · Victoria Calafut Paul J. Wiita · More Details Abstract ...
Research Directory for Manpower, Personnel, Training, and Human Factors, 1992
1992-11-01
Malone 703-698-6225 Smart Contract Preparation Expediter (R) Ms Joan E Forester 410-278-2946 DSN:298-2946 (P) Mr R Cofod 703-359-0996 Soldier...Mike Hanuschik 513-255-3871 DSN:785-3871 Small Unit Maintenance Manpower Analyses (SUMMA) (R) Mr Edward Boyle 513-255-3871 DSN:785-3871 Smart Contract Preparation
77 FR 24969 - National Cancer Institute; Notice of Closed Meetings
2012-04-26
... Emphasis Panel; SBIR Topic 255 Development of Anticancer Agents Meeting I. Date: May 14, 2012. Time: 12 p.m. to 3 p.m. Agenda: To review and evaluate contract proposals. Place: National Institutes of Health... Panel; SBIR Topic 255 Development of Anticancer Agents Meeting II. Date: May 15, 2012. Time: 12 p.m. to...
Ding, Haitao; Gao, Fen; Liu, Danfeng; Li, Zeli; Xu, Xiaohong; Wu, Min; Zhao, Yuhua
2013-12-10
Rational design was applied to glucose 1-dehydrogenase (LsGDH) from Lysinibacillus sphaericus G10 to improve its thermal stability by introduction of disulfide bridges between subunits. One out of the eleven mutants, designated as DS255, displayed significantly enhanced thermal stability with considerable soluble expression and high specific activity. It was extremely stable at pH ranging from 4.5 to 10.5, as it retained nearly 100% activity after incubating at different buffers for 1h. Mutant DS255 also exhibited high thermostability, having a half-life of 9900min at 50°C, which was 1868-fold as that of its wild type. Moreover, both of the increased free energy of denaturation and decreased entropy of denaturation of DS255 suggested that the enzyme structure was stabilized by the engineered disulfide bonds. On account of its robust stability, mutant DS255 would be a competitive candidate in practical applications of chiral chemicals synthesis, biofuel cells and glucose biosensors. Copyright © 2013 Elsevier Inc. All rights reserved.
Low frequency studies of the Galactic Centre with GMRT
International Nuclear Information System (INIS)
Roy, Subhashis; Rao, A Pramesh
2006-01-01
We have observed the GC region at 255 and 154 MHz with the GMRT. From the 255 MHz map we detect 28 compact sources, and an anti-correlation of their deconvolved sizes with angular distance from the GC is observed. This is the first direct indication of scatter broadening for a statistically large sample of extragalactic sources in the region and we discuss its implications in determining the properties of the screen. Our multifrequency observations at 255 and 154 MHz in tandem with previous observations of the GC shows that the 7' halo in Sgr A complex is a non-thermal source rather than a mixture of thermal and non-thermal electrons as was proposed before
Urinary stone composition in Oman: with high incidence of cystinuria.
Al-Marhoon, Mohammed S; Bayoumi, Riad; Al-Farsi, Yahya; Al-Hinai, Abdullhakeem; Al-Maskary, Sultan; Venkiteswaran, Krishna; Al-Busaidi, Qassim; Mathew, Josephkunju; Rhman, Khalid; Sharif, Omar; Aquil, Shahid; Al-Hashmi, Intisar
2015-06-01
Urinary stones are a common problem in Oman and their composition is unknown. The aim of this study is to analyze the components of urinary stones of Omani patients and use the obtained data for future studies of etiology, treatment, and prevention. Urinary stones of 255 consecutive patients were collected at the Sultan Qaboos University Hospital. Stones were analyzed by Fourier transform infrared spectrophotometer. The biochemical, metabolic, and radiological data relating to the patients and stones were collected. The mean age was 41 years, with M:F ratio of 3.7:1. The common comorbidities associated with stone formation were hypertension; diabetes, benign prostate hyperplasia; urinary tract infection; obesity; and atrophic kidney. The common presentation was renal colic and flank pain (96%). Stones were surgically retrieved in 70% of patients. Mean stone size was 9 ± 0.5 mm (range 1.3-80). Stone formers had a BMI ≥ 25 in 56% (P = 0.006) and positive family history of stones in 3.8%. The most common stones in Oman were as follows: Calcium Oxalates 45% (114/255); Mixed calcium phosphates & calcium oxalates 22% (55/255); Uric Acid 16% (40/255); and Cystine 4% (10/255). The most common urinary stones in Oman are Calcium Oxalates. Overweight is an important risk factor associated with stone formation. The hereditary Cystine stones are three times more common in Oman than what is reported in the literature that needs further genetic studies.
Utilization of radiation facilities at TNRC for shielding researches and related topics
Energy Technology Data Exchange (ETDEWEB)
Akki, T S [Physics Department, Nuclear Physics and Radiation Shielding Division Tajura Nuclear Research Center, Tripoli (Libyan Arab Jamahiriya)
1997-12-31
This paper presents the running shielding research activities at Tajura Nuclear research center. The main area of researches are concentrated on the investigation of different types of concrete made from local materials such as conventional concrete, Magnetite-Limonite concrete, and heat resistant concrete. The measuring techniques used were neutron-gamma spectrometry, and activation foils. The measurements were performed using collimated beam of reactor neutrons emitted from one of the horizontal channels, as well as from californium-252 neutron source. The transmitted neutron spectra through concrete barriers of different thicknesses were measured by a scintillation spectrometer with NE-213 liquid organic scintillator. A non-destructive testing of some reactor materials were also carried out using neutron and gamma ray computerized tomography technique (CT). Some experiments were also carried out related to measurements of neutron depth dose distributions inside tissue equivalent materials. 10 figs.
Dust grain charges in a nuclear-track plasma and the formation of dynamic vortex dust structures
International Nuclear Information System (INIS)
Rykov, V.A.; Khudyakov, A.V.; Filinov, V.S.; Vladimirov, V.I.; Deputatova, L.V.; Krutov, D.V.; Nefedov, A.P.; Fortov, V.E.
2002-01-01
Results are presented from Monte Carlo calculations of the electric charge of dust grains in a plasma produced during the slowing down of the radioactive decay products of californium nuclei in neon. The dust grain charging is explained for the first time as being due to the drift of electrons and ions in an external electric field. It is shown that the charges of the grains depend on their coordinates and strongly fluctuate with time. The time-averaged grain charges agree with the experimental data obtained on ordered liquidlike dust structures in a nuclear-track plasma. The time-averaged dust grain charges are used to carry out computer modeling of the formation of dynamic vortex structures observed in experiments. Evidence is obtained of the fact that the electrostatic forces experienced by the dust grains are potential in character
Transuranic biokinetic parameters for marine invertebrates--a review.
Ryan, T P
2002-04-01
A catalogue of biokinetic parameters for the transuranic elements plutonium, americium, curium, neptunium, and californium in marine invertebrates is presented. The parameters considered are: the seawater-animal concentration factor (CF); the sediment-animal concentration ratio (CR); transuranic assimilation efficiency; transuranic tissue distribution and transuranic elimination rates. With respect to the seawater-animal CF, authors differ considerably on how they define this parameter and a seven-point reporting system is suggested. Transuranic uptake from sediment by animals is characterised by low CRs. The assimilation efficiencies of transuranic elements in marine invertebrates are high compared to vertebrates and mammals in general and the distribution of transuranics within the body tissue of an animal is dependent on the uptake path. The elimination of transuranics from most species examined conformed to a standard biphasic exponential model though some examples with three elimination phases were identified.
Off-line commissioning of EBIS and plans for its integration into ATLAS and CARIBU
Energy Technology Data Exchange (ETDEWEB)
Ostroumov, P. N., E-mail: ostroumov@anl.gov; Barcikowski, A.; Dickerson, C. A.; Mustapha, B.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. [Argonne National Laboratory, Argonne, Illinois 60439 (United States)
2016-02-15
An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed at Argonne to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne Tandem Linac Accelerator System (ATLAS). The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and significantly improve the purity of reaccelerated radioactive ion beams. The CARIBU EBIS-CB has been successfully commissioned offline with an external singly charged cesium ion source. The performance of the EBIS fully meets the specifications to breed rare isotope beams delivered from CARIBU. The EBIS is being relocated and integrated into ATLAS and CARIBU. A long electrostatic beam transport system including two 180° bends in the vertical plane has been designed. The commissioning of the EBIS and the beam transport system in their permanent location will start at the end of this year.
Off-line commissioning of EBIS and plans for its integration into ATLAS and CARIBU
Ostroumov, P. N.; Barcikowski, A.; Dickerson, C. A.; Mustapha, B.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G.
2016-02-01
An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed at Argonne to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne Tandem Linac Accelerator System (ATLAS). The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and significantly improve the purity of reaccelerated radioactive ion beams. The CARIBU EBIS-CB has been successfully commissioned offline with an external singly charged cesium ion source. The performance of the EBIS fully meets the specifications to breed rare isotope beams delivered from CARIBU. The EBIS is being relocated and integrated into ATLAS and CARIBU. A long electrostatic beam transport system including two 180° bends in the vertical plane has been designed. The commissioning of the EBIS and the beam transport system in their permanent location will start at the end of this year.
Robotics and remote systems applications
International Nuclear Information System (INIS)
Rabold, D.E.
1996-01-01
This article is a review of numerous remote inspection techniques in use at the Savannah River (and other) facilities. These include: (1) reactor tank inspection robot, (2) californium waste removal robot, (3) fuel rod lubrication robot, (4) cesium source manipulation robot, (5) tank 13 survey and decontamination robots, (6) hot gang valve corridor decontamination and junction box removal robots, (7) lead removal from deionizer vessels robot, (8) HB line cleanup robot, (9) remote operation of a front end loader at WIPP, (10) remote overhead video extendible robot, (11) semi-intelligent mobile observing navigator, (12) remote camera systems in the SRS canyons, (13) cameras and borescope for the DWPF, (14) Hanford waste tank camera system, (15) in-tank precipitation camera system, (16) F-area retention basin pipe crawler, (17) waste tank wall crawler and annulus camera, (18) duct inspection, and (19) deionizer resin sampling
International Nuclear Information System (INIS)
Murali, M.S.; Nair, A.G.C.; Gujar, R.B.; Jain, A.; Tomar, B.S.; Godbole, S.V.; Reddy, A.V.R.; Manchanda, V.K.
2008-07-01
The present report gives a description of the methodology for the separation of 248 Cm(III) from decayed 252 Cf (III) waste solution. The waste solution was first assayed for 252 Cf content by neutron counting using a neutron well coincidence counter. The sample was subjected to the chemical separation of 248 Cm (III) from 252 Cf (III) following anion and cation exchange chromatography. The alpha spectrum of the separated curium fraction showed peaks due to 246 Cm and 248 Cm while the corresponding alpha spectrum of californium fraction showed 249,250,251,252 Cf. The gamma ray abundances of 249 Cf were determined with respect to its gamma rays of 387 keV and the data agreed well with that in literature. Separated Cm(III) was further characterized by recording its time resolved fluorescence spectrum (TRFS) in aqueous medium. (author)
International Nuclear Information System (INIS)
Bringer, O.
2007-10-01
This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of 241 Am and 237 Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the 241 Am isomeric branching ratio were precisely measured at thermal energy point. (author)
Testing of ENDF/B cross section data in the Californium-252 neutron benchmark field
International Nuclear Information System (INIS)
Mannhart, W.
1979-01-01
The fission neutron field of 252 Cf presently represents one of the most well-known neutron benchmark fields. For 13 neutron reactions which are of importance in reactor metrology, measurements of spectrum-averaged cross sections, [sigma], performed in this neutron field were compared with calculated average cross sections. This comparison allows one to draw conclusions as to the quality of different sigma(E) data taken from ENDF/B-IV, from ENDF/B-V, and from recent experiments and used in the calculation of average cross sections. The comparison includes an uncertainty analysis regarding the different uncertainty contributions of [sigma], of sigma(E), and of the spectral distribution of 252 Cf fission neutrons. Additionally, in a few examples, sensitivity studies were carried out. The sensitivity of the spectrum-averaged cross sections to individual characteristics of the sigma(E) data, such as normalization factors or shifts in the energy scale, was investigated. Similarly, the sensitivity of [sigma] to the spectral distribution of 252 Cf was determined. 4 figures, 2 tables
Total neutron cross sections of berkelium-249 and californium-249 below 100 eV
International Nuclear Information System (INIS)
Benjamin, R.W.; Harvey, J.A.; Hill, N.W.; Pandey, M.S.; Carlton, R.F.
1979-01-01
The neutron total cross sections of 249 Bk and 249 Cf have been measured from 0.03 to 100 eV using the Oak Ridge Electron Linear Accelerator (ORELA) as a source of pulsed neutrons. The 1.6 mm dia. cylindrical transmission samples contained initially up to 5.3 mg of 98% 249 Bk and 2% 249 Cf: 4.5 years later, when the final measurements were made, the composition of the samples had become 2.5% 249 Bk, 96.9% 249 Cf, and 0.6% 245 Cm. Samples were cooled with liquid nitrogen to reduce Doppler broadening. Thirty-nine resonances were identified in 249 Bk and analyzed using a single-level Breit-Wigner formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. The resonance parameters obtained have been used to determine the average level spacings and the s-wave neutron and fission strength functions. Where possible, bound-level parameters were derived to fit the thermal neutron total cross section data
TASK 2.5.5 NATURAL EXPOSURE TESTING IN CALIFORNIA
Energy Technology Data Exchange (ETDEWEB)
Miller, William A [ORNL; Cheng, Mengdawn [ORNL; New, Joshua Ryan [ORNL; Ronnen, Levinson [Lawrence Berkeley National Laboratory (LBNL); Akbari, Hashem [Lawrence Berkeley National Laboratory (LBNL); Berhahl, Paul [Lawrence Berkeley National Laboratory (LBNL)
2010-03-01
Airborne particulate matter that settles on a roof can either reflect or absorb incoming solar radiation, dependent on the chemical content and size of the particles. These light scattering and absorption processes occur within a few microns of the surface, and can affect the solar reflectance of the roof. Wilkes et al. (2000) tested 24 different roof coatings on a low-slope test stand and observed about a 25% decrease in the solar reflectance of white-coated and aluminum-coated surfaces as the time of exposure increased; however, the decrease leveled off after 2 years. SPRI Inc. and its affiliates studied the effect of climatic exposure on the surface properties of white thermoplastic single-ply membranes and determined that membranes lose from 30 to 50% of their reflectance over 3 years (Miller et al. 2002). The CMRC and its affiliates AISI, NamZAC, MBMA, MCA and NCCA exposed unpainted and painted metal roofing on both steep- and low-slope test roofs and found that after 3 years, the painted polyvinylidene fluoride (PVDF) metal roofs lost less than 5% of their original reflectance (Miller et al. 2004). The results of the three different weathering studies are very interesting in terms of their solar reflectance after 3 years of exposure. The white thermoplastic membrane and white ceramic coating with white topcoat had original reflectance measures that were about 20 percentage points higher than the painted metal; however, after 3-years of field exposure the solar reflectance of the painted metal exceeds that of the thermoplastic membrane and equals that of the coating. The long-term loss of reflectance appears driven by the ability of the particulate matter to cling to the roof and resist being washed off by wind and or rain. Miller et al. (2002) discovered that aerosol deposition introduced biomass of complex microbial consortia onto the test roofs and the combination of contaminants and biomass accelerated the loss of solar reflectance for the thermoplastic membranes and the roof coatings. Airborne contaminants and biomass were also detected on the painted metal roofs; however, the loss of solar reflectance was less than 5% for the painted metal roofs. The chemistry of the PVDF paint resin system uses similar organic film bonding to that responsible for Teflon , making it extremely chemical resistant and dirt shedding. Miller and Rudolph (2003) found the PVDF painted metals maintained solar reflectance even after 30 years of climatic exposure. Therefore the reduction of roof reflectance is closely related to the composition of the roof and to the chemical profile of the contaminants soiling the roof. Contaminants collected from samples of roof products exposed at seven California weathering sites were analyzed for elements and carbons to characterize the chemical profile of the particles soiling each roof sample and to identify those elements that degrade or enhance solar reflectance. The losses in solar reflectance varied from site to site and also varied at a give site based on the color of the coupon. The least drop in reflectance was observed in the alpine climate of McArthur while the largest drop occurred in sites near urban development. Light color samples were soiled after just one year of exposure. The darker color coupons did not show the same seasonal variations in solar reflectance as observed for the lighter colors. However, after an additional year of exposure the samples at all sites regained most of their solar reflectance due to rain and/or wind washing. The loss of reflectance appears cyclical with the onset of seasons having more rainfall. Solar reflectance of the cool pigmented coupons always exceeded that of the conventional pigmented coupons. Climatic soiling did not cause the cool pigmented roof coupons to lose any more solar reflectance than their conventional pigmented counterparts. The effect of roof slope appears to have more of an effect on lighter color roofs whose solar reflectance exceeds at least 0.5 and visually shows the accumulation of airborne contaminants. The thermal emittance remained invariant with time and location and was therefore not affected by climatic soiling. A thin-film deposition model was developed based on first principles, which simulates light interaction with a soiled substrate. This model was used in combination with the measured data to determine the solar absorptance and reflectance of particulate matter at each of the sites calculated using least squares fitting routines. Principal Component Analysis was used to determine the most important combinations of chemicals correlated with changes in solar absorption. Linear regression helped extract an approximate correlation using chromium, iron and elemental carbon concentrations. It appears that chromium ranks first, iron ranks second, and elemental carbon ranks third in importance to soil absorptance in the data
50 CFR 216.255 - Requirements for monitoring and reporting.
2010-10-01
... animals sighted. (4) Conduct shipboard monitoring to reduce impacts to protected species. Trained marine..., including the time of sighting and the direction of travel, into a marine animal tracking and sighting... will report all marine animals spotted and their directions of travel to the lead scientist onboard the...
Psychological Operations: Air Force Doctrine Document 2-5.5
National Research Council Canada - National Science Library
1997-01-01
..., decision making processes, and behavior. Examples of PSYOP include: promises, threats of force or retaliation, conditions of surrender safe passage for deserters, or support to resistance groups...
All projects related to | Page 255 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Topic: INNOVATIONS, RESEARCH NETWORKS, Capacity building, PARTNERSHIP, INFORMATION TRANSFER, SCIENCE EDUCATION. Region: Middle East, South Asia, South of Sahara, North and Central America, South America, Far East Asia, Brazil, China, Panama, Egypt, South Africa, Colombia, Thailand, Lebanon, ...
Energy Technology Data Exchange (ETDEWEB)
King, L.J.; Bigelow, J.E.; Collins, E.D.
1976-03-01
During the period January 1, 1975, through June 30, 1975, the following amounts of transuranium elements were recovered from 22 irradiated HFIR targets: 2g /sup 243/Am, 59 g /sup 244/Cm, 51 mg /sup 249/Bk, 465 mg /sup 252/Cf, 2.5 mg /sup 253/Es, and 1.4 pg /sup 257/Fm. In addition, 45 mg of high-purity /sup 248/Cm was operated from /sup 252/Cf which had been recovered and purified during earlier periods, and 56 mg of a lower-quality /sup 248/Cm was separated from californium purification rework solutions. Five HFIR targets, each containing approximately 9 g of actinides (predominantly curium), were fabricated. A new long-term projection showed that /sup 252/Cf production in the TRU-HFIR complex could increase to as much as 2.5 g/year. During the next 18 months, we expect to recover totals of 46 mg of /sup 249/Bk, 520 mg of /sup 252/Cf, 2.0 mg of /sup 253/Es (in a mixture of isotopes), 220 ..mu..g of high-purity /sup 253/Es, and 1.6 pg of /sup 257/Fm. We also expect to obtain 125 mg of high-purity /sup 248/Cm from purified californium now in storage. There are no plans to process any of the remaining SRP Pu-Al tubes or to irradiate any plutonium targets in the HFIR; thus, we do not expect to recover any /sup 244/Pu. No changes were made in the chemical processing flowsheets normally used at TRU. Two neutron sources were fabricated, bringing the total fabricated to 77. In special projects, we (1) produced about 1 mg of /sup 250/Cf by irradiation of /sup 249/Bk in HFIR rabbits, and (2) processed some irradiated /sup 248/Cm samples and obtained yield and isotopic composition data for use in determining the capture cross section of /sup 249/Cm in the HFIR. The values that are currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated in the Appendix.
International Nuclear Information System (INIS)
Liu, G.K.; Huang, J.; Beitz, J.V.
