WorldWideScience

Sample records for californium 255

  1. Californium-252 progress, report No. 7, April 1971

    Energy Technology Data Exchange (ETDEWEB)

    1971-12-31

    This report contains discusses of the following topics on Californium-252: First sales of californium-252; encapsulation services discussed; three new participants in market evaluation program; summer training programs to use californium; Californium-252 shipping casks available; Californium-252 questions and answers, radiotherapy; neutron radiography; natural resources exploration; nuclear safeguards; process control; dosimetry; neutron radiography; neutron shielding; and nuclear safeguards.

  2. Historical review of californium-252 discovery and development

    Science.gov (United States)

    Stoddard, D. H.

    This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving (252)Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed.

  3. Californium-252: a remarkable versatile radioisotope

    Energy Technology Data Exchange (ETDEWEB)

    Osborne-Lee, I.W.; Alexander, C.W.

    1995-10-10

    A product of the nuclear age, Californium-252 ({sup 252}Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, {sup 252}Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of {sup 252}Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the {sup 252}Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, {sup 252}Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of {sup 252}Cf from ORNL is summarized herein.

  4. Production, Distribution, and Applications of Californium-252 Neutron Sources

    Energy Technology Data Exchange (ETDEWEB)

    Balo, P.A.; Knauer, J.B.; Martin, R.C.

    1999-10-03

    The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-year half-life. A source the size of a person's little finger can emit up to 10{sup 11} neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6- year half-life. A source the size of a person's little finger can emit up to 10 neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory(ORNL). DOE sells {sup 252}Cf to commercial

  5. Unusual structure, bonding and properties in a californium borate

    Energy Technology Data Exchange (ETDEWEB)

    Polinski, Matthew J.; Garner, Edward B.; Maurice, Rémi; Planas, Nora; Stritzinger, Jared T.; Parker, T. Gannon; Cross, Justin N.; Green, Thomas D.; Alekseev, Evgeny V.; Van Cleve, Shelley M.; Depmeier, Wulf; Gagliardi, Laura; Shatruk, Michael; Knappenberger, Kenneth L.; Liu, Guokui; Skanthakumar, S.; Soderholm, Lynda; Dixon, David A.; Albrecht-Schmitt, Thomas E.

    2014-03-23

    The participation of the valence orbitals of actinides in bonding has been debated for decades. Recent experimental and computational investigations demonstrated the involvement of 6p, 6d and/or 5f orbitals in bonding. However, structural and spectroscopic data, as well as theory, indicate a decrease in covalency across the actinide series, and the evidence points to highly ionic, lanthanide-like bonding for late actinides. Here we show that chemical differentiation between californium and lanthanides can be achieved by using ligands that are both highly polarizable and substantially rearrange on complexation. A ligand that suits both of these desired properties is polyborate. We demonstrate that the 5f, 6d and 7p orbitals are all involved in bonding in a Cf(III) borate, and that large crystal-field effects are present. Synthetic, structural and spectroscopic data are complemented by quantum mechanical calculations to support these observations.

  6. Biomedical neutron research at the Californium User Facility for neutron science

    Energy Technology Data Exchange (ETDEWEB)

    Martin, R.C. [Oak Ridge National Lab., TN (United States); Byrne, T.E. [Roane State Community College, Harriman, TN (United States); Miller, L.F. [Univ. of Tennessee, Knoxville, TN (United States)

    1997-04-01

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact {sup 252}Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with {sup 252}Cf sources. Three projects at the CUF that demonstrate the versatility of {sup 252}Cf for biological and biomedical neutron-based research are described: future establishment of a {sup 252}Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded {sup 252}Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy.

  7. 29 CFR 1910.255 - Resistance welding.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 5 2010-07-01 2010-07-01 false Resistance welding. 1910.255 Section 1910.255 Labor... OCCUPATIONAL SAFETY AND HEALTH STANDARDS Welding, Cutting and Brazing § 1910.255 Resistance welding. (a.... Ignitron tubes used in resistance welding equipment shall be equipped with a thermal protection switch. (3...

  8. 40 CFR 255.25 - Public participation.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Public participation. 255.25 Section 255.25 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES... § 255.25 Public participation. Public participation in the process of identifying regions and agencies...

  9. 42 CFR 447.255 - Related information.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Related information. 447.255 Section 447.255 Public... Facility Services Payment Rates § 447.255 Related information. The Medicaid agency must submit, with the assurances described in § 447.253(a), the following information: (a) The amount of the estimated average...

  10. 20 CFR 632.255 - Program planning.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Program planning. 632.255 Section 632.255... EMPLOYMENT AND TRAINING PROGRAMS Summer Youth Employment and Training Programs § 632.255 Program planning. (a... with its title IV program. (2) Native American grantees shall use the planning process described in...

  11. 40 CFR 96.255 - Banking.

    Science.gov (United States)

    2010-07-01

    ... Tracking System § 96.255 Banking. (a) CAIR SO2 allowances may be banked for future use or transfer in a... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Banking. 96.255 Section 96.255 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) NOX BUDGET...

  12. 49 CFR 178.255-2 - Material.

    Science.gov (United States)

    2010-10-01

    ... weldable quality and conform with the requirements in Sections V, VIII, and IX of the ASME Code (IBR, see... 49 Transportation 2 2010-10-01 2010-10-01 false Material. 178.255-2 Section 178.255-2 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS MATERIALS SAFETY...

  13. 40 CFR 97.255 - Banking.

    Science.gov (United States)

    2010-07-01

    ... Banking. (a) CAIR SO2 allowances may be banked for future use or transfer in a compliance account or a... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Banking. 97.255 Section 97.255 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) FEDERAL NOX...

  14. 39 CFR 255.5 - Employment.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Employment. 255.5 Section 255.5 Postal Service... Employment. No qualified individual with a disability shall, on the basis of disability, be subjected to discrimination in employment with the Postal Service. The definitions, requirements, and procedures of section...

  15. Apparatus for the measurement of total body nitrogen using prompt neutron activation analysis with californium-252.

    Science.gov (United States)

    Mackie, A; Hannan, W J; Smith, M A; Tothill, P

    1988-01-01

    Details of clinical apparatus designed for the measurement of total body nitrogen (as an indicator of body protein), suitable for the critically ill, intensive-care patient are presented. Californium-252 radio-isotopic neutron sources are used, enabling a nitrogen measurement by prompt neutron activation analysis to be made in 40 min with a precision of +/- 3.2% for a whole body dose equivalent of 0.145 mSv. The advantages of Californium-252 over alternative neutron sources are discussed. A comparison between two irradiation/detection geometries is made, leading to an explanation of the geometry adopted for the apparatus. The choice of construction and shielding materials to reduce the count rate at the detectors and consequently to reduce the pile-up contribution to the nitrogen background is discussed. Salient features of the gamma ray spectroscopy system to reduce spectral distortion from pulse pile-up are presented.

  16. Safety Analysis Report for Packaging (SARP) of the Oak Ridge National Laboratory TRU Californium Shipping Container

    Energy Technology Data Exchange (ETDEWEB)

    Box, W.D.; Shappert, L.B.; Seagren, R.D.; Klima, B.B.; Jurgensen, M.C.; Hammond, C.R.; Watson, C.D.

    1980-01-01

    An analytical evaluation of the Oak Ridge National Laboratory TRU Californium Shipping Container was made in order to demonstrate its compliance with the regulations governing off-site shipment of packages that contain radioactive material. The evaluation encompassed five primary categories: structural integrity, thermal resistance, radiation shielding, nuclear criticality safety, and quality assurance. The results of this evaluation demonstrate that the container complies with the applicable regulations.

  17. 14 CFR 255.3 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... REGULATIONS AIRLINE COMPUTER RESERVATIONS SYSTEMS § 255.3 Definitions. Availability means information provided... transportation industry and that uses a system. System means a computerized reservations system offered to...

  18. 40 CFR 25.5 - Public hearings.

    Science.gov (United States)

    2010-07-01

    ... RESOURCE CONSERVATION AND RECOVERY ACT, THE SAFE DRINKING WATER ACT, AND THE CLEAN WATER ACT § 25.5 Public... make it available at no more than cost to anyone who requests it. A copy of the record shall be...

  19. Reference: 255 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 255 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16107538i Stevenson-...emy of Sciences of the United States of America Bastidas Robert J|Chiou Shean-Tai|Frye Roy A|Stevenson-Paulik Jill|York John D

  20. Dicty_cDB: SFL255 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFL255 (Link to dictyBase) - - - Contig-U16449-1 SFL255P (Link to Original site) SFL255F...(Link to library) Clone ID SFL255 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig...Contig-U16449-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SF/SFL2-C/SFL255Q.Seq.d/ Representative...Representative seq. ID SFL255P (Link to Original site) Representative DNA sequence >SFL255 (SFL255Q) /CSM/SF/SFL2-C/SFL255Q...AGTTTGTATTGAGATNAGGTTTTATAATATAAAATGTCAAAAACTCCAGCTAAACTTGTA GATTGTAGTTCAACCCTCAGCAGAGTTGGTAACCACCTCC

  1. Cyberspace Content Manager Technician (MOS 255a)

    Science.gov (United States)

    2011-01-01

    Cyberspace content management technician (MOS 255A) By CW5 Todd M. Boudreau To fully grasp the evolution and current role of the Army’s cyberspace...adaptive technical expert, combat leader , trainer, and advisor. Through progressive levels of exper- tise in assignments, training, and education, the WO...administers, manages , maintains, operates, and integrates Army systems [underline added for emphasis] and equipment across the full spectrum of

  2. 42 CFR 137.255 - What does reassumption mean?

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false What does reassumption mean? 137.255 Section 137.255 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Reassumption § 137.255 What does reassumption...

  3. 42 CFR 441.255 - Sterilization by hysterectomy.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Sterilization by hysterectomy. 441.255 Section 441.255 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Sterilizations § 441.255 Sterilization by hysterectomy. (a) FFP is not available in expenditures for a...

  4. 4 CFR 25.5 - Conformity with signs and directions.

    Science.gov (United States)

    2010-01-01

    ... 4 Accounts 1 2010-01-01 2010-01-01 false Conformity with signs and directions. 25.5 Section 25.5 Accounts GOVERNMENT ACCOUNTABILITY OFFICE GENERAL PROCEDURES CONDUCT IN THE GOVERNMENT ACCOUNTABILITY OFFICE BUILDING AND ON ITS GROUNDS § 25.5 Conformity with signs and directions. Persons in the GAO...

  5. 21 CFR 137.255 - Bolted white corn meal.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Bolted white corn meal. 137.255 Section 137.255... Flours and Related Products § 137.255 Bolted white corn meal. (a) Bolted white corn meal is the food prepared by so grinding and sifting cleaned white corn that: (1) Its crude fiber content is less than 1.2...

  6. 49 CFR 234.255 - Gate arm and gate mechanism.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Gate arm and gate mechanism. 234.255 Section 234... Maintenance, Inspection, and Testing Inspections and Tests § 234.255 Gate arm and gate mechanism. (a) Each gate arm and gate mechanism shall be inspected at least once each month. (b) Gate arm movement shall be...

  7. 39 CFR 255.7 - Special arrangements for postal services.

    Science.gov (United States)

    2010-07-01

    .... (2) Postal retail services and programs. (i) Stamps by mail or phone. (ii) Retail service from rural... 39 Postal Service 1 2010-07-01 2010-07-01 false Special arrangements for postal services. 255.7 Section 255.7 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION ACCESS OF...

  8. 40 CFR 52.255 - Gasoline transfer vapor control.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 3 2010-07-01 2010-07-01 false Gasoline transfer vapor control. 52.255... (CONTINUED) APPROVAL AND PROMULGATION OF IMPLEMENTATION PLANS California § 52.255 Gasoline transfer vapor control. (a) “Gasoline” means any petroleum distillate having a Reid vapor pressure of 4 pounds or greater...

  9. 7 CFR 1901.255 - Historical and archeological assessments.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 12 2010-01-01 2010-01-01 false Historical and archeological assessments. 1901.255... Historical and Archeological Properties § 1901.255 Historical and archeological assessments. (a) The FmHA or... preapplication/application review, prepare a historical and archeological assessment of the undertaking. In...

  10. 14 CFR 25.255 - Out-of-trim characteristics.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Out-of-trim characteristics. 25.255 Section 25.255 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT...-trim characteristics. (a) From an initial condition with the airplane trimmed at cruise speeds up to...

  11. Application of TSH bioindicator for studying the biological efficiency of neutrons from californium-252 source

    Energy Technology Data Exchange (ETDEWEB)

    Cebulska-Wasilewska, A.; Rekas, K. [Institute of Nuclear Physics, Cracow (Poland); Kim, J.K. [Korea Atomic Energy Research Inst., Taejon (Korea, Republic of)

    1997-12-31

    The effectiveness of neutrons from a Californium-252 source in the induction of various abnormalities in the Tradescantia clone 4430 stamen hair cells (TSH-assay) was studied. The special attention was paid to check whether any enhancement in effects caused by process of boron neutron capture is visible in the cells enriched with boron ions. Two chemicals (borax and BSH) were applied to introduce boron-10 ions into cells. Inflorescence, normal or pretreated with chemicals containing boron, were irradiated in the air with neutrons from a Cf-252 source at KAERI, Taejon, Korea. To estimate the relative biological effectiveness (RBE) in the induction of gene mutations of the neutron beam under the study, Tradescantia inflorescences, without any chemical pretreatment, were irradiated with various doses of X-rays. The ranges of radiation doses used were 0-0.1 Gy in neutrons and 0-0.5 Gy in X-rays. After the time needed to complete the postirradiation repair Tradescantia cuttings were transferred to Cracow, where screening of gene and lethal; mutations, cell cycle alterations in somatic cells have been done, and dose response relationships were figured. The maximal RBE values were estimated in the range of 4.6-6.8. Alterations of RBE value were observed; from 6.8 to 7.8 in the case of plants pretreated with 240 ppm of B-10 from borax, and 4.6 to 6.1 in the case of 400 ppm of B-10 from BSH. Results showed a slight, although statistically insignificant increase in biological efficacy of radiation from the Cf-252 source in samples pretreated with boron containing chemicals. (author)

  12. Study of the shielding for spontaneous fission sources of Californium-252; Estudio de blindaje para fuentes de fision espontanea de Californio-252

    Energy Technology Data Exchange (ETDEWEB)

    Davila R, I

    1991-06-15

    A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)

  13. Simulation and design of an electron beam ion source charge breeder for the californium rare isotope breeder upgrade

    Directory of Open Access Journals (Sweden)

    Clayton Dickerson

    2013-02-01

    Full Text Available An electron beam ion source (EBIS will be constructed and used to charge breed ions from the californium rare isotope breeder upgrade (CARIBU for postacceleration into the Argonne tandem linear accelerator system (ATLAS. Simulations of the EBIS charge breeder performance and the related ion transport systems are reported. Propagation of the electron beam through the EBIS was verified, and the anticipated incident power density within the electron collector was identified. The full normalized acceptance of the charge breeder with a 2 A electron beam, 0.024π  mm mrad for nominal operating parameters, was determined by simulating ion injection into the EBIS. The optics of the ion transport lines were carefully optimized to achieve well-matched ion injection, to minimize emittance growth of the injected and extracted ion beams, and to enable adequate testing of the charge bred ions prior to installation in ATLAS.

  14. Extraction of Trivalent Actinides and Lanthanides from Californium Campaign Rework Solution Using TODGA-based Solvent Extraction System

    Energy Technology Data Exchange (ETDEWEB)

    Benker, Dennis [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Delmau, Laetitia Helene [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Dryman, Joshua Cory [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-07-01

    This report presents the studies carried out to demonstrate the possibility of quantitatively extracting trivalent actinides and lanthanides from highly acidic solutions using a neutral ligand-based solvent extraction system. These studies stemmed from the perceived advantage of such systems over cationexchange- based solvent extraction systems that require an extensive feed adjustment to make a low-acid feed. The targeted feed solutions are highly acidic aqueous phases obtained after the dissolution of curium targets during a californium (Cf) campaign. Results obtained with actual Cf campaign solutions, but highly diluted to be manageable in a glove box, are presented, followed by results of tests run in the hot cells with Cf campaign rework solutions. It was demonstrated that a solvent extraction system based on the tetraoctyl diglycolamide molecule is capable of quantitatively extracting trivalent actinides from highly acidic solutions. This system was validated using actual feeds from a Cf campaign.

  15. Beyond Californium-A Neutron Generator Alternative for Dosimetry and Instrument Calibration in the U.S.

    Science.gov (United States)

    Piper, Roman K; Mozhayev, Andrey V; Murphy, Mark K; Thompson, Alan K

    2017-09-01

    Evaluations of neutron survey instruments, area monitors, and personal dosimeters rely on reference neutron radiations, which have evolved from the heavy reliance on (α,n) sources to a shared reliance on (α,n) and the spontaneous fission neutrons of californium-252 (Cf). Capable of producing high dose equivalent rates from an almost point source geometry, the characteristics of Cf are generally more favorable when compared to the use of (α,n) and (γ,n) sources or reactor-produced reference neutron radiations. Californium-252 is typically used in two standardized configurations: unmoderated, to yield a fission energy spectrum; or with the capsule placed within a heavy-water moderating sphere to produce a softened spectrum that is generally considered more appropriate for evaluating devices used in nuclear power plant work environments. The U.S. Department of Energy Cf Loan/Lease Program, a longtime origin of affordable Cf sources for research, testing and calibration, was terminated in 2009. Since then, high-activity sources have become increasingly cost-prohibitive for laboratories that formerly benefited from that program. Neutron generators, based on the D-T and D-D fusion reactions, have become economically competitive with Cf and are recognized internationally as important calibration and test standards. Researchers from the National Institute of Standards and Technology and the Pacific Northwest National Laboratory are jointly considering the practicality and technical challenges of implementing neutron generators as calibration standards in the U.S. This article reviews the characteristics of isotope-based neutron sources, possible isotope alternatives to Cf, and the rationale behind the increasing favor of electronically generated neutron options. The evaluation of a D-T system at PNNL has revealed characteristics that must be considered in adapting generators to the task of calibration and testing where accurate determination of a dosimetric quantity is

  16. Californium-252 Brachytherapy Combined With External-Beam Radiotherapy for Cervical Cancer: Long-Term Treatment Results

    Energy Technology Data Exchange (ETDEWEB)

    Lei Xin; Qian Chengyuan; Qing Yi; Zhao Kewei; Yang Zhengzhou; Dai Nan; Zhong Zhaoyang; Tang Cheng; Li Zheng; Gu Xianqing; Zhou Qian; Feng Yan; Xiong Yanli; Shan Jinlu [Cancer Center, Research Institute of Surgery and Daping Hospital, Third Military Medical University, Chongqing (China); Wang Dong, E-mail: dongwang64@hotmail.com [Cancer Center, Research Institute of Surgery and Daping Hospital, Third Military Medical University, Chongqing (China)

    2011-12-01

    Purpose: To observe, by retrospective analysis, the curative effects and complications due to californium-252 ({sup 252}Cf) neutron intracavitary brachytherapy (ICBT) combined with external-beam radiotherapy (EBRT) in the treatment of cervical cancer. Methods and Materials: From February 1999 to December 2007, 696 patients with cervical cancer (Stages IB to IIIB) were treated with {sup 252}Cf-ICBT in combination of EBRT. Of all, 31 patients were at Stage IB, 104 at IIA, 363 at IIB, 64 at IIIA, and 134 at IIIB. Californium-252 ICBT was delivered at 7-12 Gy per insertion per week, with a total dose of 29-45 Gy to reference point A in three to five insertions. The whole pelvic cavity was treated with 8-MV X-ray external irradiation at 2 Gy per fraction, four times per week. After 16-38 Gy of external irradiation, the center of the whole pelvic field was blocked with a 4-cm-wide lead shield, with a total external irradiation dose of 44-56 Gy. The total treatment course was 5 to 6 weeks. Results: Overall survival rate at 3 and 5 years for all patients was 76.0% and 64.9%, respectively. Disease-free 3- and 5-year survival rates of patients were 71.2% and 58.4%, respectively. Late complications included vaginal contracture and adhesion, radiation proctitis, radiation cystitis, and inflammatory bowel, which accounted for 5.8%, 7.1%, 6.2%, and 4.9%, respectively. Univariate analysis results showed significant correlation of stage, age, histopathologic grade, and lymph node status with overall survival. Cox multiple regression analysis showed that the independent variables were stage, histopathologic grade, tumor size, and lymphatic metastasis in all patients. Conclusion: Results of this series suggest that the combined use of {sup 252}Cf-ICBT with EBRT is an effective method for treatment of cervical cancer.

  17. 24 CFR 203.255 - Insurance of mortgage.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance of mortgage. 203.255... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Endorsement and Contract of Insurance...

  18. 40 CFR 255.31 - Integration with other acts.

    Science.gov (United States)

    2010-07-01

    ... Relationship to Other Programs § 255.31 Integration with other acts. The Governor shall integrate the....), the Safe Drinking Water Act (42 U.S.C. 300f et seq.), the Toxic Substances Control Act (15 U.S.C. 2601...

  19. Phenotype-gene: 255 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 255 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1253i delayed in org.... http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u17704213i delayed in organ named petiole during

  20. Phenotype abnormality: 255 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 255 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u761i disfunctional c...otyledon during process named cotyledon emergence stage ... cotyledon ... disfunctional ... cotyledon emergence stage ...

  1. 40 CFR 255.32 - Coordination with other programs.

    Science.gov (United States)

    2010-07-01

    ... criteria (§ 255.11) specify review of solid waste activities being conducted by water quality management planning agencies, underground injection control agencies, and air quality management agencies. There... the National Pollutant Discharge Elimination System of the Federal Water Pollution Control Act will be...

  2. Development of tilted fibre Bragg gratings using highly coherent 255 ...

    Indian Academy of Sciences (India)

    2014-02-06

    Feb 6, 2014 ... This paper reports the study on development of tilted fibre Bragg gratings using highly coherent 255 nm radiation, obtained from the second harmonic generation (SHG) of copper vapour laser (CVL). The transmission and reflection spectra of the tilted fibre Bragg gratings (TFBG) were studied for the tilt ...

  3. 27 CFR 24.255 - Bottling or packing wine.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Bottling or packing wine..., DEPARTMENT OF THE TREASURY LIQUORS WINE Storage, Treatment and Finishing of Wine Bottling, Packing, and Labeling of Wine § 24.255 Bottling or packing wine. (a) General. Proprietors of a bonded wine premises and...

  4. Long-term effects of an intracavitary treatment with californium-252 on normal tissue. [Swine, /sup 226/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.

    1976-01-01

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with /sup 252/Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from /sup 252/Cf and 7000 rad from /sup 226/Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for /sup 252/Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from /sup 252/Cf and 5000 rad from /sup 226/Ra.

  5. InP Heterojunction Bipolar Transistor Amplifiers to 255 GHz

    Science.gov (United States)

    Radisic, Vesna; Sawdai, Donald; Scott, Dennis; Deal, William; Dang, Linh; Li, Danny; Cavus, Abdullah; To, Richard; Lai, Richard

    2009-01-01

    Two single-stage InP heterojunction bipolar transistor (HBT) amplifiers operate at 184 and 255 GHz, using Northrop Grumman Corporation s InP HBT MMIC (monolithic microwave integrated circuit) technology. At the time of this reporting, these are reported to be the highest HBT amplifiers ever created. The purpose of the amplifier design is to evaluate the technology capability for high-frequency designs and verify the model for future development work.

  6. 20 CFR 255.9 - Individual enrolled under supplementary medical insurance plan.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Individual enrolled under supplementary medical insurance plan. 255.9 Section 255.9 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT RECOVERY OF OVERPAYMENTS § 255.9 Individual enrolled under...

  7. 39 CFR 255.4 - Accessibility to electronic and information technology.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Accessibility to electronic and information technology. 255.4 Section 255.4 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION ACCESS OF PERSONS WITH DISABILITIES TO POSTAL SERVICE PROGRAMS, ACTIVITIES, FACILITIES, AND ELECTRONIC AND INFORMATION TECHNOLOGY § 255.4...

  8. 40 CFR 255.33 - Inclusion of Federal facilities and Native American Reservations.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Inclusion of Federal facilities and Native American Reservations. 255.33 Section 255.33 Protection of Environment ENVIRONMENTAL PROTECTION... Responsibilities of Identified Agencies and Relationship to Other Programs § 255.33 Inclusion of Federal facilities...

  9. 37 CFR 255.8 - Public performances of sound recordings and musical works.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Public performances of sound recordings and musical works. 255.8 Section 255.8 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE... UNDER COMPULSORY LICENSE FOR MAKING AND DISTRIBUTING PHONORECORDS § 255.8 Public performances of sound...

  10. 28 CFR 2.55 - Disclosure of file prior to parole hearing.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Disclosure of file prior to parole hearing. 2.55 Section 2.55 Judicial Administration DEPARTMENT OF JUSTICE PAROLE, RELEASE, SUPERVISION AND RECOMMITMENT OF PRISONERS, YOUTH OFFENDERS, AND JUVENILE DELINQUENTS United States Code Prisoners and Parolees § 2.55 Disclosure of file prior to...

  11. Efficacy of comprehensive treatment on amblyopia in 255 children

    Directory of Open Access Journals (Sweden)

    Xing-Hui Xu

    2015-11-01

    Full Text Available AIM: To study the efficacy of comprehensive treatment on amblyopia in children.METHODS: A total of 255 cases 386 eyes diagnosed as amblyopia were given refractive errors correction, multi-media training system, coveting treatment, CAM treatment and red light stimulation. The relationship of therapeutic effect with age, type and degree of amblyopia was analyzed. RESULTS: The total effective rate was 94%, and total cure rate was 71%. Mild amblyopia, 3~6 years group, ametropia amblyopia had the highest cure rate. CONCLUSION: Efficacy of comprehensive treatment on amblyopia is certain, which is relation with age, type and degree of amblyopia.

  12. Bent crystal channeling of 255 MeV electrons

    Science.gov (United States)

    Takabayashi, Y.; Pivovarov, Yu. L.; Tukhfatullin, T. A.

    2018-01-01

    Charged particles channeled in a bent crystal plane are known to be deflected along the bent plane. Such studies have mainly been performed for high-energy positively-charged particles such as protons, and recently for electrons with energies from 855 MeV to 20.35 GeV. In this work, we present experimental results on the bent crystal channeling of electrons for a lower energy region (255 MeV), where the multiple scattering effect in a crystal is expected to be more dominant. Angular distributions of electrons transmitted through a bent Si crystal have been measured, which are in good agreement with the simulation results.

  13. Ab initio full-potential study of mechanical properties and magnetic phase stability of californium monopnictides (CfN and CfP)

    Energy Technology Data Exchange (ETDEWEB)

    Amari, S., E-mail: siham_amari@yahoo.fr [Faculté des Sciences de la Nature et de la Vie, Université Hassiba Benbouali, Chlef, 02000 (Algeria); Bouhafs, B. [Laboratoire de Modélisation et Simulation en Sciences des Matériaux, Université Djillali Liabès de Sidi Bel-Abbés, Sidi Bel-Abbés, 22000 (Algeria)

    2016-09-15

    Based on the first-principles methods, the structural, elastic, electronic, properties and magnetic ordering of californium monopnictides CfX (X = P) have been studied using the full-potential augmented plane wave plus local orbitals (FP-L/APW + lo) method within the framework of density functional theory (DFT). The electronic exchange correlation energy is described by generalized gradient approximation GGA and GGA+U (U is the Hubbard correction). The GGA+U method is applied to the rare-earth 5f states. We have calculated the lattice parameters, bulk modulii and the first pressure derivatives of the bulk modulii. The elastic properties of the studied compounds are only investigated in the most stable calculated phase. In order to gain further information, we have calculated Young’s modulus, shear modulus, anisotropy factor and Kleinman parameter by the aid of the calculated elastic constants. The results mainly show that californium monopnictides CfX (X = P) have an antiferromagnetic spin ordering. Density of states (DOS) and charge densities for both compounds are also computed in the NaCl (B1) structure.

  14. Low-Dose-Rate Californium-252 Neutron Intracavitary Afterloading Radiotherapy Combined With Conformal Radiotherapy for Treatment of Cervical Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Min [Department of Oncology, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Xu Hongde [Cancer Center, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Pan Songdan; Lin Shan; Yue Jianhua [Department of Oncology, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Liu Jianren, E-mail: liujianren0571@hotmail.com [Second Affiliated Hospital, School of Medicine, Zhejiang University, Hangzhou, Zhejiang Province (China)

    2012-07-01

    Purpose: To study the efficacy of low-dose-rate californium-252 ({sup 252}Cf) neutron intracavitary afterloading radiotherapy (RT) combined with external pelvic RT for treatment of cervical cancer. Methods and Materials: The records of 96 patients treated for cervical cancer from 2006 to 2010 were retrospectively reviewed. For patients with tumors {<=}4 cm in diameter, external beam radiation was performed (1.8 Gy/day, five times/week) until the dose reached 20 Gy, and then {sup 252}Cf neutron intracavitary afterloading RT (once/week) was begun, and the frequency of external beam radiation was changed to four times/week. For patients with tumors >4 cm, {sup 252}Cf RT was performed one to two times before whole-pelvis external beam radiation. The tumor-eliminating dose was determined by using the depth limit of 5 mm below the mucosa as the reference point. In all patients, the total dose of the external beam radiation ranged from 46.8 to 50 Gy. For {sup 252}Cf RT, the dose delivered to point A was 6 Gy/fraction, once per week, for a total of seven times, and the total dose was 42 Gy. Results: The mean {+-} SD patient age was 54.7 {+-} 13.7 years. Six patients had disease assessed at stage IB, 13 patients had stage IIA, 49 patients had stage IIB, 3 patients had stage IIIA, 24 patients had stage IIIB, and 1 patient had stage IVA. All patients obtained complete tumor regression (CR). The mean {+-} SD time to CR was 23.5 {+-} 3.4 days. Vaginal bleeding was fully controlled in 80 patients within 1 to 8 days. The mean {+-} SD follow-up period was 27.6 {+-} 12.7 months (range, 6-48 months). Five patients died due to recurrence or metastasis. The 3-year survival and disease-free recurrence rates were 89.6% and 87.5 %, respectively. Nine patients experienced mild radiation proctitis, and 4 patients developed radiocystitis. Conclusions: Low-dose-rate {sup 252}Cf neutron RT combined with external pelvic RT is effective for treating cervical cancer, with a low incidence of

  15. 40 CFR 80.255 - Compliance plans and demonstration of commitment to produce low sulfur gasoline.

    Science.gov (United States)

    2010-07-01

    ... commitment to produce low sulfur gasoline. 80.255 Section 80.255 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Gasoline Sulfur... gasoline. The requirements of this section apply to any refiner approved for small refiner standards who...

  16. 40 CFR 1039.255 - What decisions may EPA make regarding my certificate of conformity?

    Science.gov (United States)

    2010-07-01

    ... my certificate of conformity? 1039.255 Section 1039.255 Protection of Environment ENVIRONMENTAL... certificate of conformity? (a) If we determine your application is complete and shows that the engine family meets all the requirements of this part and the Act, we will issue a certificate of conformity for your...

  17. 40 CFR 1051.255 - What decisions may EPA make regarding my certificate of conformity?

    Science.gov (United States)

    2010-07-01

    ... my certificate of conformity? 1051.255 Section 1051.255 Protection of Environment ENVIRONMENTAL... conformity? (a) If we determine your application is complete and shows that the engine family meets all the requirements of this part and the Act, we will issue a certificate of conformity for your engine family for...

  18. 40 CFR 1048.255 - What decisions may EPA make regarding my certificate of conformity?

    Science.gov (United States)

    2010-07-01

    ... my certificate of conformity? 1048.255 Section 1048.255 Protection of Environment ENVIRONMENTAL... of conformity? (a) If we determine your application is complete and shows that the engine family meets all the requirements of this part and the Act, we will issue a certificate of conformity for your...

  19. 40 CFR 1045.255 - What decisions may EPA make regarding my certificate of conformity?

    Science.gov (United States)

    2010-07-01

    ... my certificate of conformity? 1045.255 Section 1045.255 Protection of Environment ENVIRONMENTAL... certificate of conformity? (a) If we determine your application is complete and shows that the engine family meets all the requirements of this part and the Clean Air Act, we will issue a certificate of conformity...

  20. 40 CFR 1060.255 - What decisions may EPA make regarding my certificate of conformity?

    Science.gov (United States)

    2010-07-01

    ... my certificate of conformity? 1060.255 Section 1060.255 Protection of Environment ENVIRONMENTAL... regarding my certificate of conformity? (a) If we determine your application is complete and shows that the... of conformity for your emission family for that production period. We may make the approval subject...

  1. 40 CFR 1054.255 - What decisions may EPA make regarding my certificate of conformity?

    Science.gov (United States)

    2010-07-01

    ... my certificate of conformity? 1054.255 Section 1054.255 Protection of Environment ENVIRONMENTAL... regarding my certificate of conformity? (a) If we determine your application is complete and shows that the... of conformity for your emission family for that model year. We may make the approval subject to...

  2. Una Rilettura di Polibio XXXI 25.5

    Directory of Open Access Journals (Sweden)

    Francesco Maria Ferrara

    2017-12-01

    Full Text Available L’articolo si propone di ricostruire la fisionomia testuale di un luogo delle Storie di Polibio (II sec. a.C. – XXXI 25.5 nell’edizione polibiana di Büttner-Wobst, p. 349 –, che è tramandato soltanto dagli Excerpta Constantiniana (X sec.: in una forma più breve dagli Excerpta de Virtutibus et Vitiis [n. 104], nella sezione degli estratti dal XXXI libro che raccoglie la lunga digressione su Scipione Emiliano (testimone: Tours, Bibl. munic., 980 C, del X sec., [P], noto e utilizzato dal XVII sec.; e in una forma più ampia dagli Excerpta de Sententiis [n. 137] (testimone: Città del Vaticano, BAV, gr. 73, del X sec., [M], palinsesto, riscoperto nel 1827, edito dal 1846. Per la conoscenza della pagina polibiana disponiamo anche di Ateneo (fine II sec. d.C., che ne citò il contenuto nel vi libro dei Deipnosophistai (vi 274f-275a, e di due ulteriori estratti costantiniani, questa volta da libri non tramandati dell’opera dello storico Diodoro (I sec. a.C., che attinse anche alle Storie di Polibio: Exc. de Sententiis n. 365 [Diod. xxxi fr. 36 Goukowsky] e n. 436 [Diod. xxxvii fr. 3 Goukowsky]. Attraverso una riflessione sull’affidabilità dei testi di Ateneo e Diodoro in rapporto con quello delle Storie, e un costante confronto con tutta l’opera polibiana volto ad indagare lingua e stile dell’autore, l’articolo giunge a una ricostruzione in parte diversa da quella del Büttner-Wobst, il cui testo riproducono tutte le edizioni moderne.

  3. Californium-252 neutron intracavity brachytherapy alone for T1N0 low-lying rectal adenocarcinoma: A definitive anal sphincter-preserving radiotherapy

    Science.gov (United States)

    Xiong, Yanli; Shan, Jinlu; Liu, Jia; Zhao, Kewei; Chen, Shu; Xu, Wenjing; Zhou, Qian; Yang, Mei; Lei, Xin

    2017-01-01

    This study evaluated the 4-year results of 32 patients with T1N0 low-lying rectal adenocarcinoma treated solely with californium-252 (Cf-252) neutron intracavity brachytherapy (ICBT). Patients were solicited into the study from January 2008 to June 2011. All the patients had refused surgery or surgery was contraindicated. The patients were treated with Cf-252 neutron ICBT using a novel 3.5-cm diameter off-axis 4-channel intrarectal applicator designed by the authors. The dose reference point was defined on the mucosa surface, with a total dose of 55–62 Gy-eq/4 f (13–16 Gy-eq/f/wk). All the patients completed the radiotherapy in accordance with our protocol. The rectal lesions regressed completely, and the acute rectal toxicity was mild (≤G2). The 4-year local control, overall survival, disease-free survival, and late complication (≥G2) rates were 96.9%, 90.6%, 87.5% and 15.6%, respectively. No severe late complication (≥G3) occurred. The mean follow-up was 56.1 ± 16.0 months. At the end of last follow-up, 29 patients remained alive. The mean survival time was 82.1 ± 2.7 months. Cf-252 neutron ICBT administered as the sole treatment (without surgery) for patients with T1N0 low-lying rectal adenocarcinoma is effective with acceptable late complications. Our study and method offers a definitive anal sphincter-preserving radiotherapy for T1N0 low-lying rectal adenocarcinoma patients. PMID:28094790

  4. 28 CFR 25.5 - Validation and data integrity of records in the system.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Validation and data integrity of records... INFORMATION SYSTEMS The National Instant Criminal Background Check System § 25.5 Validation and data integrity of records in the system. (a) The FBI will be responsible for maintaining data integrity during all...

  5. 42 CFR 440.255 - Limited services available to certain aliens.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Limited services available to certain aliens. 440... Limits Applicable to All Services § 440.255 Limited services available to certain aliens. (a) FFP for services. FFP is available for services provided to aliens described in this section which are necessary to...

  6. 38 CFR 17.255 - Applications for grants for programs which include construction projects.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Applications for grants... Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS MEDICAL Grants for Exchange of Information § 17.255 Applications for grants for programs which include construction projects. In addition to the documents and...

  7. 42 CFR 84.255 - Requirements for end-of-service-life indicator.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Requirements for end-of-service-life indicator. 84... Special Use Respirators § 84.255 Requirements for end-of-service-life indicator. (a) Each canister or... equipped with a canister or cartridge end-of-service-life indicator which shows a satisfactory indicator...

  8. 20 CFR 667.255 - Are there special rules that apply to veterans when income is a factor in eligibility...

    Science.gov (United States)

    2010-04-01

    ... eligibility purposes, (for example, in the WIA youth, Job Corps, or NFJP programs) and applies if income is... veterans when income is a factor in eligibility determinations? 667.255 Section 667.255 Employees' Benefits... apply to veterans when income is a factor in eligibility determinations? Yes, under 38 U.S.C. 4213, when...

  9. 20 CFR 255.14 - Waiver not available when recovery can be made from accrual of social security benefits.

    Science.gov (United States)

    2010-04-01

    ... made from accrual of social security benefits. 255.14 Section 255.14 Employees' Benefits RAILROAD... available when recovery can be made from accrual of social security benefits. Where the overpayment is the... individual's entitlement to social security benefits and recovery of such overpayment may be made by offset...

  10. 41 CFR 102-117.255 - What actions may I take if the TSP's performance is not satisfactory?

    Science.gov (United States)

    2010-07-01

    ... if the TSP's performance is not satisfactory? 102-117.255 Section 102-117.255 Public Contracts and... may I take if the TSP's performance is not satisfactory? If the TSP's performance is not satisfactory, you may place a TSP in temporary nonuse, suspended status, or debarred status. For more information on...

  11. A High Mass & Low Envelope Fraction for the Warm Neptune K2-55b

    Science.gov (United States)

    Dressing, Courtney; Sinukoff, Evan; Fulton, Benjamin; Lopez, Eric; Beichman, Charles; Howard, Andrew; Knutson, Heather; Werner, Michael; Schlieder, Joshua; Benneke, Björn; Crossfield, Ian; Isaacson, Howard; Krick, Jessica; Gorjian, Varoujan; Livingston, John; Petigura, Erik; Akeson, Rachel; Batygin, Konstantin; Christiansen, Jessie; Ciardi, David; Crepp, Justin; Jasmine Gonzales, Erica; Hardegree-Ullman, Kevin; Hirsch, Lea; Kosiarek, Molly; Weiss, Lauren

    2018-01-01

    The NASA K2 mission is using the Kepler spacecraft to search for transiting planets in multiple fields along the ecliptic plane. One of the planets detected by K2 is K2-55b, a warm Neptune in a short-period orbit (2.8 days) around a late K dwarf. We previously obtained near-infrared spectra from IRTF/SpeX to characterize the system and found that the host star K2-55 has a radius of 0.715 (+0.043/-0.040) solar radii, a mass of 0.668 (+/- 0.069) solar masses, and an effective temperature of 4300K (+100/-107). We then combined our updated stellar properties with new fits to the K2 photometry to estimate a planet radius of 4.38 (+0.29/-0.25) Earth radii, confirmed the transit ephemeris using Spitzer/IRAC (GO 11026, PI Werner), and embarked on radial velocity observations with Keck/HIRES to measure the planet mass. Our RV data suggest that K2-55b is much more massive than expected, indicating that the planet has a high density despite having a relatively high mass. The lack of a significant volatile envelope tests current theories of gas giant formation and indicates that K2-55b may have avoided runaway accretion by migration, delayed formation, or inefficient core accretion. We gratefully acknowledge funding from the NASA Sagan Fellowship Program and the NASA K2 Guest Observer Program. This work is based in part on observations made with the Spitzer Space Telescope, which is operated by the Jet Propulsion Laboratory, California Institute of Technology under a contract with NASA. Support for this work was provided by NASA through an award issued by JPL/Caltech.

  12. Californium-252 Program Equipment Evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Chattin, Fred Rhea [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Wilson, Kenton [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Ezold, Julie G. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-12-01

    To successfully continue the 252Cf production and meet the needs of the customers, a comprehensive evaluation of the Building 7920 processing equipment was requested to identify equipment critical to the operational continuity of the program.

  13. Retrospective Evaluation Of MRI Findings Of Knee Joint In 255 Patients

    Directory of Open Access Journals (Sweden)

    Ahmet Mete

    2003-03-01

    Full Text Available Retrospective evaluation of knee MRI obtained from 255 cases and to demonstrate most common knee joint pathologies in our region.In our study knee joints of 255 cases who admitted to different clinics of our hospital with various complains of knee between October 1996 and December 1998 were examined in wide spectrum with MRI. Via 1.0 Tesla MRI device and special knee coil in sagittal, coronal and axial plains MRI images were obtained. The number of male and female patients were 173 and 82 and their ages were ranged between 14 and 70, and the mean age was 3413.The most common knee pathologies were intra-articular fluid (%58.04, medial (%46,66 and lateral (%12.55 meniscal injuries, anterior cruciate ligament injury (%17.25 and osteoarthritis (%14.9. The other important lesions were degeneration of medial and lateral meniscus, Baker’s cyst, bursitis, posterior cruciate ligament injury , medial and lateral collateral ligament injuries, synovial hypertrophy, chondromalasia of patella, and contusion.In our images of knee the most common lesions were injuries of meniscus and ligament. Because of being noninvasive technique for knee joint pathologies, capacity of multiplanar imaging, high contrast resolution and chance of detailed anatomic evaluation MR imaging was found to be most appropriate imaging technique for knee joint pathologies.

  14. Clinical utility of topiramate extended-release capsules (USL255): Bioequivalence of USL255 sprinkled and intact capsule in healthy adults and an in vitro evaluation of sprinkle delivery via enteral feeding tubes.

    Science.gov (United States)

    Clark, Annie M; Pellock, John M; Holmay, Mary; Anders, Bob; Cloyd, James

    2016-04-01

    The objectives of these two studies were to determine if beads from extended-release topiramate capsules sprinkled onto soft food are bioequivalent to the intact capsule and if beads from the capsule can be passed through enteral gastrostomy (G-) and jejunostomy (J-) feeding tubes. Bioequivalence of 200-mg USL255 (Qudexy XR [topiramate] extended-release capsules) sprinkled onto soft food (applesauce) versus the intact capsule was evaluated in a phase 1, randomized, single-dose, crossover study (N=36). Pharmacokinetic evaluations included area under the curve (AUC), maximum plasma concentration (Cmax), time to Cmax (Tmax), and terminal elimination half-life (t1/2). If 90% confidence intervals (CI) of the ratio of geometric least-squares means were between 0.80 and 1.25, AUC and Cmax were considered bioequivalent. In separate in vitro experiments, 100-mg USL255 beads were passed through feeding tubes using gentle syringe pressure to develop a clog-free bead-delivery method. Multiple tube sizes (14- to 18-French [Fr] tubes), dilutions (5 mg/15 mL-25 mg/15 mL), and diluents (deionized water, apple juice, Ketocal, sparkling water) were tested. Area under the curve and Cmax for USL255 beads sprinkled onto applesauce were bioequivalent to the intact capsule (GLSM [90% CI]: AUC0-t 1.01 [0.97-1.04], AUC0-∞ 1.02 [0.98-1.05]; Cmax 1.09 [1.03-1.14]). Median Tmax was 4h earlier for USL255 sprinkled versus the intact capsule (10 vs 14 h; p=0.0018), and t1/2 was similar (84 vs 82 h, respectively). In 14-Fr G-tubes, USL255 beads diluted in Ketocal minimized bead clogging versus deionized water. Recovery of USL255 beads diluted in deionized water was nearly 100% in 16-Fr G-, 18-Fr G-, and 18-Fr J-tubes. For patients with difficulty swallowing pills, USL255 sprinkled onto applesauce offers a useful once-daily option for taking topiramate. USL255 beads were also successfully delivered in vitro through ≥14-Fr G- or J-tubes, with tube clogging minimized by portioning the dose and

  15. EMS-45 Tool Steels Hardenability Experiment using Jominy ASTM A255 Test Method

    Directory of Open Access Journals (Sweden)

    Syamsul Hadi

    2013-04-01

    Full Text Available Hardenability of steels is an important way to determine heat treatment and material properties that produce component products. Jominy test is one of the method to know hardenability of steels. The Jominy ASTM A255 in used as a method for carriying out and this reseach. Parameter such as austenite temperature, holding time, cooling rate and then the results is dedicated by the prediction result, with Non Linear Numerical Equation Method. Based on test, it’s known, increasing austenite temperature, longer holding time and high cooling rate, will increase hardenability of steels. The different between the results and the prediction result done by Sonh Yue-Peng[15], Matja equation[14] and Zehtab equation[10], about 5 % -10 %. The data obtained from this experiment can be used to determine the appropriated heat treatment in order to get the desired mechanical properties, as well as to avoid distortion.

  16. Intraoperative electrocortical stimulation of Brodman area 4: a 10-year analysis of 255 cases

    Directory of Open Access Journals (Sweden)

    Brock Mario

    2006-07-01

    Full Text Available Abstract Background Brain tumor surgery is limited by the risk of postoperative neurological deficits. Intraoperative neurophysiological examination techniques, which are based on the electrical excitability of the human brain cortex, are thus still indispensable for surgery in eloquent areas such as the primary motor cortex (Brodman Area 4. Methods This study analyzed the data obtained from a total of 255 cerebral interventions for lesions with direct contact to (121 or immediately adjacent to (134 Brodman Area 4 in order to optimize stimulation parameters and to search for direct correlation between intraoperative potential changes and specific surgical maneuvers when using monopolar cortex stimulation (MCS for electrocortical mapping and continuous intraoperative neurophysiological monitoring. Results Compound muscle action potentials (CMAPs were recorded from the thenar muscles and forearm flexors in accordance with the large representational area of the hand and forearm in Brodman Area 4. By optimizing the stimulation parameters in two steps (step 1: stimulation frequency and step 2: train sequence MCS was successful in 91% (232/255 of the cases. Statistical analysis of the parameters latency, potential width and amplitude showed spontaneous latency prolongations and abrupt amplitude reductions as a reliable warning signal for direct involvement of the motor cortex or motor pathways. Conclusion MCS must be considered a stimulation technique that enables reliable qualitative analysis of the recorded potentials, which may thus be regarded as directly predictive. Nevertheless, like other intraoperative neurophysiological examination techniques, MCS has technical, anatomical and neurophysiological limitations. A variety of surgical and non-surgical influences can be reason for false positive or false negative measurements.

  17. Characteristics and outcome of chronic myeloid leukemia patients with E255K/V BCR-ABL kinase domain mutations.

    Science.gov (United States)

    Naqvi, Kiran; Cortes, Jorge E; Luthra, Raja; O'Brien, Susan; Wierda, William; Borthakur, Gautam; Kadia, Tapan; Garcia-Manero, Guillermo; Ravandi, Farhad; Rios, Mary Beth; Dellasala, Sara; Pierce, Sherry; Jabbour, Elias; Patel, Keyur; Kantarjian, Hagop

    2018-02-20

    Kinase domain (KD) mutations of ABL1 represent the most common resistance mechanism to tyrosine kinase inhibitors (TKI) in CML. Besides T315I, mutations in codon 255 are highly resistant mutations in vitro to all TKI. We aimed to study the incidence, prognosis, and response to treatment in patients with E255K/V. We evaluated 976 patients by sequencing of BCR-ABL1 fusion transcript for ABL1 KD mutations. We identified KD mutations in 381 (39%) patients, including E255K/V in 48 (13% of all mutations). At mutation detection, 14 patients (29%) were in chronic phase (CP), 12 (25%) in accelerated phase (AP), and 22 (46%) in blast phase (BP). 9/14 CP patients responded to treatment (best response complete hematologic response-CHR-4; complete cytogenetic response-CCyR-1; major molecular response-MMR-4); only 4/12 AP patients (CHR 3; MMR 1) and 7/22 BP patients responded (CCyR 2; MMR 2; partial cytogenetic response-PCyR-3). After a median follow-up of 65 months from mutation detection, 36 patients (75%) died: 9/14 (64%) in CP, 9/12 (75%) in AP, and 18/22 (82%) in BP (p = 0.003); median overall survival was 12 months. Patients with E255K/V mutation have a poor prognosis, regardless of the stage of the disease at detection.

  18. The functional Thr130Ile and Val255Met polymorphisms of the hepatocyte nuclear factor-4alpha (HNF4A)

    DEFF Research Database (Denmark)

    Ek, Jakob; Rose, Christian Schack; Jensen, Dorit Packert

    2005-01-01

    HNF4A encodes an orphan nuclear receptor that plays crucial roles in regulating hepatic gluconeogenesis and insulin secretion. The aim of the present study was to examine two rare missense polymorphisms of HNF4A, Thr130Ile and Val255Met, for altered function and for association with type 2 diabetes...

  19. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source; Determinacao de manganes em minerios, por analise por ativacao, usando californio-252 como fonte de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Antonio

    1976-07-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  20. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252; Diseno de un reactor nuclear subcritico homogeneo a base de Torio con una fuente de Californio 252

    Energy Technology Data Exchange (ETDEWEB)

    Delgado H, C. E.; Vega C, H. R. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Sajo B, L., E-mail: ce_delgado89@hotmail.com [Universidad Simon Bolivar, Laboratorio de Fisica Nuclear, Apdo. 89000, 1080A Caracas (Venezuela, Bolivarian Republic of)

    2015-10-15

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U{sup 233} when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO{sub 2}(NO{sub 3}){sub 4} and 18% of thorium Th(NO{sub 3}){sub 4} as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 10{sup 7} s{sup -1}. In the design the value of the effective multiplication factor, whose value turned out k{sub eff} <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  1. A 25.5 MHz double-coaxial lambda/4-resonator as a rebuncher in heavy ion linac system

    CERN Document Server

    Yoshida, K; Hashimoto, Y; Masuda, H; Niki, K

    1999-01-01

    A 25.5 MHz double-coaxial lambda/4-resonator has been constructed to be used as a rebuncher between a 25.5 MHz RFQ linac and a 51 MHz interdigital-H linac for the acceleration of short-lived nuclei. By employing a double coaxial structure, the resonator length is only 130 cm; the length of the natural lambda/4-resonator is 294 cm. The resonator, 69 cm in inner diameter, has six acceleration gaps. The bare shunt impedance is 40.6 M OMEGA/m. The ions with a charge-to-mass ratio 1/10 can be rebunched by feeding an rf power of 1.4 kW.

  2. Silencing protein kinase C ζ by microRNA-25-5p activates AMPK signaling and inhibits colorectal cancer cell proliferation

    Science.gov (United States)

    Zhang, Shihu; Zhang, Yiyang; Cheng, Qing; Ma, Zhaoqun; Gong, Guanwen; Deng, Zhengming; Xu, Kun; Wang, Gaoyuan; Wei, Yousong; Zou, Xiaoping

    2017-01-01

    Developing novel strategies against human colorectal cancer (CRC) cells is needed. Activation of AMP-activated protein kinase (AMPK) could possibly inhibit CRC cells. Protein kinase C ζ (PKCζ) is an AMPK negative regulator. Here we found that PKCζ expression was significantly elevated in human colon cancer tissues and CRC cells. PKCζ upregulation was correlated with AMPK in-activation and mTOR complex 1 (mTORC1) over-activation. Reversely, PKCζ shRNA knockdown activated AMPK signaling and inhibited HT-29 cell proliferation. Significantly, downregulation of microRNA-25-5p (miR-25-5p), a PKCζ-targeting miRNA, could be the cause of PKCζ upregulation. Exogenous expression of miR-25-5p silenced PKCζ to activate AMPK signaling, which inhibited HT-29 cell proliferation. In vivo studies showed that HT-29 xenograft growth in mice was inhibited after expressing PKCζ shRNA or miR-25-5p. Collectively, PKCζ could be a novel oncogenic protein of human CRC. PKCζ silence, by targeted-shRNA or miR-25-5p expression, activates AMPK and inhibits HT-29 cell proliferation. PMID:29029434

  3. High-resolution Optical Spectroscopic Observations of Four Symbiotic Stars: AS 255, MWC 960, RW Hya, and StHα 32

    Science.gov (United States)

    Pereira, C. B.; Baella, N. O.; Drake, N. A.; Miranda, L. F.; Roig, F.

    2017-05-01

    We report on the analysis of high-resolution optical spectra of four symbiotic stars: AS 255, MWC 960, RW Hya, and StHα32. We employ the local-thermodynamic-equilibrium model atmospheres of Kurucz and the spectral analysis code moog to analyze the spectra. The abundance of barium and carbon was derived using the spectral synthesis technique. The chemical composition of the atmospheres of AS 255 and MWC 960 show that they are metal-poor K giants with metallicities of -1.2 and -1.7 respectively. StHα32 is a CH star and also a low-metallicity object (-1.4). AS 255 and MWC 960 are yellow symbiotic stars and, like other previously studied yellow symbiotics, are s-process enriched. StHα32, like other CH stars, is also an s-process and carbon-enriched object. RW Hya has a metallicity of -0.64, a value in accordance with previous determinations, and is not s-process enriched. Based on its position in the 2MASS diagram, we suggest that RW Hya is at an intermediate position between yellow symbiotics and classical S-type symbiotics. We also discuss whether the dilution effect was the mechanism responsible for the absence of the s-process elements overabundance in RW Hya. The luminosity obtained for StHα32 is below the luminosity of the asymptotic giant branch (AGB) stars that started helium burning (via thermal pulses) and became self-enriched in neutron-capture elements. Therefore, its abundance peculiarities are due to mass transfer from the previous thermally pulsing AGB star (now the white dwarf) that was overabundant in s-process elements. For the stars AS 255 and MWC 960, the determination of their luminosities was not possible due to uncertainties in their distance and interstellar absorption. AS 255 and MWC 960 have a low galactic latitude and could be bulge stars or members of the inner halo population. The heavy-element abundance distribution of AS 255 and MWC 960 is similar to that of the other yellow symbiotics previously analyzed. Their abundance patterns

  4. High-resolution Optical Spectroscopic Observations of Four Symbiotic Stars: AS 255, MWC 960, RW Hya, and StH α 32

    Energy Technology Data Exchange (ETDEWEB)

    Pereira, C. B.; Drake, N. A.; Roig, F. [Observatório Nacional/MCTIC, Rua Gen. José Cristino 77, Rio de Janeiro, 20921-400 (Brazil); Baella, N. O. [Unidad de Astronomía, Instituto Geofísico del Perú, Lima, Per (Peru); Miranda, L. F., E-mail: claudio@on.br, E-mail: drake@on.br, E-mail: froig@on.br, E-mail: nobar.baella@gmail.com, E-mail: lfm@iaa.es [Instituto de Astrofísica de Andalucía - CSIC, C/Glorieta de la Astronomía s/n, E-18008 Granada (Spain)

    2017-05-20

    We report on the analysis of high-resolution optical spectra of four symbiotic stars: AS 255, MWC 960, RW Hya, and StH α 32. We employ the local-thermodynamic-equilibrium model atmospheres of Kurucz and the spectral analysis code moog to analyze the spectra. The abundance of barium and carbon was derived using the spectral synthesis technique. The chemical composition of the atmospheres of AS 255 and MWC 960 show that they are metal-poor K giants with metallicities of −1.2 and −1.7 respectively. StH α 32 is a CH star and also a low-metallicity object (−1.4). AS 255 and MWC 960 are yellow symbiotic stars and, like other previously studied yellow symbiotics, are s -process enriched. StH α 32, like other CH stars, is also an s -process and carbon-enriched object. RW Hya has a metallicity of −0.64, a value in accordance with previous determinations, and is not s -process enriched. Based on its position in the 2MASS diagram, we suggest that RW Hya is at an intermediate position between yellow symbiotics and classical S-type symbiotics. We also discuss whether the dilution effect was the mechanism responsible for the absence of the s -process elements overabundance in RW Hya. The luminosity obtained for StH α 32 is below the luminosity of the asymptotic giant branch (AGB) stars that started helium burning (via thermal pulses) and became self-enriched in neutron-capture elements. Therefore, its abundance peculiarities are due to mass transfer from the previous thermally pulsing AGB star (now the white dwarf) that was overabundant in s -process elements. For the stars AS 255 and MWC 960, the determination of their luminosities was not possible due to uncertainties in their distance and interstellar absorption. AS 255 and MWC 960 have a low galactic latitude and could be bulge stars or members of the inner halo population. The heavy-element abundance distribution of AS 255 and MWC 960 is similar to that of the other yellow symbiotics previously analyzed. Their

  5. Institutional care and iron deficiency increase ADHD symptomology and lower IQ 2.5-5 years post-adoption.

    Science.gov (United States)

    Doom, Jenalee R; Georgieff, Michael K; Gunnar, Megan R

    2015-05-01

    Increased ADHD symptomology and lower IQ have been reported in internationally adopted (IA) children compared to non-adopted peers (Hostinar, Stellern, Schaefer, Carlson & Gunnar, 2012; Kreppner, O'Connor & Rutter, 2001). However, it is unclear whether these outcomes are due to institutional deprivation specifically or to co-occurring micronutrient deficiencies that disrupt brain development (Fuglestad, Rao & Georgieff, 2008b). In this study, IA children were compared to children raised in their biological families to examine differences in ADHD symptomology and IQ 2.5-5 years post-adoption and to assess the contributions of iron deficiency (ID) and duration of deprivation to these cognitive outcomes. ADHD symptoms (parent- and experimenter-reported) and IQ were evaluated in 88 IA (M = 62.1 months, SD = 2.4) and 35 non-adopted children (M = 61.4 months, SD = 1.6). IA children were assessed 29-64 months post-adoption (M = 41.9 months, SD = 10.2). ID was assessed during the initial post-adoption medical visit in 69 children, and children were classified into four groups by iron status, ranging from normal to ID anemia (most severe). IA children had greater ADHD symptomology, p adopted children. Within the IA group, children with more severe ID at adoption had greater ADHD symptomology, r(69) = 0.40, p = .001, and lower IQ, r(68) = -0.28, p adoption to age 5 for children with greater ID severity at adoption and longer duration of institutional care but no improvement in ADHD symptoms. These results signify continuing effects of early deprivation and ID on ADHD symptoms and IQ years after adoption. A video abstract of this article can be viewed at http://www.youtube.com/watch?v=vUFDAS3DD1c. © 2014 John Wiley & Sons Ltd.