1993-01-01
Optical transitions between 5f states of tetravalent californium ion doped (1 metal-atom %) into CeF 4 exhibit unusually large inhomogeneous broadening. The nature of the inhomogeneous broadening in this system has been studied by using fluorescence line narrowing and excitation line narrowing (ELN). It is shown that the energy distributions of different electronic states of Cf 4+ in this system are correlated. In the ELN experiments, reduced excitation linewidth was obtained when selectively monitoring fluorescence emission. A linear relation was observed between the excitation energies of crystal-field states of the 5 G 4' manifold and the fluorescence wavelength monitored across the inhomogeneous profile of a 5 G 6' -- 7 F 6' transition. Analysis of these results by means of a microscopic theory proposed by Laird and Skinner [J. Chem. Phys. 90, 3880 (1989)] has provided insights into the structural properties of this disordered system
Chelation and stabilization of berkelium in oxidation state +IV
Deblonde, Gauthier J.-P.; Sturzbecher-Hoehne, Manuel; Rupert, Peter B.; An, Dahlia D.; Illy, Marie-Claire; Ralston, Corie Y.; Brabec, Jiri; de Jong, Wibe A.; Strong, Roland K.; Abergel, Rebecca J.
2017-09-01
Berkelium (Bk) has been predicted to be the only transplutonium element able to exhibit both +III and +IV oxidation states in solution, but evidence of a stable oxidized Bk chelate has so far remained elusive. Here we describe the stabilization of the heaviest 4+ ion of the periodic table, under mild aqueous conditions, using a siderophore derivative. The resulting Bk(IV) complex exhibits luminescence via sensitization through an intramolecular antenna effect. This neutral Bk(IV) coordination compound is not sequestered by the protein siderocalin—a mammalian metal transporter—in contrast to the negatively charged species obtained with neighbouring trivalent actinides americium, curium and californium (Cf). The corresponding Cf(III)-ligand-protein ternary adduct was characterized by X-ray diffraction analysis. Combined with theoretical predictions, these data add significant insight to the field of transplutonium chemistry, and may lead to innovative Bk separation and purification processes.
Operation manual for the INEL on-line mass-separator facility
International Nuclear Information System (INIS)
Anderl, R.A.
1984-06-01
This report is an operation manual for an on-line mass-separator facility which is located in Building 661 at the Test Reactor Area of the Idaho National Engineering Laboratory. The facility provides mass-separated sources of short-lived fission-product radionuclides whose decay properties can be studied using a variety of nuclear spectroscopic techniques. This facility is unique in that it utilizes the gas-jet technique to transport fission products from a 252 Cf source located in a hot cell to the ion source of the mass separator. This document includes the following: (a) a detailed description of the facility, (b) identification of equipment hazards and safety controls, (c) detailed operating procedures for startup, continuous operation and shutdown, (d) operating procedures for the californium hot cell, and (e) an operator's manual for the automated moving tape collector/data acquisition system. 7 references, 16 figures, 8 tables
Energy Technology Data Exchange (ETDEWEB)
Bringer, O
2007-10-15
This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of {sup 241}Am and {sup 237}Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the {sup 241}Am isomeric branching ratio were precisely measured at thermal energy point. (author)
Operational safety at the radiometallurgy laboratory of Fontenay-aux-Roses
International Nuclear Information System (INIS)
Hayet, Lucien; Petit, Pierre; Conche, Roger.
1976-01-01
Opened in 1967, the Radiometallurgy Laboratory is responsible for the examination of plutonium 239 based nuclear fuels of breeder reactors such as Rapsodie and Phenix. Part of the same laboratory is also responsible for the manufacture of californium 252 sources. These neutron sources can have a neutron fluency yield of 2,3 10 10 n/s/4π (i.e. 10mg of 252cf). This large laboratory includes a total area of 117m 2 of hot surfaces. It also includes 14 high activity cells with a capacity of 100000Ci at 1MeV. Located only 7km from the center of Paris, it must incorporate a special design and a particularly sure safety policy. Several statistics are given: irradiations, contaminations, incidents, quantity of fissile material, solid and liquid wastes etc... The principles of safety management are outlined and an analysis given of this basic nuclear facility [fr
International Nuclear Information System (INIS)
Brunson, G.S. Jr.
1982-06-01
An array of eight high-speed plastic scintillation detectors has been used to infer a mathematical model for the emission multipliciy of prompt gammas in the spontaneous fission of 252 Cf. Exceptional time resolution and coincidence capability permitted the separation of gammas from fast neutrons over a flight path of approximately 10 cm. About 20 different distribution models were tested. The average energy of the prompt gammas is inversely related to the number emitted; however, this inverse relationship is not strong and the total gamma energy does increase with increasing gamma number. An extension of the experiment incorporated a lithium-drifted germanium gamma spectrometer that resolved nearly 100 discrete gammas associated with fission. Of these gammas, some were preferentially associated with fission in which few gammas were emitted. Certain others were more frequent when many gammas were emitted. Results are presented
Dau, Phuong D; Vasiliu, Monica; Peterson, Kirk A; Dixon, David A; Gibson, John K
2017-12-06
Actinyl chemistry is extended beyond Cm to BkO 2 + and CfO 2 + through transfer of an O atom from NO 2 to BkO + or CfO + , establishing a surprisingly high lower limit of 73 kcal mol -1 for the dissociation energies, D[O-(BkO + )] and D[O-(CfO + )]. CCSD(T) computations are in accord with the observed reactions, and characterize the newly observed dioxide ions as linear pentavalent actinyls; these being the first Bk and Cf species with oxidation states above IV. Computations of actinide dioxide cations AnO 2 + for An=Pa to Lr reveal an unexpected minimum for D[O-(CmO + )]. For CmO 2 + , and AnO 2 + beyond EsO 2 + , the most stable structure has side-on bonded η 2 -(O 2 ), as An III peroxides for An=Cm and Lr, and as An II superoxides for An=Fm, Md, and No. It is predicted that the most stable structure of EsO 2 + is linear [O=Es V =O] + , einsteinyl, and that FmO 2 + and MdO 2 + , like CmO 2 + , also have actinyl(V) structures as local energy minima. The results expand actinide oxidation state chemistry, the realm of the distinctive actinyl moiety, and the non-periodic character towards the end of the periodic table. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
2017-06-01
study the laws governing shock wave propagation, and evaluate the suitability of military operations after being subjected to their use. During...14]. MCNP6.1 then outputs a dose spectrum, instead of the standard fluence spectrum created from the “ f4 ” tally [14]. In order to produce the dose...manually, an unmodified fluence tally ( f4 ) was exported externally to a spreadsheet. The energy bins were summed and grouped to mimic the energy bin
Submerged reef systems on the central western continental shelf of India
Digital Repository Service at National Institute of Oceanography (India)
Vora, K.H.; Almeida, F.
-262 255 Elsevier Science Publishers B.V., Amsterdam -- Printed in the Netherlands Letter Section Submerged Reef Systems on the Central Western Continental Shelf of India K.H. VORA and F. ALMEIDA National Institute of Oceanography, Dona Paula, Goa 403... 004 (India) (Revision accepted October 26, 1989) Abstract Vora, K.H. and Almeida, F., 1990. Submerged reef systems on the central western continental shelf of India. Mar. Geol., 91: 255-262. Echosounding and sidescan sonar data from the western...
Zhang, Yu; Chen, Yue-Guo
2018-03-05
To compare the incidence of rainbow glare (RG) after femtosecond laser assisted-LASIK (FS-LASIK) using the upgraded FS200 femtosecond laser with different flap cut parameter settings. A consecutive series of 129 patients (255 eyes) who underwent FS-LASIK for correcting myopia and/or astigmatism using upgraded WaveLight FS200 femtosecond laser with the original settings was included in group A. Another consecutive series of 129 patients (255 eyes) who underwent FS-LASIK using upgraded WaveLight FS200 femtosecond laser with flap cut parameter settings changed (decreased pulse energy, spot and line separation) was included in group B. The incidence and fading time of RG, confocal microscopic image and postoperative clinical results were compared between the two groups. There were no differences between the two groups in age, baseline refraction, excimer laser ablation depth, postoperative uncorrected visual acuity and refraction. The incidence rate of RG in group A (35/255, 13.73%) was significantly higher than that in group B (4/255, 1.57%) (P 0.05).The confocal microscopic images showed wider laser spot spacing in group A than group B. The incidence of RG was significantly correlated with age and grouping (P laser with original flap cut parameter settings could increase the incidence of RG. The narrower grating size and lower pulse energy could ameliorate this side effect.
The significance of chromosome deletions in atomic-bomb survivors
International Nuclear Information System (INIS)
Tanaka, Kimio; Shigeta, Chiharu; Oguma, Nobuo; Kamada, Nanao; Deng, Z.; Niimi, Masanobu; Aisaka, Tadaichi.
1986-01-01
In 39 A-bomb survivors 40 years after exposure at ≤ 1,000 m from ground zero, the frequency and features of chromosome deletions in peripheral lymphocytes were examined using a differential staining technique. Simultaneously, in vitro irradiation experiment with Cf-252 was made to infer chromosome aberrations occuring immediately after exposure. Californium-252 with 100 rad induced dicentric and ring chromosomes in 40 % of the cells and acentric fragments in 44 %. Among the A-bomb survivors, chromosome aberrations were observed in 651 (21 %) of the total 3,136 cells. There were 146 cells with deletions (22 % of abnormal cells; 5 % of the total cells), and 10 cells with acentric fragment (0.3 % of the total cells). The figure for deletions was far higher than that reported in the literature. A large number of deletions were seen in chromosomes no.4, no.21, and no.22, and a few deletions in chromosomes no.7 and no.20. Significance of chromosome deletions is discussed. (Namekawa, K.)
International Nuclear Information System (INIS)
Bigelow, J.E.; Collins, E.D.; King, L.J.
1979-01-01
At a concentration of 1 M in straight-chain hydrocarbon diluent, HDEHP will extract americium, curium, and other trivalent actinide and lanthanide elements from dilute acid or salt solutions. The solute is back-extracted with more concentrated acid, either nitric or hydrochloric. The process has been used in the continuous, countercurrent mode, but its greatest advantage arises in batch extractions where the excess acid can be titrated with NaOH to produce a final acidity of about 0.03 M. Under these conditions, 99% recovery can be achieved, usually in one stage. Cleanex was used on the 50-liter scale at the Transuranium Processing Plant at Oak Ridge for 12 years to provide a broad spectrum cleanup to transuranium elements before applying more sophisticated techniques for separating individual products. The process is also used routinely to recover excessive losses of curium and/or californium from plant waste streams. The solvent system is relatively resistant to radiation damage, being usable up to 200 W-h/liter
Dynamic vortex dust structures in a nuclear-track plasma
International Nuclear Information System (INIS)
Rykov, V A; Khudyakov, A V; Filinov, V S; Vladimirov, V I; Deputatova, L V; Krutov, D V; Fortov, V E
2003-01-01
Results are presented from Monte Carlo calculations of the electric charge on dust grains in a plasma produced during the slowing down of radioactive decay products of californium nuclei in neon. The dust grain charging is explained as being due to the drift of electrons and ions in an external electric field. It is shown that the charges of the grains depend on their coordinates and strongly fluctuate with time. The time-averaged grain charges agree with the experimental data obtained on ordered liquid-like dust structures in a nuclear-track plasma. The time-averaged dust grain charges are used to carry out computer modelling of the formation of dynamic vortex structures observed in experiments. Evidence is obtained for the fact that the electrostatic forces experienced by the dust grains are potential in character. The paper is supplemented by a video clip showing the typical dynamics of the simulated vortex dust structure
International Nuclear Information System (INIS)
Woodbury, F.B.W.
1980-12-01
The Bureau of Mines is evaluating alternative technologies to treat oxidized taconites. Since process control is an essential element in the application of these process technologies, research was performed on a prototype monitoring system utilizing a californium-252 (252-Cf) neutron source and a thermal neutron capture-gamma ray spectra analysis method to measure the amount of iron and percent solids in process slurries. The prototype system was used to monitor the concentrate and tailing streams in a 900-lb/hr flotation pilot plant during continuous around-the-clock tests. The iron content of the process slurries was determined by measuring the total peak areas under the capture spectrum peaks at 7.626-7.632 MeV, the associated escape peaks at 7.136-7.122 and 6.626-6.612 MeV, and the iron doublets at 4.900 and 4.998 MeV. A potential method for determining the percent solids in process slurries using the 2.22 MeV hydrogen capture peak is discussed
A survey of uses and users of 252Cf
International Nuclear Information System (INIS)
Bigelow, J.E.; Alexander, C.W.; King, L.J.; Knauer, J.B.; Notz, K.J.
1989-01-01
Californium-252, which is one of the transuranium-element isotopes being produced in the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL), has found many applications in service to industry and medicine. As a neutron source, 252 Cf is unique in providing a highly concentrated and extremely reliable neutron spectrum from a very small assembly. Over the past 22 years, 252 Cf has been applied with great success to cancer therapy, to neutron radiography of objects ranging from flowers to entire aircraft, to startup sources for nuclear reactors, to fission activation assay for quality control and safeguards of all commercial nuclear fuel, and to many other beneficial uses, some of which are now poised for further growth. The extensive exploitation of this highly specialized product has been made possible through 252 Sales/Loan programs sponsored by the US DOE Office of Nuclear Materials Production, initially at the Savannah River Laboratory and now at ORNL
Energy Technology Data Exchange (ETDEWEB)
Brown, Paul L. [Geochem Australia, Kiama, NSW (Australia); Ekberg, Christian [Chalmers Univ. of Technology, Goeteborg (Sweden). Nuclear Chemistry/Industrial Materials Recycling
2016-07-01
All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO{sub 2}OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH{sup 2+} for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.
International Nuclear Information System (INIS)
Brown, Paul L.; Ekberg, Christian
2016-01-01
All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO 2 OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH 2+ for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.
Nuclear Chemistry Institute, Mainz University. Annual Report 1995
International Nuclear Information System (INIS)
Denschlag, H.O.
1996-03-01
The annual report of the Institut fuer Kernchemie addresses inter alia three main research activities. The first belongs to the area of basic research, covering studies in the fields of nuclear fission, chemistry of the super-heavy elements and of heavy-ion reactions extending from the Coulomb barrier to relativistic energies, and nuclear astrophysics in connection with the ''r process''. By means of laser technology, high-precision data could be measured of the ionization energies of berkelium and californium. Studies of atomic clusters in the vacuum of an ionization trap revealed interesting aspects. The second major activity was devoted to the analysis of environmental media, applying inter alia neutron activation analysis and resonance ionization mass spectroscopy (RIMS). The third activity resulted in the development of novel processes, or the enhancement of existing processes or methods, for applications in basic research work and in environmental analytics. Another item of interest is the summarizing report on the operation of the TRIGA research reactor. (orig./SR) [de
Test and evaluation results of the 252Cf shuffler at the Savannah River Plant
International Nuclear Information System (INIS)
Crane, T.W.
1981-03-01
The 252 Cf Shuffler, a nondestructive assay instrument employing californium neutron source irradiation and delayed-neutron counting, was developed for measuring 235 U content of scrap and waste items generated at the Savannah River Plant (SRP) reactor fuel fabrication facility. The scrap and waste items include high-purity uranium-aluminum alloy ingots as well as pieces of castings, saw and lathe chips from machining operations, low-purity items such as oxides of uranium or uranium intermixed with flux materials found in recovery operations, and materials not recoverable at SRP such as floor sweepings or residues from the uranium scrap recovery operation. The uranium contains about 60% 235 U with the remaining isotopes being 236 U, 238 U, and 234 U in descending order. The test and evaluation at SRP concluded that the accuracy, safety, reliability, and ease of use made the 252 Cf Shuffler a suitable instrument for routine use in an industrial, production-oriented plant
General purpose nuclear irradiation chamber
International Nuclear Information System (INIS)
Nurul Fadzlin Hasbullah; Nuurul Iffah Che Omar; Nahrul Khair Alang Md Rashid; Jaafar Abdullah
2013-01-01
Nuclear technology has found a great need for use in medicine, industry, and research. Smoke detectors in our homes, medical treatments and new varieties of plants by irradiating its seeds are just a few examples of the benefits of nuclear technology. Portable neutron source such as Californium-252, available at Industrial Technology Division (BTI/ PAT), Malaysian Nuclear Agency, has a 2.645 year half-life. However, 252 Cf is known to emit gamma radiation from the source. Thus, this chamber aims to provide a proper gamma shielding for samples to distinguish the use of mixed neutron with gamma-rays or pure neutron radiation. The chamber is compatible to be used with other portable neutron sources such as 241 Am-Be as well as the reactor TRIGA PUSPATI for higher neutron dose. This chamber was designed through a collaborative effort of Kulliyyah Engineering, IIUM with the Industrial Technology Division (BTI) team, Malaysian Nuclear Agency. (Author)
Large-scale bioprospecting of cyanobacteria, micro- and macroalgae from the Aegean Sea
Digital Repository Service at National Institute of Oceanography (India)
Montalvao, S.; Demirel, Z.; PrabhaDevi; Lombardi, V.; Hongisto, V.; Perala, M.; Hattara, J.; Imamoglu, E.; Tilvi, S.; Turan, G.; Dalay, M.C.; Tammela, P.
cells (inhibition of growth 87%) andsimilar effect has previously been reported for this species (Mhadhebi et al. 2014). Recent publications(Mikami and Hosokawa 2013; Mhadhebi et al. 2014) have provided evidence that some compounds and pigments present..., Mathur EJ. Bioprospecting ethics & benefits: a model for effective benefit- sharing. Ind Biotechnol 2005;1:255–9. http://dx.doi.org/ 10.1089/ind.2005.1.255. [2] Beattie AJ, Hay M, Magnusson B, de Nys R, Smeathers J, Vincent JFV. Ecology...
People and things. CERN Courier, Jun 1985, v. 25(5)
Energy Technology Data Exchange (ETDEWEB)
Anon.
1985-06-15
The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. To honour one of the greatest physicists of the century, who died last October, and a staunch friend, the International Centre for Theoretical Physics in Trieste has announced the Paul Adrien Dirac Gold Medal Award, to be given annually for highest achievement in theoretical physics. The International Committee for Future Accelerators, ICFA, held its twelfth meeting at the Tata Institute of Fundamental Research, Bombay, on 10 April. The CERN Accelerator School was greatly encouraged by the response to the General Accelerator Physics Course organized last year in collaboration with the Orsay and Saclay Laboratories in France. On 11 March, the International Centre for Theoretical Physics (ICTP) in Trieste paid tribute to the memory of Alfred Kastler, Nobel Laureate for Physics 1966 and Chairman of the ICTP Scientific Council from 1970 to 1982, who died on 7 January 1984.
78 FR 255 - Resumption of the Population Estimates Challenge Program
2013-01-03
... commenter would like the Census Bureau to continue to leave open the option for a challenging county-level... Challenging Certain Population and Income Estimates'' to ``Procedure for Challenging Population Estimates'' to... governmental unit. In those instances where a non-functioning county-level government or statistical equivalent...
40 CFR 60.255 - Performance tests and other compliance requirements.
2010-07-01
... presence of visible emissions must meet the training requirements specified in § 2.3 of Method 22 of.... EPA); Office of Air Quality and Planning Standards; Sector Policies and Programs Division; Measurement... certified neutral density filter or other related technique to produce a known obscuration of the light beam...
255 effects of some heavy metal pollutants on fertility characteristics
African Journals Online (AJOL)
DR. AMINU
2010-06-01
Jun 1, 2010 ... ABSTRACT. This research was conducted on the irrigated soils along the banks of the Jakara River within the metropolitan Kano and its suburb. Soil samples were collected between latitude 11o59' and 12o. 08'N and longitude 8o34' and 8o 42'E at an altitude of 486.5m. The study investigated the effects ...
ORF Alignment: NC_005090 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 6 LKAPYEGIILEKLLNPGEWVATGAAIFNMAKLSPMEASIEVPFETMKNLKVGDRVNLKVA 255 ... LKAPYEGIILEKLLNPGEWVATGAAIFNMAKLSPME...ASIEVPFETMKNLKVGDRVNLKVA Sbjct: 121 LKAPYEGIILEKLLNPGEWVATGAAIFNMAKLSPMEASIEVPFETMKNLKVGDRVNLKVA 180 ...
Estimating accidental coincidences for pixelated PET detectors and singles list-mode acquisition
International Nuclear Information System (INIS)
Rafecas, M.; Torres, I.; Spanoudaki, V.; McElroy, D.P.; Ziegler, S.I.