  6. Apolipoprotein E polymorphisms and severity of cerebral palsy: a cross-sectional study in 255 children in Norway

    Science.gov (United States)

    LIEN, ESPEN; ANDERSEN, GURO L; BAO, YONGDE; GORDISH-DRESSMAN, HEATHER; SKRANES, JON S; VIK, TORSTEIN; BLACKMAN, JAMES A

    2012-01-01

    Aim The aim of this study was to examine whether the presence of the apolipoprotein E (ApoE) allele APOEε4 is associated with less severe manifestations of cerebral palsy (CP), consistent with the suggested beneficial effect of this allele on neurodevelopment in children. Method ApoE genotyping was performed on buccal epithelial cells from 255 children (141 males 114 females; mean age 12y, SD 2y 3mo, range 9–17y) recorded in the Cerebral Palsy Register of Norway. The main outcome measure of CP severity was the Gross Motor Function Classification System (GMFCS). Secondary outcome measures were fine motor function, epilepsy, and the need for gastrostomy tube feeding (GTF). Results There was no association between the APOEε4 genotype and GMFCS levels (odds ratio [OR] 1.15; 95% confidence interval [CI] 0.66–1.99). However, the APOEε4 genotype was more often present among children with epilepsy (OR 2.2; 95% CI 1.1–4.2) and/or receiving GTF (OR 2.7; 95% CI 1.1–6.6). Among children with unilateral CP, the presence of APOEε4 was associated with more severe fine motor impairment (OR 2.6; 95% CI 1.3–6.9). Interpretation Our main hypothesis that APOEε4 would have a protective effect on neurodevelopment was not supported. Instead, subgroup analyses suggested an adverse effect of the APOEε4 genotype on the developing brain after injury. PMID:23384326

  7. Multiple-gene panel analysis in a case series of 255 women with hereditary breast and ovarian cancer.

    Science.gov (United States)

    Tedaldi, Gianluca; Tebaldi, Michela; Zampiga, Valentina; Danesi, Rita; Arcangeli, Valentina; Ravegnani, Mila; Cangini, Ilaria; Pirini, Francesca; Petracci, Elisabetta; Rocca, Andrea; Falcini, Fabio; Amadori, Dino; Calistri, Daniele

    2017-07-18

    As new genes predisposing to breast (BC) and ovarian cancer (OC) are constantly emerging, the use of panels of genes analyzed by Next-Generation Sequencing (NGS) is increasing in clinical diagnostics. The identification of a large number of new germline mutations allows for deeper knowledge of cancer predisposition, although raising many questions about patient management.BC and OC patients recruited by our counseling service between 2012-2015 were included in this study. DNA was extracted from peripheral blood and a panel of 94 genes involved in hereditary tumors was analyzed by NGS. Patient clinical features of BC and OC and cancer family history were collected and compared to the patient genetic profile.A total of 255 women were analyzed, 57 of whom had a pathogenic mutation in BRCA1/2 genes, and 17 carried pathogenic mutations in other genes, such as PALB2, ATM, BRIP1, RAD51D, MSH6, PPM1D, RECQL4, ERCC3, TSC2, SLX4 and other Fanconi anemia genes.Patients with a pathogenic mutation in genes other than BRCA1 and BRCA2 showed no significant difference from the BRCA1/2-mutated carriers with respect to age at diagnosis and clinical features, suggesting that mutations in other genes could pose a high risk of cancer development.These patients had a much higher percentage of bilateral breast cancer (BBC) and a lower rate of OC than BRCA-mutated patients and patients with no pathogenic mutations: as a consequence, the surveillance protocol should be customized to the patient genetic characteristics.

  8. Jet-type, water-cooled heat sink that yields 255-W continuous-wave laser output at 808 nm from a 1-cm laser diode bar.

    Science.gov (United States)

    Miyajima, Hirofumi; Kan, Hirofumi; Kanzaki, Takeshi; Furuta, Shin-ichi; Yamanaka, Masanobu; Izawa, Yasukazu; Nakai, Sadao

    2004-02-01

    A newly designed jet-type, water-cooled heat sink (the funryu heat sink, meaning fountain flow in Japanese) yielded 255-W cw laser output at 808 nm from a 1-cm bar made from InGaAsP/InGaP quantum-well active layers with a 67% fill factor [70 quantum-well laser diode (LD) array along the 1-cm bar]. A funryu heat sink measuring 1.1 mm in thickness gave the LD 0.25 degrees C/W thermal resistance, one of the lowest values achieved with a 1-cm LD bar. Over a short period of operation, the device reached a maximum cw power of 255 W. To the best of our knowledge, this is the highest power ever achieved in 808-nm LD operation. In the future, the funryu heat sink may be capable of 80-W cw operation over an extended lifetime of several thousand hours.

  9. Quasielastic pion scattering near the (3,3) resonance. [255 MeV, differential cross section ratio

    Energy Technology Data Exchange (ETDEWEB)

    Varghese, P.

    1978-12-01

    The quasielastic pion scattering process (..pi..,..pi..p), in which an energetic pion scatters off a target nucleus, knocking-out a bound proton, was studied to determine the role of recoil nucleon charge exchange in the mechanism of the process near the (3,3) free particle pion-nucleon resonance. Calculations, which incorporate the hypothesis of final state charge exchange of the outgoing nucleon, were performed to predict expectations for observing the process. Experimental measurements were made on /sup 27/Al and /sup 208/Pb, using 255-MeV ..pi../sup +/ and ..pi../sup -/ beams. The outgoing protons were observed in a counter telescope in singles and coincidence modes. Singles spectra were measured at proton angles theta/sub rho/ = 45, 55, 64, and 90/sup 0/ and cross sections were calculated as a function of the energy of the detected proton, for each of the targets. Values of the ratio of ..pi../sup +/ to ..pi../sup -/ cross sections were calculated for each of the angles of observation. The results obtained indicate that the singles spectra contain events from processes other than quasielastic scattering and that the quasielastic events cannot be easily disentangled from the large background due to such events. The study has thus established the inadequacy of observing quasielastic pion scattering in a single arm measurement. Coincidence measurements were made by observing the recoil protons in coincidence with the scattered pions, which were detected in a scintillator counter telescope. The ratio of ..pi../sup +/ to ..pi../sup -/ cross sections were obtained for each target for the angular settings (theta/sub rho/, theta/sub ..pi../) = (55, 50/sup 0/) and (64, 37.5/sup 0/). The measured values of 7.0 +- 0.7 for /sup 27/Al and 4.5 +- 0.5 for /sup 208/Pb are substantially below the impulse approximation no-charge-exchange limit of 9. The observed A dependence of this cross section ratio is in agreement with the predictions of the semiclassical charge exchange

  10. Chemical, optical and other data collected aboard the THOMAS G. THOMPSON during cruise TN255 in the Coastal Waters of SE Alaska and North Pacific Ocean from 2010-10-16 to 2010-10-20 (NODC Accession 0104360)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0104360 includes chemical, optical and other data collected aboard the THOMAS G. THOMPSON during cruise TN255 in the Coastal Waters of SE Alaska and...

  11. Burst testing of alloys 800 and 310 at 1,255 K (1,800/sup 0/F) with a simulated coal gasification atmosphere

    Energy Technology Data Exchange (ETDEWEB)

    Dixon, C.E.

    1976-05-01

    Several corrosion- and heat-resistant alloys are being considered for long term applications in coal gasification plants at temperatures up to 1.255/sup 0/K in high pressure environments of mixed hydrogen, water, hydrocarbons, and sulfides. A method for in situ testing has been developed for short time mechanical tests of candidate alloys in high pressure, high temperature, gaseous environments, referred to as coal gasification atmosphere (CGA). The method involves bursting thin-walled tubes, using various gases to produce the burst hoop stress. The short time 1.255/sup 0/K burst and creep rupture strength and ductility properties of alloys 800 and 800H in a mixed gas environment, H/sub 2/, CO, CO/sub 2/, CH/sub 4/, SO/sub 2/ (CGA), are not reduced from properties obtained in air. However, the stress- and pressure-accelerated corrosion is more severe in CGA. It is expected that CGA will reduce long term strength and ductility in alloy 800 as a result of the accelerated corrosion. The short time 1.255/sup 0/K strengths of alloy 310 in CGA and pure hydrogen environments are reduced from the values obtained in air by less than 10 percent. The ductilities (total circumferential elongation) are good--approximately 20 percent for all test conditions. The CGA stress- and pressure-accelerated corrosion is greater than in air. Longer time tests in CGA are expected to result in additional strength degradation. Limited creep/fatigue tests of alloy 310 in hydrogen show that hold times are significant. A greater cyclic life is observed using an 8-second hold time than a 55-second hold time.

  12. Inactivation of a 25.5 µm Enterococcus faecalis biofilm by a room-temperature, battery-operated, handheld air plasma jet

    Science.gov (United States)

    Pei, X.; Lu, X.; Liu, J.; Liu, D.; Yang, Y.; Ostrikov, K.; Chu, Paul K.; Pan, Y.

    2012-04-01

    Effective biofilm inactivation using a handheld, mobile plasma jet powered by a 12 V dc battery and operated in open air without any external gas supply is reported. This cold, room-temperature plasma is produced in self-repetitive nanosecond discharges with current pulses of ˜100 ns duration, current peak amplitude of ˜6 mA and repetition rate of ˜20 kHz. It is shown that the reactive plasma species penetrate to the bottom layer of a 25.5 µm-thick Enterococcus faecalis biofilm and produce a strong bactericidal effect. This is the thickest reported biofilm inactivated using room-temperature air plasmas.

  13. [Viral etiology in children with acute lower respiratory tract infections plus platelet disorders in Changsha, China: an analysis of 255 cases].

    Science.gov (United States)

    Liu, Hua; He, Xiang-Ling; Zhang, Bing; Xiao, Ni-Guang; You, Ya-Lan; Duan, Zhao-Jun

    2014-04-01

    To investigate the viral etiology in hospitalized children with acute lower respiratory tract infections (ALRTI) plus platelet disorders. A total of 255 children with ALRTI plus platelet disorders and 442 children with ALRTI and normal platelets, all of whom were hospitalized between March 2010 and February 2011, were included in the study. Their nasopharyngeal aspirate samples were collected, and RT-PCR or PCR was performed to detect 14 viruses. Of 255 ALRTI patients with platelet disorders, thrombocytosis was found in 253 cases (99.2%) and thrombocytopenia in 2 cases (0.8%). Among ALRTI patients with platelet disorders, 173 (67.8%) were infected with at least one virus, with human rhinovirus as the most common one, followed by parainfluenza virus type 3 (PIV3) and respiratory syncytial virus (RSV). The detection rate of PIV3 in the abnormal platelet group was significantly higher than in the normal platelet group (PThrombocytosis is often found in children with ALRTI caused by viruses, especially PIV3, but infection with IFVB seldom causes platelet disorders. Hospitalized children with ALRTI under one year tend to develop platelet disorders.

  14. Dosimetry for small fields in stereotactic radiosurgery using gafchromic MD-V2-55 film, TLD-100 and alanine dosimeters.

    Directory of Open Access Journals (Sweden)

    Guerda Massillon-J L

    Full Text Available This work investigated the suitability of passive dosimeters for reference dosimetry in small fields with acceptable accuracy. Absorbed dose to water rate was determined in nine small radiation fields with diameters between 4 and 35 mm in a Leksell Gamma Knife (LGK and a modified linear accelerator (linac for stereotactic radiosurgery treatments. Measurements were made using Gafchromic film (MD-V2-55, alanine and thermoluminescent (TLD-100 dosimeters and compared with conventional dosimetry systems. Detectors were calibrated in terms of absorbed dose to water in (60Co gamma-ray and 6 MV x-ray reference (10×10 cm(2 fields using an ionization chamber calibrated at a standards laboratory. Absorbed dose to water rate computed with MD-V2-55 was higher than that obtained with the others dosimeters, possibly due to a smaller volume averaging effect. Ratio between the dose-rates determined with each dosimeter and those obtained with the film was evaluated for both treatment modalities. For the LGK, the ratio decreased as the dosimeter size increased and remained constant for collimator diameters larger than 8 mm. The same behaviour was observed for the linac and the ratio increased with field size, independent of the dosimeter used. These behaviours could be explained as an averaging volume effect due to dose gradient and lack of electronic equilibrium. Evaluation of the output factors for the LGK collimators indicated that, even when agreement was observed between Monte Carlo simulation and measurements with different dosimeters, this does not warrant that the absorbed dose to water rate in the field was properly known and thus, investigation of the reference dosimetry should be an important issue. These results indicated that alanine dosimeter provides a high degree of accuracy but cannot be used in fields smaller than 20 mm diameter. Gafchromic film can be considered as a suitable methodology for reference dosimetry. TLD dosimeters are not

  15. Tachyzoites of Toxoplasma gondii irradiated with 255 Gy induces decrease of cysts and cerebral lesions in mice challenged with cysts of ME-49; Taquizoitos de Toxoplasma gondii irradiados com 255 Gy induzem diminuicao de cistos e lesoes cerebrais em camundongos desafiados com cistos da cepa ME-49

    Energy Technology Data Exchange (ETDEWEB)

    Hiramoto, Roberto Mitsuyoshi; Galisteo Juniorm Andres Jimenez; Nascimento, Nanci do; Andrade Junior, Heitor Franco de [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil). Lab. de Biologia Molecular]. E-mail: rmhiramoto@bol.com.br; hfandrad@usp.br

    2002-07-01

    Toxoplasmosis can cause ocular lesions in normal individuals and several diseases in foetus, HIV infection and transplants. Toxoplasma gondii has a complex life cycle, involving cats, as the definitive host, and warm blood species, as intermediated hosts. The infection occurs by ingestion of food and water contaminated with infected cat faeces, contaminated milk and cheese or raw and undercook meat of the intermediated hosts. To date, there is no commercial vaccine of use in humans. In this work, tachyzoites of T. gondii RH strain were irradiated with 255 Gy and inoculated in C57Bl/6j mice (3 doses, biweekly), after mice were challenged with 1, 5, 10, 20 and 25 cysts of ME-49 by oral gavage. The lesions and cysts in the brain were analyzed in all mice, after 4-week post infection. The mortality was 20% in control mice (ME-49 cysts only) and not one in immunized mice. The number of cysts was high in the control group, but low in immunized 255 Gy mice (n<100). Immunized mice showed less cerebral pathology and necrosis foci. Ionizing radiation is an important tool in the study toxoplasmosis and vaccine development. (author)

  16. Review to Historia proxima poetis. L’influence de la poésie épique sur le style des historiens latins de Salluste à Ammien Marcellin [Collection Latomus, vol. 255], Bruxelles: Latomus, 2000, 488 pp.

    Directory of Open Access Journals (Sweden)

    Joaquín Villalba Álvarez

    2007-10-01

    Full Text Available Review to Historia proxima poetis. L’influence de la poésie épique sur le style des historiens latins de Salluste à Ammien Marcellin [Collection Latomus, vol. 255], Bruxelles: Latomus, 2000, 488 pp. ISBN 2-87031-196-6.

  17. HST Multicolor (255-1042 nm) Photometry of Saturn's Main Rings. 1; Radial Profiles, Phase and Opening Angle Variations, and Regional Spectra

    Science.gov (United States)

    Cuzzi, Jeffrey N.; French, Richard G.; Dones, Luke; DeVincenzi, Donald (Technical Monitor)

    2001-01-01

    The main rings of Saturn were observed with the Planetary Camera of the WFPC2 instrument on the Hubble Space Telescope (HST) from September 1996 to August 2000 as the'ring opening angle to Earth and Sun increased from 4 deg to 24 deg, with a spread of phase angles between 0.3 deg and 6 deg at each opening angle. The rings were routinely observed in the five HST wideband UBVRI filters (F336W, F439W, F555W, F675W, and F814W) and occasionally in the F255W, F785LP, and F1042M filters. The emphasis in this series of papers will be on radial color (implying compositional) variations. In this first paper we describe the analysis technique and calibration procedure, note revisions in a previously published Voyager ring color data analysis, and present new results based on over 100 HST images. In the 300-600 nm spectral range where the rings are red, the 555nm/336nm ratio increases by about 14% as the phase angle increases from 0.3 deg to 6 deg. This effect, never reported previously for the rings, is significantly larger than the phase reddening which characterizes other icy objects, primarily because of the redness of the rings. However, there is no discernible tendency for color to vary with ring opening angle at a given phase angle, and there is no phase variation of color where the spectrum is flat. We infer from this combination of facts that multiple intraparticle scattering, either in a regolith or between facets of an unusually rough surface, is important in these geometries, but that multiple interparticle scattering in a vertically extended layer is not. Voyager color ratios at a phase angle of 14 deg are compatible with this trend, but calibration uncertainties prevent their use in quantitative modeling. Overall ring-average spectra are compatible with those of earlier work within calibration uncertainties, but ring spectra vary noticeably with region. We refine and subdivide the regions previously defined by others. The variation seen between radial profiles of

  18. Intermetallic Reactions during the Solid-Liquid Interdiffusion Bonding of Bi2Te2.55Se0.45 Thermoelectric Material with Cu Electrodes Using a Sn Interlayer

    Directory of Open Access Journals (Sweden)

    Chien-Hsun Chuang

    2016-04-01

    Full Text Available The intermetallic compounds formed during the diffusion soldering of a Bi2Te2.55Se0.45 thermoelectric material with a Cu electrode are investigated. For this bonding process, Bi2Te2.55Se0.45 was pre-coated with a 1 μm Sn thin film on the thermoelectric element and pre-heated at 250 °C for 3 min before being electroplated with a Ni barrier layer and a Ag reaction layer. The pre-treated thermoelectric element was bonded with a Ag-coated Cu electrode using a 4 μm Sn interlayer at temperatures between 250 and 325 °C. The results indicated that a multi-layer of Bi–Te–Se/Sn–Te–Se–Bi/Ni3Sn4 phases formed at the Bi2Te2.55Se0.45/Ni interface, ensuring sound cohesion between the Bi2Te2.55Se0.45 thermoelectric material and Ni barrier. The molten Sn interlayer reacted rapidly with both Ag reaction layers to form an Ag3Sn intermetallic layer until it was completely exhausted and the Ag/Sn/Ag sandwich transformed into a Ag/Ag3Sn/Ag joint. Satisfactory shear strengths ranging from 19.3 and 21.8 MPa were achieved in Bi2Te2.55Se0.45/Cu joints bonded at 250 to 300 °C for 5 to 30 min, dropping to values of about 11 MPa for 60 min, bonding at 275 and 300 °C. In addition, poor strengths of about 7 MPa resulted from bonding at a higher temperature of 325 °C for 5 to 60 min.

  19. ANTIHYPERTENSIVE EFFICACY AND VASOPROTECTIVE PROPERTIES OF A NEW COMBINATION OF BETA-BLOCKER, BISOPROLOL (2,5/5 MG AND DIURETIC, HYDROCHLOROTHIAZIDE (6,25 MG

    Directory of Open Access Journals (Sweden)

    O. D. Ostroumova

    2010-01-01

    Full Text Available Aim. To study influence of the fixed bisoprolol (BIS + hydrochlorothiazide (HCT combination on blood pressure (BP level and a blood flow in middle cerebral artery in patients with a arterial hypertension (HT, 1 degree.Material and methods. 18 patients with HT 1 degree (7 men, 11 women; age 50,1±5,7 y.o. were included in the non-comparative open study. All patients received a combination of selective beta1-adrenoblocker (BIS 2.5-5 mg and diuretic (HCT 6,25 mg. Initially and in 12 weeks of the treatment all patients had a standard clinical examination, ambulatory BP monitoring, ultrasonography of mesencephalic arteries for evaluation of the cerebrovascular blood flow reactivity.Results. The target BP level (<140/90 mm Hg in 12 weeks of the treatment (12 patients received BIS 5 mg/HCT 6,25 mg, 6 patients - BIS 2,5 mg/HCT 6,25 mg was reached in 100% of patients. Besides, significant increase in cerebral blood flow reactivity was found in tests with hyper- and hypoventilation.Conclusion. The fixed BIS/HCT combination has high antihypertensive and vasoprotective efficacy.

  20. Self-Expanding Metal Stenting for Palliation of Patients with Malignant Colonic Obstruction: Effectiveness and Efficacy on 255 Patients with 12-Month's Follow-up

    Directory of Open Access Journals (Sweden)

    Søren Meisner

    2012-01-01

    Full Text Available Background. Self-expanding metal stents can alleviate malignant colonic obstruction in incurable patients and avoid palliative stoma surgery. Objective. Evaluate stent effectiveness and safety on palliation of patients with malignant colorectal strictures. Design. Two prospective, one Spanish and one global, multicenter studies. Settings. 39 centers (22 academic, 17 community hospitals from 13 countries. Patients. A total of 257 patients were enrolled, and 255 patients were treated with a WallFlex uncovered enteral colonic stent. Follow-up was up to 12 months or until death or retreatment. Interventions(s. Self-expanding metal stent placement. Main Outcome Measures. Procedural success, clinical success, and safety. Results. Procedural success was 98.4% (251. Clinical success rates were 87.8% at 30 days, 89.7% at 3 months, 92.8% at 6 months, and 96% at 12 months. Overall perforation rate was 5.1%. Overall migration rate was 5.5%. Overall death rate during follow-up was 48.6% (124, with 67.7% of deaths related to the patient’s colorectal cancer, unrelated in 32.3%. Only 2 deaths were related to the stent or procedure. Limitations. No control group. Conclusions. The primary palliative option for patients with malignant colonic obstruction should be self-expanding metal stent placement due to high rates of technical success and efficacy in symptom palliation and few complications.

  1. 255Gy irradiated tachyzoites of Toxoplasma gondii induce intestinal immune response in C57BL/6J immunized by oral route

    Energy Technology Data Exchange (ETDEWEB)

    Galisteo Junior, Andres Jimenez; Alves, Janaina Baptista [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil). Lab. de Biologia Molecular]. E-mail: galisteo@usp.br; Hiramoto, Roberto Mitsuyoshi [Instituto Adolfo Lutz, Sao Paulo, SP (Brazil). Secao de Parasitoses Sistemicas]. E-mail: hiramoto@usp.br; Carmo, Claudia Villano do; Andrade Junior, Heitor Franco de [Instituto de Medicina Tropical de Sao Paulo, Sao Paulo, SP (Brazil). Lab. de Protozoologia]. E-mail: hfandrad@usp.br

    2005-07-01

    Toxoplasmosis, a prevalent widespread infection in man and animals, occurs mainly through ingestion of water and food contaminated with oocyst from cat feces, causing usually benign disease in humans, except in intrauterine fetal infection or in immunodeficient patients. We study the oral route for the development of a vaccine for toxoplasmosis, using parasites irradiated with 60 Cobalt, as an alternative for vaccine development to this worldwide parasitic infection. We evaluated the development of immunity at serum or mucosal levels, and their efficiency in protect the mice against challenge with oral cysts of the ME-49 strain. C57Bl/6j isogenic mice were immunized by oral route with 10{sup 7} 255 Gy irradiated tachyzoites from RH strain, at several protocols using milk as anti-peptic adjuvant and alum hydroxide as antacid. The preparations of irradiated tachyzoites induced production of serum IgG and IgA in immunized mice, as determined by ELISA, with IgG2a as the dominant subclass, similar to chronic infection. Their use with adjuvant allowed the excretion of significant amounts of IgA in stools also IgG, despite a lesser extent. All oral preparations induced some quantitative protection against challenge, which was similar to the parenteral route only isolated alum hydroxide was used as adjuvant. All these data support the possibility of the development of an oral vaccine against toxoplasmosis, using irradiated tachyzoites, which would be possible tool in near future for use in field baits, for immunizing either domestic or wild felids. (author)

  2. Expression of a putative nitrite reductase and the reversible inhibition of nitrite-dependent respiration by nitric oxide in Nitrobacter winogradskyi Nb-255.

    Science.gov (United States)

    Starkenburg, Shawn R; Arp, Daniel J; Bottomley, Peter J

    2008-11-01

    The nitrite oxidizing Alphaproteobacterium, Nitrobacter winogradskyi, primarily conserves energy from the oxidation of nitrite (NO(2)(-))to nitrate (NO(3)(-)) through aerobic respiration. Almost 20 years ago, NO-dependent NADH formation was reported to occur in both aerobic and anaerobic cell suspensions of N. winogradskyi strain 'agilis', suggesting that NO oxidation might contribute to energy conservation by Nitrobacter. Recently, the N. winogradskyi Nb-255 genome was found to contain a gene (Nwin_2648) that encodes a putative copper-containing nitrite reductase (NirK), which may reduce NO(2)(-) to NO. In this study, the putative nirK was found to be maximally transcribed under low O(2) (between zero and 4% O(2)) in the presence of NO(2)(-). Transcription of nirK was not detected under anaerobic conditions in the absence of NO(2)(-) or in the presence of NO(3)(-) and pyruvate. Although net production of NO could not be detected from either aerobically grown or anaerobically incubated cells, exogenous NO was consumed by viable cells and concomitantly inhibited NO(2)(-)-dependent O(2) uptake in a reversible, concentration dependent manner. Both NO(2(-)-dependent O(2) uptake and NO consumption were inhibited by 1 mM cyanide suggesting involvement of cytochrome oxidase with NO consumption. Abiotic consumption of NO was measured, yet, both the rates and kinetics of NO transformation in buffer alone, or by heat killed, or cyanide-treated cells differed from those of viable cells. In light of this new information, a modified model is proposed to explain how NirK and NO manage electron flux in Nitrobacter.

  3. Automated absolute activation analysis with californium-252 sources

    Energy Technology Data Exchange (ETDEWEB)

    MacMurdo, K.W.; Bowman, W.W.

    1978-09-01

    A 100-mg /sup 252/Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from /sup 17/O. Detection sensitivities of < or = 400 ppB for natural uranium and 8 ppB (< or = 0.5 (nCi/g)) for /sup 239/Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level.

  4. Metastable charge-transfer state of californium(iii) compounds.

    Science.gov (United States)

    Liu, Guokui; Cary, Samantha K; Albrecht-Schmitt, Thomas E

    2015-06-28

    Among a series of anomalous physical and chemical properties of Cf(iii) compounds revealed by recent investigations, the present work addresses the characteristics of the optical spectra of An(HDPA)3·H2O (An = Am, Cm, and Cf), especially the broadband photoluminescence from Cf(HDPA)3·H2O induced by ligand-to-metal charge transfer (CT). As a result of strong ion-ligand interactions and the relative ease of reducing Cf(iii) to Cf(ii), a CT transition occurs at low energy (transfer state undergoes radiative and non-radiative relaxations. Broadening of the CT transition arises from strong vibronic coupling and hole-charge interactions in the valence band. The non-radiative relaxation of the metastable CT state results from a competition between phonon-relaxation and thermal tunneling that populates the excited states of Cf(iii).

  5. MRI findings and return to play in football: a prospective analysis of 255 hamstring injuries in the UEFA Elite Club Injury Study.

    Science.gov (United States)

    Ekstrand, Jan; Lee, Justin C; Healy, Jeremiah C

    2016-06-01

    The present study evaluated whether the MRI parameters of hamstring injuries in male professional football players correlate with time to return to play (RTP). 46 elite European football teams were followed prospectively for hamstring injuries between 2007 and 2014. Club medical staff recorded individual player exposure and time-loss after hamstring injury. MRI parameters were evaluated by two independent radiologists and correlated with the RTP data. A total of 255 grade 1 and 2 injuries were evaluated in this study. RTP was longer for grade 2 than grade 1 injuries (24±13, 95% CI 21 to 26 days vs 18±15, 95% CI 16 to 20 days; mean difference: 6, 95% CI 2 to 9 days, p=0.004, d=0.39). 84% of injuries affected the biceps femoris (BF) muscle, whereas 12% and 4% affected the semimembranosus (SM) and semitendinosus (ST), respectively. No difference in lay-off time was found for injuries to the three different muscles (BF 20±15 days, SM 18±11 days, ST 23±14 days; p=0.83). The recurrence rate was higher for BF injuries than for SM and ST injuries combined (18% vs 2%, p=0.009). The size of the oedema weakly correlated with time to RTP (r(2)=6-12%). No correlation was found between location of injury and time to RTP. The majority of the intramuscular injuries affected the MT junction (56% in grade 1 and 2 injuries), but no difference in lay-off time was found between the different types of injuries. The radiological grade and size of the oedema correlate with time to RTP for both, grade 1 and 2 injuries. No correlations were found between time to RTP and the location and type of injury. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/

  6. The Exiguobacterium sibiricum 255-15 GtfC Enzyme Represents a Novel Glycoside Hydrolase 70 Subfamily of 4,6-α-Glucanotransferase Enzymes.

    Science.gov (United States)

    Gangoiti, Joana; Pijning, Tjaard; Dijkhuizen, Lubbert

    2015-11-20

    The glycoside hydrolase 70 (GH70) family originally was established for glucansucrase enzymes found solely in lactic acid bacteria synthesizing α-glucan polysaccharides from sucrose (e.g., GtfA). In recent years, we have characterized GtfB and related Lactobacillus enzymes as 4,6-α-glucanotransferase enzymes. These GtfB-type enzymes constitute the first GH70 subfamily of enzymes that are unable to act on sucrose as a substrate but are active with maltodextrins and starch, cleave α1→4 linkages, and synthesize linear α1→6-glucan chains. The GtfB disproportionating type of activity results in the conversion of malto-oligosaccharides into isomalto/malto-polysaccharides with a relatively high percentage of α1→6 linkages. This paper reports the identification of the members of a second GH70 subfamily (designated GtfC enzymes) and the characterization of the Exiguobacterium sibiricum 255-15 GtfC enzyme, which is also inactive with sucrose and displays 4,6-α-glucanotransferase activity with malto-oligosaccharides. GtfC differs from GtfB in synthesizing isomalto/malto-oligosaccharides. Biochemically, the GtfB- and GtfC-type enzymes are related, but phylogenetically, they clearly constitute different GH70 subfamilies, displaying only 30% sequence identity. Whereas the GtfB-type enzyme largely has the same domain order as glucansucrases (with α-amylase domains A, B, and C plus domains IV and V), this GtfC-type enzyme differs in the order of these domains and completely lacks domain V. In GtfC, the sequence of conserved regions I to IV of clan GH-H is identical to that in GH13 (I-II-III-IV) but different from that in GH70 (II-III-IV-I because of a circular permutation of the (β/α)8 barrel. The GtfC 4,6-α-glucanotransferase enzymes thus represent structurally and functionally very interesting evolutionary intermediates between α-amylase and glucansucrase enzymes. Copyright © 2016, American Society for Microbiology. All Rights Reserved.

  7. Clinical observation of the adverse drug reactions caused by non-ionic iodinated contrast media: results from 109,255 cases who underwent enhanced CT examination in Chongqing, China.

    Science.gov (United States)

    Li, X; Chen, J; Zhang, L; Liu, H; Wang, S; Chen, X; Fang, J; Wang, S; Zhang, W

    2015-03-01

    To analyse the pattern and factors that influence the incidence of adverse drug reactions (ADRs) induced by non-ionic iodinated contrast media and to evaluate their safety profiles. Data from 109,255 cases who underwent enhanced CT examination from 1 January 2008 to 31 August 2013 were analysed. ADRs were classified according to the criteria issued by the American College of Radiology and the Chinese Society of Radiology. A total of 375 (0.34%) patients had ADRs, including 281 mild (0.26%); 80 moderate (0.07%); and 14 severe (0.01%) ADRs; no death was found. 302 (80.53%) of the ADRs occurred within 15 min after examination. Patients aged 40-49 years (204 cases, 0.43%; p contrast media are mainly mild ones, while moderate or severe ADRs are relatively rare, suggesting that enhanced CT examination with non-ionic iodinated contrast media is highly safe, and severe adverse events will seldom occur under appropriate care. The study included 109,255 patients enrolled in various types of enhanced CT examinations, which could reflect ADR conditions and regulations in Chinese population accurately and reliably.

  8. Testing of the VENUS 4.12, DPMJET 2.55, QGSJET II-03 and SIBYLL 2.3 hadronic interaction models via help of the atmospheric vertical muon spectra

    Science.gov (United States)

    Dedenko, L. G.; Lukyashin, A. V.; Roganova, T. M.; Fedorova, G. F.