2007-01-01
We have studied the validity of random estimation techniques for various low energy thresholds (LETs) and single list-mode data sets in small animal PET. While a LET below 255 keV helps to increase the sensitivity, it also results in an increase of random coincidences and inter-crystal scatter (ICS). The study is carried out for MADPET-II, a dual-layer positron emission tomography (PET) scanner prototype consisting of LSO crystals read out individually by APDs. The data are acquired in singles list-mode format, and coincidences are computed post-acquisition. To estimate randoms, we have used the delayed coincidence window method (DW), and the singles rate model (SR). Various phantoms were simulated using GATE. For LETs under 255 keV, the number of random events R, estimated using the SR and the DW methods, is larger than the number of randoms which was directly computed from GATE simulations, and R(SR)>R(DW)>R(GATE). The higher the LET, the smaller the overestimation. For LETs >255 keV, R(DW)/R(GATE) ∼1. If scattered singles were excluded from the file, this discrepancy between R(DW or SR) and R(GATE) significantly diminished. This fact points out to ICS as the effect responsible for the mismatch, since for LETs lower than 255 keV, all singles related to an ICS event can be detected independently, thus altering the singles rate. Therefore, if low LETs are used, random estimation techniques should account for ICS
Microbial UV fluence-response assessment using a novel UV-LED collimated beam system.
Bowker, Colleen; Sain, Amanda; Shatalov, Max; Ducoste, Joel
2011-02-01
A research study has been performed to determine the ultraviolet (UV) fluence-response of several target non-pathogenic microorganisms to UV light emitting diodes (UV-LEDs) by performing collimated beam tests. UV-LEDs do not contain toxic mercury, offer design flexibility due to their small size, and have a longer operational life than mercury lamps. Comsol Multiphysics was utilized to create an optimal UV-LED collimated beam design based on number and spacing of UV-LEDs and distance of the sample from the light source while minimizing the overall cost. The optimized UV-LED collimated beam apparatus and a low-pressure mercury lamp collimated beam apparatus were used to determine the UV fluence-response of three surrogate microorganisms (Escherichia coli, MS-2, T7) to 255 nm UV-LEDs, 275 nm UV-LEDs, and 254 nm low-pressure mercury lamps. Irradiation by low-pressure mercury lamps produced greater E. coli and MS-2 inactivation than 255 nm and 275 nm UV-LEDs and similar T7 inactivation to irradiation by 275 nm UV-LEDs. The 275 nm UV-LEDs produced more efficient T7 and E. coli inactivation than 255 nm UV-LEDs while both 255 nm and 275 nm UV-LEDs produced comparable microbial inactivation for MS-2. Differences may have been caused by a departure from the time-dose reciprocity law due to microbial repair mechanisms. Copyright © 2010 Elsevier Ltd. All rights reserved.
Molecular mechanism of bacterial Hsp90 pH-dependent ATPase activity.
Jin, Yi; Hoxie, Reyal S; Street, Timothy O
2017-06-01
Hsp90 is a dimeric molecular chaperone that undergoes an essential and highly regulated open-to-closed-to-open conformational cycle upon ATP binding and hydrolysis. Although it has been established that a large energy barrier to closure is responsible for Hsp90's low ATP hydrolysis rate, the specific molecular contacts that create this energy barrier are not known. Here we discover that bacterial Hsp90 (HtpG) has a pH-dependent ATPase activity that is unique among other Hsp90 homologs. The underlying mechanism is a conformation-specific electrostatic interaction between a single histidine, H255, and bound ATP. H255 stabilizes ATP only while HtpG adopts a catalytically inactive open configuration, resulting in a striking anti-correlation between nucleotide binding affinity and chaperone activity over a wide range of pH. Linkage analysis reveals that the H255-ATP salt bridge contributes 1.5 kcal/mol to the energy barrier of closure. This energetic contribution is structurally asymmetric, whereby only one H255-ATP salt-bridge per dimer of HtpG controls ATPase activation. We find that a similar electrostatic mechanism regulates the ATPase of the endoplasmic reticulum Hsp90, and that pH-dependent activity can be engineered into eukaryotic cytosolic Hsp90. These results reveal site-specific energetic information about an evolutionarily conserved conformational landscape that controls Hsp90 ATPase activity. © 2017 The Protein Society.
A preliminary study on related factors of mental health in nuclear power plant operators
International Nuclear Information System (INIS)
Dai Tingting; Liu Yulong; Li Yuan; Liao Haihong; Qiu Mengyue; Bian Huahui; Chen Weibo; Liu Chunfeng
2012-01-01
Objective: To explore the status of nuclear power plant operators in mental health and its correlation with emotional stability, liveliness, anxiety and urgency. Methods: 255 male operators were randomly selected from three nuclear power bases, meanwhile 61 undergraduates were used as control group. The mental health and neurobehavioral evaluation system of Chinese nuclear power plant operators was developed by Second Affiliated Hospital of Soochow University, which was used to assess mental health of the subjects. The scores of mental health personality factors were recorded, together with four main personality factors including emotional stability, liveliness, anxiety and urgency. Results: The score of lie was lower than 8 which showed all inspected groups were normal. 1.57% (4/255) operators had psychological disorders, 3.92% (10/255) had poor mental health, 27.84% (71/255) had general mental health, 66.7% (170/255) had excellent mental health, whereas 9.84% (6/61) for control group had psychological disorders. Obvious difference was observed in the final scores between the nuclear power plant operators and control group. The former gained higher scores on mental health,emotional stability,and lower scores on anxiety and urgency (t=3.437, 4.423, -2.493, -2.093, P<0.05). Both groups aged over 27 years and with length of service over 5 years were awarded higher scores on mental health, emotional stability (t=2.585, 2.349; t=2.606, 2.947, P<0.05), lower scores on anxiety and urgency (t=-3.407, -2.138; t=- 2.941, -2.256, P<0.05). The mental health was positively correlated with emotional stability and liveliness (r=0.721, 0.650, P<0.05), but negatively correlated with anxiety and urgency (r=-0.809, -0.693, P<0.05). Conclusions: The majority of nuclear power plant operators had excellent psychological quality, but some factors should be paid more attention, such as different ages and length of service time. (authors)
Occurrence of a Carboxin-Resistant Strain of Ustilago nuda in Italy
Directory of Open Access Journals (Sweden)
J. Menzies
2005-08-01
Full Text Available Loose smut of barley, caused by Ustilago nuda (Jens. Rostr., is commonly controlled through the use of systemic seed-treatment fungicides. The most widely used active ingredient in these fungicides has been carboxin. However, isolates of U. nuda resistant to carboxin have been reported in France. In 1996 and 1997, unsatisfactory levels of loose smut of barley were observed near Perugia (central Italy, despite the treatment of the barley seed with a carboxin-based fungicide. An isolate of U. nuda (97-255 was collected from this field to determine if the pathogen had developed resistance to carboxin. Germination tests on carboxin-amended agar media indicated that isolate 97- 255 was more resistant to carboxin than a wild type isolate of U. nuda collected in Canada. In tests in which isolate 97-255 was inoculated onto barley cv. Regal, the percentage of smutted plants arising from the inoculated seed was not reduced by a carboxin seed treatment. This is the first report of resistance to carboxin in populations of U. nuda from Italy.
ORF Alignment: NC_005784 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available DPETGIIDYDTLEKNAVLYRPKILVAGTS Sbjct: 121 PDGGHLSHGYQTETRKISAVSTYFESFPYRVDPETGIIDYDTLEKNAVLYRPKILVAGTS 180 ... Query: 255 GAMIF...FRRGVRSVHPKTGEEVMYDLEGPINFSVFPGHQGGPHNHTISALATALKQATTPE 314 ... GAMIFFRRGVRSVHPKTGEEVM...YDLEGPINFSVFPGHQGGPHNHTISALATALKQATTPE Sbjct: 241 GAMIFFRRGVRSVHPKTGEEVMYDLEGPINF
Damgård, Ivan; Keller, Marcel
We propose several variants of a secure multiparty computation protocol for AES encryption. The best variant requires 2200 + {{400}over{255}} expected elementary operations in expected 70 + {{20}over{255}} rounds to encrypt one 128-bit block with a 128-bit key. We implemented the variants using VIFF, a software framework for implementing secure multiparty computation (MPC). Tests with three players (passive security against at most one corrupted player) in a local network showed that one block can be encrypted in 2 seconds. We also argue that this result could be improved by an optimized implementation.
Márcio Afonso Arimura Fialho
2007-01-01
Neste trabalho é feito um estudo comparativo entre dois algoritmos de identificação de estrelas desenvolvidos para um sensor de estrelas autônomo de campo largo em projeto no INPE - Instituto Nacional de Pesquisas Espaciais. A comparação é realizada com base nas especificações técnicas deste sensor de estrelas, cujas principais características são: campo de visada quadrado de 25,5 x 25,5 , matriz fotodetectora de 1024 1024 pixels de tecnologia CMOS-APS e precisão na determinação de atitude...
International Nuclear Information System (INIS)
Takabayashi, Y.; Bagrov, V.G.; Bogdanov, O.V.; Pivovarov, Yu.L.; Tukhfatullin, T.A.
2015-01-01
New experiments on channeling of 255 MeV electrons in a half-wavelength crystals (HWC) were performed at SAGA Light Source facilities. The simulations of trajectories for (2 2 0) and (1 1 1) planar channeling in Si were performed using the computer code BCM-1.0. Comparison of experimental and theoretical results shows a good agreement. The results of calculations of spectral distribution of radiation in forward direction (θ = 0°) from 255 MeV electrons at (2 2 0) channeling in HWC silicon are presented. Qualitative comparison with radiation spectrum from an electron moving in an arc is performed
ORF Alignment: NC_001144 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available GTS Sbjct: 121 PDGGHLSHGYATENRKISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTS 180 ... Query: 255 GAMIFFRRGVRSINPK...TGKEVLYDLENPINFSVFPGHQGGPHNHTIXXXXXXXXXXXXPE 314 ... GAMIFFRRGVRSINPKTGKEV...LYDLENPINFSVFPGHQGGPHNHTI ... PE Sbjct: 241 GAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTIAALATALKQAA
47 CFR 15.255 - Operation within the band 57-64 GHz.
2010-10-01
... systems, unless the field disturbance sensors are employed for fixed operation. For the purposes of this... operating under the provisions of paragraph (b)(2) of this section, the peak transmitter output power shall... of the spurious emissions shall not exceed the level of the fundamental emission. (d) Only spurious...
7 CFR 1726.255 - Prior approved contract modifications related to indemnification.
2010-01-01
... indemnitor indemnify the indemnitee for the indemnitee's own negligence, the borrower may add the words “otherwise this provision shall apply to any alleged negligence or condition caused by the Owner” so that the... destruction caused by the sole negligence of Owner, otherwise this provision shall apply to any negligence or...
Ferry Terminals and Small Craft Berthing Facilities. Design Manual 25.5.
1981-07-01
become water-logged and sink in a few years. Use is generally not recommended. (2) Extruded polystyrene (Styrofoam). Available in several sizes of precast...Supplemental facilities, such as boardroom, coffee- break room or snack bar, engineering room, and storage room, fol large installations. b
In-situ elemental analysis of coal by neutron activation
International Nuclear Information System (INIS)
Mikesell, J.L.; Senftle, F.E.; Tanner, A.B.
1986-01-01
The U.S. Geological Survey (USGS) has worked to develop neutron techniques for the borehole measurement of the elemental composition of ores since 1969, and first demonstrated a borehole ultimate analysis of coal in 1977. Borehole measurements such as these permit real-time evaluation of coal quality without the expense of coring or the delays associated with laboratory analyses. Two technological innovations make such measurements possible: the availability, from Savannah River Operations Office, DOE, of small californium-252 (/sup 252/Cf) fission neutron sources, and the development, by USGS and Princeton Gamma-Techn, of the melting-cryogen-cooled high-purity germanium borehole gamma-ray detector. A technique of relating mass fractions to measured gamma-ray intensities, which eliminates the need for detailed knowledge of the geometry of the neutron distribution, is used to calculate elemental compositions without resorting to the test pits or computer borehole modeling. In coal, all of the major constituents (C, H, N, S, Si, Al, Fe, Ti) except oxygen can be determined quantitatively by thermal neutron capture gamma-ray spectroscopy
Energy Technology Data Exchange (ETDEWEB)
Kondev, F.; Carpenter, M.P.; Chowdhury, P.; Clark, J.A.; Lister, C.J.; Nichols, A.L.; Swewryniak, D. (Nuclear Engineering Division); (Univ. of Massachusetts); (Univ. of Surrey)
2011-10-06
A workshop on 'Decay Spectroscopy at CARIBU: Advanced Fuel Cycle Applications, Nuclear Structure and Astrophysics' will be held at Argonne National Laboratory on April 14-16, 2011. The aim of the workshop is to discuss opportunities for decay studies at the Californium Rare Isotope Breeder Upgrade (CARIBU) of the ATLAS facility with emphasis on advanced fuel cycle (AFC) applications, nuclear structure and astrophysics research. The workshop will consist of review and contributed talks. Presentations by members of the local groups, outlining the status of relevant in-house projects and availabile equipment, will also be organized. time will also be set aside to discuss and develop working collaborations for future decay studies at CARIBU. Topics of interest include: (1) Decay data of relevance to AFC applications with emphasis on reactor decay heat; (2) Discrete high-resolution gamma-ray spectroscopy following radioactive decya and related topics; (3) Calorimetric studies of neutron-rich fission framgents using Total ABsorption Gamma-Ray Spectrometry (TAGS) technique; (4) Beta-delayed neutron emissions and related topics; and (5) Decay data needs for nuclear astrophysics.
International Nuclear Information System (INIS)
Brunelle, A.
1990-09-01
A new time-of-flight mass spectrometer, Super-Depil, is used to study secondary ion emission from solid surfaces bombarded by various kinds of primary particles. Three different desorption probes were set up on this machine: a 252 californium source, providing by spontaneous fission about 1 MeV/u energy heavy ions, a 5 to 30 keV energy pulsed caesium ion gun and a pulsed nitrogen laser, which wavelength is 337 mm. A two stages electrostatic mirror was added to the spectrometer. The time spread due to the initial kinetic energy of secondary ions leaving the surface was minimized. The mass resolution is greater than 5000. The analysis of glycosidic terpenes showed the complementarity of the three probes. The study of such metastable ions, with the electrostatic mirror, showed that some fragment ions may conserve the memory of the stereochemistry of the neutral lost. Clusters ions were used as projectiles in the energy range 5-60 keV. A strong non linear enhancement was observed in the secondary ion yield from various targets [fr
International Nuclear Information System (INIS)
Karalova, Z.K.; Bukina, T.I.; Myasoedov, B.F.; Fedorov, L.A.; Sokolovskij, S.A.
1987-01-01
Extraction of trivalent americium, curium, californium and europium by technical mixture of mono- and didecylpyrocatechin (TAP) in various diluents from carbonate solutions is investigated. Effect of many factors (pH, K 2 CO 3 concentration, TAP, metal; the time of phase contact) on the completeness of element isolation and separation is clarified. It is ascertained that the elements listed are quantitatively extracted by TAP solution in toluene and cyclohexane in the range of K 2 CO 3 concentrations from 0.25 to 1.5 mol/l. The difference in americium and curium distribution coefficient during their extraction by TAP from 0.25 mol/l of K 2 CO 3 solution is detected. Separation coefficients of the pair increase with the increase of carbonate solution pH. The separation can be improved at the stage of element reextraction by the mixture of K 2 CO 3 and DTPA or EDTA from alkylpyrocatechin, sunce rate constants of americium and curium reextraction differ greatly. Using 13 C NMR the composition of compounds in organic phase on the basis of 4-(α, α-dioctylethyl)pyrocatechin is investigated
Fast neutron tomography with real-time pulse-shape discrimination in organic scintillation detectors
Energy Technology Data Exchange (ETDEWEB)
Joyce, Malcolm J., E-mail: m.joyce@lancaster.ac.uk [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Agar, Stewart [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Aspinall, Michael D. [Hybrid Instruments Ltd., Gordon Manley Building, Lancaster Environment Centre, Lancaster University, Lancaster LA1 4YW (United Kingdom); Beaumont, Jonathan S.; Colley, Edmund; Colling, Miriam; Dykes, Joseph; Kardasopoulos, Phoevos; Mitton, Katie [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom)
2016-10-21
A fast neutron tomography system based on the use of real-time pulse-shape discrimination in 7 organic liquid scintillation detectors is described. The system has been tested with a californium-252 source of dose rate 163 μSv/h at 1 m and neutron emission rate of 1.5×10{sup 7} per second into 4π and a maximum acquisition time of 2 h, to characterize two 100×100×100 mm{sup 3} concrete samples. The first of these was a solid sample and the second has a vertical, cylindrical void. The experimental data, supported by simulations with both Monte Carlo methods and MATLAB®, indicate that the presence of the internal cylindrical void, corners and inhomogeneities in the samples can be discerned. The potential for fast neutron assay of this type with the capability to probe hydrogenous features in large low-Z samples is discussed. Neutron tomography of bulk porous samples is achieved that combines effective penetration not possible with thermal neutrons in the absence of beam hardening.
[Fast neutron cross section measurements]: Progress report
International Nuclear Information System (INIS)
1988-01-01
As projected in our previous proposal, the past year on the cross section project at the University of Michigan has been one primarily of construction and assembly of our 14 MeV pulsed Neutron Facility. All the components of the system have now been either purchased or fabricated in our shop facilities and have been assembled in their final configuration. We are now in the process of testing the rf components that have been designed to deliver voltage to both the pulser and buncher stages. We expect that the system will be operational by the end of the current contract year. We have also accomplished the design and construction of several other major pieces of equipment that are needed to begin fast neutron time-of-flight measurements. These include the primary proton recoil detector, and a californium fission chamber needed in the efficiency calibration of the primary detector. We have also added considerable concrete shielding designed to lower the neutron background in the experimental area. 10 figs., 5 tabs
International Nuclear Information System (INIS)
Truchet, G.; Van Rooijen, W. F. G.; Shimazu, Y.; Yamaguchi, K.
2012-01-01
The Modified Neutron Source Method (MNSM) is applied to the Monju reactor. This static method to estimate sub-criticality has already given good results on commercial Pressurized Water Reactors. The MNSM consists both in the extraction of the fundamental mode seen by a detector to avoid the effect of higher modes near sources, and the correction of flux distortion effects due to control rod movement. Among Monju's particularities that have a big influence on MNSM factors are: the presence of two californium sources and the position of the detector which is located far from the core outside of the reactor vessel. The importance of spontaneous fission and (α, n) reactions which have increased during the shutdown period of 15 years will also be discussed. The relative position of detectors and sources deeply affect the correction factors in some regions. In order to evaluate the detector count rate, an analytical propagation has been conducted from the reactor vessel. For two subcritical states, an estimation of the reactivity has been made and compared to experimental data obtained in the restart experiments at Monju (2010). (authors)
Measurement of neutron dose and spectra at light-water reactors
International Nuclear Information System (INIS)
Soldat, K.L.; Endres, G.W.R.; Cummings, F.M.
1982-08-01
In choosing one dosimeter over another, both sensitivity and precision must be addressed. It has been determined that dosimeters employing NTA film lack adequate sensitivity for use inside containment of nuclear plants. From this study, it is apparent that CR-39 and polycarbonate track etch films used without radiators are also inadequate. The rest of the dosimeters tested displayed adequate sensitivity. The two general types of dosimeters which comprise that group are: (1) TLDs and (2) the polycarbonate track etch which was used in conjunction with (n, α) radiators. The precision of the TLD dosimeter depends on the calibration technique and response correction technique. TLD dosimeters calibrated to D 2 O-moderated californium-252 or corrected based on 9- to 3-in. sphere response rates seemed to function best inside reactor containment. Polycarbonate track etch film with (n, α) radiators was found to be sensitive enough for use inside reactor containment; however, the standard deviation for the results was roughly twice the value of the most precise TLD albedo dosimeters. Also, several of the polycarbonate dosimeters saturated, rendering any evaluation impossible
Development of an analytical theory to describe the PNAR and CIPN nondestructive assay techniques
International Nuclear Information System (INIS)
Bolind, Alan Michael
2014-01-01
Highlights: • Neutron albedo is modeled by a discrete and iterative reflection process. • The theory enables the PNAR and CIPN NDA techniques to be compared quantitatively. • Improvements to the data analysis and to the CIPN instrument design are suggested. • A correction to translate real no-reflection PNAR data into ideal data is provided. - Abstract: This paper develops an analytical theory to describe how neutron albedo (reflection) increases the multiplication of neutrons by a used fuel assembly. With this theory, the two nondestructive assay (NDA) techniques of Passive Neutron Albedo Reactivity (PNAR) and Californium-252 Interrogation with Prompt Neutron Detection (CIPN) can be compared directly. Specifically, the theory derives expressions for the PNAR and CIPN metrics in terms of the physical properties of the used fuel assembly, such as the neutron multiplications and fate probabilities. The theory thus clarifies the interpretation of these two NDA techniques and suggests ways to improve both the design of the NDA instruments and the algorithms for analyzing the measurement results
Robotics at Savannah River site: activity report
International Nuclear Information System (INIS)
Byrd, J.S.