    2017-10-01

    Uncertainties of the model energy spectra of the most energetic secondary π± -mesons (and K± -mesons) are discussed. Computer simulations of the partial energy spectra of the atmospheric vertical muons induced by primary cosmic particles with various fixed energies in interval 102 -107 GeV in terms of the VENUS 4.12, DPMJET 2.55, QGSJET II-03 and SIBYLL 2.3 models had been carried out with help of CORSIKA package. These partial spectra should be convoluted with the contemporary spectra of the primary cosmic particles. Results of simulations are compared with the contemporary atmospheric vertical muon flux data. Comparison shows that all models underestimate production of secondary π± -mesons (and K± -mesons) by factor of ˜ 2 at the most high energies. This underestimation induces more rapid development of extensive air showers in the atmosphere and results in uncertainties in estimates of energy and composition of the primary cosmic particles.

  9. Microstructure and mechanical properties of aluminium matrix composites reinforced by Al{sub 62}Cu{sub 25.5}Fe{sub 12.5} melt spun ribbon

    Energy Technology Data Exchange (ETDEWEB)

    Lityńska-Dobrzyńska, Lidia, E-mail: l.litynska@imim.pl; Mitka, Mikołaj; Góral, Anna; Stan-Głowińska, Katarzyna; Dutkiewicz, Jan

    2016-07-15

    Aluminium matrix composites containing 15, 30 and 50 vol.% of pulverized Al{sub 62}Cu{sub 25.5}Fe{sub 12.5} (in at.%) melt spun ribbons have been prepared by a vacuum hot pressing (T = 673 K, P = 600 MPa). The microstructure of the initial ribbon and the composites was investigated using X-ray, scanning and transmission electron microscopy. In the as-spun ribbon the quasicrystalline icosahedral phase (i-phase) coexisted with the cubic copper rich β-Al(Cu, Fe) intermetallic compound. The phase composition of Al-Cu-Fe particles changed after consolidation process and the i-phase transformed partially to the ω-Al{sub 70}Cu{sub 20}Fe{sub 10} phase. Additionally, the Θ-Al{sub 2}Cu phase formed at the α(Al)/Al-Cu-Fe particle interfaces. With an increase in volume fraction of the reinforcement the hardness of the composites increased up to HV = 180 for the highest amount of added particles. The ultimate compression strength of the same sample reached the value of 545 MPa. - Highlights: • Al and 15, 30, 50% of pulverized Al{sub 62}Cu{sub 25.5}Fe{sub 12.5} melt spun ribbon were consolidated. • The initial ribbon consisted of the icosahedral i-phase and copper rich β-Al(Cu, Fe). • The i-phase partially transforms to ω-Al{sub 7}Cu{sub 2}Fe phase in all composites. • Increase of microhardness and compressive strength with content of reinforcement • Ultimate compression strength 545 MPa for 50% of added particles.

  10. Is the Internet a useful and relevant source for health and health care information retrieval for German cardiothoracic patients? First results from a prospective survey among 255 Patients at a German cardiothoracic surgical clinic

    Directory of Open Access Journals (Sweden)

    Diez Claudius

    2006-10-01

    Full Text Available Abstract Background It is not clear how prevalent Internet use among cardiopathic patients in Germany is and what impact it has on the health care utilisation. We measured the extent of Internet use among cardiopathic patients and examined the effects that Internet use has on users' knowledge about their cardiac disease, health care matters and their use of the health care system. Methods We conducted a prospective survey among 255 cardiopathic patients at a German university hospital. Results Forty seven respondents (18 % used the internet and 8,8 % (n = 23 went online more than 20 hours per month. The most frequent reason for not using the internet was disinterest (52,3 %. Fourteen patients (5,4 % searched for specific disease-related information and valued the retrieved information on an analogous scale (1 = not relevant, 5 = very relevant on median with 4,0. Internet use is age and education dependent. Only 36 (14,1 % respondents found the internet useful, whereas the vast majority would not use it. Electronic scheduling for ambulatory visits or postoperative telemedical monitoring were rather disapproved. Conclusion We conclude that Internet use is infrequent among our study population and the search for relevant health and disease related information is not well established.

  11. 16 CFR 255.3 - Expert endorsements.

    Science.gov (United States)

    2010-01-01

    ... in fact have found such superiority. Example 1: An endorsement of a particular automobile by one... is well acquainted with the design and performance of automobiles. If the endorser's field is, for example, chemical engineering, the endorsement would be deceptive. Example 2: An endorser of a hearing aid...

  12. 21 CFR 25.5 - Terminology.

    Science.gov (United States)

    2010-04-01

    ... AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ENVIRONMENTAL IMPACT...) Environmental assessment (EA) (40 CFR 1508.9). (6) Environmental document (40 CFR 1508.10). (7) Environmental...). (12) Legislation (40 CFR 1508.17). (13) Major Federal action (40 CFR 1508.18). (14) Mitigation (40 CFR...

  13. Cybersoace Defense Technician (MOS 255s)

    Science.gov (United States)

    2011-01-01

    is crucial. The master CyD will be, without argument, today’s intellectual capital to ensure the Army not only meets its future demands within and...significant amount of intellectual capital and funding were required to acquire, reverse engineer, fabricate, and reproduce such equipment by our

  14. 15 CFR 255.2 - Qualifications.

    Science.gov (United States)

    2010-01-01

    ... fellowship; (c) Able to speak, read, write and understand the English language; (d) Of good moral character... recognized university, college or other institution of learning, with some training or experience in the...

  15. 16 CFR 255.2 - Consumer endorsements.

    Science.gov (United States)

    2010-01-01

    ... their homes, their monthly utility bills went down by $100, $125, and $150, respectively. The ad will... the motion picture studio had approached these individuals outside the theater and offered them free...

  16. 21 CFR 173.255 - Methylene chloride.

    Science.gov (United States)

    2010-04-01

    ... HUMAN CONSUMPTION (CONTINUED) SECONDARY DIRECT FOOD ADDITIVES PERMITTED IN FOOD FOR HUMAN CONSUMPTION... section. (c) In coffee as a residue from its use as a solvent in the extraction of caffeine from green...

  17. 39 CFR 255.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... of which is not the acquisition, storage, manipulation, management, movement, control, display... any person who— (1) Has a physical or mental impairment that substantially limits one or more of such... of equipment, that is used in the automatic acquisition, storage, manipulation, management, movement...

  18. 255-IJBCS-Article- Dr Msafiri Jackson

    African Journals Online (AJOL)

    RHUMSIKI

    Compartment Model provided a satisfactory approximation of the measured CO concentrations with an .... consumption per household and corresponding burning duration. The fuel wood consumption was determined by weighing the amount of wood used for cooking. .... years spend more time indoors at home than.

  19. 6 CFR 27.255 - Recordkeeping requirements.

    Science.gov (United States)

    2010-01-01

    ... exercise, the name(s) and qualifications of the exercise director, and any best practices or lessons... the following records: (1) Training. For training, the date and location of each session, time of day... and exercises. For each drill or exercise, the date held, a description of the drill or exercise, a...

  20. 24 CFR 983.255 - Tenant screening.

    Science.gov (United States)

    2010-04-01

    ... providing information to owners. (4) The PHA policy must provide that the PHA will give the same types of information to all owners. (d) The protections for victims of domestic violence, dating violence, and stalking...

  1. 46 CFR 174.255 - Restricted service.

    Science.gov (United States)

    2010-10-01

    ... encountered while jacking. (b) Damaged stability. (1) Each liftboat must be designed so that, while it is in... liftboat must have a means of closing off each pipe, ventilation system, and trunk in each compartment described by paragraph (b)(4) of this section if any part of the pipe, ventilation system, or trunk is...

  2. 16 CFR 255.1 - General considerations.

    Science.gov (United States)

    2010-01-01

    ... honest opinions, findings, beliefs, or experience of the endorser. Furthermore, an endorsement may not... reworded so as to distort in any way the endorser's opinion or experience with the product. An advertiser... X typing on each keyboard and then picking the advertiser's brand. The announcer asks her why, and X...

  3. Publications | Page 255 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded research, ... and measurement of child poverty. Further, poverty has many dimensions, including mortality, morbidity, hunger, illiteracy, lack of.

  4. 10 CFR 25.5 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... information at the facility. The CSA for the facility provides security representation for other government... Uranium Mill Tailings Radiation Control Act of 1978, any State or any political subdivision of, or any political entity within a State, any foreign government or nation or any political subdivision of any such...

  5. Neutron Protection Factor Determination and Validation for a Vehicle Surrogate Using a Californium Fission Source

    Science.gov (United States)

    2017-06-01

    a 4 mm x 4 mm (0.157" x 0.157") LiI(Eu) crystal with 96% enrichment of lithium -6. The crystal is connected to a photomultiplier tube (PMT) which...32 Figure 17. Lithium -6 Iodide, Europium Doped Scintillation Detector. Source: [27...Alamos National Laboratory LiI(Eu) Lithium Iodide Europium Doped LLD Low Level Discriminator LLNL Lawrence Livermore National Laboratory MASH Monte

  6. TASK 2.5.5 NATURAL EXPOSURE TESTING IN CALIFORNIA

    Energy Technology Data Exchange (ETDEWEB)

    Miller, William A [ORNL; Cheng, Mengdawn [ORNL; New, Joshua Ryan [ORNL; Ronnen, Levinson [Lawrence Berkeley National Laboratory (LBNL); Akbari, Hashem [Lawrence Berkeley National Laboratory (LBNL); Berhahl, Paul [Lawrence Berkeley National Laboratory (LBNL)

    2010-03-01

    Airborne particulate matter that settles on a roof can either reflect or absorb incoming solar radiation, dependent on the chemical content and size of the particles. These light scattering and absorption processes occur within a few microns of the surface, and can affect the solar reflectance of the roof. Wilkes et al. (2000) tested 24 different roof coatings on a low-slope test stand and observed about a 25% decrease in the solar reflectance of white-coated and aluminum-coated surfaces as the time of exposure increased; however, the decrease leveled off after 2 years. SPRI Inc. and its affiliates studied the effect of climatic exposure on the surface properties of white thermoplastic single-ply membranes and determined that membranes lose from 30 to 50% of their reflectance over 3 years (Miller et al. 2002). The CMRC and its affiliates AISI, NamZAC, MBMA, MCA and NCCA exposed unpainted and painted metal roofing on both steep- and low-slope test roofs and found that after 3 years, the painted polyvinylidene fluoride (PVDF) metal roofs lost less than 5% of their original reflectance (Miller et al. 2004). The results of the three different weathering studies are very interesting in terms of their solar reflectance after 3 years of exposure. The white thermoplastic membrane and white ceramic coating with white topcoat had original reflectance measures that were about 20 percentage points higher than the painted metal; however, after 3-years of field exposure the solar reflectance of the painted metal exceeds that of the thermoplastic membrane and equals that of the coating. The long-term loss of reflectance appears driven by the ability of the particulate matter to cling to the roof and resist being washed off by wind and or rain. Miller et al. (2002) discovered that aerosol deposition introduced biomass of complex microbial consortia onto the test roofs and the combination of contaminants and biomass accelerated the loss of solar reflectance for the thermoplastic membranes and the roof coatings. Airborne contaminants and biomass were also detected on the painted metal roofs; however, the loss of solar reflectance was less than 5% for the painted metal roofs. The chemistry of the PVDF paint resin system uses similar organic film bonding to that responsible for Teflon , making it extremely chemical resistant and dirt shedding. Miller and Rudolph (2003) found the PVDF painted metals maintained solar reflectance even after 30 years of climatic exposure. Therefore the reduction of roof reflectance is closely related to the composition of the roof and to the chemical profile of the contaminants soiling the roof. Contaminants collected from samples of roof products exposed at seven California weathering sites were analyzed for elements and carbons to characterize the chemical profile of the particles soiling each roof sample and to identify those elements that degrade or enhance solar reflectance. The losses in solar reflectance varied from site to site and also varied at a give site based on the color of the coupon. The least drop in reflectance was observed in the alpine climate of McArthur while the largest drop occurred in sites near urban development. Light color samples were soiled after just one year of exposure. The darker color coupons did not show the same seasonal variations in solar reflectance as observed for the lighter colors. However, after an additional year of exposure the samples at all sites regained most of their solar reflectance due to rain and/or wind washing. The loss of reflectance appears cyclical with the onset of seasons having more rainfall. Solar reflectance of the cool pigmented coupons always exceeded that of the conventional pigmented coupons. Climatic soiling did not cause the cool pigmented roof coupons to lose any more solar reflectance than their conventional pigmented counterparts. The effect of roof slope appears to have more of an effect on lighter color roofs whose solar reflectance exceeds at least 0.5 and visually shows the accumulation of airborne contaminants. The thermal emittance remained invariant with time and location and was therefore not affected by climatic soiling. A thin-film deposition model was developed based on first principles, which simulates light interaction with a soiled substrate. This model was used in combination with the measured data to determine the solar absorptance and reflectance of particulate matter at each of the sites calculated using least squares fitting routines. Principal Component Analysis was used to determine the most important combinations of chemicals correlated with changes in solar absorption. Linear regression helped extract an approximate correlation using chromium, iron and elemental carbon concentrations. It appears that chromium ranks first, iron ranks second, and elemental carbon ranks third in importance to soil absorptance in the data

  7. Dicty_cDB: SFA255 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LGVLISRSSLQFVKIKHIGVITILQGINMVFWIIQ AKYKMVTSVWVLFILMVYCGLLGGASYVNVFYLILHQKNIPNEDRELCINYAALLVTVGI TLA...LGVLISRSSLQFVKIKHIGVITILQGINMVFWIIQ AKYKMVTSVWVLFILMVYCGLLGGASYVNVFYLILHQKNIPNEDRELCINYAALLVTVGI TLA

  8. China Report, Agriculture, No. 255, 1981 Agricultural Yearbook.

    Science.gov (United States)

    1983-04-28

    495 New Seedling Propagation Techniques Training Class 495 Technical Training in Use of Bacillus Thuringiensis 495 Use of Rice Moths in Breeding of...Prevention and Control of Schistosomiasis of Plow Oxen 167 Rapid Revival and Development of Superior Bee Variety [Apis sinensis Smith] Production 168 State...Cultivation 242 Brief Summary of Symposium on Uses of Bee Products 243 National Academic Exchange Conference on Applications to Agriculture of Isotope

  9. 255 effects of some heavy metal pollutants on fertility characteristics

    African Journals Online (AJOL)

    DR. AMINU

    2010-06-01

    Jun 1, 2010 ... some are essential for some biological processes as trace elements, all are toxic above certain tolerance level. Most readily cited examples of these substances as shown by Wild (1996) include Arsenic (As),. Cadmium (Cd), Chromium (Cr), Copper (Cu), Lead. (Pb), Mercury (Hg), Nickel (Ni) and Zinc (Zn).

  10. Dicty_cDB: SSL255 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available icus clone CH230-43O14, *** SEQUENCING IN PROGRESS ***, 1 ordered piece. 46 0.24 1 BH328654 |BH328654.1 CH230-124J3.TJB CHORI-230 Seg...ment 1 Rattus norvegicus genomic clone CH230-124J3, DNA sequence. 46 0.24 1 AX34605

  11. 14 CFR 255.4 - Display of information.

    Science.gov (United States)

    2010-01-01

    ... in selecting service options from the database or give single-plane flights a preference over...-time performance code for each nonstop flight segment and one-stop or multi-stop single plane flight... carrier identity and that are consistently applied to all carriers and to all markets. (2) When a flight...

  12. 40 CFR 255.11 - Criteria for identifying agencies.

    Science.gov (United States)

    2010-07-01

    ... procedures for public participation in the planning process. (5) Have appropriate experience and skills to... considered for planning and implementation responsibilities. Agencies which have completed planning that... priority consideration for future planning responsibilities when they otherwise meet these criteria. (b) An...

  13. 15 CFR 255.1 - Type of fellowships.

    Science.gov (United States)

    2010-01-01

    ... include the usual subdivisions of physics (weights and measures, heat, optics, mechanics, atomic physics... standardization and testing. (b) Practical laboratory training in various branches of physics, chemistry, and...

  14. Dicty_cDB: VFK255 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KDQQEEEKYHGATVKDLTLPKPITISATTTCAAAVQLLQQYGFDQLPVVSESKKVLGQLT LGNLLSHIASKKAVPTDAVSKVMFRFTKNEKYIPITQSTSLATLSKFFENHSSAIVTXND...KDQQEEEKYHGATVKDLTLPKPITISATTTCAAAVQLLQQYGFDQLPVVSESKKVLGQLT LGNLLSHIASKKAVPTDAVSKVMFRFTKNEKYIPITQSTSLATLSKFFENHSSAIVTXND

  15. Dicty_cDB: SHD255 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ---NSLITHCTDCPGIGCTTTDFCFQQVCSATDGDVCTTVPLNCDDGLQCTVDSCIGPMG VCSHIAIAPKCLECALEPCITTDNCQPVICGPDGRCIQETIEDFCDDYNYCTVDTCTGVG...---NSLITHCTDCPGIGCTTTDFCFQQVCSATDGDVCTTVPLNCDDGLQCTVDSCIGPMG VCSHIAIAPKCLECALEPCITTDNCQPVICGPDGRCIQETIEDFCDDYNYCTVDTCTGVG

  16. 37 CFR 255.4 - Definition of digital phonorecord delivery.

    Science.gov (United States)

    2010-07-01

    ... transmission of a sound recording which results in a specifically identifiable reproduction by or for any transmission recipient of a phonorecord of that sound recording, regardless of whether the digital transmission is also a public performance of the sound recording or any nondramatic musical work embodied therein...

  17. Dicty_cDB: AFJ255 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence. 78 2e-10 1 BM398179 |BM398179...Tor7258 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence. 70 4e-08 1 dna update 2004

  18. 40 CFR 255.10 - Criteria for identifying regions.

    Science.gov (United States)

    2010-07-01

    ... configuration should be considered, weighing transportation costs against economies of scale. (2) Left-over... economies of scale, and affect marketability of resources recovered. A region should include sufficient...

  19. Dicty_cDB: AFK255 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6. 1 Translated Amino Acid sequence ---QAGNLADDWELLPSKQIKDPKQSKPVDWVDVKEIDDPEDVKPAGHDDIPASIVDPEA VK...rekes*rkiscrksc*krsrrs**rrrrsr*rr Frame C: ---QAGNLADDWELLPSKQIKDPKQSKPVDWVDVKEIDDPEDVKPAGHDDIPASIVDPEA VK

  20. Dicty_cDB: SHB255 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available clone: QtrA-10777, 5' end, expressed in brain temporal lobe. 42 2.0 1 CJ476120 |CJ476120.1 Macaca fascicularis...clone: QtrA-10130, 5' end, expressed in brain temporal lobe. 42 2.0 1 CJ467789 |CJ467789.1 Macaca fascicularis

  1. 6 CFR 25.5 - Obligations of seller.

    Science.gov (United States)

    2010-01-01

    ... price of the product, and the possible consequences thereof for development, production, or deployment... the failure to obtain one or more of such waivers adversely affect, the issuance, validity... or subsequent for the issuance, validity, effectiveness, duration, or applicability of a Designation...

  2. Dicty_cDB: VFL255 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rvpsmigsi*--- ---kxnslpvxxlxxx*iixkxxnxxligxfy*nk*ikkk*kki*kkkqlnk*in*link *n Frame C: qqqnnnnnvyni*sskckre*...ikk*dc*fprkktigskgw wkiddsrlsiinh*ndsrn*keyqrsin*rmgkqtifnynskryngsincingnr*kll* l*nvfnvwftrgnirgypr*lgryk--- ---nxilcrsxgxfxxk*fxnxx

  3. Development of tilted fibre Bragg gratings using highly coherent 255 ...

    Indian Academy of Sciences (India)

    2014-02-06

    Feb 6, 2014 ... very efficient source for writing FBGs using phase mask as well as interferometers [4–7]. In this paper, we ... Figure 1 shows the experimental set-up for writing the tilted fibre Bragg grating. High spatial coherent UV .... [1] R Kashyap, Fibre Bragg grating (Academic Press, New York, 1999). [2] T Erdogan and ...

  4. Low-metallicity Star Formation (IAU S255)

    Science.gov (United States)

    Hunt, Leslie K.; Madden, Suzanne C.; Schneider, Raffaella

    2009-01-01

    Preface; SOC and LOC; Participants; Life at the conference; Conference photo; Session I. Population III and Metal-Free Star Formation: 1. Open questions in the study of population III star formation S. C. O. Glover, P. C. Clark, T. H. Greif, J. L. Johnson, V. Bromm, R. S. Klessen and A. Stacy; 2. Protostar formation in the early universe Naoki Yoshida; 3. Population III.1 stars: formation, feedback and evolution of the IMF Jonathan C. Tan; 4. The formation of the first galaxies and the transition to low-mass star formation T. H. Greif, D. R. G. Schleicher, J. L. Johnson, A.-K. Jappsen, R. S. Klessen, P. C. Clark, S. C. O. Glover, A. Stacy and V. Bromm; 5. Low-metallicity star formation: the characteristic mass and upper mass limit Kazuyuki Omukai; 6. Dark stars: dark matter in the first stars leads to a new phase of stellar evolution Katherine Freese, Douglas Spolyar, Anthony Aguirre, Peter Bodenheimer, Paolo Gondolo, J. A. Sellwood and Naoki Yoshida; 7. Effects of dark matter annihilation on the first stars F. Iocco, A. Bressan, E. Ripamonti, R. Schneider, A. Ferrara and P. Marigo; 8. Searching for Pop III stars and galaxies at high redshift Daniel Schaerer; 9. The search for population III stars Sperello di Serego Alighieri, Jaron Kurk, Benedetta Ciardi, Andrea Cimatti, Emanuele Daddi and Andrea Ferrara; 10. Observational search for population III stars in high-redshift galaxies Tohru Nagao; Session II. Metal Enrichment, Chemical Evolution, and Feedback: 11. Cosmic metal enrichment Andrea Ferrara; 12. Insights into the origin of the galaxy mass-metallicity relation Henry Lee, Eric F. Bell and Rachel S. Somerville; 13. LSD and AMAZE: the mass-metallicity relation at z > 3 F. Mannucci and R. Maiolino; 14. Three modes of metal-enriched star formation at high redshift Britton D. Smith, Matthew J. Turk, Steinn Sigurdsson, Brian W. O'Shea and Michael L. Norman; 15. Primordial supernovae and the assembly of the first galaxies Daniel Whalen, Bob Van Veelen, Brian W. O'Shea and Michael L. Norman; 16. Damped Lyα systems as probes of chemical evolution over cosmological timescales Miroslava Dessauges-Zavadsky; 17. Connecting high-redshift galaxy populations through observations of local damped Lyman alpha dwarf galaxies Regina E. Schulte-Ladbeck; 18. Chemical enrichment and feedback in low metallicity environments: constraints on galaxy formation Francesca Matteucci; 19. Effects of reionization on dwarf galaxy formation Massimo Ricotti; 20. The importance of following the evolution of the dust in galaxies on their SEDs A. Schurer, F. Calura, L. Silva, A. Pipino, G. L. Granato, F. Matteucci and R. Maiolino; 21. About the chemical evolution of dSphs (and the peculiar globular cluster ωCen) Andrea Marcolini and Annibale D'Ercole; 22. Young star clusters in the small Magellanic cloud: impact of local and global conditions on star formation Elena Sabbi, Linda J. Smith, Lynn R. Carlson, Antonella Nota, Monca Tosi, Michele Cignoni, Jay S. Gallagher III, Marco Sirianni and Margaret Meixner; 23. Modeling the ISM properties of metal-poor galaxies and gamma-ray burst hosts Emily M. Levesque, Lisa J. Kewley, Kirsten Larson and Leonie Snijders; 24. Dwarf galaxies and the magnetisation of the IGM Uli Klein; Session III. Explosive Events in Low-Metallicity Environments: 25. Supernovae and their evolution in a low metallicity ISM Roger A. Chevalier; 26. First stars - type Ib supernovae connection Ken'ichi Nomoto, Masaomi Tanaka, Yasuomi Kamiya, Nozomu Tominaga and Keiichi Maeda; 27. Supernova nucleosynthesis in the early universe Nozomu Tominaga, Hideyuki Umeda, Keiichi Maeda, Ken'ichi Nomoto and Nobuyuki Iwamoto; 28. Powerful explosions at Z = 0? Sylvia Ekström, Georges Meynet, Raphael Hirschi and André Maeder; 29. Wind anisotropy and stellar evolution Cyril Georgy, Georges Meynet and André Maeder; 30. Low-mass and metal-poor gamma-ray burst

  5. 16 CFR 255.0 - Purpose and definitions.

    Science.gov (United States)

    2010-01-01

    ... in the advertisement. Example 6: An infomercial for a home fitness system is hosted by a well-known... entertainer's views. Example 7: A television advertisement for a housewares store features a well-known female comedian and a well-known male baseball player engaging in light-hearted banter about products each one...

  6. Dicty_cDB: SFI255 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF445056 |CF445056.1 EST681401 normalized cDNA library of onion Allium cepa cDNA clone ACAIF62, mRNA sequen...ce. 46 2e-09 3 CF439652 |CF439652.1 EST675997 normalized cDNA library of onion Al

  7. 255 effects of some heavy metal pollutants on fertility characteristics

    African Journals Online (AJOL)

    DR. AMINU

    2010-06-01

    ) and Zinc (Zn). As Aydinalp and Marinova (2003) observe, a precise knowledge of heavy metals concentration and the forms in which they are found, their dependence on soil's physico-chemical properties provide a basis.

  8. 16 CFR 255.5 - Disclosure of material connections.

    Science.gov (United States)

    2010-01-01

    .... Example 7: A college student who has earned a reputation as a video game expert maintains a personal... exchange for his review of the product, and given the value of the video game system, this fact likely...

  9. Liquid chromatography/tandem mass spectrometry determination of (4S,2RS)-2,5,5-trimethylthiazolidine-4-carboxylic acid, a stable adduct formed between D-(-)-penicillamine and acetaldehyde (main biological metabolite of ethanol), in plasma, liver and brain rat tissues.

    Science.gov (United States)

    Serrano, Elena; Pozo, Oscar J; Beltrán, Joaquin; Hernández, Felix; Font, Laura; Miquel, Marta; Aragon, Carlos M G

    2007-01-01

    Acetaldehyde, the main biological metabolite of ethanol, is nowadays considered to mediate some ethanol-induced effects. Previous studies on alcohol effect attenuation have shown that D-(-)-penicillamine (3-mercapto-D-valine), a thiol amino acid, acts as an effective agent for the inactivation of acetaldehyde. In the study reported here, laboratory rats were treated with ethanol and D-(-)-penicillamine at different doses looking for the interaction (in vivo) of D-(-)-penicillamine with metabolically formed acetaldehyde following a condensation reaction to form the stable adduct (4S,2RS)-2,5,5-trimethylthiazolidine-4-carboxylic acid (TMTCA). A novel and rapid procedure based on liquid chromatography coupled to tandem mass spectrometry (LC/MS/MS) was developed for quantification and reliable identification of TMTCA in different rat tissues, including plasma, liver and brain. Firstly, plasma was obtained from whole blood. Then, proteins were precipitated from plasma, brain and liver extracts with acetonitrile and the clarified extracts diluted 10-fold. A 20 microL aliquot of the final extracts was then analyzed using an Atlantis C18 5 microm, 100x2 mm column which was connected to the electrospray source of a LC/triple quadrupole mass spectrometer. The analyte was detected in positive ion mode acquiring four MS/MS transitions in selected reaction monitoring (SRM) mode. The method has been validated and it has proved to be fast, reliable and sensitive. The accuracy and precision were evaluated by means of recovery experiments from plasma, liver and brain samples fortified at two concentration levels obtaining satisfactory recoveries in all cases: 95 and 105% in plasma (at 10 and 100 ng/mL, respectively), 79 and 89% in brain (100 and 1000 ng/g), 85 and 99% in liver (100 and 1000 ng/g). Precision, expressed as repeatability, was in all tissues analyzed lower than 17% at the two concentrations tested. The estimated detection limits were 1 ng/mL in plasma, 4 ng/g in brain

  10. Una mutación en el gen PARK2 causa enfermedad de Parkinson juvenil en una extensa familia colombiana Mutation c.255delA in the PARK2 gene as cause of juvenile Parkinson´s disease in a large Colombian family

    Directory of Open Access Journals (Sweden)

    Nicolas Pineda Trujillo

    2009-05-01

    Full Text Available

    La enfermedad de Parkinson (EP es común y se   debe   a degeneración de las neuronas dopaminérgicas en la sustancia nigra y en otras áreas del cerebro. Varios genes y mutaciones han sido implicados en ella y la mayoría de estas últimas han sido identificadas en el gen PARK2. Reportamos la evaluación de este gen PARK2 y de su región flanqueante en una gran familia de origen caucano, al suroccidente de Colombia. Los padres son primos hermanos y cuatro de sus diez hijos resultaron afectados en edad juvenil.

     

    La evaluación molecular incluyó tipificación de microsatélites (STR y la secuencia directa de los exones del gen. Nuestros hallazgos evidenciaron la presencia en condición homocigota de la mutación c.255delA, en el exón 2 de PARK2. Además, se pudo identificar un haplotipo portado por ambos padres y presente en condición homocigota en los hijos afectados. Del mismo modo se observó una alta tasa de recombinantes en la extensión de la región cromosómica analizada. La mutación c.255delA en PARK2 ya había sido reportada previamente en familias tanto de Francia como de España.

  11. Movilidad de pacientes y obstáculos a la libre prestación de servicios. A propósito del reintegro de gastos médicos no hospitalarios realizados en otro Estado miembro. Comentario a la Sentencia del Tribunal de Justicia de la Unión Europea de 27 de octubre de 2011. Asunto C-255/09. Comisión/contra Portugal

    Directory of Open Access Journals (Sweden)

    Mª de los Reyes Martínez Barroso

    2014-06-01

    Full Text Available La libre prestación de servicios incluye dos manifestaciones íntimamente ligadas entre sí: la prohibición de cualquier restricción a dicha libertad y la aplicación del principio de tratamiento igual con independencia de la nacionalidad del prestador de servicios. A partir de tal premisa, el Tribunal de Justicia de la Unión Europea ha debido intervenir para solucionar diversos litigios derivados de la prestación de servicios sanitarios o del denominado “turismo sanitario a la carta”. En concreto, a propósito de los gastos de atención médica en otros Estados miembros de la Unión Europea y su posterior reintegro en el Estado de origen del asegurado en función de las normas de Seguridad Social de éste último país. Ante la ausencia de una regulación sobre la cuestión hasta fechas muy recientes (Directiva 2011/24/UE del Parlamento Europeo y del Consejo de 9 de marzo de 2011, relativa a la aplicación de los derechos de los pacientes en la asistencia sanitaria transfronteriza la labor interpretativa efectuada por el órgano jurisdiccional comunitario ha sido determinante para comprender el alcance de esta materia, declarando que solamente respecto de aquellas prestaciones en las que efectivamente pudiera existir una justificación derivada de la sostenibilidad del sistema público, como sucede en las prestaciones sanitarias hospitalarias, procederá la exigencia de una autorización previa. Por el contrario, cuando no se requiere el empleo de materiales pesados y onerosos, la exigencia del requisito de autorización previa resulta contraria al actual art. 56 TFUE (antiguo art. 49 TCE, como determina la sentencia comentada, de 27 de octubre de 2011, Comisión contra Portugal, C-255/09. La protección a ultranza de la libre prestación de servicios sanitarios obliga a reflexionar, por último, sobre la situación de la asistencia sanitaria en nuestro país.