1984-09-01
The objectives of the Robotics Technology Group at the Savannah River Laboratory are to employ modern industrial robots and to develop unique automation and robotic systems to enhance process operations at the Savannah River site (SRP and SRL). The incentives are to improve safety, reduce personnel radiation exposure, improve product quality and productivity, and to reduce operating costs. During the past year robotic systems have been installed to fill chemical dilution vials in a SRP laboratory at 772-F and remove radioactive waste materials in the SRL Californium Production Facility at 773-A. A robotic system to lubricate an extrusion press has been developed and demonstrated in the SRL robotics laboratory and is scheduled for installation at the 321-M fuel fabrication area. A mobile robot was employed by SRP for a radiation monitoring task at a waste tank top in H-Area. Several other robots are installed in the SRL robotics laboratories and application development programs are underway. The status of these applications is presented in this report
Efficiency of interaction between various radiation and chemicals
International Nuclear Information System (INIS)
Kim, Jin Kyu; Song, H. S.; Kim, J. S.; Chun, K. J.; Lee, Y. K.; Lee, B. H.; Shin, H. S.; Lee, K. H.; Petin, Vladislav G.
2002-01-01
KAERI and INP (Poland) have been carried out parallel study and joint experiments on the major topics according to MOU about their cooperative project. Major experimental techniques were TSH assay, comet assay, and synergism assay. The research consisted of the following workscopes. 1) Application of TSH bioindicator for studying the biological efficiency of radiation, 2) Relative biological efficiency of californium-252 neutrons in the induction of gene and lethal mutations in TSH cells normal and enriched with boron compound, 3) Effect of pesticide on radiation-induced mutations in TSH cells, 4) Interaction of radiation with pesticide on DNA damage in human peripheral blood lymphocytes, 5) Radiomodifying effect of boron and gadolinium compounds in human peripheral blood lymphocytes, 6) Mathematical description of synergistic interactions, 7) General regularities of synergistic interactions, and 8) Determinant of synergistic interaction between radiation, heat and chemicals in cell killing. Both institutes have established wide variety of research techniques applicable to various radiation research through the cooperation. The results of research can make the role of fundamental basis for the better relationship between Korea and Poland
Separation of Am-Cm from Al(NO3)3 waste solutions by in-canyon-tank precipitation as oxalates
International Nuclear Information System (INIS)
Gray, L.W.; Burney, G.A.; Wilson, T.W.; McKibben, J.M.; Bibler, N.E.; Holtzscheiter, E.W.; Campbell, T.G.
1982-04-01
A process for recovery of Am-Cm residues from high-activity waste concentrates has been developed specifically for application in Savannah River Plant (SRP) canyon tanks. The Am-Cm residues were collected from a campaign to produce plutonium containing high isotopic concentrations of 242 Pu. The separation of Am-Cm from the high-activity waste stream, containing about 2M Al(NO 3 ) 3 , is necessary to produce an acceptable feed solution for a later pressurized cation exchange chromatography separation and purification step. The new process includes formic acid denitration, adjustment of contaminating cations by evaporation and water dilution, and oxalate precipitation of the actinides and lanthanides. After washing, the precipitate was dissolved in 8M nitric acid and the oxalate was destroyed by nitric acid oxidation that was catalyzed by manganous ions. This new process generates about one-fourth the waste of the californium solvent extraction process, which it replaced. The new process also produces a cleaner feed solution for the pressurized cation exchange chromatography separation and purification step
Fabrication of intense neutron sources for medical applications
International Nuclear Information System (INIS)
Boulogne, A.R.; Walker, V.W.
1975-01-01
Simulated sources containing 252 Cf equivalents of 0.1 to 1.0 milligrams were prepared. Samarium was used as the simulant in a modified chemical plating technique similar to that used to prepare palladium-californium oxide cermet for industrial applications. The length of the platinum-10 percent iridium doubly encapsulated source with its protective sheath is 0.545 in. (14.1 mm). Outside dia of the source, including its sheath, is 0.109 in. (2.8 mm). Existing ''Brachytrons'' can accommodate this source form. This capsule system will withstand internal gas pressures from helium due to alpha decay and fission gases from a 1 mg 252 Cf source after ten years if the source is subjected to a maximum temperature of 800 0 C, the theoretical temperature of an accidental fire. Under these conditions the safety factor is 3. The capsule system is being tested with tracer amounts of 252 Cf to ensure that it will withstand adverse service conditions as well as tests specified for Special Form Materials. (auth)
International Nuclear Information System (INIS)
Vasil'ev, Yu.A.; Barashkov, Yu.A.; Golovanov, O.A.; Sidorov, L.V.
1977-01-01
A method for determining the average number of secondary neutrons anti ν produced in nuclear fission by the neutrons of the 252 Cf fission spectra by means of a 4π time-of-flight spectrometer is described. Layers of 252 Cf and an isotope studied are placed close to each other; if the isotope layer density is 1 mg/cm 2 probability of its fission is about 10 -5 per one spontaneous fission of californium. Fission fragments of 252 Cf and the isotope investigated have been detected by two surface-barrier counters with an efficiency close to 100%. The layers and the counters are situated in a measuring chamber placed in the center of the 4π time-of-flight spectrometer. The latter is utilized as a neutron counter because of its fast response. The method has been verified by carrying out measurements for 235 U and 239 Pu. A comparison of the experimental and calculated results shows that the method suggested can apply to determine the number of secondary neutrons in fission of isotopes that have not been investigated yet
B(E2) ↑ (01+ -> 21+) predictions for even–even nuclei in the differential equation model
International Nuclear Information System (INIS)
Nayak, R.C.; Pattnaik, S.
2015-01-01
We use the recently developed differential equation model (DEM) for the reduced electric quadrupole transition probability B(E2)↑ for the transition from the ground to the first 2 + state for predicting its values for a wide range of even–even nuclides almost throughout the nuclear landscape from Neon to Californium. This is made possible as the principal equation in the model, namely, the differential equation connecting the B(E2)↑ value of a given even–even nucleus with its derivatives with respect to the neutron and proton numbers, provides two different recursion relations, each connecting three different neighboring even–even nuclei from lower- to higher-mass numbers and vice versa. These relations are primarily responsible in extrapolating from known to unknown terrain of the B(E2)↑-landscape and thereby facilitate the predictions throughout. As a result, we have succeeded in predicting its hitherto unknown value for the adjacent 251 isotopes lying on either side of the known B(E2)↑ database. (author)
Reprocessing of nuclear fuels at the Savannah River Plant
International Nuclear Information System (INIS)
Gray, L.W.
1986-01-01
For more than 30 years, the Savannah River Plant (SRP) has been a major supplier of nuclear materials such as plutonium-239 and tritium-3 for nuclear and thermonuclear weapons, plutonium-238 for space exploration, and isotopes of americium, curium, and californium for use in the nuclear research community. SRP is a complete nuclear park, providing most of the processes in the nuclear fuel cycle. Key processes involve fabrication and cladding of the nuclear fuel, target, and control assemblies; rework of heavy water for use as reactor moderator; reactor loading, operation, and unloading; chemical recovery of the reactor transmutation products and spent fuels; and management of the gaseous, liquid, and solid nuclear and chemical wastes; plus a host of support operations. The site's history and the key processes from fabrication of reactor fuels and targets to finishing of virgin plutonium for use in the nuclear weapons complex are reviewed. Emphasis has been given to the chemistry of the recovery and purification of weapons grade plutonium from irradiated reactor targets
Hoke, Forney M.
Papers on the testing and evaluation of IR detectors and arrays are presented, covering topics such as a short wavelength IR test system, pulse height analysis, the use of an expert system for IR detector testing, low-background IR focal plane testing, electron beam testing, high performance silicide Schottky photodiodes, the SDI organization focal plane test program, the absorption cross section of arsenic in silicon, and long wavelength IR hybrids. Other topics include low background radiometric detector measurements, an ultralow background dewar for IR detector characterization studies, a computer assisted mosaic array test station, a configurable detector array test station, automated detector material characterization capabilities, and a test system for mercury cadmium telluride photoconductor arrays. Additional topics include ionization dosimetry measurements inside a dewar for linac electron and californium-252 neutron environments, a radiation test facility using a variable-flux electron beam source, automated visual inspection of IR focal plane arrays, a titanium cryostat for low temperature radiation effects studies, a low dose rate gamma test facility, and the test and evaluation of stability in IR staring focal plane arrays after nonuniformity correction.
Branching ratios of α-decay to ground and excited states of Fm, Cf, Cm and Pu
Hassanabadi, H.; Hosseini, S. S.
2018-06-01
We use the well-known Wentzel-Kramers-Brillouin (WKB) barrier penetration probability to calculate α-decay branching ratios for ground and excited states of heavy even-even nuclei of Fermium (248-254Fm), Californium (244-252Cf), Curium (238-248Cm) and Plutonium (234-244Pu) with 94 ≤Zp ≤100. We obtained the branching ratios for the excited states of daughter nucleus by the α-decay energy (Qα), the angular momentum of α-particle (ℓα), and the excitation probability of the daughter nucleus with the excitation energy of state ℓ in the daughter nucleus (i.e. Eℓ*). α-Decay half-lives have been evaluated by using the proximity potential model for the heavy even-even nuclei. We have reported the half-lives and compared the results with the experimental data. The theoretical branching ratios of α-transitions in our calculation are found to agree with the available experimental data well for 0+→ 0+, 0+→ 2+, 0+→ 4+, 0+→ 6+ and 0+ → 8+α-transitions.
Dust vortices, clouds, and jets in nuclear-induced plasmas
International Nuclear Information System (INIS)
Vladimirov, V.I.; Deputatova, L.V.; Nefedov, A.P.; Fortov, V.E.; Rykov, V.A.; Khudyakov, A.V.
2001-01-01
The collective movement of dust particles in a plasma formed during deceleration of decay products of californium nuclei in neon is investigated experimentally. For the first time, compact vortex structures containing a large number of coagulating dust particles and dense dust clouds evolving in time are observed. Dust formations have clearly defined boundaries and particles in them form ordered liquid-type structures. Under steady-state conditions, dust structures exist from several minutes to hours. An increase in the voltage applied to the high-voltage electrode leads to the formation of dust particle jets. A change in the electric field configuration transforms the structures from one type to another. A strong recombination of electrons and ions at dust particles is observed. The momentum transfer from ions drifting in an external field to gas molecules is studied using the Monte Carlo method. It is shown that the transferred momentum is so large that it may cause a gas flow. The characteristic features of vortex flow in neon and in air are explained
Glasses impregnated with lead for radiation shielding
International Nuclear Information System (INIS)
Abd El Monem, A.M.; Kansouh, W.A.; Megahid, R.M.; Ismail, A.L.; Awad, E.M.
2005-01-01
The attenuation properties of glasses with different concentration of lead have been investigated for the attenuation of gamma-rays from cesium-137 and for total gamma rays using a beam of neutrons and gamma rays emitted from californium-252 source. Measurements have been performed using a gamma-ray spectrometer with Nal(T1) detector for gamma-rays emitted from 137 Cs and a neutron/gamma spectrometer with stilbene scintillator for measurement of total gamma-rays from 252 Cf neutron source. The latter applied the pulse shape discrimination technique to distinguish between recoil proton and recoil electron pulses. The obtained results given the form displayed pulse height spectra and attenuation relations which were used to derive the linear attenuation coefficient (μ), and the mass attenuation coefficient (mu/p) of the investigated glasses. In addition, calculations were performed to determine the attenuation properties of glass shields under investigation using XCOM code given by the others. A comparison of the shielding properties of these glasses with some standard shielding materials indicated that, the investigated glasses process the shielding advantages required for different nuclear technology applications
Calibration techniques and results for the Portsmouth Cf shuffler
International Nuclear Information System (INIS)
Gross, J.C.; Wines, K.M.
1993-01-01
As environmental concerns over radioactive waste disposal continue to rise, the importance of Californium shufflers as a versatile waste monitoring and segregation instrument also continue to increase. The extent to which different amounts and types of materials can be measured by the shuffler is directly related to the extent of its calibration. As shufflers become more common place and their waste management uses also rise, the importance of a wide ranging and thorough calibration becomes critical. This paper presents the techniques used at the Portsmouth Gaseous Diffusion Plant for calibrating the shuffler to detect levels of U-235 in radioactive waste. While the calibration techniques are similar to those used by Los Alamos, the standards that were used were constructed somewhat differently so that geometric effects are maximized. Also presented are shuffler transmission measurements that are used to determine the matrix type and the corresponding calibration. A discussion of the calibration data is given. This discussion includes specific aspects of the calibration such as overall range, high end limits, and poly shielding range and usefulness
LET dependence of GafChromic films and an ion chamber in low-energy proton dosimetry
International Nuclear Information System (INIS)
Kirby, Daniel; Parker, David; Green, Stuart; Hugtenburg, Richard; Wojnecki, Cecile; Palmans, Hugo
2010-01-01
Dosimetry using a PMMA phantom was performed in 15 and 29 MeV proton beams from the Birmingham cyclotron, with a Markus parallel-plate ionization chamber and GafChromic EBT and MD-V2-55 film. Simulations of the depth-dose curves were performed with FLUKA 2008.3 and MCNPX 2.5.0, which agreed almost perfectly with each other in range and only differed by 2% in the Bragg peak (BP) region. FLUKA was also used to calculate k Q factors for Markus chamber measurements as an improvement to the IAEA TRS-398 values in low-energy beams. FLUKA depth-dose simulations overestimate the BP height measured by ion chamber by about 10%, where the initial proton energy spread was estimated by fitting to the slope of the measured BP distal edge. Both GafChromic films showed an under-response in the BP compared to ion chamber; however, EBT exhibits this effect at lower energies than MD-V2-55. A possible reason for this is attributed to the shape and arrangement of the monomer particles being different in the active components of EBT and MD-V2-55. Relative effectiveness (RE) of both films is presented as functions of residual range R res in water and peak proton energy determined by FLUKA, with considerations for the spatial separation of the two active layers in each film. The proton energies at which RE reduces to 90% of maximum film response are 6.7 and 3.2 MeV for MD-V2-55 and EBT, respectively. Additionally, a beam quality correction factor (g Q,Q 0 ) is suggested for both GafChromic films, involving water-to-film stopping power ratios evaluated using ICRU recommendations, and a polymer yield factor G Q 0 /G Q . RE in this work is equated to the reciprocal of the polymer yield factor. The calculated values of (s w,film ) Q /(s w,film ) Q 0 are constant within 2.1% and 1.2% across the proton energy range of 1-300 MeV for EBT and MD-V2-55, respectively, so it is concluded that the polymer yield factor is the dominant factor causing the LET quenching effect.
International Nuclear Information System (INIS)
Jaubert, Silke; Maurer, Gerd
2014-01-01
Highlights: • Formation of hemiacetal/poly(oxymethylene) hemiacetals in liquid binary mixtures. • Acetaldehyde and a low molecular alcohol (methanol or ethanol or 1-propanol). • Quantitative 13 C NMR spectroscopy at temperatures between (255 and 295) K. • Hemiacetals are the predominant species. • (Acetaldehyde + methanol (50 + 50)) at 255 K: hemiacetal (polymers) >80% (≈10%). -- Abstract: Aldehydes react with alcohols to hemiacetals and poly(oxymethylene) hemiacetals. The chemical reaction equilibria of such reactions, in particular in the liquid state, can have an essential influence on the thermodynamic properties and related phenomena like, for example, on the vapour + liquid phase equilibrium. Therefore, thermodynamic models that aim to describe quantitatively such phase equilibria have to consider the chemical reaction equilibrium in the coexisting phases. This is well known in the literature for systems such as, for example, formaldehyde and methanol. However, experimental information on the chemical reaction equilibria in mixtures with other aldehydes (than formaldehyde) and alcohols is extremely scarce. Therefore, quantitative NMR spectroscopy was used to investigate the chemical reaction equilibria in binary mixtures of acetaldehyde and a single alcohol (here either methanol, ethanol or 1-propanol) at temperatures between (255 and 295) K. The results reveal that the majority of the constituents of the mixture is present as hemiacetal and the first two poly(oxymethylene) hemiacetals: in an equimolar mixture of (acetaldehyde + methanol or ethanol or 1-propanol), between about 90% at T = 255 K and about 75% at 295 K. The mole-fraction based chemical reaction equilibrium constants for the formation of those species were determined and some derived properties are reported
[Study of gene mutation and pathogenetic mechanism for a family with Waardenburg syndrome].
Chen, Hongsheng; Liao, Xinbin; Liu, Yalan; He, Chufeng; Zhang, Hua; Jiang, Lu; Feng, Yong; Mei, Lingyun
2017-08-10
To explore the pathogenetic mechanism of a family affected with Waardenburg syndrome. Clinical data of the family was collected. Potential mutation of the MITF, SOX10 and SNAI2 genes were screened. Plasmids for wild type (WT) and mutant MITF proteins were constructed to determine their exogenous expression and subcellular distribution by Western blotting and immunofluorescence assay, respectively. A heterozygous c.763C>T (p.R255X) mutation was detected in exon 8 of the MITF gene in the proband and all other patients from the family. No pathological mutation of the SOX10 and SNAI2 genes was detected. The DNA sequences of plasmids of MITF wild and mutant MITF R255X were confirmed. Both proteins were detected with the expected size. WT MITF protein only localized in the nucleus, whereas R255X protein showed aberrant localization in the nucleus as well as the cytoplasm. The c.763C>T mutation of the MITF gene probably underlies the disease in this family. The mutation can affect the subcellular distribution of MITF proteins in vitro, which may shed light on the molecular mechanism of Waardenburg syndrome caused by mutations of the MITF gene.
ORF Alignment: NC_005042 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available str. CCMP1375] ... Length = 255 ... Query: 1 ... MGVINVTPDSFSDGGEYLEPLEAYKKASECI...AAGVDVIDVGGQSTRPGAKTISPEKELQR 60 ... MGVINVTPDSFSDGGEYLEPLEAYKKASECIAAGVDVIDVGGQSTRPGAKTISPEKELQR Sb...jct: 1 ... MGVINVTPDSFSDGGEYLEPLEAYKKASECIAAGVDVIDVGGQSTRPGAKTISPEKELQR 60 ... Query: 121 YVITHSRGNSFDMNNYAFYNDVV
Information and Communication Technology (ICT) Standards and Guidelines. Final rule.
2017-01-18
We, the Architectural and Transportation Barriers Compliance Board (Access Board or Board), are revising and updating, in a single rulemaking, our standards for electronic and information technology developed, procured, maintained, or used by Federal agencies covered by section 508 of the Rehabilitation Act of 1973, as well as our guidelines for telecommunications equipment and customer premises equipment covered by Section 255 of the Communications Act of 1934. The revisions and updates to the section 508-based standards and section 255-based guidelines are intended to ensure that information and communication technology covered by the respective statutes is accessible to and usable by individuals with disabilities.
International Nuclear Information System (INIS)
Wogman, N.A.