  12. A retrospective study of californium-252 neutron brachytherapy combined with EBRT versus 3D-CRT in the treatment of esophageal squamous cell cancer.

    Science.gov (United States)

    Wang, Qifeng; Li, Tao; Lang, Jinyi; Wang, Jie; Wang, Jian; Liu, Huiming; Jia, Xitang; Liu, Bo; Wang, C-K Chris

    2015-10-24

    We conducted a retrospective analysis on 884 patients who were diagnosed with esophageal squamous cell carcinoma (ESCC) and treated with either the neutron brachytherapy in combination with external beam radiotherapy (NBT + EBRT) or 3-dimensional conformal radiation therapy (3D-CRT) to determine the differences in efficacy and morbidity between the two treatment groups. The 884 ESCC patients treated with either NBT + EBRT or 3D-CRT between 2002 and 2012 were retrospectively reviewed and analyzed. Multivariable Cox regression was used to compare oncologic outcomes of the two groups of patients in the context of other clinically relevant variables. The acute and chronic toxicities associated with the two groups were compared using Fisher exact and log-rank tests, respectively. Among the 884 patients, 545 received NBT + EBRT and 339 received 3D-CRT (i.e. EBRT-only). The age range is 39-95 years (median 66). The follow-up time range is 3-145 months (median 32). The analysis shows that the NBT + EBRT group has higher overall survival rate and local control rate than that of the 3D-CRT group. The acute toxicity effects were acceptable for both groups of patients with the NBT + EBRT group showing higher rates of leukopenia and thrombocytopenia and the 3D-CRT group showing higher rates on fistula and massive bleeding. The patients treated with NBT + EBRT showed better oncologic outcomes than those treated with 3D-CRT. The toxicity effects were acceptable for both groups with the NBT + EBRT group showing higher rates on the acute effects and the 3D-CRT group showing higher rates on the late effects.

  13. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in 248Cm samples for transmutation studies

    Energy Technology Data Exchange (ETDEWEB)

    Gourgiotis, A.; Isnard, H.; Aubert, M.; Dupont, E.; AlMahamid, I.; Cassette, P.; Panebianco, S.; Letourneau, A.; Chartier, F.; Tian, G.; Rao, L.; Lukens, W.

    2011-02-01

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (INcineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in {sup 248}Cm ({approx}97 %) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides formations ranged from 0.3% to 1.3%. This uncertainties range is quite acceptable for the nuclear data to be used in transmutation studies.

  14. Radiological Characterization Technical Report on Californium-252 Sealed Source Transuranic Debris Waste for the Off-Site Source Recovery Project at Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Feldman, Alexander [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-04-24

    This document describes the development and approach for the radiological characterization of Cf-252 sealed sources for shipment to the Waste Isolation Pilot Plant. The report combines information on the nuclear material content of each individual source (mass or activity and date of manufacture) with information and data on the radionuclide distributions within the originating nuclear material. This approach allows for complete and accurate characterization of the waste container without the need to take additional measurements. The radionuclide uncertainties, developed from acceptable knowledge (AK) information regarding the source material, are applied to the summed activities in the drum. The AK information used in the characterization of Cf-252 sealed sources has been qualified by the peer review process, which has been reviewed and accepted by the Environmental Protection Agency.

  15. An audit of the insulin-tolerance test in 255 patients with pituitary disease

    DEFF Research Database (Denmark)

    Lange, Martin; Svendsen, Ole L; Skakkebaek, Niels E

    2002-01-01

    The insulin-tolerance test (ITT) is currently considered to be the gold standard for evaluating adults suspected of GH deficiency (GHD). The aim of this study was to determine factors that may influence nadir blood glucose (BG) when using a mean insulin dose of 0.1 IU/kg body weight. Furthermore...

  16. ASYMMETRY VIRTUAL POLITICAL SPACE. RESULTS THE COMPARATIVE ANALYSIS OF 255 NATIONAL DOMAINS INTERNET

    Directory of Open Access Journals (Sweden)

    D. S. Barinov

    2011-01-01

    Full Text Available Abstract: The article examines interrelationship between traditional national sovereignty and autonomy in Internet reflected in the presence of the national domain. Moreover the author analyses existing misbalances in substantive filling of national domains, testifying various levels of stateness in virtual political space.

  17. 40 CFR 725.255 - Information to be included in the TERA.

    Science.gov (United States)

    2010-07-01

    ... TERA must submit phenotypic and ecological characteristics information required in § 725.155(d)(3) as..., geographical, physical, chemical, and biological features, proximity to human habitation or activity, and... notification. (2) Information on monitoring, confinement, mitigation, and emergency termination procedures. (i...

  18. Phase II : correlation between experimental and finite element analysis : Alaska bridge 255-Chulitna River bridge.

    Science.gov (United States)

    2014-09-01

    In this study, we will monitor the behavior of the Alaska Chulitna Bridge for the specific purpose of assisting the DOT in performing an accurate : condition assessment of this bridge. : Based on the state-of-the-art SHM knowledge and technologies wi...

  19. Genome Sequence of the Chemolithoautotrophic Nitrite-Oxidizing Bacterium Nitrobacter winogradskyi Nb-255

    OpenAIRE

    Starkenburg, Shawn R.; Chain, Patrick S. G.; Sayavedra-Soto, Luis A.; Hauser, Loren; Land, Miriam L.; Larimer, Frank W.; Stephanie A Malfatti; Klotz, Martin G.; Bottomley, Peter J.; Arp, Daniel J.; Hickey, William J.

    2006-01-01

    The alphaproteobacterium Nitrobacter winogradskyi (ATCC 25391) is a gram-negative facultative chemolithoautotroph capable of extracting energy from the oxidation of nitrite to nitrate. Sequencing and analysis of its genome revealed a single circular chromosome of 3,402,093 bp encoding 3,143 predicted proteins. There were extensive similarities to genes in two alphaproteobacteria, Bradyrhizobium japonicum USDA110 (1,300 genes) and Rhodopseudomonas palustris CGA009 CG (815 genes). Genes encodin...

  20. Genome sequence of the chemolithoautotrophic nitrite-oxidizing bacterium Nitrobacter winogradskyi Nb-255

    Energy Technology Data Exchange (ETDEWEB)

    Hauser, Loren John [ORNL; Land, Miriam L [ORNL; Larimer, Frank W [ORNL; Arp, D J [Oregon State University; Hickey, W J [University of Wisconsin, Madison

    2006-03-01

    The alphaproteobacterium Nitrobacter winogradskyi (ATCC 25391) is a gram-negative facultative chemolithoautotroph capable of extracting energy from the oxidation of nitrite to nitrate. Sequencing and analysis of its genome revealed a single circular chromosome of 3,402,093 bp encoding 3,143 predicted proteins. There were extensive similarities to genes in two alphaproteobacteria, Bradyrhizobium japonicum USDA110 (1,300 genes) and Rhodopseudomonas palustris CGA009 CG (815 genes). Genes encoding pathways for known modes of chemolithotrophic and chemoorganotrophic growth were identified. Genes encoding multiple enzymes involved in anapleurotic reactions centered on C2 to C4 metabolism, including a glyoxylate bypass, were annotated. The inability of N. winogradskyi to grow on C6 molecules is consistent with the genome sequence, which lacks genes for complete Embden-Meyerhof and Entner-Doudoroff pathways, and active uptake of sugars. Two gene copies of the nitrite oxidoreductase, type I ribulose-1,5-bisphosphate carboxylase/oxygenase, cytochrome c oxidase, and gene homologs encoding an aerobic-type carbon monoxide dehydrogenase were present. Similarity of nitrite oxidoreductases to respiratory nitrate reductases was confirmed. Approximately 10% of the N. winogradskyi genome codes for genes involved in transport and secretion, including the presence of transporters for various organic-nitrogen molecules. The N. winogradskyi genome provides new insight into the phylogenetic identity and physiological capabilities of nitrite-oxidizing bacteria. The genome will serve as a model to study the cellular and molecular processes that control nitrite oxidation and its interaction with other nitrogen-cycling processes.

  1. Genome sequence of the chemolithoautotrophic nitrite-oxidizing bacterium Nitrobacter winogradskyi Nb-255.

    Science.gov (United States)

    Starkenburg, Shawn R; Chain, Patrick S G; Sayavedra-Soto, Luis A; Hauser, Loren; Land, Miriam L; Larimer, Frank W; Malfatti, Stephanie A; Klotz, Martin G; Bottomley, Peter J; Arp, Daniel J; Hickey, William J

    2006-03-01

    The alphaproteobacterium Nitrobacter winogradskyi (ATCC 25391) is a gram-negative facultative chemolithoautotroph capable of extracting energy from the oxidation of nitrite to nitrate. Sequencing and analysis of its genome revealed a single circular chromosome of 3,402,093 bp encoding 3,143 predicted proteins. There were extensive similarities to genes in two alphaproteobacteria, Bradyrhizobium japonicum USDA110 (1,300 genes) and Rhodopseudomonas palustris CGA009 CG (815 genes). Genes encoding pathways for known modes of chemolithotrophic and chemoorganotrophic growth were identified. Genes encoding multiple enzymes involved in anapleurotic reactions centered on C2 to C4 metabolism, including a glyoxylate bypass, were annotated. The inability of N. winogradskyi to grow on C6 molecules is consistent with the genome sequence, which lacks genes for complete Embden-Meyerhof and Entner-Doudoroff pathways, and active uptake of sugars. Two gene copies of the nitrite oxidoreductase, type I ribulose-1,5-bisphosphate carboxylase/oxygenase, cytochrome c oxidase, and gene homologs encoding an aerobic-type carbon monoxide dehydrogenase were present. Similarity of nitrite oxidoreductases to respiratory nitrate reductases was confirmed. Approximately 10% of the N. winogradskyi genome codes for genes involved in transport and secretion, including the presence of transporters for various organic-nitrogen molecules. The N. winogradskyi genome provides new insight into the phylogenetic identity and physiological capabilities of nitrite-oxidizing bacteria. The genome will serve as a model to study the cellular and molecular processes that control nitrite oxidation and its interaction with other nitrogen-cycling processes.

  2. 24 CFR 960.255 - Self-sufficiency incentives-Disallowance of increase in annual income.

    Science.gov (United States)

    2010-04-01

    ...) Definitions. The following definitions apply for purposes of this section. Disallowance. Exclusion from annual... for needy families funded under Part A of Title IV of the Social Security Act, as determined by the PHA in consultation with the local agencies administering temporary assistance for needy families...

  3. Yeast Interacting Proteins Database: YIL106W, YBR255W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available for the activation and Cdc15p-dependent phosphorylation of the Dbf2p kinase; required for cytokinesis and cell separation...r the activation and Cdc15p-dependent phosphorylation of the Dbf2p kinase; required for cytokinesis and cell separation

  4. Yeast Interacting Proteins Database: YDL239C, YPL255W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YDL239C ADY3 Protein required for spore wall formation, thought to mediate assembly...ait ORF YDL239C Bait gene name ADY3 Bait description Protein required for spore wall formation, thought to m

  5. Yeast Interacting Proteins Database: YEL062W, YPL255W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available iates downregulation of TOR Complex 1 activity in response to amino acid limitation; transcription is induce...regulation of TOR Complex 1 activity in response to amino acid limitation; transcription is induced in respo

  6. 20 CFR 255.4 - Persons from whom overpayments may be recovered.

    Science.gov (United States)

    2010-04-01

    ... (3). C, a child of a deceased employee by his first marriage, is receiving a disability annuity on... marries without notifying the Board. Marriage terminates a child's annuity. W is not aware of C's marriage. Upon discovery of C's marriage, the Board demands that C refund the overpaid annuities; C refuses. Even...

  7. : tous les projets | Page 255 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Participation des jeunes femmes à la vie politique en Tunisie : mobilisation institutionnelle et non structurée. Projet. Le programme Droits des femmes et participation citoyenne (DFPC) du CRDI appuie un ensemble de recherches comparatives visant à déterminer si les institutions de démocratie et de gouvernance tiennent ...

  8. 40 CFR 60.255 - Performance tests and other compliance requirements.

    Science.gov (United States)

    2010-07-01

    ... in paragraph (h) of this section. (i) If any 6-minute average opacity reading in the most recent... certified neutral density filter or other related technique to produce a known obscuration of the light beam... 40 Protection of Environment 6 2010-07-01 2010-07-01 false Performance tests and other compliance...

  9. An audit of the insulin-tolerance test in 255 patients with pituitary disease

    DEFF Research Database (Denmark)

    Lange, Martin; Svendsen, Ole L; Skakkebaek, Niels E

    2002-01-01

    The insulin-tolerance test (ITT) is currently considered to be the gold standard for evaluating adults suspected of GH deficiency (GHD). The aim of this study was to determine factors that may influence nadir blood glucose (BG) when using a mean insulin dose of 0.1 IU/kg body weight. Furthermore,...

  10. 20 CFR 645.255 - What nondiscrimination protections apply to participants in Welfare-to-Work programs?

    Science.gov (United States)

    2010-04-01

    ... funds, shall not be discriminated against because of gender. Participants alleging gender discrimination... subpart (section 403(a)(5)(J)(iii)) of the Act). Participants alleging gender discrimination in WtW... under all applicable Federal, State and local laws prohibiting discrimination, and their implementing...

  11. SU-F-T-255: Accuracy and Precision of Dynamic Tracking Irradiation with VERO-4DRT System

    Energy Technology Data Exchange (ETDEWEB)

    Hayashi, N [Graduate school of Health Sciences, Fujita Health University, Tayoake, Aichi (Japan); Takada, Y; Mizuno, T; Nakae, H [Department of Radiology, Ogaki Tokushukai Hospital, Ogaki, Gifu (Japan); Murai, T [Department of Radiation Oncology, Nagoya City University, Nagoya, Aichi (Japan)

    2016-06-15

    Purpose: The VERO-4DRT system is able to provide dynamic tracking irradiation (DTI) for the target with respiratory motion. This technique requires enough commissioning for clinical implementation. The purpose of this study is to make sure the accuracy and precision of DTI using VERO- 4DRT through commissioning from fundamental evaluation to end-to-end test. Method: We evaluated several contents for DTI commissioning: the accuracy of absorption dose at isocenter in DTI, the field size and penumbra of DTI, the accuracy of 4D modeling in DTI. All evaluations were performed by respiratory motion phantom (Quasar phantom). These contents were compared the results between static irradiation and DTI. The shape of radiation field was set to square from 3 cm × 3 cm to 10 cm × 10 cm. The micro 3D chamber and Gafchromic EBT3 film were used for absorbed dose and relative dose distribution measurement, respectively. The sine and irregular shaped waves were used for demonstrative respiratory motion. The visicoil was implanted into the phantom for guidance of respiratory motion. The respiration patterns of frequency and motion amount were set to 10–15 BPM and 1–2 cm, respectively. Results: As the result of absorbed dose of DTI in comparison with static irradiation, the average dose error at isocenter was 0.5% even though various respiratory patterns were set on. As the result of relative dose distribution, the field size (set it on 50% dose line) was not significantly changed in all respiratory patterns. However, the penumbra was larger in greater respiratory motion (up to 4.1 mm). The 4D modeling coincidence between actual and created waves was within 1%. Conclusion: The DTI using VERO-4DRT can provide sufficient accuracy and precision in absorbed dose and distribution. However, the patientspecific quantitative internal margin corresponding respiratory motion should be taken into consideration with image guidance.

  12. 41 CFR 102-74.255 - How must occupant evacuation or relocation be accomplished when there is immediate danger to...

    Science.gov (United States)

    2010-07-01

    ... danger to persons or property, such as fire, explosion or the discovery of an explosive device (not... immediate danger to persons or property, such as fire, explosion or the discovery of an explosive device... evacuation or relocation be accomplished when there is immediate danger to persons or property, such as fire...

  13. SU-E-T-255: Development of a Michigan Quality Assurance (MQA) Database for Clinical Machine Operations

    Energy Technology Data Exchange (ETDEWEB)

    Roberts, D [University of Michigan Hospital, Ann Arbor, MI (United States)

    2015-06-15

    Purpose: A unified database system was developed to allow accumulation, review and analysis of quality assurance (QA) data for measurement, treatment, imaging and simulation equipment in our department. Recording these data in a database allows a unified and structured approach to review and analysis of data gathered using commercial database tools. Methods: A clinical database was developed to track records of quality assurance operations on linear accelerators, a computed tomography (CT) scanner, high dose rate (HDR) afterloader and imaging systems such as on-board imaging (OBI) and Calypso in our department. The database was developed using Microsoft Access database and visual basic for applications (VBA) programming interface. Separate modules were written for accumulation, review and analysis of daily, monthly and annual QA data. All modules were designed to use structured query language (SQL) as the basis of data accumulation and review. The SQL strings are dynamically re-written at run time. The database also features embedded documentation, storage of documents produced during QA activities and the ability to annotate all data within the database. Tests are defined in a set of tables that define test type, specific value, and schedule. Results: Daily, Monthly and Annual QA data has been taken in parallel with established procedures to test MQA. The database has been used to aggregate data across machines to examine the consistency of machine parameters and operations within the clinic for several months. Conclusion: The MQA application has been developed as an interface to a commercially available SQL engine (JET 5.0) and a standard database back-end. The MQA system has been used for several months for routine data collection.. The system is robust, relatively simple to extend and can be migrated to a commercial SQL server.

  14. Africa’s Irregular Security Threats: Challenges for U.S. Engagement (Strategic Forum, Number 255, May 2010)

    Science.gov (United States)

    2010-05-01

    stripping assets from civil- ian populations, trading in gemstones and strategic resources such as oil, tin, or coltan , and extorting “taxes” on aid and...the Uranium Mining Company of Franceville came under scru- tiny for dumping 2 million tons of radioactive waste in southeast Gabon, which leached...Press and Potomac Books, 2007). 13 See Reuven Paz and Moshe Terdman, “Africa: The Gold Mine of Al-Qaeda and Global Jihad,” PRISM Occasional Papers 4

  15. Demaria C., 2004, Développement durable et finance, Paris : Maxima Laurent du Mesnil Editeur, 255 p.

    Directory of Open Access Journals (Sweden)

    Marianne Rubinstein

    2005-05-01

    Full Text Available L’objectif de l’ouvrage de Cyril Demaria est de mettre à jour le lien existant entre développement durable et logique financière, de traiter du paradoxe apparent selon lequel la transition des sociétés vers le développement durable doit plus aux forces de marché qu’à toute autre dynamique : « le fait que les principaux leviers au service du développement durable soient les fonds d’investissement et les marchés financiers rompt donc avec une vision ‘révolutionnaire’ associée au développement d...

  16. 40 CFR 1068.255 - What are the provisions for exempting engines and fuel-system components for hardship for...

    Science.gov (United States)

    2010-07-01

    ... corporate name and trademark. (iii) Engine displacement (in liters or cubic centimeters) and model year of... engines and fuel-system components for hardship for equipment manufacturers and secondary engine...) AIR POLLUTION CONTROLS GENERAL COMPLIANCE PROVISIONS FOR ENGINE PROGRAMS Exemptions and Exclusions...

  17. 78 FR 62329 - Special Local Regulation; Tennessee River, Miles 255.0 to 256.5, Florence, AL

    Science.gov (United States)

    2013-10-17

    ... pursuant to authority under section 4(a) of the Administrative Procedure Act (APA) (5 U.S.C. 553(b)). This.... Civil Justice Reform This rule meets applicable standards in sections 3(a) and 3(b)(2) of Executive.... Technical Standards This rule does not use technical standards. Therefore, we did not consider the use of...

  18. ARL: A Bimonthly Report on Research Library Issues and Actions from ARL, CNI, and SPARC. Number 255

    Science.gov (United States)

    Barrett, G. Jaia, Ed.

    2007-01-01

    ARL is the bimonthly report on research library issues and actions from ARL (Association of Research Libraries), CNI (Coalition of Networked Information), and SPARC (Scholarly Publishing and Academic Resources Coalition). ARL reports on current issues of interest to academic and research library administrators, staff, and users; higher education…

  19. Muscle power and repeated sprint ability in soccer players DOI: 10.5007/1980-0037.2010v12n4p255

    Directory of Open Access Journals (Sweden)

    Juliano Dal Pupo

    2010-01-01

    Full Text Available Muscle power is one of the most important physical qualities of soccer player performance and needs to be maintained during a match. Thus, the aim of this study was to investigate the levels of muscle power in soccer players before and after performing repeated sprints (RS, and the association between power and RS performance. Twenty soccer players from the under-20 category aged 18-20 years participated in this study. The study consisted of the execution of vertical jumps, execution of RS, new execution of vertical jumps, and collection of blood samples. The continuous jump (CJ test was performed on a piezoelectric force platform for the measurement of muscle power and the RAST test was used to evaluate RS ability. No significant difference in the levels of muscle power was observed after RS (p=0.57. Significant differences were observed in the first to fifth sprint times (p< 0.01, but not between the fifth and sixth sprint (p=0.06. CJ height before RS was correlated with first sprint time (r=-0.62, p< 0.01, best sprint time (r=-0.60, p< 0.01, and average sprint time (r= -0.54, p<0.01. In conclusion, the soccer players studied showed no significant reduction in muscle power after RS. A decrease in performance was observed from the first to the fifth sprint, but not between the fifth and sixth sprint. The muscle power of soccer players was a determinant factor to perform one maximum sprint, as well as successive sprints.

  20. Book Review: Aullón de Haro, P. (2016, La Escuela Universalista Española del siglo XVIII. Madrid: Sequitur, pp. 255.

    Directory of Open Access Journals (Sweden)

    Esther Zarzo

    2017-07-01

    Full Text Available Recently published by the Madrid publishing house Sequitur, La Escuela Universalista Española del siglo XVIII is an introductory work to a study of the so-called Universalist School. Its author, Pedro Aullón de Haro from the University of Alicante, Spain, and Head of the Research Group “Humanism-Europe” since 1994, has coordinated various volumes whose main objective is the historical reconstruction of the Late Spanish Enlightenment Period, which was truncated by Charles III of Spain’s expulsion of the Jesuits, affecting a great many of its members. This Enlightenment Period, in contrast to the victorious French Enlightenment, offered not a political, but a scientific and humanistic view of knowledge, taking a comparative and universalist approach, but, due to the aforementioned expulsion of the Jesuits, the authors dispersed, leaving their work unfinished; and it is only now, under the label of the Universalist School, coined by Prof. Aullón de Haro, that they have been gathered together furthering the possibility of recovering their meaning and systematic cohesion. This volume serves as an introduction to the publications that the author has announced for 2018, in which the detailed study of the main authors within this scientific community will be undertaken following an encyclopaedic structure, which will finally give recognition to the Universalist School movement, and whose stand out authors include: Juan Andrés, creator of the Universal History of the Humanities and Sciences; Lorenzo Hervás y Panduro, creator of Universal and Comparative Linguistics; and Antonio Eximeno, creator of a universal aesthetic concept of music as language and expression. The common thread of the School is precisely the "universalist ideation" that assumes the unity of knowledge in a harmonious integration of experimental sciences, fine arts and human sciences within a humanistic epistemological framework, and consequently, comparativism as a methodology of study, based on the unity of its object: the destiny of man, with his knowledge integrated into a unitary vision of the universe and the world. All this is ultimately based on the work of Dionysius of Halicarnassus, historically rooted in the process of Greco-Roman cultural parallels, and with the main figures of Macrobius, Scaliger and Morhof. Furthermore, 2017 is the second centenary of the death of Juan Andrés, commemorated by an international Congress held at the Complutense University of Madrid and featuring an important bibliographical exhibition in the History Library of this Madrid University, titled "Juan Andres y la Escuela Universalista Española" (2017. The great scientific and thematic scope of the School means that it is possible to discern several sectors or "sub-schools", although the authors often practice several disciplines: the linguistic sub-school (Hervás and his extensive circle of collaborators, bibliographical (Miguel de Casiri, Diosdado Caballero…, botanical-naturalist (Antonio José Cavanilles, Pedro Franco Dávila, Juan José Ruperto de Cuéllar, José Celestino Mutis, Eduardo Romeo…, musicological (Antonio Eximeno, Josef Pintado, Vicente Requeno, Buenaventura Prats, Joaquín Millás…, Americanist-Mexicanist (Francisco Javier Clavijero, Juan Bautista Muñoz, Miguel del Barco González, José Lino Fábregas, Juan Nuix y Perpiñá…, on the Philippines (Juan de la Concepción, Antonio de Tornos, Bernardo Bruno de la Fuente…, meteorology (Andrés, Viñes, Faura…, studies on translation (Carlos Andrés, Juan Bautista Colomés, Pedro Cantón… etc. The work is divided into three sections: "Teoría general", "Textos de y sobre autores de la Escuela", and "Bibliografía fundamental y selecta". The first section begins with an introductory chapter in which the conceptual principles of the School are explained in relation to the particularity of the Hispanic cultural history, where both its antecedents and theoretical limits are determined. Next comes a description of the sequence of milestones, historical circumstances and accidents that resulted in the formation of the School, as well as an in-depth explanation of the concept of "universalist ideation". Finally, "La ideación del primer programa epistemológico", is a necessary exposition of the important and almost inaccessible Prospectus Philosophiae Universae, a work that was written and directed by Juan Andrés. It is a general and pluridisciplinary programmatic text published in 1773 in Ferrara, and access to it for consultation is hard to come by. That is, it is a kind of program that intends to carry out a radical overcoming of the culture and thought of the Baroque era, through the integration of empiricist science and philosophy with classical humanism and its evolution through a historically founded and revisable concept of progress. The fourth chapter, entitled "La Ilustración universalista: creación de la Comparatística moderna y Literatura Universal", lists the conceptual keys to understanding the particularity of this late Spanish age of Enlightenment of Hispanic-Italian roots, Christian, integrative, international, intercontinental, founded on a unitary vision of the universe and the world. The fifth chapter, "La clasificación de las ciencias, la universalidad tematológica y la estética de la expresión", analyses the variables of the Enlightenment Period, the various types of European illustrations and their internal conceptual sectors, in an attempt to bring to light the lack of historical and intellectual homogeneity of a process of great relevance, and analyses the universalistic classification of scientific disciplines by comparison with the classification of the French illustration, showing the flagrant reduction of the French classification, and also includes a revealing study on the concept of "expression" elaborated by Antonio Eximeno, which was later also recovered by Benedetto Croce, although without him acknowledging the precedence of Eximeno’s work. The second part, "Textos de y sobre autores de la Escuela", presents a series of documents as a critical support of the School and its authors. This is especially true of the textual references from the three main authors with respect to the other members of the School, which provides an account of the indisputable existence of a productive and active scientific community. The last part records essential bibliographical sources and information intended to enable a continuation of the study by the authors of this School, a bibliographic selection of the most important works of all the members of the School, and another selection of general and monographic studies on relevant theoretical, historical and cultural issues. In short, this work succeeds in refuting one of the most important historical and intellectual fallacies of our time: the absence of a Spanish Enlightenment Period, and consequently, proves the existence of an original and consistent modern Hispanic thought. In this way, it opens up a field of study that demands new research that will bring to light better-informed reinterpretations of both Spanish and Hispanic America pasts in general, which will lead to a search for unity, not in political and economic terms, as seems to be the objective of economic globalization, but on the basis of the concept of universality. For this purpose, the Research Group Humanismo-Europa has affiliated itself with the Instituto Juan Andrés de Comparatística y Globalización, as well created links to its online network Biblioteca HumanismoEuropa, where all the information about the authors of the School and their texts has been gathered and made available to the general public.

  1. The Exiguobacterium sibiricum 255-15 GtfC Enzyme Represents a Novel Glycoside Hydrolase 70 Subfamily of 4,6-α-Glucanotransferase Enzymes

    OpenAIRE

    Gangoiti, Joana; Pijning, Tjaard; Dijkhuizen, Lubbert

    2016-01-01

    The glycoside hydrolase 70 (GH70) family originally was established for glucansucrase enzymes found solely in lactic acid bacteria synthesizing α-glucan polysaccharides from sucrose (e.g., GtfA). In recent years, we have characterized GtfB and related Lactobacillus enzymes as 4,6-α-glucanotransferase enzymes. These GtfB-type enzymes constitute the first GH70 subfamily of enzymes that are unable to act on sucrose as a substrate but are active with maltodextrins and starch, cleave α1→4 linkages...

  2. The Exiguobacterium sibiricum 255-15 GtfC enzyme representing a novel glycoside hydrolase 70 subfamily of 4,6-α-glucanotransferase enzymes

    NARCIS (Netherlands)

    Gangoiti, Joana; Pijning, Tjaard; Dijkhuizen, Lubbert

    2015-01-01

    The Glycoside Hydrolase (GH) family 70 originally was established for glucansucrase enzymes, solely found in lactic acid bacteria, synthesizing α-glucan polysaccharides from sucrose (e.g. GtfA). In recent years we have characterized GtfB and related Lactobacillus enzymes as 4,6-α-glucanotransferase

  3. Falcón y Tella, María José. (2015). Derecho y literatura. Madrid: Marcial Pons. 255 pp.

    OpenAIRE

    Nuria Cuadrado Gamarra

    2015-01-01

    Quienes tenemos el privilegio de haber conocido y trabajado con la profesora Falcón nos sentimos en deuda con ella por habernos siempre abierto el camino –y la mente– hacia nuevos campos de investigación. En esta ocasión, la autora de “Derecho y literatura” se adentra en un terreno más humanista y artístico –como ella misma refiere en la Introducción– del ámbito jurídico. Estructura su estudio en torno a cuatro propuestas, no necesariamente innovadoras todas ellas, aunque sí bien expuestas, f...

  4. Falcón y Tella, María José. (2015. Derecho y literatura. Madrid: Marcial Pons. 255 pp.

    Directory of Open Access Journals (Sweden)

    Nuria Cuadrado Gamarra

    2015-12-01

    Full Text Available Quienes tenemos el privilegio de haber conocido y trabajado con la profesora Falcón nos sentimos en deuda con ella por habernos siempre abierto el camino –y la mente– hacia nuevos campos de investigación. En esta ocasión, la autora de “Derecho y literatura” se adentra en un terreno más humanista y artístico –como ella misma refiere en la Introducción– del ámbito jurídico. Estructura su estudio en torno a cuatro propuestas, no necesariamente innovadoras todas ellas, aunque sí bien expuestas, fundadas y sistematizadas, cuya base es la clasificación articulada en el “Law and Literature Movement”: el “Derecho de la Literatura”, “Derecho como Literatura”, la “Literatura en el Derecho” y, finalmente el “Derecho en la Literatura”.

  5. 5-tert-Butyl-2-[5-(5-tert-butyl-1,3-benzoxazol-2-yl-2-thienyl]-1,3-benzoxazole

    Directory of Open Access Journals (Sweden)

    Fang-Fang Jian

    2008-12-01

    Full Text Available The title compound, C26H26N2O2S, was prepared by the reaction of thiophene-2,5-dicarboxylic acid and 2-amino-4-tert-butylphenol. One of the tert-butyl groups is disordered over two conformations, with occupancies of 0.539 (1 and 0.461 (2. The two 1,3-benzoxazole rings are almost planar, with dihedral angles of 0.83 (18 and 1.64 (17° between the five- and six-membered rings. The thiophene ring makes dihedral angles of 21.54 (19 and 4.49 (18° with the planes of the five-membered oxazole rings. The crystal packing is controlled by π–π stacking interactions involving the thiophene and benzene rings, with a centroid–centroid distance of 3.748 (2 Å.

  6. Retrieval of atmospheric boundary layer height by CSIR NLC mobile LIDAR, Pretoria (25.5° S; 28.2° E), South Africa

    CSIR Research Space (South Africa)

    Sivakumar, V

    2011-07-01

    Full Text Available In this paper, the authors present the preliminary methods for detection of the boundary layer based on backscattered signals from a mobile LIDAR (LIght Detection And Ranging) developed at Council for Scientific and Industrial Research (CSIR...

  7. Ewa Głażewska, Urszula Kusio, Komunikacja niewerbalna. Płeć i kultura. Wybrane zagadnienia, Lublin, Wydawnictwo Uniwersytetu Marii Curie-Skłodowskiej, 2012, 255 s., ISBN 978-83-7784-177-8

    Directory of Open Access Journals (Sweden)

    Paulina Banaśkiewicz

    2014-07-01

    Full Text Available Autorka recenzji opisuje pokrótce zawartość dwóch części książki na temat komunikacji niewerbalnej celem skupienia się na trzech walorach publikacji: konstrukcji książki, prezentacji niezbyt dobrze znanych w Polsce koncepcji wybitnych antropologów i socjologów oraz liczebności eksplikacji, które służą zilustrowaniu rozważań teoretycznych.English abstractThe author briefly describes the contents of the two parts of the book about non-verbal communication to focus on three qualities: design of the book, not very well known in Poland concepts of eminent anthropologists and sociologists and the number of explications, which illustrate the theoretical considerations. 

  8. A proposta estética em Quarto de despejo, de Carolina de Jesus DOI - 10.5752/P.2358-3428.2014v18n35p255

    Directory of Open Access Journals (Sweden)

    Elzira Divina Perpétua

    2014-12-01

    Full Text Available O centenário de nascimento de Carolina Maria de Jesus, comemorado em 2014, abre diversas perspectivas de estudos da obra da escritora, imortalizada em seu primeiro diário como voz coletiva da favela do Canindé nos anos 1960, de cujas páginas vemos também emergir uma personalidade singular em sua luta pessoal para manter-se íntegra e lúcida através da escrita. Ao expor o desejo da autora de se projetar longe da miséria, marcando sua diferença na escrita, Quarto de despejo compõe a poética que a consagrou e inaugura uma nova proposta estética.Palavras-chave: Diário. Estética. Carolina de Jesus. Quarto de despejo.

  9. Discovery of isotopes of the transuranium elements with 93≤Z≤98

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-01-15

    One hundred and five isotopes of the transuranium elements neptunium, plutonium, americium, curium, berkelium, and californium have been observed so far; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  10. Separation of Transplutonium Elements from Neutron Irradiated Americium-241

    National Research Council Canada - National Science Library

    UENO, Kaoru; WATANABE, Kenju; SAGAWA, Chiaki; ISHIMORI, Tomitaro

    1974-01-01

    .... The ratios of the amounts present of these isotopes were determined by mass spectrometry. It was not possible to identify 249Bk in the berkelium fraction owing to the interference from other β-ray emitting nuclides. In the californium fraction, both spontaneous fission and a-activities due to 250, 252 were observed.

  11. Neutron-Activated Gamma-Emission: Technology Review

    Science.gov (United States)

    2012-01-01

    flux sources developed for boron neutron capture therapy ( BNCT ), found to be an experimental success in cancer treatment (26). 30 Improved flux on...achievable Am americium API associated particle imaging B boron Be beryllium BNCT boron neutron capture therapy C carbon Cf californium Cl

  12. ORF Alignment: NC_006449 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available LNDSKKIPKSKHEAIYNQVMKEAVAVGI 60 ... Query: 196 IAAASIVAKVTRDKMMADYEQEFPGYAFAKNAGYGTK...EHLSGIDKFGVTPIHRRSFEPIK 255 ... IAAASIVAKVTRDKMMADYEQEFPGYAFAKNAGYGTKEHLSGIDKFGVTPIHRRSFEPIK Sbjct: 121 IAAASIVAKVTRDKMMADYEQEFPGYAFAKNAGYGTKEHLSGIDKFGVTPIHRRSFEPIK 180 ...

  13. ORF Alignment: NC_006448 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available LNDSKKIPKSKHEAIYNQVMKEAVAVGI 60 ... Query: 196 IAAASIVAKVTRDKMMADYEQEFPGYAFAKNAGYGTK...EHLSGIDKFGVTPIHRRSFEPIK 255 ... IAAASIVAKVTRDKMMADYEQEFPGYAFAKNAGYGTKEHLSGIDKFGVTPIHRRSFEPIK Sbjct: 121 IAAASIVAKVTRDKMMADYEQEFPGYAFAKNAGYGTKEHLSGIDKFGVTPIHRRSFEPIK 180 ...

  14. Solid-State Neutron Multiplicity Counting System Using Commercial Off-the-Shelf Semiconductor Detectors

    Energy Technology Data Exchange (ETDEWEB)

    Rozhdestvenskyy, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-08-09

    This work iterates on the first demonstration of a solid-state neutron multiplicity counting system developed at Lawrence Livermore National Laboratory by using commercial off-the-shelf detectors. The system was demonstrated to determine the mass of a californium-252 neutron source within 20% error requiring only one-hour measurement time with 20 cm2 of active detector area.

  15. Cold valleys in the radioactive decay of 248−254Cf isotopes

    Indian Academy of Sciences (India)

    Geiger–Nuttal plots of log10(T1/2) vs. Q−1/2 for 48−52Ca emitting from various californium isotopes. Acknowledgement. One of the authors (KPS) would like to thank University Grants Commis- sion, Govt. of India for the financial support under project No. MRP(S)-. 352/2005(X Plan)/KLKA 002/UGC-SWRO. References.

  16. Directed evolution of the periodic table: probing the electronic structure of late actinides.

    Science.gov (United States)

    Marsh, M L; Albrecht-Schmitt, T E

    2017-07-25

    Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.

  17. Open Source: Potential in Latin America for Radiological Weapons

    Science.gov (United States)

    2010-03-01

    terrorist group would need to acquire a radioactive isotope with a relatively short half-life. 36,37 As an aside, the IAEA verified that depleted...cns.miis.edu/npr/pdfs/123salama.pdf (accessed March 3, 2010), Useful RDD isotopes include cobalt-60, strontium-90, yttrium-90, iridium-192, cesium-137...plutonium-238, radium -226, americium-241, and californium-252. 37 Hansell and Salama, “Does intent equal capability?,” 640-641. 38 Internation Atomic

  18. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC255 (Link to dictyBase) - - - Contig-U16272-1 VFC255P (Link... to Original site) VFC255F 198 VFC255Z 525 VFC255P 723 - - Show VFC255 Library VF (Link to library) Clone ID VFC255 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16272-1 Original site URL http://dict...oducing significant alignments: (bits) Value N L08391 |L08391.1 Dictyostelium discoideum ribosomal protein (...ic 32.0 %: nuclear 4.0 %: Golgi 4.0 %: mitochondrial >> prediction for VFC255 is cyt 5' end seq. ID VFC255F

  19. Instalación de una bodega de vino tinto D.O.Navarra, vino en lata y sangría, con una producción de 255.000 Kg. de uva al año, sita en Los Arcos (Navarra)

    OpenAIRE

    Badiola Amillategi, Maddi

    2011-01-01

    Desde hace algunos años, el sector del vino ha ido cambiando su estrategia comercial, tanto por la evolución de los años como por las necesidades del mercado. A partir de la década de los sesenta, el sector se ha caracterizado por la formación de excedentes, y en este contexto, tanto el marketing como el mercado necesitaban un giro renovador. La causa principal de dicha situación ha sido el descenso acusado del consumo en los países tradicionalmente productores de vino (Ital...

  20. Gclust Server: 118950 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Cluster Sequences Related Sequences(26) 255 Damm: Death associated molecule related to Mch2 CG18188-PA 1...Sequence length 255 Representative annotation Damm: Death associated molecule related to Mch2 CG18188-PA Number

  1. Gclust Server: 122994 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences Related Sequences(16) 255 NP_620450.1 oligodendrocyte transcription factor 1 ; no annotation 1...length 255 Representative annotation NP_620450.1 oligodendrocyte transcription factor 1 ; no annotation Number

  2. 76 FR 11254 - Agency Information Collection Activities: Declaration of Unaccompanied Articles

    Science.gov (United States)

    2011-03-01

    ... Unaccompanied Articles AGENCY: U.S. Customs and Border Protection (CBP), Department of Homeland Security. ACTION... the Declaration of Unaccompanied Articles (CBP Form 255). This request for comment is being made... Unaccompanied Articles. OMB Number: 1651-0030. Form Number: CBP Form 255. Abstract: CBP Form 255 is completed by...

  3. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  4. Composition containing transuranic elements for use in the homeopathic treatment of aids

    Energy Technology Data Exchange (ETDEWEB)

    Lustig, D.

    1996-04-18

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author).

  5. Advanced development of the spectrum sciences Model 5005-TF, single-event test fixture

    Energy Technology Data Exchange (ETDEWEB)

    Ackermann, M.R.; Browning, J.S. (Sandia National Labs., Albuquerque, NM (USA)); Hughlock, B.W. (Boeing Aerospace and Electronics Co., Seattle, WA (USA)); Lum, G.K. (Lockheed Missiles and Space Co., Sunnyvale, CA (USA)); Tsacoyeanes, W.C. (Draper (Charles Stark) Lab., Inc., Cambridge, MA (USA)); Weeks, M.D. (Spectrum Sciences, Inc., Santa Clara, CA (USA))

    1990-09-01

    This report summarizes the advanced development of the Spectrum Sciences Model 5005-TF, Single-Event Test Fixture. The Model 5005-TF uses a Californium-252 (Cf-252) fission-fragment source to test integrated circuits and other devices for the effects of single-event phenomena. Particle identification methods commonly used in high-energy physics research and nuclear engineering have been incorporated into the Model 5005-TF for estimating the particle charge, mass, and energy parameters. All single-event phenomena observed in a device under test (DUT) are correlated with an identified fission fragment, and its linear energy transfer (LET) and range in the semiconductor material of the DUT.

  6. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  7. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  8. The Uses of a Polarimetric Camera

    Science.gov (United States)

    2008-09-01

    xiii ACKNOWLEDGMENTS I would like to acknowledge the following people in their help with this thesis: • Professor R. C. Olsen • Angela Puetz...and more efficient measurements of light polarization, which set the foundation for many discoveries in the remainder of the century. Eastman Kodak ...of Day’, align = 0.5, size = 1.8, color = 0 red = 255 green = 255*256L blue = 255* 256L * 256L white = red+ green + blue window, 2, xsize

  9. ORF Alignment: NC_004578 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ALADRYADVDCS 60 ... Query: 123 VTGKPVIIHTRGARADTLSLLREAALPQAGVLHCFTEDWDMAKAALDMGYYISLSGIVTF 182 ... VTGK...PVIIHTRGARADTLSLLREAALPQAGVLHCFTEDWDMAKAALDMGYYISLSGIVTF Sbjct: 121 VTGKPVIIHTRGA...RADTLSLLREAALPQAGVLHCFTEDWDMAKAALDMGYYISLSGIVTF 180 ... Query: 243 AEQTTANFARLFP 255 ... AEQTTANFARLFP Sbjct: 241 AEQTTANFARLFP 253

  10. ORF Alignment: NC_005125 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available us PCC ... 7421] ... Length = 255 ... Query: 6 ... QNPVIKQLRKLHAAKERQAQGLFLVEGTHPVAAALAGGWELEFVCATEAWVGEHPAM...HTA 65 ... QNPVIKQLRKLHAAKERQAQGLFLVEGTHPVAAALAGGWELEFVCATEAWVGEHPAM...HTA Sbjct: 1 ... QNPVIKQLRKLHAAKERQAQGLFLVEGTHPVAAALAGGWELEFVCATEAWVGEHPAMHTA 60 ... Query: 126 NVGTLVRSCAAVGA

  11. Sensemaking

    DEFF Research Database (Denmark)

    Schilhab, Theresa

    2012-01-01

    2012a Sensemaking. In D. Favareau, P. Cobley & K. Kull (Eds.) A More Developed Sign: Interpreting the work of Jesper Hoffmeyer.255-257. Tartu: Tartu University Press.......2012a Sensemaking. In D. Favareau, P. Cobley & K. Kull (Eds.) A More Developed Sign: Interpreting the work of Jesper Hoffmeyer.255-257. Tartu: Tartu University Press....

  12. 76 FR 78574 - Airworthiness Directives; The Boeing Company Airplanes

    Science.gov (United States)

    2011-12-19

    ... appeared to run through the entire thickness of the forward edge of the fitting at the radius corner of the... long and started from the radius of the fitting flange. The airplane had accumulated 16,655 total... Repetitive HFEC inspection...... 3 work-hours x $85 per $0 $255 per inspection $106,335 per hour = $255 per...

  13. GETDB: 104850 [GETDB

    Lifescience Database Archive (English)

    Full Text Available table - 1 255 Link to cluster table 255 1 Request - many cells, muscles, sh In L3all muscle, trachea(DT,...clusters 1 Stock Request Request - Embryonic Expression many cells, muscles, Larval GFP sh In L3all muscle, trachea(DT

  14. Gclust Server: 89869 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Rpal_RPA0635 Cluster Sequences Related Sequences(255) 492 sensor histidine kinase 1 9.98e-01 0.0 0.0 0.0 6.67 0...Sequences(255) Sequence length 492 Representative annotation sensor histidine kinase Number of Sequences 1 Homologs

  15. Gclust Server: 89766 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Bms_BR0274 Cluster Sequences Related Sequences(255) 541 sensor histidine kinase 1 1.00e-08 0.0 0.0 0.0 0.0 3.23...Sequences(255) Sequence length 541 Representative annotation sensor histidine kinase Number of Sequences 1 Homologs

  16. NCBI nr-aa BLAST: CBRC-DYAK-08-0013 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DYAK-08-0013 ref|YP_319016.1| O-antigen polymerase [Nitrobacter winogradskyi N...b-255] gb|ABA05664.1| O-antigen polymerase [Nitrobacter winogradskyi Nb-255] YP_319016.1 2.1 33% ...

  17. NCBI nr-aa BLAST: CBRC-TSYR-01-1170 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1170 ref|YP_317033.1| hypothetical protein Nwi_0414 [Nitrobacter winog...radskyi Nb-255] gb|ABA03681.1| Protein of unknown function DUF214 [Nitrobacter winogradskyi Nb-255] YP_317033.1 0.062 27% ...

  18. NCBI nr-aa BLAST: CBRC-DNOV-01-1277 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-1277 ref|YP_319048.1| N-formylglutamate amidohydrolase [Nitrobacter wi...nogradskyi Nb-255] gb|ABA05696.1| N-formylglutamate amidohydrolase [Nitrobacter winogradskyi Nb-255] YP_319048.1 2.3 30% ...

  19. Water quality and fish diversity of Federal University of Agriculture ...

    African Journals Online (AJOL)

    Water quality and fish diversity of Federal University of Agriculture Abeokuta reservoir. ... At the river channel and the floodplain sites, traps, cast nets (2.55cm mesh), seine nets (2.55 x 2 cm mesh), monofilament nylon gillnets (15.55 cm mesh), and hook ... The water quality parameters were favourable for fish production.

  20. Gclust Server: 31992 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available SCE_YAL014C=SYN8 Cluster Sequences Related Sequences(21) 255 Endosomal SNARE related to mammalian syntaxin 8 3 1.00e-40...Sequences(21) Sequence length 255 Representative annotation Endosomal SNARE related to mammalian syntaxin 8 Number

  1. Becoming a Blood Stem Cell Donor

    Medline Plus

    Full Text Available ... National Institutes of Health Clinical Center in Bethesda, MD. Bone marrow transplantation (BMT) and peripheral blood stem ... 2:55. bmdpsg 5,299 views 2:55 Myelodysplastic Syndrome | Dr. Tony Talebi discusses "Treatment of Myelodysplastic Syndrome?" - ...

  2. AcEST: DK958308 [AcEST

    Lifescience Database Archive (English)

    Full Text Available edic... 255 2e-66 tr|B5LWQ7|B5LWQ7_ZIZJJ Ubiquitin extensive-like protein OS=Zizip... 255 2e-66 tr|A9T8M3|A9...: 121 CPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 >tr|B5LWQ7|B5LWQ7_ZIZJJ Ubiquitin extensive-like protein OS=Zizi

  3. AcEST: DK950324 [AcEST

    Lifescience Database Archive (English)

    Full Text Available tein OS=Medic... 255 2e-66 tr|B5LWQ7|B5LWQ7_ZIZJJ Ubiquitin extensive-like protein OS=Zizip... 255 2e-66 tr|...ANHFDRHYCGKCGLTYVYQKA 153 >tr|B5LWQ7|B5LWQ7_ZIZJJ Ubiquitin extensive-like protei

  4. Becoming a Blood Stem Cell Donor

    Medline Plus

    Full Text Available ... blood stem cell) Harvest - Duration: 2:55. bmdpsg 5,068 views 2:55 Does Donating Bone Marrow ... Cell Donation Experience - Duration: 4:17. Mike G 5,933 views 4:17 Bone Marrow Donation via ...

  5. GETDB: 104465 [GETDB

    Lifescience Database Archive (English)

    Full Text Available in leg, double tarsus and tibia, internal - - comment1:A, comment2:55C1-C2 d1 - ...lt GFP internal Lethality - Also known as - Original Comments comment1:A, comment2:55C1-C2 Disc (Image) d1 D

  6. GETDB: 112168 [GETDB

    Lifescience Database Archive (English)

    Full Text Available - - 0 - weak - sg, gut, cns internal lethal - comment1:A, comment2:55C4 d1 d2 d3 d4 d5 - - - Show 112168 DG...ty lethal Also known as - Original Comments comment1:A, comment2:55C4 Disc (Image) d1 d2 d3 d4 d5 Disc (numb

  7. NCBI nr-aa BLAST: CBRC-ACAR-01-1153 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1153 ref|YP_319126.1| Multi antimicrobial extrusion protein MatE [Nitr...obacter winogradskyi Nb-255] gb|ABA05774.1| Multi antimicrobial extrusion protein MatE [Nitrobacter winogradskyi Nb-255] YP_319126.1 0.55 30% ...

  8. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... Home; Journals; Journal of Astrophysics and Astronomy; Volume 36; Issue 2. Issue front cover thumbnail. Volume 36, Issue 2. June 2015, pages 255-334. pp 255-268. Modeling the Emission from Turbulent Relativistic Jets in Active Galactic Nuclei · Victoria Calafut Paul J. Wiita · More Details Abstract ...

  9. An Investigation of an Individualized Approach to Evaluating, Grouping, and Planning Therapy for Children with Functional Articulation Problems in the First and Second Grades in a Public School System. Final Report.

    Science.gov (United States)

    Bell, Dorothy Mays; Sanders, Edwina

    A study was conducted to investigate methods of grouping children in grades 1 and 2 in a speech and hearing therapy program, and to determine the prevalence of certain auditory skills and deviant swallowing behavior associated with articulation problems. A screening test of articulation identified 255 control and 255 experimental subjects. A test…

  10. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes; Mesures des sections efficaces de capture et potentiels d'incineration des actinides mineurs dans les hauts flux de neutrons: Impact sur la transmutation des dechets

    Energy Technology Data Exchange (ETDEWEB)

    Bringer, O

    2007-10-15

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of {sup 241}Am and {sup 237}Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the {sup 241}Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  11. A gas secondary electron detector

    CERN Document Server

    Drouart, A; Alamanos, N; Auger, F; Besson, P; Bougamont, E; Bourgeois, P; Lobo, G; Pollacco, E C; Riallot, M

    2002-01-01

    A new Secondary Electron gas Detector (SED) is under development to be used in conjunction with an emissive foil to detect low energy heavy ions as an alternative to micro-channel plates. It could measure position and time of flight. Secondary electrons are accelerated to 10 keV so that they can cross through the 0.9 mu m Mylar entrance window. The electrons then are multiplied in the isobutane gas of the detector at 4-10 Torr. A time resolution of 150 ps and a spatial resolution of 3 mm have been obtained by using californium fission fragments on a prototype detector of 7x7 cm sup 2. The advantage of the SED against MCP is that its size is not limited. Our final goal is to build a large size detector (15x40 cm sup 2) that will operate at the focal plane of the VAMOS magnetic spectrometer at GANIL.

  12. Environmental assessment of the thermal neutron activation explosive detection system for concourse use at US airports

    Energy Technology Data Exchange (ETDEWEB)

    Jones, C.G.

    1990-08-01

    This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs.

  13. Chelation and stabilization of berkelium in oxidation state +IV

    Science.gov (United States)

    Deblonde, Gauthier J.-P.; Sturzbecher-Hoehne, Manuel; Rupert, Peter B.; An, Dahlia D.; Illy, Marie-Claire; Ralston, Corie Y.; Brabec, Jiri; de Jong, Wibe A.; Strong, Roland K.; Abergel, Rebecca J.

    2017-09-01

    Berkelium (Bk) has been predicted to be the only transplutonium element able to exhibit both +III and +IV oxidation states in solution, but evidence of a stable oxidized Bk chelate has so far remained elusive. Here we describe the stabilization of the heaviest 4+ ion of the periodic table, under mild aqueous conditions, using a siderophore derivative. The resulting Bk(IV) complex exhibits luminescence via sensitization through an intramolecular antenna effect. This neutral Bk(IV) coordination compound is not sequestered by the protein siderocalin—a mammalian metal transporter—in contrast to the negatively charged species obtained with neighbouring trivalent actinides americium, curium and californium (Cf). The corresponding Cf(III)-ligand-protein ternary adduct was characterized by X-ray diffraction analysis. Combined with theoretical predictions, these data add significant insight to the field of transplutonium chemistry, and may lead to innovative Bk separation and purification processes.

  14. The CARIBU EBIS control and synchronization system

    Science.gov (United States)

    Dickerson, Clayton; Peters, Christopher

    2015-01-01

    The Californium Rare Isotope Breeder Upgrade (CARIBU) Electron Beam Ion Source (EBIS) charge breeder has been built and tested. The bases of the CARIBU EBIS electrical system are four voltage platforms on which both DC and pulsed high voltage outputs are controlled. The high voltage output pulses are created with either a combination of a function generator and a high voltage amplifier, or two high voltage DC power supplies and a high voltage solid state switch. Proper synchronization of the pulsed voltages, fundamental to optimizing the charge breeding performance, is achieved with triggering from a digital delay pulse generator. The control system is based on National Instruments realtime controllers and LabVIEW software implementing Functional Global Variables (FGV) to store and access instrument parameters. Fiber optic converters enable network communication and triggering across the platforms.

  15. Off-line commissioning of EBIS and plans for its integration into ATLAS and CARIBU

    Energy Technology Data Exchange (ETDEWEB)

    Ostroumov, P. N., E-mail: ostroumov@anl.gov; Barcikowski, A.; Dickerson, C. A.; Mustapha, B.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. [Argonne National Laboratory, Argonne, Illinois 60439 (United States)

    2016-02-15

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed at Argonne to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne Tandem Linac Accelerator System (ATLAS). The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and significantly improve the purity of reaccelerated radioactive ion beams. The CARIBU EBIS-CB has been successfully commissioned offline with an external singly charged cesium ion source. The performance of the EBIS fully meets the specifications to breed rare isotope beams delivered from CARIBU. The EBIS is being relocated and integrated into ATLAS and CARIBU. A long electrostatic beam transport system including two 180° bends in the vertical plane has been designed. The commissioning of the EBIS and the beam transport system in their permanent location will start at the end of this year.

  16. Populations of selected microbial and fungal species growing on the surface of rape seeds following treatment with desiccants or plant growth regulators.

    Science.gov (United States)

    Frac, Magdalena; Jezierska-Tys, Stefania; Tys, Jerzy

    2010-01-01

    The aim of this study was to determine the effects of desiccants and plant growth regulators on selected microbial species affecting rape seeds, with special emphasis on the growth of fungi and identification of the genus and species composition. The experimental material in the study was seeds of winter rape cv. Californium that were collected from the field during combine harvest. The chemical agents applied, both desiccants and growth regulators, generally decreased the populations of bacteria occurring on the surface of rape seeds. The responses of fungi depended upon the type of agent applied and were manifested as either stimulation or inhibition of the growth of the fungal species. The fungi isolated from the surface of rape seeds were characteristic of those found in the field environment (Cladosporium and Penicillium) and typical for those present on the surface of rape seeds (Alternaria).

  17. Reliability of semiconductor and gas-filled diodes for over-voltage protection exposed to ionizing radiation

    Directory of Open Access Journals (Sweden)

    Stanković Koviljka

    2009-01-01

    Full Text Available The wide-spread use of semiconductor and gas-filled diodes for non-linear over-voltage protection results in a variety of possible working conditions. It is therefore essential to have a thorough insight into their reliability in exploitation environments which imply exposure to ionizing radiation. The aim of this paper is to investigate the influence of irradiation on over-voltage diode characteristics by exposing the diodes to californium-252 combined neutron/gamma radiation field. The irradiation of semiconductor over-voltage diodes causes severe degradation of their protection characteristics. On the other hand, gas-filled over-voltage diodes exhibit a temporal improvement of performance. The results are presented with the accompanying theoretical interpretations of the observed changes in over-voltage diode behaviour, based on the interaction of radiation with materials constituting the diodes.

  18. Triton and alpha-particle contribution from LiF converter for neutron dosimeter

    CERN Document Server

    Camacho, M E; Balcazar, M

    1999-01-01

    A personnel neutron dosimeter prototype based on chemical and electrochemical etched CR-39 detector, combined with LiF converter, has been calibrated using an ICRP-like phantom, under a heavy-water moderated Californium source neutron spectra; A conversion factor of 1.052+-126 spots cm sup - sup 2 mSv sup - sup 1 was obtained. The sealing properties of the detector holder showed a ten-fold reduction in radon background when it was tested in a high radon atmosphere. A convenient mechanical shock resistance was achieved in LiF converters by sintering to 11 tons pressure LiF powder at 650 deg. C, during one hour.

  19. Study of reproducibility of measurements with the spectrometer of Bonner multispheres

    Energy Technology Data Exchange (ETDEWEB)

    Azevedo, G.A.; Pereira, W.W.; Patrao, K.C.S.; Fonseca, E.S., E-mail: geisadeazevedo@gmail.com, E-mail: walsan@ird.gov.br, E-mail: karla@ird.gov.br, E-mail: evaldo@ird.gov.br [Instituto de Radionprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2013-07-01

    This work aims to study the metrological behavior of the Bonner Multisphere Spectrometer (BMS) of the LN / LNMRI / IRD - Laboratorio Metrologia de Neutrons / Laboratorio Nacional de Metrologia e Radiacao Ionizante / Instituto de Radioprotecao e Dosimetria, for measurements in repeatability and reproducibility conditions. Initially, a simulation was done by applying the Monte Carlo method, using the MCNP code and respecting the ISO 8529-1 (2001), using the sources of Californium ({sup 252} Cf), Americium-Beryllium ({sup 241} AmBe) and californium in heavy water (Cf + D{sub 2}O), all located at a distance of 100 cm from the neutron detector ({sup 6}Li (Eu) - crystal scintillator). In this program, the counting of neutrons that are captured by the detector was made. The source is located in the center of a sphere of radius 300 cm. Analyzes the impact of these neutrons in a point of the sphere wall, which in this case acted as a neutron detector and from there, it is estimated the number of neutrons that collide in the whole sphere. The purpose is to obtain the neutron count for different energy bands in a solid field of neutrons, since they have a spectrum ranging from a low to a high energy that can also vary within a particular environment. Wishes to obtain new fields with different sources and moderators materials to be used as new reference fields. Measurements are being conducted for these fields, with the aim of analyzing the variability conditions of the measurement (repeatability and reproducibility) in LEN - Laboratorio de Espectrometria de Neutrons of the LN/LMNRI/IRD. Thus, the spectrometer will be used to improve both the knowledge of the spectrum as the standard of neutrons of the lab, proving that a spectrometry is essential for correct measurement.

  20. Directory of Design Support Methods

    Science.gov (United States)

    2005-08-01

    Don Monk 937-255-8814 How To Acquire: Commercial Telephone: 937-255-4842 DSN: 785-4842 Fax: 937-255-4823 E-Mail: lisa.mcintosh...or if you have questions, contact Jennifer C. Swoboda, Comm. (410) 278- 5948, DSN 298-5948, jcrouch@arl.army.mil or Patricia W. Kilduff, Comm. (410... Rucker , AL: Anacapa Sciences, Inc., 10-89. Iavecchia, H.P., Linton, P.M., Bittner, A.C. Jr, and Byers, J.C., "Operator Workload in the UH-60A Black

  1. AcEST: DK953554 [AcEST

    Lifescience Database Archive (English)

    Full Text Available GLTYVYQKA 153 >tr|B5LWQ7|B5LWQ7_ZIZJJ Ubiquitin extensive-like protein OS=Ziziphus jujuba GN=UBQ PE=2 SV=1 L...m tu... 255 2e-66 tr|B7FGN8|B7FGN8_MEDTR Putative uncharacterized protein OS=Medic... 255 2e-66 tr|B5LWQ7|B5LWQ7_ZIZJJ Ubiquitin exte...nsive-like protein OS=Zizip... 255 2e-66 tr|A9T8M3|A9T8M3_PHYPA Predicted protein O

  2. New Fellows and Honorary Fellow

    Indian Academy of Sciences (India)

    London). Date of birth: 21 October 1930. Date of death: 7 May 2006. Specialization: Rural Technology, Energy Analysis, Electrochemistry and S & T Policy Last known address: 25/5, Bore Bank Road, Benson Town, Bengaluru 560 046.