1976-12-01
Instrumentation has been designed for in situ analysis of marine and terrestrial minerals using the techniques of x-ray fluorescence and neutron activation analysis. The energy-dispersive x-ray fluorescence analyzer allows more than 20 elements to be quantitatively measured at the 10 ppM level in water depths to 300 m. The analyzer consists of a solid cryogen-cooled Si(Li) detector, a 50 mCi 109 Cd or 57 Co excitation source, and an analyzer-computer system for data storage and manipulation. The neutron activation analysis, which is designed to measure up to 30 elements at parts per hundred to ppM levels, utilizes the man-made element 252 Cf as its neutron activation source. The resulting radioelements which emit characteristic gamma radiation are then analyzed in situ during 2- to 200-s counting intervals with Ge(Li) or NaI(T1) detector systems. An extension of this latter technique, which uses a 252 Cf- 235 U fueled subcritical multiplier, is also being studied. The subcritical facility allows the neutrons from the 252 Cf source to be multiplied, thus providing greater neutron flux. Details of these in situ analysis systems, actual in situ spectra, and recorded data are discussed with respect to the detection of minerals at their varying concentration levels. The system response of each illustrates its usefulness for various rapid environmental mineral exploration studies. These techniques can be utilized on terrestrial surfaces and marine or fresh water sediments. 5 figures, 2 tables
ORF Alignment: NC_003919 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... pv. citri str. 306] ... Length = 255 ... Query: 6 ... KKTALVTGASSGMGKAIAHRLIQDGYQVYVAARNVDRMADLALLGAHPLC...MDVSRDDDIV 65 ... KKTALVTGASSGMGKAIAHRLIQDGYQVYVAARNVDRMADLALLGAHPLC...MDVSRDDDIV Sbjct: 1 ... KKTALVTGASSGMGKAIAHRLIQDGYQVYVAARNVDRMADLALLGAHPLCMDVSRDDDIV 60 ... Query: 126 KRAGHIVN
ORF Alignment: NC_003552 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available SGVSFSIEESETLALVGETGCGKSVVAHAIMRLLPPESRVK 60 ... Query: 130 XXXXXXXXXXXNMGFSNVSECIRYYPSWCSGGMNQRFLIAASIILNPALLI...ADEPSKGLD 189 ... NMGFSNVSECIRYYPSWCSGGMNQRFLIAASIILNPALLIADEPS...KGLD Sbjct: 121 EAFLKAAKALKNMGFSNVSECIRYYPSWCSGGMNQRFLIAASIILNPALLIADEPSKGLD 180 ... Query: 250 MHPYTRGLLNSLPEK 264 ... MHPYTRGLLNSLPEK Sbjct: 241 MHPYTRGLLNSLPEK 255
Directory of Open Access Journals (Sweden)
Sônia Rodrigues Dutra
2008-08-01
Full Text Available OBJETIVO: avaliar a efetividade do esterilizador com esferas de vidro Steri® 350, quanto ao controle de infecção das partes ativas dos alicates ortodônticos. METODOLOGIA: foram utilizados nove alicates ortodônticos, previamente esterilizados em autoclave à temperatura de 121ºC, durante 20 minutos. Posteriormente, as partes ativas dos alicates foram contaminadas com Bacillus stearothermophilus. Logo após, as pontas dos alicates foram colocadas no Steri® 350, durante os períodos de 3, 5, 10, 15, 20, 30 e 40 segundos, em temperatura de 255ºC, para avaliar a eficácia da esterilização. RESULTADOS E CONCLUSÕES: o esterilizador com esferas de vidro mostrou-se eficaz no controle do crescimento de Bacillus stearothermophilus nas partes ativas dos alicates ortodônticos, a partir de 10 segundos de exposição à temperatura de 255ºC.AIM: The aim of this research was to evaluate the efficiency of Steri® 350glass bead sterilizer, on the infection control of the active part of the orthodontic pliers. METHODS: Nine orthodontic pliers were sterilized in the steam autoclave at 121ºC in 20 minutes and subsequently the active part of each plier was dipped in a culture for Bacillus stearothermophilus. Later, the active part of each plier was putted into the Steri® 350 in the following periods: 3, 5, 10, 15, 20, 30, and 40 seconds at 255ºC to evaluate the efficiency of this method in the infection control. RESULTS AND CONCLUSIONS: This sterilization method has been effective to control the presence of Bacillus stearothermophilus on the active part of orthodontic pliers at 255ºC in 10 seconds.
A strategy for molecular diagnostics of Fanconi anemia in Brazilian patients.
Pilonetto, Daniela V; Pereira, Noemi F; Bonfim, Carmem M S; Ribeiro, Lisandro L; Bitencourt, Marco A; Kerkhoven, Lianne; Floor, Karijn; Ameziane, Najim; Joenje, Hans; Gille, Johan J P; Pasquini, Ricardo
2017-07-01
Fanconi anemia (FA) is a predominantly autosomal recessive disease with wide genetic heterogeneity resulting from mutations in several DNA repair pathway genes. To date, 21 genetic subtypes have been identified. We aimed to identify the FA genetic subtypes in the Brazilian population and to develop a strategy for molecular diagnosis applicable to routine clinical use. We screened 255 patients from Hospital de Clínicas, Universidade Federal do Paraná for 11 common FA gene mutations. Further analysis by multiplex ligation-dependent probe amplification (MLPA) for FANCA and Sanger sequencing of all coding exons of FANCA , -C , and - G was performed in cases who harbored a single gene mutation. We identified biallelic mutations in 128/255 patients (50.2%): 89, 11, and 28 carried FANCA , FANCC , and FANCG mutations, respectively. Of these, 71 harbored homozygous mutations, whereas 57 had compound heterozygous mutations. In 4/57 heterozygous patients, both mutations were identified by the initial screening, in 51/57 additional analyses was required for classification, and in 2/57 the second mutation remained unidentified. We found 52 different mutations of which 22 were novel. The proposed method allowed genetic subtyping of 126/255 (49.4%) patients at a significantly reduced time and cost, which makes molecular diagnosis of FA Brazilian patients feasible.
Initial performance of clones of rubber, in Puerto Carreño, Vichada – Colombia.
Directory of Open Access Journals (Sweden)
Diego Fernando Vélez Sánchez
2013-12-01
Full Text Available This study aimed to evaluate performance in a large-scale clonal field of rubber clones (Hevea brasiliensis [Willd. ex Adr. de Juss.] Muell.-Arg. IAN 710, IAN 873, FX 3864, RRIM 600, RRIM 703, PB 314, PB 312, PB 235, PR 255, PR 303 e IRCA 41 at 12 and 36 months of planting. Clonal materials were established using a randomized complete block design with 4 replications of 100 trees per clone. It was evaluated the growth in height and diameter. Clones that showed better diameter growth at 12 and 36 months were FX 3864 (2.13cm and 3.5cm and IAN 710 (2.06cm and 3.63cm, those of smaller growth in diameter at 12 months were IAN 873 with 1.48 cm and PR255 with 1.47cm, while at 36 months was IAN 873 with 2.48cm. Respect to the total height IAN 710 (4.97m and 5.20m presented the best growth at 12 and 36 months, while PR 255 with 2.21m and PR 303 with 2.12cm the lowest growth in 12 months and in 36 months IAN 873 slower growth with 2.82m.
LET dependence of GafChromic films and an ion chamber in low-energy proton dosimetry
Energy Technology Data Exchange (ETDEWEB)
Kirby, Daniel; Parker, David [School of Physics and Astronomy, University of Birmingham, Birmingham, B15 2TT (United Kingdom); Green, Stuart; Hugtenburg, Richard; Wojnecki, Cecile [Department of Medical Physics, University Hospital Birmingham NHS Trust, Birmingham, B15 2TH (United Kingdom); Palmans, Hugo [National Physical Laboratory, Acoustics and Ionizing Radiation, Teddington (United Kingdom)], E-mail: djk191@bham.ac.uk
2010-01-21
Dosimetry using a PMMA phantom was performed in 15 and 29 MeV proton beams from the Birmingham cyclotron, with a Markus parallel-plate ionization chamber and GafChromic EBT and MD-V2-55 film. Simulations of the depth-dose curves were performed with FLUKA 2008.3 and MCNPX 2.5.0, which agreed almost perfectly with each other in range and only differed by 2% in the Bragg peak (BP) region. FLUKA was also used to calculate k{sub Q} factors for Markus chamber measurements as an improvement to the IAEA TRS-398 values in low-energy beams. FLUKA depth-dose simulations overestimate the BP height measured by ion chamber by about 10%, where the initial proton energy spread was estimated by fitting to the slope of the measured BP distal edge. Both GafChromic films showed an under-response in the BP compared to ion chamber; however, EBT exhibits this effect at lower energies than MD-V2-55. A possible reason for this is attributed to the shape and arrangement of the monomer particles being different in the active components of EBT and MD-V2-55. Relative effectiveness (RE) of both films is presented as functions of residual range R{sub res} in water and peak proton energy determined by FLUKA, with considerations for the spatial separation of the two active layers in each film. The proton energies at which RE reduces to 90% of maximum film response are 6.7 and 3.2 MeV for MD-V2-55 and EBT, respectively. Additionally, a beam quality correction factor (g{sub Q,Q{sub 0}}) is suggested for both GafChromic films, involving water-to-film stopping power ratios evaluated using ICRU recommendations, and a polymer yield factor G{sub Q{sub 0}}/G{sub Q}. RE in this work is equated to the reciprocal of the polymer yield factor. The calculated values of (s{sub w,film}){sub Q} /(s{sub w,film}){sub Q{sub 0}} are constant within 2.1% and 1.2% across the proton energy range of 1-300 MeV for EBT and MD-V2-55, respectively, so it is concluded that the polymer yield factor is the dominant factor
Obligations and Duplicate Payments on Air Force Maintenance Contract FA2550-96-C-0003
National Research Council Canada - National Science Library
2001-01-01
... on a $25.5 million, multiyear, maintenance contract. Accordingly, the contracting officials questioned the validity of providing two funding adjustments that were requested by the operating location. Objective...
2013-12-04
... company's reliance on section 2.55(a) to install an air stabilization unit was unwarranted because the... coolers, a transformer, field inlet separation facilities, and pigging equipment). [[Page 72796
Level structure of 68149Er81 and high-spin isomerism in proton-rich N=81, 82, 83 nuclei
International Nuclear Information System (INIS)
Broda, R.; Daly, P.J.; McNeill, J.; Janssens, R.V.F.; Radford, D.C.
1987-01-01
The level structure of the N=81 nucleus 149 Er has been studied by γ-ray spectroscopy following the reaction 92 Mo+255 MeV 60 Ni. Yrast levels in 149 Er are established up to ≅ 3.3 MeV, including 0.61 and 4.8 μs isometric states. Most of the observed levels are interpreted as seniority-three states arising from the coupling of s 1/2 , d 3/2 and h 11/2 neutron holes with πh n 11/2 . Isomers identified in the reaction 96 Ru+255 MeV 58 Ni are tentatively assigned to 151 Yb. The B(E2) values of high-spin isomers in Z=66-70, N=81-83 nuclei are surveyed. (orig.)
78 FR 72904 - Changes in Flood Hazard Determinations
2013-12-04
... lomc. Rothschild, Services Mayor, City of Division, 201 Tucson, 255 West North Stone Alameda, 10th... Prowers County http:// November 18, 2013......... 080272 areas of Prowers D. Marble, Land Use www...
2012-10-10
... or default. Authority for maintenance of the system: Section 255 of the National Housing Act of 1934... 24x7 security guards including electronic access and surveillance capabilities (CCTV and recorders...
2010-07-01
..., production, and sampling and analysis information. Effluent characteristics Effluent limitations BAT and NSPS...-Dinitrophenol 123 71 2,4-Dinitrotoluene 285 113 2,6-Dinitrotoluene 641 255 Ethylbenzene 108 32 Fluoranthene 68...
Full Text Available ... Veterans Health Administration 58,393 views 2:45 World War II Veterans Honored at Bay Pines Community Living Center - Duration: 2:55. ... Loading... Loading... About Press Copyright Creators ...
Energy Technology Data Exchange (ETDEWEB)
Talamo, Alberto; Gohar, Yousry, E-mail: alby@anl.gov [Argonne National Laboratory, Lemont, IL (United States); Dulla, Sandra; Ravetto, Piero [Politecnico di Torino (Italy)
2011-07-01
The importance of (n,xn) reactions must be taken into consideration while calculating the kinetic parameters of subcritical assemblies driven by an external neutron source. This study is divided into two parts, the first part is dedicated to the classic definition of the neutron source multiplication factor and two alternative calculation methodologies are compared. The second part considers a new definition of the kinetic parameters for subcritical assemblies, with particular emphasis on the delayed neutron fraction and generation time. This new definition has been modified to take into account the external neutron source and (n,xn) reactions, which increase the fraction of prompt neutrons. The developed theoretical framework has been applied by Monte Carlo and deterministic calculations to the YALINA Thermal subcritical assembly in Belarus. This facility can be driven by californium, deuterium-deuterium (D-D), or deuterium-tritium (D-T) external neutron sources. For the D-T neutron source, (n,xn) reactions must be taken into account in order to produce accurate results because the average energy of D-T source neutrons is 14.1 MeV, a value much higher than the threshold energy of the (n,2n) cross section of uranium isotopes. (author)
International Nuclear Information System (INIS)
Talamo, Alberto; Gohar, Yousry; Dulla, Sandra; Ravetto, Piero
2011-01-01
The importance of (n,xn) reactions must be taken into consideration while calculating the kinetic parameters of subcritical assemblies driven by an external neutron source. This study is divided into two parts, the first part is dedicated to the classic definition of the neutron source multiplication factor and two alternative calculation methodologies are compared. The second part considers a new definition of the kinetic parameters for subcritical assemblies, with particular emphasis on the delayed neutron fraction and generation time. This new definition has been modified to take into account the external neutron source and (n,xn) reactions, which increase the fraction of prompt neutrons. The developed theoretical framework has been applied by Monte Carlo and deterministic calculations to the YALINA Thermal subcritical assembly in Belarus. This facility can be driven by californium, deuterium-deuterium (D-D), or deuterium-tritium (D-T) external neutron sources. For the D-T neutron source, (n,xn) reactions must be taken into account in order to produce accurate results because the average energy of D-T source neutrons is 14.1 MeV, a value much higher than the threshold energy of the (n,2n) cross section of uranium isotopes. (author)
Directory of Open Access Journals (Sweden)
Yudakov Aleksandr A.
2015-01-01
Full Text Available The methods used to determine the gold content in the technogenic objects of gold mining were analyzed regarding their non-homogeneity and complexity of chemical and mineral compositions. A possible application of the neutron activation analysis with the use of the californium source of neutrons for determining the content of fine-grained and extra-fine-grained gold in the technogenic objects, including the bottom-ash waste of energy providers, is considered. It was demonstrated that the chemical composition of the sample affects the neuron flux distribution in the sample, which can essentially distort the results of the neutron activation analysis. In order to eliminate possible systematic errors investigations of the effect of the sample mineral composition on the results of the gold determination using the neutron activation analysis were carried out. Namely, a large mass of rock (3-5 kg was loaded into an activation zone using four matrix types such as silicate, carbon-containing, iron-containing, and titanium magnetite. It was shown that there wereno significant difference between the dispersal of the fluxes of thermal and resonance neutrons emitted from 252Cf during activation of the gold-containing technogenic samples with different mineral compositions.
A technique for combining neutron and gamma-ray data into a single assay value
International Nuclear Information System (INIS)
Pickrell, M.M.; Mercer, D.; Sharpe, T.J.
1998-01-01
The authors explored the potentials of using both neutron and gamma-ray measurements on a single item and combining these data into a single assay value. The purpose was to improve assay capability for sample matrices that are difficult to measure. They chose an empirical approach because they wanted to address difficult-to-measure items for which the assay problem is complex. They used the tomographic gamma scanner; a passive, high-efficiency neutron counter with add-a-source and multiplicity; and an active neutron, californium shuffler to obtain measurements. Twenty-four 200-L drums were measured with various matrices using all three machines. The matrices were chosen specifically to spain the difficult-to-measure assay problems for some or all of the instruments. For example, the authors measured a drum filled with concrete and another filled with metal. The data from these measurements were analyzed using the alternating conditional expectation algorithm, which is one of a class of generalized additive models. Other data fusion algorithms are also possible and are being explored. The intent was to find ways to combine the data that would reduce the matrix-induced measurement error
Activation analysis of stainless steel flux monitors using 252Cf neutron sources
International Nuclear Information System (INIS)
Williams, J.G.; Newton, T.H. Jr.; Cogburn, C.O.
1984-01-01
Activation analysis was performed on stainless steel beads from a chain which is used in reactor pressure vessel surveillance experiments at the Arkansas Power and Light Company reactors. The beads allow monitoring of two fast and three thermal neutron induced reactions: 58 Ni(n,p) 58 Co, 54 Fe(n,p) 54 Mn, 58 Fe(n,γ) 59 Fe, 59 Co(n,γ) 60 Co and 50 Cr(n,γ) 51 Cr. The analysis was performed using 12 beads from various positions along 5 different batches of chain and standard materials in an H 2 O moderator tank using two intense californium sources which had a total neutron emission rate of 3.97 x 10 10 /s. Semiconductor gamma spectrometers were used to count the products of the above reactions in the specimens. The percentage by weight of the iron, chromium and cobalt in the beads were found to be 62.1%, 20.2% and 0.120%, respectively. The excellent uniformity found in the bead compositions demonstrates the reproducibility of the experimental techniques and enhances considerably the value of the beads as neutron flux montitors
Interface detection by neutron scattering
International Nuclear Information System (INIS)
De Monchy, A.R.; Kok, C.A.; Dorrepaal, J.
1979-01-01
A method and apparatus for detecting an interface of materials having different hydrogen content present in a metal vessel or pipe eg. made of steel, are described. Steel walls of columns, reactors, pipelines etc can be monitored. It is very suitable for detection of liquid water or hydrocarbons present in gas pipelines and also for the detection of a liquid hydrocarbon in a vessel or column. A series of measurements of the hydrogen density of the contents of a vessel or pipe are made using at least one californium-252 neutron source located near the outer side of the pipe. Neutrons are emitted and are scattered by the contents of the pipe. At least one neutron detector is located near the outer side of the metal wall. The detectors have a higher sensitivity for scattered neutrons (from the light hydrogen nuclei present in water or hydrocarbons). A source of 0.1 - 1 micrograms produces enough neutrons for most technical applications so the handling is relatively safe although shielding is advocated. The detectors contain helium-3 at a pressure of about 10 bar. Current pulses from the detector are counted. (U.K.)
MinT: Middleware for Cooperative Interaction of Things.
Jeon, Soobin; Jung, Inbum
2017-06-20
This paper proposes an Internet of Things (IoT) middleware called Middleware for Cooperative Interaction of Things (MinT). MinT supports a fully distributed IoT environment in which IoT devices directly connect to peripheral devices easily construct a local or global network, and share their data in an energy efficient manner. MinT provides a sensor abstract layer, a system layer and an interaction layer. These enable integrated sensing device operations, efficient resource management, and active interconnection between peripheral IoT devices. In addition, MinT provides a high-level API to develop IoT devices easily for IoT device developers. We aim to enhance the energy efficiency and performance of IoT devices through the performance improvements offered by MinT resource management and request processing. The experimental results show that the average request rate increased by 25% compared to Californium, which is a middleware for efficient interaction in IoT environments with powerful performance, an average response time decrease of 90% when resource management was used, and power consumption decreased by up to 68%. Finally, the proposed platform can reduce the latency and power consumption of IoT devices.
Design of active-neutron fuel rod scanner
International Nuclear Information System (INIS)
Griffith, G.W.; Menlove, H.O.
1996-01-01
An active-neutron fuel rod scanner has been designed for the assay of fissile materials in mixed oxide fuel rods. A 252 Cf source is located at the center of the scanner very near the through hole for the fuel rods. Spontaneous fission neutrons from the californium are moderated and induce fissions within the passing fuel rod. The rod continues past a combined gamma-ray and neutron shield where delayed gamma rays above 1 MeV are detected. We used the Monte Carlo code MCNP to design the scanner and review optimum materials and geometries. An inhomogeneous beryllium, graphite, and polyethylene moderator has been designed that uses source neutrons much more efficiently than assay systems using polyethylene moderators. Layers of borated polyethylene and tungsten are used to shield the detectors. Large NaI(Tl) detectors were selected to measure the delayed gamma rays. The enrichment zones of a thermal reactor fuel pin could be measured to within 1% counting statistics for practical rod speeds. Applications of the rod scanner include accountability of fissile material for safeguards applications, quality control of the fissile content in a fuel rod, and the verification of reactivity potential for mixed oxide fuels. (orig.)
Sources of Radioactive Isotopes for Dirty Bombs
Lubenau, Joel
2004-05-01
From the security perspective, radioisotopes and radioactive sources are not created equal. Of the many radioisotopes used in industrial applications, medical treatments, and scientific research, only eight, when present in relatively large amounts in radioactive sources, pose high security risks primarily because of their prevalence and physical properties. These isotopes are americium-241, californium-252, cesium-137, cobalt-60, iridium-192, radium-226, plutonium-238, and strontium-90. Except for the naturally occurring radium-226, nuclear reactors produce the other seven in bulk commercial quantities. Half of these isotopes emit alpha radiation and would, thus, primarily pose internal threats to health; the others are mainly high-energy gamma emitters and would present both external and internal health hazards. Therefore, the response to a "dirty bomb" event depends on what type of radioisotope is chosen and how it is employed. While only a handful of major corporations produce the reactor-generated radioisotopes, they market these materials to thousands of smaller companies and users throughout the world. Improving the security of the high-risk radioactive sources will require, among other efforts, cooperation among source suppliers and regulatory agencies.
Seasonal variability of mercury contents in street dust in Brno, Czech Republic
Czech Academy of Sciences Publication Activity Database
Coufalík, Pavel; Zvěřina, O.; Mikuška, Pavel; Komárek, J.
2014-01-01
Roč. 93, č. 4 (2014), s. 503-508 ISSN 0007-4861 Institutional support: RVO:68081715 Keywords : mercury * accumulation * dust Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 1.255, year: 2014
Polyethylene glycol in water: A simple, efficient and green protocol ...
Indian Academy of Sciences (India)
Medicinal Chemistry Research Laboratory, School of Chemical Sciences, Solapur University,. Solapur 413 255, (MS) ... This inexpensive, non-toxic, eco- friendly and readily ..... HVC thanks Council of Scientific and Industrial. Research (CSIR) ...