  3. O použití Einsteinových rovnic v kosmologii

    Czech Academy of Sciences Publication Activity Database

    Křížek, Michal

    2015-01-01

    Roč. 60, č. 3 (2015), s. 255-272 ISSN 0032-2423 Institutional support: RVO:67985840 Keywords : dark matter * dark energy * Friedmann equation Subject RIV: BA - General Mathematics http://hdl.handle.net/10338.dmlcz/144419

  4. The Association between Neuroticism and Heart Rate Variability Is Not Fully Explained by Cardiovascular Disease and Depression

    National Research Council Canada - National Science Library

    Čukić, Iva; Bates, Timothy C

    2015-01-01

    .... Subjects were derived from a nationally representative sample (n = 1,255: mean age 54.5, SD = 11.5). Higher neuroticism was associated with reduced heart rate variability equally under rest and stress...

  5. Arno Rafael Cederberg ja Eesti ajalooteadus / Hans Kruus

    Index Scriptorium Estoniae

    Kruus, Hans, 1891-1976

    2005-01-01

    Soome ajalooprofessorist Arno Rafael Cederbergist (1885-1948). Tartu Ülikoolis töötades oli tema peamine õppe-ja uurimisaine Eesti ja Põhjamaade ajalugu. Ilm.: Eesti Kirjandus, 1935, nr. 6., lk. 254-255

  6. (TCF7L2) variations associated with earlier age-onset of type 2 ...

    Indian Academy of Sciences (India)

    onset of type 2 diabetes in Thai patients. Watip Tangjittipokin, Nalinee Chongjarean, Nattachet Plengvidhya, Mayuree Homsanit and Pa-Thai Yenchitsomanus. J. Genet. 91, 251–255. Table 1. Details of primers and PCR reaction condition. SNP.

  7. 75 FR 78607 - Changes in Flood Elevation Determinations

    Science.gov (United States)

    2010-12-16

    ... Mayor, City of Tucson, Daily Star. City Hall, 255 West Alameda, Tucson, AZ 85701. Arizona: Pinal City of... Honorable Pete Rios, December 6, 2010..... 040077 of Pinal County. 7, 2010, Casa Grande Chairman, Pinal...

  8. 76 FR 60748 - Changes in Flood Elevation Determinations

    Science.gov (United States)

    2011-09-30

    .... Tucson, 255 West Alameda Street, Tucson, AZ 85701. Pinal Unincorporated areas July 15, 2011; July The Honorable Pete Rios, November 21, 2011 040077 of Pinal County (11- 22, 2011; The Case Chairman, Pinal County...

  9. 77 FR 1884 - Changes in Flood Elevation Determinations

    Science.gov (United States)

    2012-01-12

    ..., 2011; The Walkup, Mayor, City of Arizona Daily Star. Tucson, 255 West Alameda Street, Tucson, AZ 85701. Pinal (FEMA Docket No.: B-1219). Unincorporated areas July 15, 2011; July The Honorable Pete Rios...

  10. The influence of parents and the home environment on preschoolers' physical activity behaviours: a qualitative investigation of childcare providers' perspectives

    National Research Council Canada - National Science Library

    Tucker, Patricia; van Zandvoort, Melissa M; Burke, Shauna M; Irwin, Jennifer D

    2011-01-01

    .... This study sought to examine childcare providers' perspectives of the importance of parents and the home environment for supporting the physical activity behaviours of preschool-aged children (aged 2.5-5 years...

  11. Disease: H01063 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available H01063 Human metapneumovirus infection Human metapneumovirus (hMPV) is an emerging ...v_factor) Kahn JS Human metapneumovirus: a newly emerging respiratory pathogen. Curr Opin Infect Dis 16:255-8 (2003) ...

  12. South African Family Practice - Vol 55, No 3 (2013)

    African Journals Online (AJOL)

    Eating disorders are real treatable medical illnesses · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. A Revelas, 252-255. http://dx.doi.org/10.1080/20786204.2013.10874346 ...

  13. ORF Alignment: NC_002971 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available TIG_COXBU ... Trigger factor (TF) ... Length = 124 ... Query: 135 EITEEDLDKMLEALRKQYAEWKEMDRPAKAD...DRVIIDFEGTLDGKPFERGSAKDFQLELG 194 ... EITEEDLDKMLEALRKQYAEWKEMDRPAKADDRVII...DFEGTLDGKPFERGSAKDFQLELG Sbjct: 1 ... EITEEDLDKMLEALRKQYAEWKEMDRPAKADDRVIIDFEGTLDGKPFERGSAKDFQLELG 60 ... Query: 255 QFAE 258 ... QFAE Sbjct: 121 QFAE 124

  14. 75 FR 12749 - Ocean Transportation Intermediary License Reissuances

    Science.gov (United States)

    2010-03-17

    ... Date reissued 015530N Distinction Cargo Management February 15, 2010. Inc., Cargo Bldg. 9, Suite 255..., 2010. Logistic, (USA) Inc., 219 Stuyvesant Avenue, Lyndhurst, NJ 01071. 021870N AKM International, LLC...

  15. ORIGINAL ARTICLES Estimation of the diagnostic accuracy of organ ...

    African Journals Online (AJOL)

    Enrique

    . 5. Sierak T, Szopinski J. Universal device for organ electrodermal diagnostics and electrotherapy (Polish). Probl Tech Med 1987; 18: 255-262. 6. Szopinski J, Sierak T, Gabryel A. Die Erforschung der bioenergetischen Eigenschaften der.

  16. African Journal of Biomedical Research - Vol 18, No 3 (2015)

    African Journals Online (AJOL)

    Simultaneous Occurrence of Periodontal and Skin Abscesses in a Nigerian Girl: Case Report · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. EB Dosumu, OO Bankole, OO Dosumu, 249-255 ...

  17. Pharmaceuticals, benzene, toluene and chlorobenzene removal from contaminated groundwater by combined UV/H2O2 photo-oxidation and aeration

    Czech Academy of Sciences Publication Activity Database

    Lhotský, O.; Krákorová, Eva; Mašín, P.; Žebrák, R.; Linhartová, Lucie; Křesinová, Zdena; Kašlík, J.; Steinová, J.; Rodsand, T.; Filipová, Alena; Petrů, K.; Kroupová, K.; Cajthaml, Tomáš

    2017-01-01

    Roč. 120, SEP 1 2017 (2017), s. 245-255 ISSN 0043-1354 Institutional support: RVO:61388971 Keywords : Pharmaceuticals * BTEX * Chlorobenzene Subject RIV: EE - Microbiology, Virology Impact factor: 6.942, year: 2016

  18. Drug: D08825 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available tegory of drugs in Japan [BR:br08301] 2 Agents affecting individual organs 25 Urogenital and anal organ agents 255 Hemorrhoidal prepa...rations 2559 Others D08825 Hemolingual PubChem: 96025508 ...

  19. Processing of the insulin-like growth factor-II-mannose 6-phosphate receptor in isolated liver subcellular fractions

    National Research Council Canada - National Science Library

    Tahiri K; Cam L; Desbuquois B; Chauvet G

    2001-01-01

    .... The receptor in plasma membrane fractions differed from that in Golgi-endosomal fractions by: (i) a lower molecular size upon reducing polyacrylamide gel electrophoresis (245 vs. 255 kDa); (ii...

  20. Introducing Undergraduates to Global Health Epidemiology, Emerging Infectious Diseases, and Parasitology: A Small Book with a Big Impact

    Directory of Open Access Journals (Sweden)

    Dara L. Wegman-Geedey

    2014-08-01

    Full Text Available Review of: Forgotten People, Forgotten Diseases: The Neglected Tropical Diseases and their Impact on Global Health and Development, 2nd Edition; Peter J. Hotez; (2013. ASM Press, Washington, DC. 255 pages.

  1. A Comprehensive LC/MS Analysis of Novel Cyclopentenedione Library.

    Czech Academy of Sciences Publication Activity Database

    Papoušková, B.; Bernard, Martin; Ottenschlager, Jakub; Karban, Jindřich; Velíšek, Petr; Hrbáč, J.; Sýkora, Jan; Storch, Jan; Vacek, J.

    2016-01-01

    Roč. 128, SEP 5 (2016), s. 342-351 ISSN 0731-7085 Institutional support: RVO:67985858 Keywords : bioactive cyclopentenediones * liquid chromatography * mass spectrometry Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.255, year: 2016

  2. NIHSeniorHealth

    Medline Plus

    Full Text Available ... 5:30 Play next Play now Physical Therapy Exercises After Knee Replacement - Duration: 5 minutes, 30 seconds. 38,731 views 3 years ago CC 2:55 Play next Play now What Are Advance ...

  3. Annual Thaw Depths and Water Depths in Tanana Flats, Alaska, Version 1

    Data.gov (United States)

    National Aeronautics and Space Administration — Thaw depths and water depths were monitored at 1 m to 2 m intervals along a 255-m transect across an area of discontinuous and degrading permafrost on the Tanana...

  4. Field Plot and Observation Points for Fossil Butte National Monument Vegetation Mapping Project

    Data.gov (United States)

    National Park Service, Department of the Interior — This point file contains 255 point locations of field plot and observation data used by, and collected for, the vegetation mapping project for Fossil Butte National...

  5. Measuring Accurately Single-Phase Sinusoidal and Non-Sinusoidal Power.

    Science.gov (United States)

    1983-01-01

    made by the voltage and current circuits. The two methods for connecting the Model 255 wattmeter for measuring power arc shown in figure 6.1(a) and 6.1(b...insertion losses due to the physical connections made by the voltage and current- coil circuits. The two method :, for connecting the P-3 wattmeter for...P-3 Electrodynamometer wattmeters , two Clarke-Hess Model 255 Digital Wattmeters and one General Electric Type VM- 63-S Induction Watthour Meter. The

  6. Modeling the interactions of a peptide-major histocompatibility class I ligand with its receptors. II. Cross-reaction between a monoclonal antibody and two alpha beta T cell receptors

    DEFF Research Database (Denmark)

    Rognan, D; Engberg, J; Stryhn, A

    2000-01-01

    The recombinant antibody, pSAN13.4.1, has a unique T cell like specificity; it binds an Influenza Hemagglutinin octapeptide (Ha255-262) in an MHC (H-2Kk)-restricted manner, and a detailed comparison of the fine specificity of pSAN13.4.1 with the fine specificity of two Ha255-262-specific, H-2Kk-r...

  7. Evaluation of Sun Glint Correction Algorithms for High-Spatial Resolution Hyperspectral Imagery

    Science.gov (United States)

    2012-09-01

    Surface Derived from Sun Glitter." Journal of Marine Research, 1954, 13: 198–227. Feynman , Richard P. QED: The Strange Theory of Light and Matter... Richards and Jia 2006). For example, an 8-bit image has pixel values between 0 and 255, where 0 is black and 255 is white, with shades of grey...using both the index of refraction and the angle of incidence of light upon the medium ( Feynman 1985). Light can be scattered off the surface of a

  8. Overview of the Anyphaenids (Araneae, Anyphaeninae, Anyphaenidae) spider fauna from the Chocó forest of Ecuador, with the description of thirteen new species

    OpenAIRE

    Nadine Duperre; Elicio Tapia

    2016-01-01

    Nadine Duperre, Elicio Tapia (2016): Overview of the Anyphaenids (Araneae, Anyphaeninae, Anyphaenidae) spider fauna from the Chocó forest of Ecuador, with the description of thirteen new species. European Jornal of Taxonomy 255: 1-50, DOI: 10.5852/ejt.2016.255, URL: http://sciencepress.mnhn.fr/en/periodiques/european-journal-taxonomy/2016/overview-anyphaenids-araneae-anyphaeninae-anyphaenidae-spider-fauna-choco-forest-ecuador-description-thirteen-new-species

  9. AcEST: DK961175 [AcEST

    Lifescience Database Archive (English)

    Full Text Available B7FGN8_MEDTR Putative uncharacterized protein OS=Medic... 255 2e-66 tr|B5LWQ7|B5LWQ7_ZIZJJ Ubiquitin extensive...DRHYCGKCGLTYVYQKA Sbjct: 121 CPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 >tr|B5LWQ7|B5LWQ7_ZIZJJ Ubiquitin exten...sive-like protein OS=Ziziphus jujuba GN=UBQ PE=2 SV=1 Length = 156 Score = 255 bits

  10. Glacial to interglacial contrast in the calcium carbonate content and influence of Indus discharge in two eastern Arabian sea cores

    Digital Repository Service at National Institute of Oceanography (India)

    Naidu, P.D.

    , Palaeoecology, 86 (1991): 255-263 255 Elsevier Science Publishers B.V., Amsterdam Glacial to interglacial contrasts in the calcium carbonate content and influence of Indus discharge in two eastern Arabian Sea cores P. Divakar Naidu National Institute... of Oceanography, DonaPaula, Goa 403004, India (Received January 2, 1990; revised version accepted January 18, 1991) ABSTRACT Divakar Naidu, P., 1991. Glacial to interglacial contrasts in the calcium carbonate content and influence of Indus discharge in two...

  11. Involvement of multiple genetic loci in Staphylococcus aureus teicoplanin resistance

    OpenAIRE

    Bischoff, Markus; Roos, Martin; Putnik, Jasmina; Wada, Akihito; Glanzmann, Philipp; Giachino, Philipp; Vaudaux, Pierre; Berger-Bächi, B.

    2017-01-01

    Teicoplanin resistance was transformed from a teicoplanin-resistant Staphylococcus aureus into the susceptible strain BB255 to give strain BB938. The cell wall composition, amidation of the iD-glutamate, and peptide crosslinking were identical in BB938 as in BB255 except for a 60% increased length of the glycan chain. Transductional crosses revealed that at least two distinct loci contributed in a cumulative fashion to teicoplanin resistance. One of these loci correlated with a mutation inact...

  12. FADS single-nucleotide polymorphisms are associated with behavioral outcomes in children, and the effect varies between sexes and is dependent on PPAR genotype

    DEFF Research Database (Denmark)

    Jensen, Heidi Ar; Harsløf, Laurine Bente Schram; Nielsen, Maria Søgaard

    2014-01-01

    = 256) and physical activity by accelerometry (n = 231) in children from the SKOT [Småbørns Kost Og Trivsel (Diet and Thriving in Young Children)] cohort. Blood samples were taken to determine erythrocyte DHA (n = 200), FADS tag-SNPs (n = 255), and PPARG-Pro12Ala (n = 255). All outcomes were analyzed...... proliferator-activated receptor-mediated effect on behavior in children, indicating a programming effect of early DHA exposure....

  13. Conference on Aerospace Transparent Materials and Enclosures Held in San Diego, California on 9-13 August 1993. Volume 2. Sessions 5-9

    Science.gov (United States)

    1994-03-01

    TELEMETRY FOR BIRD AVOIDANCE 832 D. J. Rubin , Spectrum Sciences and Software ROUND ROBIN TESTING TO DETERMINE THE PRECISION AND ACCURACY IN MEASURING...Research Project Engineer WL/FIBT (513) 255-2318 LT GRETCHEN BROCKFELD Durability Research Project Manager WL/FIVR (513) 255-4926 Wright-Patterson Air...Chainnan: D. J. Rubin Spectrum Sciences & Software Co-Chainnan:L. Task Armstrong Labs Coordinator: D. Hamershock Flight Dynamics Directorate Wright

  14. Urinary stone composition in Oman: with high incidence of cystinuria.

    Science.gov (United States)

    Al-Marhoon, Mohammed S; Bayoumi, Riad; Al-Farsi, Yahya; Al-Hinai, Abdullhakeem; Al-Maskary, Sultan; Venkiteswaran, Krishna; Al-Busaidi, Qassim; Mathew, Josephkunju; Rhman, Khalid; Sharif, Omar; Aquil, Shahid; Al-Hashmi, Intisar

    2015-06-01

    Urinary stones are a common problem in Oman and their composition is unknown. The aim of this study is to analyze the components of urinary stones of Omani patients and use the obtained data for future studies of etiology, treatment, and prevention. Urinary stones of 255 consecutive patients were collected at the Sultan Qaboos University Hospital. Stones were analyzed by Fourier transform infrared spectrophotometer. The biochemical, metabolic, and radiological data relating to the patients and stones were collected. The mean age was 41 years, with M:F ratio of 3.7:1. The common comorbidities associated with stone formation were hypertension; diabetes, benign prostate hyperplasia; urinary tract infection; obesity; and atrophic kidney. The common presentation was renal colic and flank pain (96%). Stones were surgically retrieved in 70% of patients. Mean stone size was 9 ± 0.5 mm (range 1.3-80). Stone formers had a BMI ≥ 25 in 56% (P = 0.006) and positive family history of stones in 3.8%. The most common stones in Oman were as follows: Calcium Oxalates 45% (114/255); Mixed calcium phosphates & calcium oxalates 22% (55/255); Uric Acid 16% (40/255); and Cystine 4% (10/255). The most common urinary stones in Oman are Calcium Oxalates. Overweight is an important risk factor associated with stone formation. The hereditary Cystine stones are three times more common in Oman than what is reported in the literature that needs further genetic studies.

  15. (AJST) DETERMINATION OF THE PARAMETERS FOR DESIGN OF ...

    African Journals Online (AJOL)

    2 as per ASTM D 638 (2003) for Type II specimens. Specimens in both the axis parallel to the direction of ... 588. 21.93. 0.781. 0.95. 0.22. 0.255. 0.695. 427. 20.26. 40 °C. 1.563. 2.55. 0.60. 0.363. 0.199. 1070. 30.46. 0.937. 1.80. 0.42. 0.280. 0.092. 636. 26.75. 0.781. 1.65. 0.38. 0.255. 0.069. 445. 23.41. 50 °C. 1.563. 3.60.

  16. Compensated bismuth-loaded plastic scintillators for neutron detection using low-energy pseudo-spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Dumazert, Jonathan, E-mail: jonathan.dumazert@cea.fr [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France); Coulon, Romain; Bertrand, Guillaume H.V.; Normand, Stéphane [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France); Méchin, Laurence [CNRS, UCBN, Groupe de Recherche en Informatique, Image, Automatique et Instrumentation de Caen, 14050 Caen (France); Hamel, Matthieu [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France)

    2016-05-21

    Gadolinium-covered modified plastic scintillators show a high potential for the deployment of cost-effective neutron detectors. Taking advantage of the low-energy photon and electron signature of thermal neutron captures in gadolinium-155 and gadolinium-157 however requires a background correction. In order to display a trustable rate, dual compensation schemes appear as an alternative to Pulse Shape Discrimination. This paper presents the application of such a compensation scheme to a two-bismuth loaded plastic scintillator system. A detection scintillator interacts with incident photon and fast neutron radiations and is covered with a gadolinium converter to become thermal neutron-sensitive as well. In the meantime, an identical compensation scintillator, covered with terbium, solely interacts with the photon and fast neutron part of incident radiations. After the acquisition and the treatment of the counting signals from both sensors, a hypothesis test determines whether the resulting count rate after subtraction falls into statistical fluctuations or provides a robust image of neutron activity. A laboratory prototype is tested under both photon and neutron radiations, allowing us to investigate the performance of the overall compensation system. The study reveals satisfactory results in terms of robustness to a cesium-137 background and in terms of sensitivity in presence of a californium-252 source.

  17. Systematic studies of the fundamental chemistry of pyrochlore oxides. An{sub 2}Zr{sub 2}O{sub 7} [An=Pu, Am, Cm, Bk and Cf

    Energy Technology Data Exchange (ETDEWEB)

    Haire, R.G.; Assefa, Z. [Oak Ridge National Laboratory, Oak Ridge, TN (United States); Raison, P.E. [Commissariat a l' Energie Atomique, CEA-Cadarache DRN/DEC/SPUA/LACA (France)

    2002-11-01

    Our efforts to pursue the fundamental science of actinide pyrochlore oxides, An{sub 2}Zr{sub 2}O{sub 7}, (An=plutonium through californium), are presented. We have addressed their structural and chemical behavior via X-ray diffraction, Raman spectroscopy and by considering the pseudo-oxidation potentials of the actinides. The structure, fundamental chemistry, ionic radii and the electronic configuration of the specific actinide involved in these oxide systems all have a significant impact on their science. We are also exploring a calculational approach based on valence-bond relationships to assess the position of the oxygen atoms located at the general crystallographic position. The oxygen position is important regarding the chemical behavior and thermal stability of these materials. Also considered is the structural stability of the materials regarding self-irradiation, and with some compounds, their resistance towards oxidation. These aspects will be discussed using a systematic evaluation of the five-actinide systems together with comparable lanthanide systems studied. (author)

  18. 1982 US-CEC neutron personnel dosimetry intercomparison study

    Energy Technology Data Exchange (ETDEWEB)

    Swaja, R.E.; Sims, C.S.; Greene, R.T.; Schraube, H.; Burger, G.

    1983-11-01

    A neutron personnel dosimetry intercomparison study was conducted during April 19-23, 1982, as a joint effort between the United States and the Commission of European Communities. Dosimeters from 48 participating agencies were mounted on cylindrical phantoms and exposed to a range of low-level dose equivalents (0.48-13.91 mSv neutron and 0.02-1.32 mSv gamma) in nine different radiation fields. Exposure conditions considered in this study included four mixed-field spectra produced using the Health Physics Research Reactor, four monoenergetic neutron fields generated by accelerators, and one 15-cm D/sub 2/O-moderated californium source spectrum. In general, neutron results reported by the participating agencies were consistent with expected dosimeter performance based on energy response characteristics of the detection systems. Albedo dosimeters, which were the most popular neutron monitoring systems used in this study, provided the best overall accuracy for all exposure conditions. Film, Cr-39 recoil track, and Th-232 fission track systems generally underestimated dose equivalents relative to reference values. Associated gamma measurements showed that TLD monitors produced more accurate results than film dosimeters although both systems overestimated gamma dose equivalents in mixed radiation fields. 24 references, 10 figures, 19 tables.

  19. Application of the backward extrapolation method to pulsed neutron sources

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto; Gohar, Yousry

    2018-01-01

    Particle detectors operated in pulse mode are subjected to the dead-time effect. When the average of the detector counts is constant over time, correcting for the dead-time effect is simple and can be accomplished by analytical formulas. However, when the average of the detector counts changes over time it is more difficult to take into account the dead-time effect. When a subcritical nuclear assembly is driven by a pulsed neutron source, simple analytical formulas cannot be applied to the measured detector counts to correct for the dead-time effect because of the sharp change of the detector counts over time. This work addresses this issue by using the backward extrapolation method. The latter can be applied not only to a continuous (e.g. californium) external neutron source but also to a pulsed external neutron source (e.g. by a particle accelerator) driving a subcritical nuclear assembly. The backward extrapolation method allows to obtain from the measured detector counts both the dead-time value and the real detector counts.

  20. The cross sections of fusion-evaporation reactions: the most promising route to superheavy elements beyond Z=118

    Science.gov (United States)

    Jadambaa, Khuyagbaatar

    2017-11-01

    The synthesis of superheavy elements beyond oganesson (Og), which has atomic number Z = 118, is currently one of the main topics in nuclear physics. An absence of sufficient amounts of target material with atomic numbers heavier than californium (Z = 98) forces the use of projectiles heavier than 48Ca (Z = 20), which has been successfully used for the discoveries of elements with Z = 114 - 118 in complete fusion reactions. Experimental cross sections of 48Ca with actinide targets behave very differently to "cold" and "hot" fusion-evaporation reactions, where doubly-magic lead and deformed actinides are used as targets, respectively. The known cross sections of these reactions have been analysed compared to calculated fission barriers. It has been suggested that observed discrepancies between the cross sections of 48Ca-induced and other fusionevaporation reactions originate from the shell structure of the compound nucleus, which lies in the island of the stability. Besides scarcely known data on other reactions involving heavier projectiles, the most promising projectile for the synthesis of the elements beyond Og seems to be 50Ti. However, detailed studies of 50Ti, 54Cr, 58Fe and 64Ni-induced reactions are necessary to be performed in order to fully understand the complexities of superheavy element formation.

  1. Report to the DOE nuclear data committee. [EV RANGE 10-100; CROSS SECTIONS; PHOTONEUTRONS; NEUTRONS; GAMMA RADIATION; COUPLED CHANNEL THEORY; DIFFERENTIAL CROSS SECTIONS; MEV RANGE 01-10; ; CAPTURE; GAMMA SPECTRA; THERMAL NEUTRONS; COMPUTER CALCULATIONS; DECAY; FISSION PRODUCTS; FISSION YIELD; SHELL MODELS; NUCLEAR DATA COLLECTIONS

    Energy Technology Data Exchange (ETDEWEB)

    Struble, G.L.; Haight, R.C.

    1981-03-01

    Topics covered include: studies of (n, charged particle) reactions with 14 to 15 MeV neutrons; photoneutron cross sections for /sup 15/N; neutron radiative capture; Lane-model analysis of (p,p) and (n,n) scattering on the even tin isotopes; neutron scattering cross sections for /sup 181/Ta, /sup 197/Au, /sup 209/Bi, /sup 232/Th, and /sup 238/U inferred from proton scattering and charge exchange cross sections; neutron-induced fission cross sections of /sup 245/Cm and /sup 242/Am; fission neutron multiplicities for /sup 245/Cm and /sup 242/Am; the transport of 14 MeV neutrons through heavy materials 150 < A < 208; /sup 249/Cm energy levels from measurement of thermal neutron capture gamma rays; /sup 231/Th energy levels from neutron capture gamma ray and conversion electron spectroscopy; new measurements of conversion electron binding energies in berkelium and californium; nuclear level densities; relative importance of statistical vs. valence neutron capture in the mass-90 region; determination of properties of short-lived fission products; fission yield of /sup 87/Br and /sup 137/I from 15 nuclei ranging from /sup 232/Th to /sup 249/Cf; evaluation of charged particle data for the ECPL library; evaluation of secondary charged-particle energy and angular distributions for ENDL; and evaluated nuclear structure libraries derived from the table of isotopes. (GHT)

  2. Activation analysis of ITER blanket first wall

    Energy Technology Data Exchange (ETDEWEB)

    Lopatkin, A.; Muratov, V. [RDIPE (NIKIET), Moscow (Russian Federation)

    1998-09-01

    To analyze the activation of ITER blanket structural components, the authors have prepared the AUCDAS code that calculates changes in nuclide concentrations and radioactivity characteristics during neutron irradiation and during cooling. UCDAS takes into account all neutron reactions and decay types, the prepared library of constants contains nuclear data of nuclides from hydrogen to californium. A comparative analysis of the results as obtained using UCDAS code and the widely known FISPACT code is given. The analysis of decay heat, gas generation and activity of ITER blanket first wall`s structural components was carried out. The beryllium coating, copper alloy and stainless steel were analysed. Calculations were performed for the first plasma burning pulse, 6 months and 1 year of operation in accordance with the ITER scenario. The materials recommended by ITER central team and their Russian analogs were considered: TGR and B1 (beryllium coating), GlidCop AL-25 Ds and Br-MKX (copper alloy), 316LN-IG and 12Cr18Ni10Ti (stainless steel). It has been demonstrated that there is a difference in all of the considered characteristics between the above materials. It is caused by impurities which are present in the materials. The report also considers the accumulation of gases (H, D, T, He{sup 3}, He{sup 4}) in the above materials. Besides, the change in the activity of irradiated materials during the cooling of up to 10{sup 7} years was calculated. (orig.) 7 refs.

  3. Toward achieving flexible and high sensitivity hexagonal boron nitride neutron detectors

    Science.gov (United States)

    Maity, A.; Grenadier, S. J.; Li, J.; Lin, J. Y.; Jiang, H. X.

    2017-07-01

    Hexagonal boron nitride (h-BN) detectors have demonstrated the highest thermal neutron detection efficiency to date among solid-state neutron detectors at about 51%. We report here the realization of h-BN neutron detectors possessing one order of magnitude enhancement in the detection area but maintaining an equal level of detection efficiency of previous achievement. These 3 mm × 3 mm detectors were fabricated from 50 μm thick freestanding and flexible 10B enriched h-BN (h-10BN) films, grown by metal organic chemical vapor deposition followed by mechanical separation from sapphire substrates. Mobility-lifetime results suggested that holes are the majority carriers in unintentionally doped h-BN. The detectors were tested under thermal neutron irradiation from californium-252 (252Cf) moderated by a high density polyethylene moderator. A thermal neutron detection efficiency of ˜53% was achieved at a bias voltage of 200 V. Conforming to traditional solid-state detectors, the realization of h-BN epilayers with enhanced electrical transport properties is the key to enable scaling up the device sizes. More specifically, the present results revealed that achieving an electrical resistivity of greater than 1014 Ωṡcm and a leakage current density of below 3 × 10-10 A/cm2 is needed to fabricate large area h-BN detectors and provided guidance for achieving high sensitivity solid state neutron detectors based on h-BN.

  4. Design of the low energy beam transport line between CARIBU and the EBIS charge breeder

    Energy Technology Data Exchange (ETDEWEB)

    Perry, A., E-mail: aperry4@hawk.iit.edu [Argonne National Laboratory, Argonne, IL 60439, USA and Illinois Institute of Technology, Chicago, IL 60616 (United States); Ostroumov, P. N.; Barcikowski, A.; Dickerson, C.; Kondrashev, S. A.; Mustapha, B.; Savard, G. [Argonne National Laboratory, Argonne, IL 60439 (United States)

    2015-01-09

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at ATLAS. The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and improve the purity of reaccelerated radioactive ion beams. The EBIS-CB is in the final stage of off-line commissioning. Currently, we are developing a low energy beam transport (LEBT) system to transfer CARIBU beams to the EBIS-CB. As was originally planned, an RFQ cooler-buncher will precede the EBIS-CB. Recently, it was decided to include a multi-reflection time-of-flight (MR-TOF) mass-spectrometer following the RFQ. MR-TOF is a relatively new technology used to purify beams with a mass-resolving power up to 3×10{sup 5} as was demonstrated in experiments at CERN/ISOLDE. Very high purity singly-charged radioactive ion beams will be injected into the EBIS for charge breeding and due to its inherent properties, the EBIS-CB will maintain the purity of the charge bred beams. Possible contamination of residual gas ions will be greatly suppressed by achieving ultra-high vacuum in the EBIS trap. This paper will present and discuss the design of the LEBT and the overall integration of the EBIS-CB into ATLAS.