The Effects of Subthreshold Priming Alerts on Pilots in the USAARL TH-67 Microsim
2009-06-01
subthreshold priming, subliminal messaging, cockpit displays UNCLAS UNCLAS UNCLAS SAR 46 Loraine Parish St. Onge, PhD 334-255-6906 Reset...4 Communication scanner display...5 3. Simulated communication scanner display and
Czech Academy of Sciences Publication Activity Database
Skobelev, N. K.; Penionzhkevich, Y. E.; Kulko, A. A.; Demekhina, N. A.; Kroha, Václav; Kugler, Andrej; Lukyanov, S.; Mrázek, Jaromír; Sobolev, Yu. G.; Maslov, V. A.; Muzychka, Yu. A.; Voskoboynik, E. I.; Fomichev, A. S.
2013-01-01
Roč. 10, č. 3 (2013), s. 248-255 ISSN 1547-4771 Institutional support: RVO:61389005 Keywords : nuclear reactions * gamma activity * cross section Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders
Arno Rafael Cederberg ja Eesti ajalooteadus / Hans Kruus
Kruus, Hans, 1891-1976
2005-01-01
Soome ajalooprofessorist Arno Rafael Cederbergist (1885-1948). Tartu Ülikoolis töötades oli tema peamine õppe-ja uurimisaine Eesti ja Põhjamaade ajalugu. Ilm.: Eesti Kirjandus, 1935, nr. 6., lk. 254-255
Digital Repository Service at National Institute of Oceanography (India)
Nakamoto, S.; Kano, M.; PrasannaKumar, S.; Oberhuber, J.M.; Muneyama, K.; Ueyoshi, K.; Subrahmanyam, B.; Nakata, K.; Lai, C.A.; Frouin, R.
29208, USA 'Ocean Engineering Department, Tokai University, Shimizu, Japan "LOS Alamos National Laboratory, Los Alamos, NM, USA *Corresponding author. E-mail address: nakamotoocean@aol.com (S. Nakamoto?. Elsevier Oceanography Series 73 255 Edited...
NCBI nr-aa BLAST: CBRC-DRER-07-0095 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-07-0095 ref|ZP_00539949.1| Acyltransferase 3 [Exiguobacterium sibiricum 2...55-15] gb|EAM86904.1| Acyltransferase 3 [Exiguobacterium sibiricum 255-15] ZP_00539949.1 0.11 27% ...
Search Results | Page 911 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 9101 - 9110 of 9601 ... ... Apply RESEARCH NETWORKS filter · Evaluation (255) Apply ... Filter by project status ... Selective review of foreign direct investment theories ... Effects of environmental regulations on South Asian food and ...
Directory of Open Access Journals (Sweden)
Dara L. Wegman-Geedey
2014-08-01
Full Text Available Review of: Forgotten People, Forgotten Diseases: The Neglected Tropical Diseases and their Impact on Global Health and Development, 2nd Edition; Peter J. Hotez; (2013. ASM Press, Washington, DC. 255 pages.
Processus iudiciarius secundum stilum Pragensem Mikuláše Puchníka
Czech Academy of Sciences Publication Activity Database
Budský, Dominik
2009-01-01
Roč. 39, - (2009), s. 255-277 ISSN 0585-5691 Institutional research plan: CEZ:AV0Z90560517 Keywords : codicology * canon law * manuscripts * Puchnik, Nicolaus * procedural law Subject RIV: AJ - Letters, Mass-media, Audiovision
Nutrition-related cancer prevention knowledge of undergraduate ...
African Journals Online (AJOL)
Oluyemisi Folake Folasire
A food frequency questionnaire was used to evaluate the dietary pattern. Weight, height, waist and hip ... abdominal obesity while 25.5% had high risk of abdominal obesity. Nutrition ..... significant association between nutrition knowledge on.
The Office of the Secretary of the Air Force 1947-1965
1993-01-01
245 xvi A ppendices ....................................................................................................... 255 1. Air...timed and did not endear the Air Force to McNamara and the President, both of whom had been acutely embarrassed. 69 Project Forecast One idea of
2011-11-25
.... \\4\\ Cement Kiln Recycling Coalition v. EPA, 255 F.3d 855 (DC Cir. 2001) (per curiam). \\5\\ National... insulation and bonded heavy- density products.'' The MACT rule for the Wool Fiberglass Manufacturing source...
Cakar, N; Tuŏrul, M; Demirarslan, A; Nahum, A; Adams, A; Akýncý, O; Esen, F; Telci, L
2001-04-01
To determine the time required for the partial pressure of arterial oxygen (PaO2) to reach equilibrium after a 0.20 increment or decrement in fractional inspired oxygen concentration (FIO2) during mechanical ventilation. A multi-disciplinary ICU in a university hospital. Twenty-five adult, non-COPD patients with stable blood gas values (PaO2/FIO2 > or = 180 on the day of the study) on pressure-controlled ventilation (PCV). Following a baseline PaO2 (PaO2b) measurement at FIO2 = 0.35, the FIO2 was increased to 0.55 for 30 min and then decreased to 0.35 without any other change in ventilatory parameters. Sequential blood gas measurements were performed at 3, 5, 7, 9, 11, 15, 20, 25 and 30 min in both periods. The PaO2 values measured at the 30th min after a step change in FIO2 (FIO2 = 0.55, PaO2[55] and FIO2 = 0.35, PaO2[35]) were accepted as representative of the equilibrium values for PaO2. Each patient's rise and fall in PaO2 over time, PaO2(t), were fitted to the following respective exponential equations: PaO2b + (PaO2[55]-PaO2b)(1-e-kt) and PaO2[55] + (PaO2[35]-PaO2[55])(e-kt) where "t" refers to time, PaO2[55] and PaO2[35] are the final PaO2 values obtained at a new FIO2 of 0.55 and 0.35, after a 0.20 increment and decrement in FIO2, respectively. Time constant "k" was determined by a non-linear fitting curve and 90% oxygenation times were defined as the time required to reach 90% of the final equilibrated PaO2 calculated by using the non-linear fitting curves. Time constant values for the rise and fall periods were 1.01 +/- 0.71 min-1, 0.69 +/- 0.42 min-1, respectively, and 90% oxygenation times for rises and falls in PaO2 periods were 4.2 +/- 4.1 min-1 and 5.5 +/- 4.8 min-1, respectively. There was no significant difference between the rise and fall periods for the two parameters (p > 0.05). We conclude that in stable patients ventilated with PCV, after a step change in FIO2 of 0.20, 5-10 min will be adequate for obtaining a blood gas sample to measure a Pa
A heavy ion linac complex for RI beams
International Nuclear Information System (INIS)
Arai, Shigeaki
1995-01-01
A heavy ion linac complex for RI-beams has been under construction since fiscal year 1992 at INS. The linac complex comprises following accelerating structures: a 25.5-MHz split coaxial RFQ (SCRFQ), a 51-MHz interdigital-H (IH) linac, and a 25.5-MHz rebuncher cavity. The SCRFQ with modulated vanes accelerates ions with a charge-to-mass ratio (q/A) greater than 1/30 from 2 to 170 keV/u. The IH linac comprises four cavities and three magnetic quadrupole triplets placed between cavities, accelerates ions with q/A≥1/10, and varies the output energy continuously in the range 0.17 ∼1.05 MeV/u. The rebuncher cavity with six accelerating gaps is a double coaxial λ/4 resonator, and the total accelerating voltage is 200 kV. (author)
DEFF Research Database (Denmark)
Bonde, J P; Hjollund, N H; Jensen, T K
1998-01-01
This paper presents design and methods of a follow-up study of fecundability (defined as the probability of conception during one menstrual cycle) in first-pregnancy planners. We recruited 430 couples by postal letter among 52,255 members of four trade unions. Couples without earlier reproductive......-18%). Among all conceptions the proportion of early embryonal loss was 17% (95% CI 12-22%). This study demonstrates the feasibility of a prospective study of fertility and that the established study base can provide useful information on environmental risk to subfertility.......This paper presents design and methods of a follow-up study of fecundability (defined as the probability of conception during one menstrual cycle) in first-pregnancy planners. We recruited 430 couples by postal letter among 52,255 members of four trade unions. Couples without earlier reproductive...
Parametric Analyses of Dynamic Characteristic of the Cable-Stayed Pedestrian Bridge
Directory of Open Access Journals (Sweden)
Pańtak Marek
2017-12-01
Full Text Available The paper presents characteristics of the structural system and results of dynamic field tests and numerical parametric analyses of three-span, two-pylon, cable-stayed pedestrian bridge with steel-concrete composite deck and spans of 25.5 + 60.0 + 25.5 m. The footbridge is characterized by increased dynamic susceptibility of the elements of the suspension system observed during the everyday operation of the structure. The analyses have shown that the high amplitude vibrations of the pylon back-stay cables change the parameters of the structural system and consequently change the value of the natural vibration frequencies of the structure. In the paper, the selection methodology of parameters of the computational model which allows to correctly determine the natural vibration frequencies of the footbridge has been presented.
Development of a universal stress sensor for graphene and carbon fibres
Czech Academy of Sciences Publication Activity Database
Frank, Otakar; Tsoukleri, G.; Riaz, I.; Papagelis, K.; Parthenios, J.; Ferrari, A.; Geim, A.K.; Novoselov, K. S.; Galiotis, C.
2011-01-01
Roč. 2, č. 1 (2011), s. 255 ISSN 2041-1723 Institutional research plan: CEZ:AV0Z40400503 Keywords : carbon fiber * graphene * Raman spectrometry Subject RIV: CG - Electrochemistry Impact factor: 7.396, year: 2011
African Journals Online (AJOL)
Dr. K.J. Umar
Nigerian Journal of Basic and Applied Science (June, 2015), 23(1): 51-54 ... Neurological examination was performed and computed tomography scan of the brain done. Blood samples were ..... Pediatric Neurology, 23: 252-255. Mochan, A.
The Enigmatic Nature of the Israeli Legal System
African Journals Online (AJOL)
NWUuser
The picture that emerges from the jurisprudence of the South African courts is that ..... See Garreth Anver Prince v South Africa Communication 255/02 (African Commission ...... Modern Ghana News 2010 Ghana, Nigeria to Exchange Prisoners.
Czech Academy of Sciences Publication Activity Database
Lhotský, O.; Krákorová, Eva; Mašín, P.; Žebrák, R.; Linhartová, Lucie; Křesinová, Zdena; Kašlík, J.; Steinová, J.; Rodsand, T.; Filipová, Alena; Petrů, K.; Kroupová, K.; Cajthaml, Tomáš
2017-01-01
Roč. 120, SEP 1 2017 (2017), s. 245-255 ISSN 0043-1354 Institutional support: RVO:61388971 Keywords : Pharmaceuticals * BTEX * Chlorobenzene Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 6.942, year: 2016
Czech Academy of Sciences Publication Activity Database
Lanés, L. E. K.; Reichard, Martin; De Moura, R. G.; Godoy, R. S.; Maltchik, L.
2018-01-01
Roč. 101, č. 6 (2018), s. 963-977 ISSN 0378-1909 Institutional support: RVO:68081766 Keywords : Austrolebias * Cynopoecilus * killifish * temporary water s * pampas Subject RIV: EH - Ecology, Behaviour Impact factor: 1.255, year: 2016
Lifescience Database Archive (English)
Full Text Available net A 118A:255-9 (2003) DOI:10.1002/ajmg.a.20021 ... PMID:17009331 (gene) ... AUTHORS ...letal organization. ... JOURNAL ... Cell Motil Cytoskeleton 64:49-63 (2007) DOI:10.1002/cm.20167
O použití Einsteinových rovnic v kosmologii
Czech Academy of Sciences Publication Activity Database
Křížek, Michal
2015-01-01
Roč. 60, č. 3 (2015), s. 255-272 ISSN 0032-2423 Institutional support: RVO:67985840 Keywords : dark matter * dark energy * Friedmann equation Subject RIV: BA - General Mathematics http://hdl.handle.net/10338.dmlcz/144419
Chromosomal variation in social voles: a Robertsonian fusion in Günther‘s vole
Czech Academy of Sciences Publication Activity Database
Zima, Jan; Arslan, A.; Benda, P.; Macholán, Miloš; Kryštufek, B.
2013-01-01
Roč. 58, č. 3 (2013), s. 255-265 ISSN 0001-7051 Institutional support: RVO:68081766 ; RVO:67985904 Keywords : karyotypes * systematics * C-banding * NOR distribution Subject RIV: EG - Zoology Impact factor: 1.161, year: 2013
A Comprehensive LC/MS Analysis of Novel Cyclopentenedione Library.
Czech Academy of Sciences Publication Activity Database
Papoušková, B.; Bernard, Martin; Ottenschlager, Jakub; Karban, Jindřich; Velíšek, Petr; Hrbáč, J.; Sýkora, Jan; Storch, Jan; Vacek, J.
2016-01-01
Roč. 128, SEP 5 (2016), s. 342-351 ISSN 0731-7085 Institutional support: RVO:67985858 Keywords : bioactive cyclopentenediones * liquid chromatography * mass spectrometry Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.255, year: 2016
Czech Academy of Sciences Publication Activity Database
Mossety-Leszczak, B.; Strachota, Beata; Strachota, Adam; Steinhart, Miloš; Šlouf, Miroslav
2015-01-01
Roč. 72, November (2015), s. 238-255 ISSN 0014-3057 Institutional support: RVO:61389013 Keywords : liquid-crystalline epoxy resins * magnetic field orientation * nanocomposites Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.485, year: 2015
The effect of polyacrylamide (PAM) applications on infiltration, runoff ...
African Journals Online (AJOL)
user
2011-04-11
Apr 11, 2011 ... reduced surface runoff and soil losses, but increased infiltration rates. The effectiveness of ... Soil and water conservation is essential for sustaining food production and ...... Earth Surface Processes, 4:241-255. McIntyre DS ...
2010-05-10
... MNKD MannKind Corp... 255 TM Toyota Motor Corp. 171 MDVN Medivation Inc.. 257 HK Petrohawk Energy Corp... Kinross Gold Corp. 213 MRVL Marvell 273 EP El Paso Corp. Technology Group Ltd. 215 XLP Consumer Staples...
2010-05-11
... MannKind Corp. 255 TM Toyota Motor Corp. 171 MDVN Medivation Inc. 257 HK Petrohawk Energy Corp. 176... Gold Corp. 213 MRVL Marvell Technology 273 EP El Paso Corp. Group Ltd. 215 XLP Consumer Staples 274...
44 perceptions and involvement of neighbouring communities of ...
African Journals Online (AJOL)
TOWARDS THE PARKS CONSERVATION PROGRAMMES. 45 illegal activities in ..... 827. 25.5. Farm Implements. 549. 158. 707. 21.6. Market. 288. 132. 420. 12.8. Cottage Industry. 307 ..... Koedam, N (2001): Restoration and management of ...
Zvířecí skelet z laténského objektu v Nových Dvorech, okr. Kutná Hora
Czech Academy of Sciences Publication Activity Database
Kyselý, René
2011-01-01
Roč. 63, č. 2 (2011), s. 253-255 ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : ritual * La Tène period * osteology * Bos taurus * cattle Subject RIV: AC - Archeology, Anthropology, Ethnology
Experimental Investigation of a Lift Augmented Ground Effect Platform
National Research Council Canada - National Science Library
Igue, Roberto T
2005-01-01
.... A 0.255 m diameter prototype was designed, built and tested. An air bearing table was used as a testing platform, virtually eliminating the influence of friction and providing one degree of freedom for the experiments...
Czech Academy of Sciences Publication Activity Database
Žemlička, R.; Jílek, M.; Vogl, P.; Souček, P.; Buršíková, V.; Buršík, Jiří; Vašina, P.
2014-01-01
Roč. 255, 25 September (2014), s. 118-123 ISSN 0257-8972 Institutional support: RVO:68081723 Keywords : nanocomposite * magnetron sputtering * process control Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.998, year: 2014
National Research Council Canada - National Science Library
Lin, Liwei
2004-01-01
... of 0.2 1/hr without requiring electrical power. A low-leakage, hole-in-the-wall micro valve was demonstrated that provided fluidic resistance 255 times higher in the closed state than in the open state...
Chlorine: Is it really so bad and what are the alternatives?
African Journals Online (AJOL)
driniev
bromine can be lost in side reactions with any organic matter present in the .... Nature 354, 255. ANDREWS ... CHRISTMAN K (2004) Report to the Chlorine Chemistry Council. ... (1992) Full-litter Resorptions Caused by Low-molecular wieght.
Philipp Weselsky - profesor chemie vídeňské techniky z Českomoravské vysočiny
Czech Academy of Sciences Publication Activity Database
Jindra, Jiří
2010-01-01
Roč. 43, č. 4 (2010), s. 255-259 ISSN 0300-4414 Institutional research plan: CEZ:AV0Z80630520 Keywords : Vienna Technical university 1854-1884 * tuition of analytical chemistry * Philipp Weselsky Subject RIV: AB - History
Philipp Weselsky - profesor vídeňské techniky z Českomoravské vysočiny
Czech Academy of Sciences Publication Activity Database
Jindra, Jiří
2010-01-01
Roč. 43, č. 4 (2010), s. 255-263 ISSN 0300-4414 Institutional research plan: CEZ:AV0Z80630520 Keywords : Vienna Technical University 1854-1884 * tuition of analytical chemistry * synthetic dyes Subject RIV: AB - History
African Journals Online (AJOL)
2016-06-05
Jun 5, 2016 ... questionnaires were distributed; the 255 questionnaires were evaluated by ... Since Enriching is at the service of a specific purpose and is a ..... making functional teams and providing exchange views and denial in order to.
Czech Academy of Sciences Publication Activity Database
Reissigová, Jindra; Tomečková, Marie
2003-01-01
Roč. 45, - (2003), s. 249-255 ISSN 0010-8650 R&D Projects: GA MŠk LN00B107 Keywords : primary prevention study * longitudinal study * risk factors * atherosclerosis * mortality * cardiovascular disease Subject RIV: BA - General Mathematics
Synthesis of Diphenylamine Catalyzed by Zeolites
Czech Academy of Sciences Publication Activity Database
Hronec, M.; Cvengrošová, Z.; Čejka, Jiří
2003-01-01
Roč. 255, - (2003), s. 197-202 ISSN 0926-860X Institutional research plan: CEZ:AV0Z4040901 Keywords : zeolites beta * bentonite * Bronsted site Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.825, year: 2003
2010-05-11
... AMED Amedisys Inc. 255 TM Toyota Motor Corp. 257 HK Petrohawk Energy Corp. 258 ENER Energy Conversion... Kinross Gold Corp. 273 EP El Paso Corp. 274 SEED Origin Agritech Ltd. 275 WIN Windstream Corp. 279 DHI DR...
Czech Academy of Sciences Publication Activity Database
Nováková, Z.; Bobálová, Janette; Vidová, M.; Hapala, I.; Šmigáň, P.
2009-01-01
Roč. 298, č. 2 (2009), s. 255-259 ISSN 0378-1097 Institutional research plan: CEZ:AV0Z40310501 Keywords : methanoarchaea * bioenergetics * tributyltin resistance Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.199, year: 2009
Original Research Prevalence and distribution of Schistosoma ...
African Journals Online (AJOL)
control. As prevalence falls, diagnostics can identify high transmission areas, monitor disease trends, and guide evidence-based control strategies. Introduction ..... Fever. 255. 0.50. Abdominal pain. 295. 0.015. Blurred vision. 26. 0.44. Blood in ...
Global Journal of Pure and Applied Sciences - Vol 17, No 3 (2011)
African Journals Online (AJOL)
BE Job, E Ekpenyong, NU Bassey, 255-260 ... A comparative study of direct and indirect solar drying of mango · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT ... Physico-chemical properties, energy, mineral, vitamin and sensory ...
African Journals Online (AJOL)
Items 101 - 150 of 255 ... Vol 8, No 1 (2016), Feedback as a means to improve clinical competencies: ... Impact of a quality improvement project to strengthen infection prevention and control training at rural healthcare facilities, Abstract PDF.
Seismic communication in demon African mole rat Tachyoryctes daemon from Tanzania
Czech Academy of Sciences Publication Activity Database
Hrouzková, E.; Dvořáková, V.; Jedlička, Petr; Šumbera, R.
2013-01-01
Roč. 31, č. 3 (2013), s. 255-259 ISSN 0289-0771 Institutional support: RVO:67985530 Keywords : seismic communication * substrate-borne vibration * subterranean mammal Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 0.790, year: 2013
Food items and general condition of Hyperopisus bebe occidentalis ...
African Journals Online (AJOL)
GREG
2017-07-20
Jul 20, 2017 ... Key words: Food items, Hyperopisus bebe occidentalis, Warri River, condition factor. ... Sufficient food intake aids optimal growth in fish, resulting ... It covers a surface area of 255 km2 with ... examination was carried out.
International Nuclear Information System (INIS)
Todd, P.; Feola, J.M.
1986-01-01
Metabolically deoxygenated suspensions of human T-1 cells were used to determine the RBE in hypoxia of low dose rate (LDR) Cf-252 radiation compared to LDR gamma radiation. Based upon the initial portion of the survival curves the RBE was 5.0 ± 1.0 for all components of the Cf-252 radiation and 7.1 ± 1.7 for the neutrons alone. An inverse dose rate effect was observed for LDR gamma radiation in which greater cell sensitivity was observed at lower dose rates and longer irradiation periods. It was demonstrated that there was little or no sublethal damage repair or cell progression during LDR at 21 deg C, and the observed decrease in cell survival probability with increasing irradiation time at a given dose was attributable to reoxygenation of the cell suspensions during the course of LDR exposures. (Auth.)
An audit of the insulin-tolerance test in 255 patients with pituitary disease
DEFF Research Database (Denmark)
Lange, Martin; Svendsen, Ole L; Skakkebaek, Niels E
2002-01-01
The insulin-tolerance test (ITT) is currently considered to be the gold standard for evaluating adults suspected of GH deficiency (GHD). The aim of this study was to determine factors that may influence nadir blood glucose (BG) when using a mean insulin dose of 0.1 IU/kg body weight. Furthermore...
International Nuclear Information System (INIS)
1983-11-01
This report documents the review completed under the SEP for those issues that required refined engineering evaluations or the continuation of ongoing evaluations after the Final IPSAR for the Palisades Plant was issued. The review has provided for (1) an assessment of the significance of differences between current technical positions on selected safety issues and those that existed when the Palisades Plant was licensed, (2) a basis for deciding on how these differences should be resolved in an integrated plant review, and (3) a documented evaluation of plant safety when the supplement to the Final IPSAR and the Safety Evaluation Report for converting the license from a provisional to a full-term license have been issued. The Final IPSAR and its supplement will form part of the bases for considering the conversion of the provisional operating license to a full-term operating license
Guo, Yu-qing; Han, Xin-min; Zhu, Xian-kang; Zhou, Zheng; Ma, Bing-xiang; Zhang, Bao-qing; Li, Yan-ning; Feng, Yu-lin; Xue, Zheng; Wang, Yong-hong; Li, Yi-min; Jiang, Zhi-mei; Xu, Jin-xing; Yue, Wei-zhen; Xiang, Xi-xiong
2015-12-01
To evaluate the application effect of Chinese medical clinical pathway for treating attention-deficit hyperactivity disorder (ADHD), and to provide evidence for further improving clinical pathways. Totally 270 ADHD children patients were recruited and treated at pediatrics clinics of 9 cooperative hospitals from December 2011 to December 2012. The treatment course for all was 3 months. Scores of attention deficit and hyperactivity rating scale, scores of behavior, Conners index of hyperactivity (CIH), and Chinese medical syndrome scores were compared between before and after treatment. The efficacy difference in various sexes, ages, and disease courses were evaluated by judging standards for Chinese medical syndrome and ADHD. Fifteen children patients who entered clinical pathway dropped out, and the rest 255 completed this trial. Compared with before treatment, total scores of attention deficit and hyperactivity rating scale, scores of attention deficit and hyperactivity rating scale, CIH, and Chinese medical syndrome scores obviously decreased (all P < 0.01). The total effective rate in disease efficacy was 87.8% (224/255 cases), and the total effective rate in Chinese medical syndrome curative effect was 87.5% (223/255 cases). The clinical curative effect was not influenced by age, gender, or course of disease when statistically analyzed from judging standards for Chinese medical syndrome or for disease efficacy. Intervention by Chinese medical clinical pathway could improve ADHD patients' symptoms, and its efficacy was not influenced by sex, age, or course of disease.
Directory of Open Access Journals (Sweden)
Yudong Zhang
2015-03-01
Full Text Available Background: Developing an accurate computer-aided diagnosis (CAD system of MR brain images is essential for medical interpretation and analysis. In this study, we propose a novel automatic CAD system to distinguish abnormal brains from normal brains in MRI scanning. Methods: The proposed method simplifies the task to a binary classification problem. We used discrete wavelet packet transform (DWPT to extract wavelet packet coefficients from MR brain images. Next, Shannon entropy (SE and Tsallis entropy (TE were harnessed to obtain entropy features from DWPT coefficients. Finally, generalized eigenvalue proximate support vector machine (GEPSVM, and GEPSVM with radial basis function (RBF kernel, were employed as classifier. We tested the four proposed diagnosis methods (DWPT + SE + GEPSVM, DWPT + TE + GEPSVM, DWPT + SE + GEPSVM + RBF, and DWPT + TE + GEPSVM + RBF on three benchmark datasets of Dataset-66, Dataset-160, and Dataset-255. Results: The 10 repetition of K-fold stratified cross validation results showed the proposed DWPT + TE + GEPSVM + RBF method excelled not only other three proposed classifiers but also existing state-of-the-art methods in terms of classification accuracy. In addition, the DWPT + TE + GEPSVM + RBF method achieved accuracy of 100%, 100%, and 99.53% on Dataset-66, Dataset-160, and Dataset-255, respectively. For Dataset-255, the offline learning cost 8.4430s and online prediction cost merely 0.1059s. Conclusions: We have proved the effectiveness of the proposed method, which achieved nearly 100% accuracy over three benchmark datasets.
Prevalence of antenatal depressive symptoms and associated ...
African Journals Online (AJOL)
... it is important to carry out different studies that explore the magnitude of the ... cross sectional study was conducted among 196 pregnant women from April to June 2015. ... Unwanted pregnancy was reported by 25.5% of the participants.
ORF Alignment: NC_003366 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003366 gi|18309739 >1v7zA 1 255 3 250 3e-61 ... dbj|BAB80463.1| creatinase [Clostr...idium perfringens str. 13] ref|NP_561673.1| ... creatinase [Clostridium perfringens str. 13] ...
... Parents Have Safe, Stable, Nurturing Relationships [PDF 255KB] Essentials for Childhood Connecting the Dots: An Overview of the Links Among Multiple Forms of Violence [PDF 2.51MB] Economic Cost of Child Abuse Adverse Childhood Experiences (ACE) ...
2010-05-11
... SYMC Symantec Corp. 162 TIVO TiVo Inc 253 AMED Amedisys Inc. 163 MNKD MannKind Corp 255 TM Toyota Motor... Marvell Technology Group 273 EP El Paso Corp. Ltd. 215 XLP Consumer Staples Select 274 SEED Origin...
2010-05-10
... Symantec Corp. 162 TIVO TiVo Inc 253 AMED Amedisys Inc. 163 MNKD MannKind Corp 255 TM Toyota Motor Corp... Marvell Technology Group 273 EP El Paso Corp. Ltd. 215 XLP Consumer Staples Select 274 SEED Origin...
Susceptibility of Some Bacterial Contaminants Recovered from ...
African Journals Online (AJOL)
Tropical Journal of Pharmaceutical Research February 2014; 13 (2): 255-259. ISSN: 1596-5996 (print); .... buffer pH 7. ... of each container are also given in Table 1. .... This investigation was performed to find out .... Microbiological quality of.
ORF Alignment: NC_004307 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004307 gi|23464642 >1v7zA 5 255 7 250 1e-55 ... ref|NP_695245.1| creatinine amidohydrolase; creatin...inase [Bifidobacterium longum ... NCC2705] gb|AAN23881.1| creatinine amidohydrolase; ... creatin
Miconazole/Clotrimazole and Pregnancy
... the diagnosis. If you have another kind of vaginal infection, it may need different treatment. Do medications applied ... e1-14. Soong D and Einarson A. 2009. Vaginal yeast infections during pregnancy. Can Fam Physician. 55(3):255- ...
Opavané jako vychovatelé šlechty z českých zemí na prahu novověku (1550-1620)
Czech Academy of Sciences Publication Activity Database
Holý, Martin
2009-01-01
Roč. 107, č. 4 (2009), s. 241-255 ISSN 0037-6833 R&D Projects: GA AV ČR KJB800150801 Institutional research plan: CEZ:AV0Z80150510 Keywords : nobility * preceptors * private education Subject RIV: AB - History
Czech Academy of Sciences Publication Activity Database
Moravec, Ivo; Cudlín, Pavel; Polák, T.; Havlíček, František
2002-01-01
Roč. 8, - (2002), s. 255-264 ISSN 1211-7420 R&D Projects: GA MŠk OK 389 Institutional research plan: CEZ:AV0Z6087904 Keywords : bark beetle infestation * crown status * Picea abies Subject RIV: GK - Forestry
Covalent cross-linking of insulin-like growth factor-1 to a specific inhibitor from human serum
International Nuclear Information System (INIS)
Ooi, G.T.; Herington, A.C.
1986-01-01
Previous studies have shown that a specific inhibitor of insulin-like growth factor (IGF) action in vitro can be isolated from normal human serum and subsequently partially purified on an IGF-affinity column. The ability of the inhibitor to bind the IGFs has now been confirmed directly using covalent cross-linking techniques. When 125 I-IGF-1 was cross-linked to inhibitor using disuccinimidyl suberate, five specifically labelled bands were seen on SDS-PAGE and autoradiography. Two bands (MW 21.5 K and 25.5 K) were intensely labelled, while the remaining three (MW 37 K, 34 K and 18 K) appeared as minor bands only. Inhibitor bioactivity, following further analysis by hydrophobic interaction chromatography or Con A-Sepharose affinity chromatography, was always associated with the presence of the 21.5 K and/or 25.5 K bands
2010-05-11
... Symantec Corp. 162 TIVO TiVo Inc. 253 AMED Amedisys Inc. 163 MNKD MannKind Corp. 255 TM Toyota Motor Corp... 273 EP El Paso Corp. Group Ltd. 215 XLP Consumer Staples 274 SEED Origin Agritech Select Sector SPDR...
Czech Academy of Sciences Publication Activity Database
Velková, Alice
15 2010, č. 3 (2010), s. 255-270 ISSN 1081-602X Institutional research plan: CEZ:AV0Z80150510 Keywords : Widowhood * Remarriage * 19th century Bohemia * Rural family Subject RIV: AB - History Impact factor: 0.595, year: 2010
Advantages of breath testing for the early diagnosis of lung cancer
Czech Academy of Sciences Publication Activity Database
Smith, D.; Španěl, Patrik; Sule-Suso, J.
2010-01-01
Roč. 10, č. 3 (2010), s. 255-257 ISSN 1473-7159 Institutional research plan: CEZ:AV0Z40400503 Keywords : mass spectrometry * breath analysis * lung cancer Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.652, year: 2010
Hematopoiesis in 5-Fluorouracil-Treated Adenosine A(3) Receptor Knock-Out Mice
Czech Academy of Sciences Publication Activity Database
Hofer, Michal; Pospíšil, Milan; Dušek, L.; Hoferová, Zuzana; Komůrková, Denisa
2015-01-01
Roč. 64, č. 2 (2015), s. 255-262 ISSN 0862-8408 Institutional support: RVO:68081707 Keywords : Adenosine A(3) receptor knock-out mice * Hematopoiesis * 5-fluorouracil-induced hematotoxicity Subject RIV: BO - Biophysics Impact factor: 1.643, year: 2015
Czech Academy of Sciences Publication Activity Database
Houk, Václav; Klee, R.
2007-01-01
Roč. 7, č. 2 (2007), s. 85-255 ISSN 1802-5439 R&D Projects: GA ČR GA205/05/0204 Institutional research plan: CEZ:AV0Z60050516 Keywords : centric diatoms * recent, * fossil Subject RIV: EF - Botanics
Optical study of BST films combining ellipsometry and reflectivity
Czech Academy of Sciences Publication Activity Database
Železný, Vladimír; Chvostová, Dagmar; Pajasová, Libuše; Jelínek, Miroslav; Kocourek, Tomáš; Daniš, S.; Valvoda, V.
2009-01-01
Roč. 255, č. 10 (2009), s. 5280-5283 ISSN 0169-4332 Institutional research plan: CEZ:AV0Z10100520 Keywords : BST thin films * optical properties Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.616, year: 2009
Pediatric Palliative Care: A Personal Story
Full Text Available ... views 4:24 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 64,345 views 5: ... Health - Meriter 255,416 views 13:34 Childhood Cancer: Palliative Care - Duration: 3:29. American Cancer Society ...
Czech Academy of Sciences Publication Activity Database
Gammino, S.; Torrisi, L.; Ciavola, G.; Andó, L.; Celona, L.; Manciagli, S.; Krása, Josef; Láska, Leoš; Pfeifer, Miroslav; Rohlena, Karel; Mazzasalma, A. M.; Gentile, C.; Picciotto, A.; Wolowski, J.; Woryna, E.; Badziak, J.; Parys, P.; Hitz, D.; Shirkov, G. D.
2004-01-01
Roč. 96, č. 5 (2004), s. 2961-2967 ISSN 0021-8979 Institutional research plan: CEZ:AV0Z1010921 Keywords : laser ion sources * ECR ion sources Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.255, year: 2004
Automatická kontrola barevných značek automobilových pružin
Czech Academy of Sciences Publication Activity Database
Čepl, J.; Ivanov, Georgi; Kratochvíl, Aleš; Hiklová, Helena; Hrabovský, Miroslav
2009-01-01
Roč. 54, č. 9 (2009), 255-258 ISSN 0447-6441 R&D Projects: GA MŠk(CZ) 1M06002 Institutional research plan: CEZ:AV0Z10100522 Keywords : colour marks * automobile spring Subject RIV: BH - Optics, Masers, Lasers
Indian Academy of Sciences (India)
Approximation methods. Sensitivity based reduced approaches for structural reliability analysis ... Classification and recognition of handwritten digits by using mathematical morphology. 419. Bolt. Relaxation .... A study on soil–structure interaction analysis in canyon-shaped topographies. 255. Elasto-plastic element free ...
ORF Alignment: NC_004557 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004557 gi|28211518 >1v7zA 1 255 3 250 2e-62 ... ref|NP_782462.1| creatininase [Clo...stridium tetani E88] gb|AAO36399.1| creatininase ... [Clostridium tetani E88] ... Length = 248
Indian Academy of Sciences (India)
chloro 3-nitrobenzoic acid -- V S S Sastry and J Ramakrishna. 146-151. The x-ray anomalous ... On the formation of silver specks in silver halide crystals -- Mahendra Singh and A P Sharma, 255-265. Critical point phenomena in the ...
2011-01-10
..., FERNDALE, MI 48220........ 335 1,978,363 MI: MICHIGAN STATE HDA PO BOX 30044, LANSING, MI 48909 12 72,255..., MI 48220........ 0 60,600 MI: MICHIGAN STATE HDA PO BOX 30044, LANSING, MI 48909 0 2,400 MN: ITASCA...
Industrial-scale process control by means of electrostatics probes
Czech Academy of Sciences Publication Activity Database
Špatenka, P.; Brunnhofer, Václav; Krumeich, J.; Blažek, J.; Šerý, M.; Endres, H. J.; Cook, R.
2001-01-01
Roč. 5, - (2001), s. 255-263 ISSN 1084-0184 R&D Projects: GA ČR GA202/00/1592; GA MŠk OC 527.60 Institutional research plan: CEZ:AV0Z5007907 Subject RIV: CI - Industrial Chemistry, Chemical Engineering
Indian Academy of Sciences (India)
dell
Material, BET Surface area (m2/g), Specific capacitance (F/g) at 0.2 A/g. Graphene oxide, -, 255. Reduced graphene oxide, -, 14. Non Ac-Sugar, 787, 104. Ac-Sugar, 655, 140. AC-rice husk, 547, 369. AC-jute, 825, 476.
Antibodies against Shigella flexneri adhesion molecule outer ...
African Journals Online (AJOL)
Tropical Journal of Pharmaceutical Research February 2017; 16 (2): 255-261 ... Milliana et al. Trop J Pharm Res, February 2017; 16(2): 256 .... Significance level was set at p ˂. 0.05. ..... labile colonization factor antigen (CFA/II) produced by.
2010-04-01
... in 24 CFR 25.5. Civil money penalties may be imposed against Title I lenders and mortgagees pursuant... unacceptable risk to the Department; or (iv) Transfer of a Title I loan to a party that does not have a valid...
Czech Academy of Sciences Publication Activity Database
Albrechtová, Barbora
2016-01-01
Roč. 99, č. 5 (2016), s. 243-255 ISSN 0027-8203 R&D Projects: GA MŠk(CZ) LM2010013 Institutional support: RVO:68378092 Keywords : animal names * derivation of gender opposite forms * markedness * word -formation Subject RIV: AI - Linguistics
African Journals Online (AJOL)
R.B. Ruthven
The Dilemma of Treating 'Offensive' Terms in Duramazwi Guru reChiShona. 255 ... exercise to increase the sum of human knowledge but practical work to put together a .... written materials focusing on a wide range of aspects of Shona life.
International Nuclear Information System (INIS)
Talamo, Alberto; Gohar, Yousry
2016-01-01
This report describes different methodologies to calculate the effective neutron multiplication factor of subcritical assemblies by processing the neutron detector signals using MATLAB scripts. The subcritical assembly can be driven either by a spontaneous fission neutron source (e.g. californium) or by a neutron source generated from the interactions of accelerated particles with target materials. In the latter case, when the particle accelerator operates in a pulsed mode, the signals are typically stored into two files. One file contains the time when neutron reactions occur and the other contains the times when the neutron pulses start. In both files, the time is given by an integer representing the number of time bins since the start of the counting. These signal files are used to construct the neutron count distribution from a single neutron pulse. The built-in functions of MATLAB are used to calculate the effective neutron multiplication factor through the application of the prompt decay fitting or the area method to the neutron count distribution. If the subcritical assembly is driven by a spontaneous fission neutron source, then the effective multiplication factor can be evaluated either using the prompt neutron decay constant obtained from Rossi or Feynman distributions or the Modified Source Multiplication (MSM) method.
International Nuclear Information System (INIS)
Armbruster, P.; Hessberger, F.P.
1998-01-01
In the last 60 years physicists have created 20 artificial elements beyond uranium. In 1934 Enrico Fermi predicted the creation of new elements by bombarding atoms with neutrons. This method led to the discovery of neptunium (Z=93), plutonium, americium, curium, berkelium, californium, einsteinium and fermium (Z=100). In fact the capture of a neutron is followed by a beta-decay which increases the atomic number (Z) by one unit. Beyond Z=100 beta-decay no more occurs so a new approach was necessary. Between the American Lawrence Berkeley Laboratory and the Russian Dubna Institute a fierce competition broke out to produce new elements by bombarding transuranium nuclei with light elements such as helium, carbon, nitrogen. This new method required heavy equipment: ion accelerator and detectors but led to the creation of all the elements from Z=101 to Z=106. A new idea was to provoke the fusion of heavy nuclei such as lead and bismuth with colliding argon, nickel or zinc ion beams. This method called 'cold fusion' opened the way to reach the nuclei beyond Z=107. In 1996 the element Z=112 was the last discovered. The next step could be the element Z=114 for which a particular stability is expected. (A.C.)
Fission-fragment attachment to aerosols and their transport through capillary tubes
International Nuclear Information System (INIS)
Novick, V.J.; Alvarez, J.L.; Greenwood, R.C.
1981-01-01
The transport of radioactive aerosols was studied using equipment, collectively called the Helium jet, that has been constructed to provide basic nuclear physics data on fission product nuclides. The transport of the fission products in the system depends on their attachment to aerosol particles. The system consists of 1) a tube furnace which generates aerosols by the sublimation or evaporation of source material, 2) a helium stream used to transport the aerosols, 3) a 25 m settling tube to eliminate the larger aerosols and smaller aerosols that would deposit in the capillary, 4) a Californium-252 self-fissioning source of fission product nuclides, and 5) a small capillary to carry the radioactive aerosols from the hot cell to the laboratory. Different source materials were aerosolized but NaCl is generally used because it yielded the highest transport efficiencies through the capillary. Particle size measurments were made with NaCl aerosols by using a cascade impactor, an optical light scattering device, and the capillary itself as a diffusion battery by performing radiation measurements and/or electrical conductivity measurements. Both radioactive and nonradioactive aerosols were measured in order to investigate the possibility of a preferential size range for fission product attachment. The measured size distributions were then used to calculate attachment coefficients and finally an attachment time
International Nuclear Information System (INIS)
King, L.J.; Bigelow, J.E.; Collins, E.D.
1977-10-01
During the period July 1, 1976, through December 31, 1976, transuranium elements were obtained from 11 irradiated HFIR targets; products recovered are 0.3 g 243 Am, 16.6 g 244 Cm, 23 g 249 Bk, 211 g 252 Cf, 1.15 mg 253 Es, and 0.4 pg 247 Fm. Two batches of high-purity 248 Cm were purified chemically for shipment, and another batch containing about 62 mg of 248 Cm was separated from 252 Cf. Thirty shipments were made from TRU during the period; recipients and the amounts of nuclides are listed in tabular form. Nine HFIR targets, each containing 8 to 9 g of curium, were fabricated. The sequence of chemical processing steps used to purify the californium product was changed; this change yielded a shorter recovery time for high-purity 253 Es, which enabled a 50% increase in the amount obtained. Eight neutron sources were fabricated during this report period, bringing the total fabricated to date to 92. Three sources that had previously been returned to TRU were reassigned; two others are also available for reassignment. The values currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated in the Appendix
Energy Technology Data Exchange (ETDEWEB)
Talamo, Alberto [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division; Gohar, Yousry [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division
2016-06-01
This report describes different methodologies to calculate the effective neutron multiplication factor of subcritical assemblies by processing the neutron detector signals using MATLAB scripts. The subcritical assembly can be driven either by a spontaneous fission neutron source (e.g. californium) or by a neutron source generated from the interactions of accelerated particles with target materials. In the latter case, when the particle accelerator operates in a pulsed mode, the signals are typically stored into two files. One file contains the time when neutron reactions occur and the other contains the times when the neutron pulses start. In both files, the time is given by an integer representing the number of time bins since the start of the counting. These signal files are used to construct the neutron count distribution from a single neutron pulse. The built-in functions of MATLAB are used to calculate the effective neutron multiplication factor through the application of the prompt decay fitting or the area method to the neutron count distribution. If the subcritical assembly is driven by a spontaneous fission neutron source, then the effective multiplication factor can be evaluated either using the prompt neutron decay constant obtained from Rossi or Feynman distributions or the Modified Source Multiplication (MSM) method.
Investigation of Workplace-like Calibration Fields via a Deuterium-Tritium (D-T) Neutron Generator.
Mozhayev, Andrey V; Piper, Roman K; Rathbone, Bruce A; McDonald, Joseph C
2017-04-01
Radiation survey meters and personal dosimeters are typically calibrated in reference neutron fields based on conventional radionuclide sources, such as americium-beryllium (Am-Be) or californium-252 (Cf), either unmodified or heavy-water moderated. However, these calibration neutron fields differ significantly from the workplace fields in which most of these survey meters and dosimeters are being used. Although some detectors are designed to yield an approximately dose-equivalent response over a particular neutron energy range, the response of other detectors is highly dependent upon neutron energy. This, in turn, can result in significant over- or underestimation of the intensity of neutron radiation and/or personal dose equivalent determined in the work environment. The use of simulated workplace neutron calibration fields that more closely match those present at the workplace could improve the accuracy of worker, and workplace, neutron dose assessment. This work provides an overview of the neutron fields found around nuclear power reactors and interim spent fuel storage installations based on available data. The feasibility of producing workplace-like calibration fields in an existing calibration facility has been investigated via Monte Carlo simulations. Several moderating assembly configurations, paired with a neutron generator using the deuterium tritium (D-T) fusion reaction, were explored.
Directory of Open Access Journals (Sweden)
Jadambaa Khuyagbaatar
2017-01-01
Full Text Available The synthesis of superheavy elements beyond oganesson (Og, which has atomic number Z = 118, is currently one of the main topics in nuclear physics. An absence of sufficient amounts of target material with atomic numbers heavier than californium (Z = 98 forces the use of projectiles heavier than 48Ca (Z = 20, which has been successfully used for the discoveries of elements with Z = 114 - 118 in complete fusion reactions. Experimental cross sections of 48Ca with actinide targets behave very differently to “cold” and “hot” fusion-evaporation reactions, where doubly-magic lead and deformed actinides are used as targets, respectively. The known cross sections of these reactions have been analysed compared to calculated fission barriers. It has been suggested that observed discrepancies between the cross sections of 48Ca-induced and other fusionevaporation reactions originate from the shell structure of the compound nucleus, which lies in the island of the stability. Besides scarcely known data on other reactions involving heavier projectiles, the most promising projectile for the synthesis of the elements beyond Og seems to be 50Ti. However, detailed studies of 50Ti, 54Cr, 58Fe and 64Ni-induced reactions are necessary to be performed in order to fully understand the complexities of superheavy element formation.
International Nuclear Information System (INIS)
Raison, P.E.; Haire, R.G.; Assefa, Z.
2002-01-01
We have investigated incorporation of americium and curium in selected zirconia-based materials. Fundamental aspects were explored via X-ray diffraction and Raman spectroscopy. First explored was the pseudo ternary system, AmO 2 -ZrO 2 -Y 2 O 3 . It was found that stable, cubic solid solutions (Am x Zr 1-x Y y )O 2-2/y can be obtained for selected compositions. The cell parameters of the cubic phases were established as being linear with the AmO 2 content. For the Cm 2 O 3 -ZrO 2 system, it was determined that diphasic materials are produced, except for two compositions: 25 mol% and 50 mol% of CmO 1.5 . For these compositions a single-phase cubic fluorite type solid solution (a=5.21A±0.01) and a pyrochlore oxide Cm 2 Zr 2 O 7 (a=10.63A±0.02) are formed, respectively. The stability of pyrochlore oxides is also being investigated as a function of self-irradiation, using shorter-lived isotopes, one being the californium pyrochlore 249 Cf 2 Zr 2 O 7 . We obtained evidence that after six months of storage the pyrochlore oxide is undergoing structural change. Additional studies are in progress. (author)
Review of the accomplishments and promise of US transplutonium research, 1940-1981
International Nuclear Information System (INIS)
Keller, O.L.; Wymer, R.G.
1982-01-01
It has been just over 40 years since the identification of plutonium by Seaborg, McMillan, Kennedy, and Wahl at the University of California, Berkeley. This discovery, and the isolation of plutonium-239 a year later by Kennedy, Seaborg, Segre, and Wahl, laid the cornerstone of one of the most exciting and productive eras of research in American history - research on the transplutonium elements. This research was to span all fields of natural science, and indeed was to have many implications and applications in the biological sciences. In this brief document, we have attempted to touch on only some of the many achievements of the US heavy element program. Many of those whose work has been at the heart of this research have contributed to this report. They have summarized some of what was scientifically important and exciting and they have suggested some of the topics of important research remaining to be done. The following topics are covered in this review: historical account; plutonium; synthesis of transplutonium isotopes; nuclear fission and stability, heavy ion reactions and nuclear structure; chemistry of the transplutonium elements; optical and magnetic properties; electronic structure and solid state properties; environmental and biological behavior of transplutonium elements; heavy element production; application of californium-252
Energy Technology Data Exchange (ETDEWEB)
Modolo, G.; Wilden, A.; Daniels, H. [Forschungszentrum Juelich GmbH (Germany). Institute for Energy and Climate Research, IEK-6, Nuclear Waste Management and Reactor Safety; Geist, A.; Magnusson, D. [Karlsruher Institut fuer Technologie, Karlsruhe (Germany). Inst. fuer Nukleare Entsorgung; Malmbeck, R. [European Commission, JRC, Karlsruhe (Germany). Inst. for Transuranium Elements (ITU)
2013-05-01
Within the framework of the European collaborative project ACSEPT, a new SANEX partitioning process was developed at Forschungszentrum Juelich for the separation of the trivalent minor actinides americium, curium and californium from lanthanide fission products in spent nuclear fuels. The development is based on batch solvent extraction studies, single-centrifugal contactor tests and on flow-sheet design by computer code calculations. The used solvent is composed of 6,6{sup '}-bis(5,5,8,8-tetramethyl-5,6,7,8-tetrahydrobenzo-[1,2-4]trizazin-3-yl)-[2,2{sup '}]-bipyridine (CyMe{sub 4}BTBP) and N,N,N{sup '},N{sup '}-tetraoctyldiglycolamide (TODGA) dissolved in n-octanol. A spiked continuous counter-current test was carried out in miniature centrifugal contactors with the aid of a 20-stage flow-sheet consisting of 12 extraction, 4 scrubbing and 4 stripping stages. A product fraction containing more than 99.9% of the trivalent actinides Am(III), Cm(III) and Cf(III) was obtained. High product/feed decontamination factors >1000 were achieved for these actinides. The trivalent lanthanides were directed to the raffinate of the process with the actinide (III) product stream being contaminated with less than 0.5 mass-% in the initial lanthanides. (orig.)
Jadambaa, Khuyagbaatar
2017-11-01
The synthesis of superheavy elements beyond oganesson (Og), which has atomic number Z = 118, is currently one of the main topics in nuclear physics. An absence of sufficient amounts of target material with atomic numbers heavier than californium (Z = 98) forces the use of projectiles heavier than 48Ca (Z = 20), which has been successfully used for the discoveries of elements with Z = 114 - 118 in complete fusion reactions. Experimental cross sections of 48Ca with actinide targets behave very differently to "cold" and "hot" fusion-evaporation reactions, where doubly-magic lead and deformed actinides are used as targets, respectively. The known cross sections of these reactions have been analysed compared to calculated fission barriers. It has been suggested that observed discrepancies between the cross sections of 48Ca-induced and other fusionevaporation reactions originate from the shell structure of the compound nucleus, which lies in the island of the stability. Besides scarcely known data on other reactions involving heavier projectiles, the most promising projectile for the synthesis of the elements beyond Og seems to be 50Ti. However, detailed studies of 50Ti, 54Cr, 58Fe and 64Ni-induced reactions are necessary to be performed in order to fully understand the complexities of superheavy element formation.
Fluorescence and excitation spectra of Bk3+, Cf3+, and Es3+ ions in single crystals of LaCl3
International Nuclear Information System (INIS)
Hessler, J.P.; Caird, J.A.; Carnall, W.T.; Crosswhite, H.M.; Sjoblom, R.K.; Wagner, F. Jr.
1978-01-01
Dye laser techniques have been used to study the energy level structure of the heavier actinides in single crystals of lanthanum chloride. In the case of einsteinium, fluorescence was detected and measured from the following manifolds: J = 5 at 0.984 μm -1 , J = 4 at 1.572 μm -1 , J = 6 at 2.930 μm -1 . This fluorescence was observed to the five lowest manifolds: J = 8, 5, 7, 2, 6. For californium, fluorescence has been detected from the manifolds: J = 11/2 at 1.190 μm -1 , J = 7/2 at 1.389 μm -1 , J = 5/2 at 1.977 μm -1 . This fluorescence was observed to the three lowest manifolds: J = 15/2, 9/2, 11/2. The fluorescence manifolds of berkelium are J = 6 at 1.540 μm -1 , and J = 4 at 1.953 μm -1 . The three lowest manifolds, J = 6, 5, and 4, have been observed in fluorescence. Absorption spectra data have yielded crystal-field splitting measurements in the higher manifolds of Es + . The location of the manifolds in general confirmed earlier approximate free-ion level structure calculations based on assumed regularities in the energy level parameters derived from spectra of the actinide ions through Cf + . 2 figures
Thermal conductivity of water: Molecular dynamics and generalized hydrodynamics results
Bertolini, Davide; Tani, Alessandro
1997-10-01
Equilibrium molecular dynamics simulations have been carried out in the microcanonical ensemble at 300 and 255 K on the extended simple point charge (SPC/E) model of water [Berendsen et al., J. Phys. Chem. 91, 6269 (1987)]. In addition to a number of static and dynamic properties, thermal conductivity λ has been calculated via Green-Kubo integration of the heat current time correlation functions (CF's) in the atomic and molecular formalism, at wave number k=0. The calculated values (0.67+/-0.04 W/mK at 300 K and 0.52+/-0.03 W/mK at 255 K) are in good agreement with the experimental data (0.61 W/mK at 300 K and 0.49 W/mK at 255 K). A negative long-time tail of the heat current CF, more apparent at 255 K, is responsible for the anomalous decrease of λ with temperature. An analysis of the dynamical modes contributing to λ has shown that its value is due to two low-frequency exponential-like modes, a faster collisional mode, with positive contribution, and a slower one, which determines the negative long-time tail. A comparison of the molecular and atomic spectra of the heat current CF has suggested that higher-frequency modes should not contribute to λ in this temperature range. Generalized thermal diffusivity DT(k) decreases as a function of k, after an initial minor increase at k=kmin. The k dependence of the generalized thermodynamic properties has been calculated in the atomic and molecular formalisms. The observed differences have been traced back to intramolecular or intermolecular rotational effects and related to the partial structure functions. Finally, from the results we calculated it appears that the SPC/E model gives results in better agreement with experimental data than the transferable intermolecular potential with four points TIP4P water model [Jorgensen et al., J. Chem. Phys. 79, 926 (1983)], with a larger improvement for, e.g., diffusion, viscosities, and dielectric properties and a smaller one for thermal conductivity. The SPC/E model shares
Elhadidy, Mohamed; Álvarez-Ordóñez, Avelino
2016-01-01
The purpose of this study was to evaluate the resistance patterns to food-related stresses of Shiga toxin producing Escherichia coli O157:H7 strains belonging to specific genotypes. A total of 33 E. coli O157:H7 strains were exposed to seven different stress conditions acting as potential selective pressures affecting the transmission of E. coli O157:H7 to humans through the food chain. These stress conditions included cold, oxidative, osmotic, acid, heat, freeze-thaw, and starvation stresses. The genotypes used for comparison included lineage-specific polymorphism, Shiga-toxin-encoding bacteriophage insertion sites, clade type, tir (A255T) polymorphism, Shiga toxin 2 subtype, and antiterminator Q gene allele. Bacterial resistance to different stressors was calculated by determining D-values (times required for inactivation of 90% of the bacterial population), which were then subjected to univariate and multivariate analyses. In addition, a relative stress resistance value, integrating resistance values to all tested stressors, was calculated for each bacterial strain and allowed for a ranking-type classification of E. coli O157:H7 strains according to their environmental robustness. Lineage I/II strains were found to be significantly more resistant to acid, cold, and starvation stress than lineage II strains. Similarly, tir (255T) and clade 8 encoding strains were significantly more resistant to acid, heat, cold, and starvation stress than tir (255A) and non-clade 8 strains. Principal component analysis, which allows grouping of strains with similar stress survival characteristics, separated strains of lineage I and I/II from strains of lineage II, which in general showed reduced survival abilities. Results obtained suggest that lineage I/II, tir (255T), and clade 8 strains, which have been previously reported to be more frequently associated with human disease cases, have greater multiple stress resistance than strains of other genotypes. The results from this
Unit Ministry Team Religious Support to Casualties on the Airland Battlefield
1987-10-28
Dysentery, Mod 248 Gastrits, Acute 249 Peptic Ulcer, Severe 250 Peptic Ulcer, Mod 251 Regional Ileitis 252 Regional Ileitis, Mod 253 Helminthiasis ...Severe 254 Helminthiasis , Mod 255 Migraine, acute 256 Varicosities, Severe 257 Varicosities, Mod 258 Essential Hypertension 2,)9 Ischemic Heart
Durbin-Watson statistic for the least trimmed squares
Czech Academy of Sciences Publication Activity Database
Víšek, Jan Ámos
2001-01-01
Roč. 8, č. 14 (2001), s. 1-40 ISSN 1212-074X Grant - others:GA UK(CZ) 255/2000/A EK/FSV Institutional research plan: CEZ:AV0Z1075907 Keywords : diagnostics * robustness * regression Subject RIV: BB - Applied Statistics, Operational Research
Attentional Bias for Emotional Stimuli in Borderline Personality Disorder : A Meta-Analysis
Kaiser, D.; Jacob, G.A.; Domes, G.; Arntz, A.
2016-01-01
Background: In borderline personality disorder (BPD), attentional bias (AB) to emotional stimuli may be a core component in disorder pathogenesis and maintenance. Sampling: 11 emotional Stroop task (EST) studies with 244 BPD patients, 255 nonpatients (NPs) and 95 clinical controls and 4 visual
Constraints on the biological recovery of the Bohemian Forest lakes from acid stress.
Czech Academy of Sciences Publication Activity Database
Vrba, Jaroslav; Bojková, J.; Chvojka, P.; Fott, J.; Kopáček, Jiří; Macek, Miroslav; Nedbalová, L.; Papáček, M.; Rádková, V.; Sacherová, V.; Soldán, Tomáš; Šorf, M.
2016-01-01
Roč. 61, č. 4 (2016), s. 376-395 ISSN 0046-5070 R&D Projects: GA ČR GAP504/12/1218 Institutional support: RVO:60077344 Keywords : acidification * aluminium * macroinvertebrates * phytoplankton * zooplankton Subject RIV: EH - Ecology, Behaviour Impact factor: 3.255, year: 2016
Coffee Certification in East Africa: Impact on Farmers, Families and Cooperatives
Directory of Open Access Journals (Sweden)
Jason Donovan
2015-08-01
Full Text Available Reviewed: Coffee Certification in East Africa: Impact on Farmers, Families and Cooperatives. Edited by Ruerd Ruben and Paul Hoebink. Wageningen, the Netherlands: Wageningen Academic Publishers, 2015. 262 pp. US $ 62.00, € 45.00. ISBN 978-90-8686-255-9.
Polymer coatings as separator layers for microbial fuel cell cathodes
Watson, Valerie J.; Saito, Tomonori; Hickner, Michael A.; Logan, Bruce E.
2011-01-01
and increased coulombic efficiency (CE = 56-64%) relative to an uncoated cathode (29 ± 8%), but decreased power production (255-574 mW m-2). Electrochemical characterization of the cathodes ex situ to the MFC showed that the cathodes with the lowest charge
Divergent adaptations in different parts of introduced range in tetraploid Vicia cracca
Czech Academy of Sciences Publication Activity Database
Líblová, Z.; Eliášová, A.; Münzbergová, Zuzana
Roč. 234, SEP 2017 (2017), s. 245-255 ISSN 0367-2530 Institutional support: RVO:67985939 Keywords : common garden experiments * autoploid * cytotype * biological invasions * evolutionary plasticity Subject RIV: EH - Ecology, Behaviour OBOR OECD: Plant sciences, botany Impact factor: 1.125, year: 2016
77 FR 42197 - Small Business Size Standards: Construction
2012-07-18
... ......... ......... $5.0 $25.5 10.0 14.0 238210 Electrical Contractors and Other Wiring 1.8 36.6 0.6 3.5 1,128.6 0.738 12.1 ......... Installation Contractors 10.0 10.0 5.0 ......... ......... $14.0 ......... 10.0 14.0...
Predicting the market potential of plug-in electric vehicles using multiday GPS data.
2011-12-01
"Detailed GPS data for a years worth of travel by 255 households from the Seattle area were used to : investigate how plug-in electric vehicle types may affect adoption rates and use levels. The results suggest : that a battery-electric vehicle (B...
Thymol Hydrogenation in Bench Scale Trickle Bed Reactor
Czech Academy of Sciences Publication Activity Database
Dudas, J.; Hanika, Jiří; Lepuru, J.; Barkhuysen, M.
2005-01-01
Roč. 19, č. 3 (2005), s. 255-262 ISSN 0352-9568 Institutional research plan: CEZ:AV0Z40720504 Keywords : thymol hydrogenation * trickle bed reactor * gas-liquid-solid reaction Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 0.632, year: 2005
The Role of Individuals in the System of the Culture of a Small Ethnographic Region
Czech Academy of Sciences Publication Activity Database
Pospíšilová, Jana
2017-01-01
Roč. 65, č. 2 (2017), s. 255-272 ISSN 0350-0861 Institutional support: RVO:68378076 Keywords : Local culture * bearer * generational transmission * a chronicler Josef Káňa (1929 - 1994) * the Czech Republic Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Antropology, ethnology
Boron-Dipyrromethene Dyes for Ion Recognition Studies
Indian Academy of Sciences (India)
pc
Singlet state energy levels of porphyrins with various cores λ abs ... Chem. Rev. 250, 468 (2006). M. Yedukondalu, M. Ravikanth, Coord. Chem. Rev. 255, 547 ..... 525 550 575 600 625 650 675 700 725 750. 0. 200. 400. 600. 800. 1000. 580.
Kolísání a tendence v režimu odtoků povodí českého Labe
Czech Academy of Sciences Publication Activity Database
Buchtele, Josef; Buchtelová, Marie; Fořtová, Magda
2008-01-01
Roč. 58, č. 7 (2008), s. 251-255 ISSN 1211-0760 Grant - others:EU(CZ) NeWater No. 511179 Institutional research plan: CEZ:AV0Z20600510 Keywords : runoff changes * natural affection * antropogenic changes * identification of changes Subject RIV: BK - Fluid Dynamics