  5. Analysis of patents on mining technology

    Energy Technology Data Exchange (ETDEWEB)

    Menyailo, N.I.; Grishchenko, A.N.; Ratner, M.V.; Kobylyanskii, A.Ya.; Tyshlek, E.G.

    1987-09-01

    Analyses the current work being carried out with the aim of developing and perfecting coal mining technology with regard to improving safety and working conditions (equipment is currently responsible for 6.3% of all hazards in coal mines) by examining patents of class ES 21 S produced in the USSR, USA, UK, FRG, Japan and France between 1970-1984. By far the majority of patents is concerned with improving technology and productivity and a disappointing number deals with safety matters (only 7.2% of the patents for new cutter loader designs deal with dust suppression systems and most of these come from the FRG; no patents for powered mining complexes deal with the problem of noise and vibration reduction). The patents with the most direct relevance to health and safety concern remote control devices for mining equipment, in particular, devices based on radioactive isotopes (e.g. cesium-137, americum-241, selenium-75, californium-252) but measures for monitoring them and protecting against them are not found.

  6. MinT: Middleware for Cooperative Interaction of Things

    Directory of Open Access Journals (Sweden)

    Soobin Jeon

    2017-06-01

    Full Text Available This paper proposes an Internet of Things (IoT middleware called Middleware for Cooperative Interaction of Things (MinT. MinT supports a fully distributed IoT environment in which IoT devices directly connect to peripheral devices easily construct a local or global network, and share their data in an energy efficient manner. MinT provides a sensor abstract layer, a system layer and an interaction layer. These enable integrated sensing device operations, efficient resource management, and active interconnection between peripheral IoT devices. In addition, MinT provides a high-level API to develop IoT devices easily for IoT device developers. We aim to enhance the energy efficiency and performance of IoT devices through the performance improvements offered by MinT resource management and request processing. The experimental results show that the average request rate increased by 25% compared to Californium, which is a middleware for efficient interaction in IoT environments with powerful performance, an average response time decrease of 90% when resource management was used, and power consumption decreased by up to 68%. Finally, the proposed platform can reduce the latency and power consumption of IoT devices.

  7. MinT: Middleware for Cooperative Interaction of Things

    Science.gov (United States)

    Jeon, Soobin; Jung, Inbum

    2017-01-01

    This paper proposes an Internet of Things (IoT) middleware called Middleware for Cooperative Interaction of Things (MinT). MinT supports a fully distributed IoT environment in which IoT devices directly connect to peripheral devices easily construct a local or global network, and share their data in an energy efficient manner. MinT provides a sensor abstract layer, a system layer and an interaction layer. These enable integrated sensing device operations, efficient resource management, and active interconnection between peripheral IoT devices. In addition, MinT provides a high-level API to develop IoT devices easily for IoT device developers. We aim to enhance the energy efficiency and performance of IoT devices through the performance improvements offered by MinT resource management and request processing. The experimental results show that the average request rate increased by 25% compared to Californium, which is a middleware for efficient interaction in IoT environments with powerful performance, an average response time decrease of 90% when resource management was used, and power consumption decreased by up to 68%. Finally, the proposed platform can reduce the latency and power consumption of IoT devices. PMID:28632182

  8. An Account of Oak Ridge National Laboratory's Thirteen Research Reactors

    Energy Technology Data Exchange (ETDEWEB)

    Rosenthal, Murray Wilford [ORNL

    2009-08-01

    The Oak Ridge National Laboratory has built and operated 13 nuclear reactors in its 66-year history. The first was the graphite reactor, the world's first operational nuclear reactor, which served as a plutonium production pilot plant during World War II. It was followed by two aqueous-homogeneous reactors and two red-hot molten-salt reactors that were parts of power-reactor development programs and by eight others designed for research and radioisotope production. One of the eight was an all-metal fast burst reactor used for health physics studies. All of the others were light-water cooled and moderated, including the famous swimming-pool reactor that was copied dozens of times around the world. Two of the reactors were hoisted 200 feet into the air to study the shielding needs of proposed nuclear-powered aircraft. The final reactor, and the only one still operating today, is the High Flux Isotope Reactor (HFIR) that was built particularly for the production of californium and other heavy elements. With the world's highest flux and recent upgrades that include the addition of a cold neutron source, the 44-year-old HFIR continues to be a valuable tool for research and isotope production, attracting some 500 scientific visitors and guests to Oak Ridge each year. This report describes all of the reactors and their histories.

  9. Neutron Detector Signal Processing to Calculate the Effective Neutron Multiplication Factor of Subcritical Assemblies

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division; Gohar, Yousry [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division

    2016-06-01

    This report describes different methodologies to calculate the effective neutron multiplication factor of subcritical assemblies by processing the neutron detector signals using MATLAB scripts. The subcritical assembly can be driven either by a spontaneous fission neutron source (e.g. californium) or by a neutron source generated from the interactions of accelerated particles with target materials. In the latter case, when the particle accelerator operates in a pulsed mode, the signals are typically stored into two files. One file contains the time when neutron reactions occur and the other contains the times when the neutron pulses start. In both files, the time is given by an integer representing the number of time bins since the start of the counting. These signal files are used to construct the neutron count distribution from a single neutron pulse. The built-in functions of MATLAB are used to calculate the effective neutron multiplication factor through the application of the prompt decay fitting or the area method to the neutron count distribution. If the subcritical assembly is driven by a spontaneous fission neutron source, then the effective multiplication factor can be evaluated either using the prompt neutron decay constant obtained from Rossi or Feynman distributions or the Modified Source Multiplication (MSM) method.

  10. Fast neutron tomography with real-time pulse-shape discrimination in organic scintillation detectors

    Energy Technology Data Exchange (ETDEWEB)

    Joyce, Malcolm J., E-mail: m.joyce@lancaster.ac.uk [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Agar, Stewart [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Aspinall, Michael D. [Hybrid Instruments Ltd., Gordon Manley Building, Lancaster Environment Centre, Lancaster University, Lancaster LA1 4YW (United Kingdom); Beaumont, Jonathan S.; Colley, Edmund; Colling, Miriam; Dykes, Joseph; Kardasopoulos, Phoevos; Mitton, Katie [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom)

    2016-10-21

    A fast neutron tomography system based on the use of real-time pulse-shape discrimination in 7 organic liquid scintillation detectors is described. The system has been tested with a californium-252 source of dose rate 163 μSv/h at 1 m and neutron emission rate of 1.5×10{sup 7} per second into 4π and a maximum acquisition time of 2 h, to characterize two 100×100×100 mm{sup 3} concrete samples. The first of these was a solid sample and the second has a vertical, cylindrical void. The experimental data, supported by simulations with both Monte Carlo methods and MATLAB®, indicate that the presence of the internal cylindrical void, corners and inhomogeneities in the samples can be discerned. The potential for fast neutron assay of this type with the capability to probe hydrogenous features in large low-Z samples is discussed. Neutron tomography of bulk porous samples is achieved that combines effective penetration not possible with thermal neutrons in the absence of beam hardening.

  11. Report on the workshop "Decay spectroscopy at CARIBU: advanced fuel cycle applications, nuclear structure and astrophysics". 14-16 April 2011, Argonne National Laboratory, USA.

    Energy Technology Data Exchange (ETDEWEB)

    Kondev, F.; Carpenter, M.P.; Chowdhury, P.; Clark, J.A.; Lister, C.J.; Nichols, A.L.; Swewryniak, D. (Nuclear Engineering Division); (Univ. of Massachusetts); (Univ. of Surrey)

    2011-10-06

    A workshop on 'Decay Spectroscopy at CARIBU: Advanced Fuel Cycle Applications, Nuclear Structure and Astrophysics' will be held at Argonne National Laboratory on April 14-16, 2011. The aim of the workshop is to discuss opportunities for decay studies at the Californium Rare Isotope Breeder Upgrade (CARIBU) of the ATLAS facility with emphasis on advanced fuel cycle (AFC) applications, nuclear structure and astrophysics research. The workshop will consist of review and contributed talks. Presentations by members of the local groups, outlining the status of relevant in-house projects and availabile equipment, will also be organized. time will also be set aside to discuss and develop working collaborations for future decay studies at CARIBU. Topics of interest include: (1) Decay data of relevance to AFC applications with emphasis on reactor decay heat; (2) Discrete high-resolution gamma-ray spectroscopy following radioactive decya and related topics; (3) Calorimetric studies of neutron-rich fission framgents using Total ABsorption Gamma-Ray Spectrometry (TAGS) technique; (4) Beta-delayed neutron emissions and related topics; and (5) Decay data needs for nuclear astrophysics.

  12. The cross sections of fusion-evaporation reactions: the most promising route to superheavy elements beyond Z=118

    Directory of Open Access Journals (Sweden)

    Jadambaa Khuyagbaatar

    2017-01-01

    Full Text Available The synthesis of superheavy elements beyond oganesson (Og, which has atomic number Z = 118, is currently one of the main topics in nuclear physics. An absence of sufficient amounts of target material with atomic numbers heavier than californium (Z = 98 forces the use of projectiles heavier than 48Ca (Z = 20, which has been successfully used for the discoveries of elements with Z = 114 - 118 in complete fusion reactions. Experimental cross sections of 48Ca with actinide targets behave very differently to “cold” and “hot” fusion-evaporation reactions, where doubly-magic lead and deformed actinides are used as targets, respectively. The known cross sections of these reactions have been analysed compared to calculated fission barriers. It has been suggested that observed discrepancies between the cross sections of 48Ca-induced and other fusionevaporation reactions originate from the shell structure of the compound nucleus, which lies in the island of the stability. Besides scarcely known data on other reactions involving heavier projectiles, the most promising projectile for the synthesis of the elements beyond Og seems to be 50Ti. However, detailed studies of 50Ti, 54Cr, 58Fe and 64Ni-induced reactions are necessary to be performed in order to fully understand the complexities of superheavy element formation.

  13. Intracavitary moderator balloon combined with (252)Cf brachytherapy and boron neutron capture therapy, improving dosimetry in brain tumour and infiltrations.

    Science.gov (United States)

    Brandão, S F; Campos, T P R

    2015-07-01

    This article proposes a combination of californium-252 ((252)Cf) brachytherapy, boron neutron capture therapy (BNCT) and an intracavitary moderator balloon catheter applied to brain tumour and infiltrations. Dosimetric evaluations were performed on three protocol set-ups: (252)Cf brachytherapy combined with BNCT (Cf-BNCT); Cf-BNCT with a balloon catheter filled with light water (LWB) and the same set-up with heavy water (HWB). Cf-BNCT-HWB has presented dosimetric advantages to Cf-BNCT-LWB and Cf-BNCT in infiltrations at 2.0-5.0 cm from the balloon surface. However, Cf-BNCT-LWB has shown superior dosimetry up to 2.0 cm from the balloon surface. Cf-BNCT-HWB and Cf-BNCT-LWB protocols provide a selective dose distribution for brain tumour and infiltrations, mainly further from the (252)Cf source, sparing the normal brain tissue. Malignant brain tumours grow rapidly and often spread to adjacent brain tissues, leading to death. Improvements in brain radiation protocols have been continuously achieved; however, brain tumour recurrence is observed in most cases. Cf-BNCT-LWB and Cf-BNCT-HWB represent new modalities for selectively combating brain tumour infiltrations and metastasis.

  14. Intracavitary moderator balloon combined with 252Cf brachytherapy and boron neutron capture therapy, improving dosimetry in brain tumour and infiltrations

    Science.gov (United States)

    Brandão, S F

    2015-01-01

    Objective: This article proposes a combination of californium-252 (252Cf) brachytherapy, boron neutron capture therapy (BNCT) and an intracavitary moderator balloon catheter applied to brain tumour and infiltrations. Methods: Dosimetric evaluations were performed on three protocol set-ups: 252Cf brachytherapy combined with BNCT (Cf-BNCT); Cf-BNCT with a balloon catheter filled with light water (LWB) and the same set-up with heavy water (HWB). Results: Cf-BNCT-HWB has presented dosimetric advantages to Cf-BNCT-LWB and Cf-BNCT in infiltrations at 2.0–5.0 cm from the balloon surface. However, Cf-BNCT-LWB has shown superior dosimetry up to 2.0 cm from the balloon surface. Conclusion: Cf-BNCT-HWB and Cf-BNCT-LWB protocols provide a selective dose distribution for brain tumour and infiltrations, mainly further from the 252Cf source, sparing the normal brain tissue. Advances in knowledge: Malignant brain tumours grow rapidly and often spread to adjacent brain tissues, leading to death. Improvements in brain radiation protocols have been continuously achieved; however, brain tumour recurrence is observed in most cases. Cf-BNCT-LWB and Cf-BNCT-HWB represent new modalities for selectively combating brain tumour infiltrations and metastasis. PMID:25927876

  15. Investigation of Workplace-like Calibration Fields via a Deuterium-Tritium (D-T) Neutron Generator.

    Science.gov (United States)

    Mozhayev, Andrey V; Piper, Roman K; Rathbone, Bruce A; McDonald, Joseph C

    2017-04-01

    Radiation survey meters and personal dosimeters are typically calibrated in reference neutron fields based on conventional radionuclide sources, such as americium-beryllium (Am-Be) or californium-252 (Cf), either unmodified or heavy-water moderated. However, these calibration neutron fields differ significantly from the workplace fields in which most of these survey meters and dosimeters are being used. Although some detectors are designed to yield an approximately dose-equivalent response over a particular neutron energy range, the response of other detectors is highly dependent upon neutron energy. This, in turn, can result in significant over- or underestimation of the intensity of neutron radiation and/or personal dose equivalent determined in the work environment. The use of simulated workplace neutron calibration fields that more closely match those present at the workplace could improve the accuracy of worker, and workplace, neutron dose assessment. This work provides an overview of the neutron fields found around nuclear power reactors and interim spent fuel storage installations based on available data. The feasibility of producing workplace-like calibration fields in an existing calibration facility has been investigated via Monte Carlo simulations. Several moderating assembly configurations, paired with a neutron generator using the deuterium tritium (D-T) fusion reaction, were explored.

  16. Production of medical radioisotopes in the ORNL High Flux Isotope Reactor (HFIR) for cancer treatment and arterial restenosis therapy after PTCA

    Energy Technology Data Exchange (ETDEWEB)

    Knapp, F.F. Jr.; Beets, A.L.; Mirzadeh, S.; Alexander, C.W.; Hobbs, R.L.

    1998-06-01

    The High Flux Isotope Reactor (HFIR) at the Oak Ridge National Laboratory (ORNL) represents an important resource for the production of a wide variety of medical radioisotopes. In addition to serving as a key production site for californium-252 and other transuranic elements, important examples of therapeutic radioisotopes which are currently routinely produced in the HFIR for distribution include dysprosium-166 (parent of holmium-166), rhenium-186, tin-117m and tungsten-188 (parent of rhenium-188). The nine hydraulic tube (HT) positions in the central high flux region permit the insertion and removal of targets at any time during the operating cycle and have traditionally represented a major site for production of medical radioisotopes. To increase the irradiation capabilities of the HFIR, special target holders have recently been designed and fabricated which will be installed in the six Peripheral Target Positions (PTP), which are also located in the high flux region. These positions are only accessible during reactor refueling and will be used for long-term irradiations, such as required for the production of tin-117m and tungsten-188. Each of the PTP tubes will be capable of housing a maximum of eight HT targets, thus increasing the total maximum number of HT targets from the current nine, to a total of 57. In this paper the therapeutic use of reactor-produced radioisotopes for bone pain palliation and vascular brachytherapy and the therapeutic medical radioisotope production capabilities of the ORNL HFIR are briefly discussed.

  17. Prevalence of the dhfr and dhps Mutations among Pregnant Women in Rural Burkina Faso Five Years after the Introduction of Intermittent Preventive Treatment with Sulfadoxine-Pyrimethamine.

    Science.gov (United States)

    Tahita, Marc C; Tinto, Halidou; Erhart, Annette; Kazienga, Adama; Fitzhenry, Robert; VanOvermeir, Chantal; Rosanas-Urgell, Anna; Ouedraogo, Jean-Bosco; Guiguemde, Robert T; Van Geertruyden, Jean-Pierre; D'Alessandro, Umberto

    2015-01-01

    The emergence and spread of drug resistance represents one of the biggest challenges for malaria control in endemic regions. Sulfadoxine-pyrimethamine (SP) is currently deployed as intermittent preventive treatment in pregnancy (IPTp) to prevent the adverse effects of malaria on the mother and her offspring. Nevertheless, its efficacy is threatened by SP resistance which can be estimated by the prevalence of dihydropteroate synthase (dhps) and dihydrofolate reductase (dhfr) mutations. This was measured among pregnant women in the health district of Nanoro, Burkina Faso. From June to December 2010, two hundred and fifty six pregnant women in the second and third trimester, attending antenatal care with microscopically confirmed malaria infection were invited to participate, regardless of malaria symptoms. A blood sample was collected on filter paper and analyzed by PCR-RFLP for the alleles 51, 59, 108, 164 in the pfdhfr gene and 437, 540 in the pfdhps gene. The genes were successfully genotyped in all but one sample (99.6%; 255/256) for dhfr and in 90.2% (231/256) for dhps. The dhfr C59R and S108N mutations were the most common, with a prevalence of 61.2% (156/255) and 55.7% (142/255), respectively; 12.2% (31/255) samples had also the dhfr N51I mutation while the I164L mutation was absent. The dhps A437G mutation was found in 34.2% (79/231) isolates, but none of them carried the codon K540E. The prevalence of the dhfr double mutations NRNI and the triple mutations IRNI was 35.7% (91/255) and 11.4% (29/255), respectively. Though the mutations in the pfdhfr and pfdhps genes were relatively common, the prevalence of the triple pfdhfr mutation was very low, indicating that SP as IPTp is still efficacious in Burkina Faso.

  18. Vowel variation in Southern Sotho: an acoustic investigation

    CSIR Research Space (South Africa)

    Barnard, E

    2008-01-01

    Full Text Available Linguistics and Applied Language Studies 2008, 26(2): 255?265 Printed in South Africa ? All rights reserved Copyright ? NISC Pty Ltd SOUTHERN AFRICAN LINGUISTICS AND APPLIED LANGUAGE STUDIES ISSN 1607?3614 EISSN 1727?9461 DOI: 10.2989/SALALS.2008... have any special status (as pointed out above, the existence of at least seven vowels in Southern African Linguistics and Applied Language Studies 2008, 26(2): 255?265 257 Southern Sotho is uncontroversial). It is also true that the orthographic form...

  19. Thermohaline structure and circulation in the upper layers of the southern Bay of Bengal during BOBMEX-Pilot (October-November 1998)

    Digital Repository Service at National Institute of Oceanography (India)

    RameshBabu, V.; Murty, V.S.N.; Rao, L.V.G.; Prabhu, C.V.; Tilvi, V.

    the Bay of Bengal. Keywords. Bay of Bengal; thermohaline circulation; Indian Monsoon Current; BOBMEX. Proc. Indian Acad. Sci. (Earth Planet. Sci.), 109, No. 2, June 2000, pp. 255--265 #Printed in India 255 2. Data and methods The locations of hydrographic..., Charuta V Prabhu and Tilvi V, 2000 Proc. Indian Acad. Sci. (Earth Planet Sci.), (this issue) Murty V S N, Sarma Y V B, Rao D P and Murty C S 1992 J. Mar. Res. 50 207--228 Murty V S N, Suryanarayana A and Rao D P 1993 Indian J. Mar. Sci. 22 12--16 Murty V...

  20. Gclust Server: 89639 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 89639 ATH_AT4G34240_18418408 Cluster Sequences Related Sequences(255) 550 ALDH3I1 (Aldehyde dehydrogenase...4.29 0.0 0.0 0.0 0.0 0.0 Show 89639 Cluster ID 89639 Sequence ID ATH_AT4G34240_18418408 Link to cluster sequences Cluster Se...quences Link to related sequences Related Sequences(255) Sequence length 550 Represe.../ aldehyde dehydrogenase (NAD) Number of Sequences 1 Homologs 1 Clustering threshold 1.00e-28 Plants and... 3I1); 3-chloroallyl aldehyde dehydrogenase/ aldehyde dehydrogenase (NAD) 1 1.00e-28 1

  1. Metals Subcommittee Report - Manufacturing Technology Advisory Group.

    Science.gov (United States)

    1980-01-01

    James W. Carstens OIC, Ofc Ass’t Sec of the Navy, (MRA&L), ATTN: Dr. James Tweeddale OIC, Nay Material Cmd, Code 08E4, Capt Fred Rollick OIC, NAVMIRO...ATTN: Mr. Bill S. Safier Cdr, Ofc Ass’t Sec of AF (RD&L),. ATTN: Mr. Martin Rogers Cdr, HQ USAF, ATTN: RDCM, MaJ Don Mackintosh Cdr, HQ AFSC, ATTN...513-255-5151 AV 785-5151, 513-255-5151 Mr. Fred Miller Mr. James Lawyer Air Force Materials Laboratory Mr. George Shearer ATTN: AFML/LTM Air Force

  2. Information and Communication Technology (ICT) Standards and Guidelines. Final rule.

    Science.gov (United States)

    2017-01-18

    We, the Architectural and Transportation Barriers Compliance Board (Access Board or Board), are revising and updating, in a single rulemaking, our standards for electronic and information technology developed, procured, maintained, or used by Federal agencies covered by section 508 of the Rehabilitation Act of 1973, as well as our guidelines for telecommunications equipment and customer premises equipment covered by Section 255 of the Communications Act of 1934. The revisions and updates to the section 508-based standards and section 255-based guidelines are intended to ensure that information and communication technology covered by the respective statutes is accessible to and usable by individuals with disabilities.

  3. Epidemiología molecular de las tuberculosis bovina y humana en una zona endémica de Querétaro, México Molecular epidemiology of cattle and human tuberculosis in Mexico

    OpenAIRE

    Laura Pérez-Guerrero; Feliciano Milián-Suazo; Camila Arriaga-Díaz; Cecilia Romero-Torres; Minerva Escartín-Chávez

    2008-01-01

    OBJETIVO: Determinar el papel de la tuberculosis bovina en la tuberculosis humana. MATERIAL Y MÉTODOS: Se analizaron 255 muestras de pacientes sintomáticos, sembradas en medios de Stonebrink y Löwenstein-Jensen y analizadas por PCRMPB70 anidada y luego por spoligotyping. RESULTADOS: De las 255 muestras, 74 fueron positivas a la PCR y 20 al aislamiento: de las primeras, 58 (78%) mostraron espoligotipo de M. tuberculosis y 5 (6.7%) de M. bovis; de las segundas, 8 (47%) revelaron espoligotipo de...

  4. Drug: D07473 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D07473 Drug Atomoxetine (INN); Tomoxetine C17H21NO 255.1623 255.3547 D07473.gif Ant...TROPICS N06BA Centrally acting sympathomimetics N06BA09 Atomoxetine D07473 Atomoxetine (INN) USP drug classi...ty Disorder Agents, Non- amphetamines Atomoxetine D07473 Atomoxetine (INN) Target-based classification of dr...ugs [BR:br08310] Transporters Solute carrier family SLC6 SLC6A2 (noradrenalin transporter) [HSA:6530] [KO:K05035] Atom...oxetine [ATC:N06BA09] D07473 Atomoxetine (INN) CAS: 83015-26-3 PubChem:

  5. Gclust Server: 137531 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 137531 Sto_STS255 Cluster Sequences - 52 hypothetical protein 1 1.00e-19 0.0 0.0 0....0 0.0 3.23 0.0 Show 137531 Cluster ID 137531 Sequence ID Sto_STS255 Link to cluster sequences Cluster Sequen...Sequences 1 Homologs 1 Clustering threshold 1.00e-19 Plants and algae (7species) ...s not appearing in this cluster ATH: 0 OSA: 0 PoTR: 0 PPT: 0 CRE: 0 OTAU: 0 CME: 0 GTH: 0 PFA: 0 PTR: 0 TPS:

  6. Students’ anticipated situational engagement : the roles of teacher behaviour, personal engagement, and gender

    NARCIS (Netherlands)

    Thijs, J.T.; Verkuyten, M.J.A.M.

    2009-01-01

    Among 9th-grade students (248 girls, 255 boys) from a large multiethnic school, the authors examined 2 aspects of anticipated situational engagement in relation to 3 types of hypothetical teacher behavior: authoritarian, authoritative, permissive. Furthermore, the authors investigated the moderating

  7. THE ROLE OF ESTUARIES IN SOUTH AFRICAN FISHERIES ...

    African Journals Online (AJOL)

    Existing catch data for 129 of 255 functional estuaries on the South African coastline were reviewed and the relationships between fish catch and estuary size, type and biogeographical region analysed using simple and multivariate models. The best predictive models were obtained by analysing data separately for each ...

  8. 7 CFR 1767.19 - Liabilities and other credits.

    Science.gov (United States)

    2010-01-01

    ... 255Accumulated Deferred Investment Tax Credits 256Deferred Gains from Disposition of Utility Plant 257Unamortized... transaction shall be recorded by debiting Account 131.1, Cash—General, and crediting Account 451... adjustment, unrealized gains and losses on certain investments in debt and equity securities, and cash flow...

  9. SELKIRK'S THEORY OF VERBAL COMPOUNDING: A CRITICAL ...

    African Journals Online (AJOL)

    the grauunar assigns grammatical functions to the nanheads of compounds. According to Selkirk (1981:255), such .... ever, Selkirk presents neither an explicit intensional definition of this notion nor an exhaustive list of ..... analysis of Afrikaans verbal compounds, this hypothesis is apparently contradicted by forms such as ...

  10. Domain Modeling: NP_057415.1 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_057415.1 chr3 CRYSTAL STRUCTURE OF A DESIGNED ZINC FINGER PROTEIN BOUND TO DNA c1meyf_ chr3/NP_057415....1/NP_057415.1_holo_169-255.pdb psi-blast 405C,407D,408C,409G,410K,411G,412F,413S,415M,

  11. Domain Modeling: NP_003315.2 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_003315.2 chr12 Crystal Structure Analysis of the human Tub protein (isoform a) s...panning residues 289 through 561 p1s31a_ chr12/NP_003315.2/NP_003315.2_holo_176-442.pdb blast 207I,222Y,224Y,232K,234F,255P PGE 0 ...

  12. 77 FR 41791 - Proposed Collection; Comment Request; Prostate, Lung, Colorectal and Ovarian Cancer Screening...

    Science.gov (United States)

    2012-07-16

    ... designed to determine if cancer screening for prostate, lung, colorectal, and ovarian cancer can reduce mortality from these cancers which currently cause an estimated 255,700 deaths annually in the U.S. The... approximately 94,000 participants being actively followed up. The reports on cancer screening and prostate, lung...

  13. 77 FR 62518 - Submission for OMB Review; Comment Request (30-Day FRN); Prostate, Lung, Colorectal and Ovarian...

    Science.gov (United States)

    2012-10-15

    ...); Prostate, Lung, Colorectal and Ovarian Cancer Screening Trial (PLCO) (NCI) SUMMARY: Under the provisions of...: Prostate, Lung, Colorectal, and Ovarian Cancer Screening Trial (PLCO), OMB No: 0925-0407, Expiration Date 9... ovarian cancer can reduce mortality from these cancers which currently cause an estimated 255,700 deaths...

  14. Incentivos para promover procesos de innovación en unidades familiares de producción de leche en México /

    OpenAIRE

    Villa Soto, Juan Carlos sustentante.

    2009-01-01

     tesis que para obtener el grado de Doctor en Estudios Latinoamericanos, presenta Juan Carlos Villa Soto ; asesor María del Carmen del Valle Rivera, Norma Blazquez Graf, José Luis Solleiro Rebolledo. 255 páginas : ilustraciones. Doctorado en Estudios Latinoamericanos UNAM, Facultad de Filosofía y Letras, 2009

  15. Modular antenna of photosystem I in secondary plastids of red algal origin: a Nannochloropsis oceanica case study

    Czech Academy of Sciences Publication Activity Database

    Bína, David; Gardian, Zdenko; Herbstová, Miroslava; Litvín, Radek

    2017-01-01

    Roč. 131, č. 3 (2017), s. 255-266 ISSN 0166-8595 R&D Projects: GA ČR(CZ) GP14-01377P Institutional support: RVO:60077344 Keywords : light-harvesting complexes * diatom phaeodactylum-tricornutum * em structure determination Subject RIV: CE - Biochemistry Impact factor: 3.864, year: 2016

  16. Physical Activity at Daycare: Issues, Challenges and Perspectives

    Science.gov (United States)

    van Zandvoort, Melissa; Tucker, Patricia; Irwin, Jennifer D.; Burke, Shauna M.

    2010-01-01

    This study sought to examine London, Ontario-based childcare providers' perspectives of the barriers and facilitators to physical activity participation among preschoolers (i.e. children aged 2.5-5 years) attending daycare. A heterogeneous sample of childcare providers (n = 54; response rate 47%) working at public daycare facilities in London,…

  17. Counseling For Entrepreneurship Development at Secondary ...

    African Journals Online (AJOL)

    The study focused on Counselling for Entrepreneurship Development at the Secondary School Level in Akwa Ibom State. The population comprised 705 principals of public and approved private secondary school in the State. A sample of 255 (116 male and 139 female) principals was drawn, using the stratified sampling ...

  18. The evaluation of the Center for Epidemiologic Studies Depression (CES-D) scale : Depressed and Positive Affect in cancer patients and healthy reference subjects

    NARCIS (Netherlands)

    Schroevers, MJ; Sanderman, R; van Sonderen, E; Ranchor, AV

    2000-01-01

    This study examined the reliability and validity of a two-factor structure of the Center for Epidemiologic Studies Depression (CES-D) scale. The study was conducted in a large group of cancer patients (n = 475) and a matched reference group (n = 255). Both groups filled in a questionnaire at two

  19. Drug: D06560 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D06560 Drug Batabulin (USAN/INN) C13H7F6NO3S 371.0051 371.255 D06560.gif Treatment of various advanced refra...ctory cancers [binds to beta-tubulin] CAS: 195533-53-0 PubChem: 47208216 PDB-CCD: T

  20. Accurately Decoding Visual Information from fMRI Data Obtained in a Realistic Virtual Environment

    Science.gov (United States)

    2015-06-09

    avoiding contact with a dog . Subjects received compensation after the scan based on the score they received in the game. Similar to the work of Spiers...2007.06.002 Spiers, H. J., and Maguire, E. A. (2007b). Neural substrates of driving behaviour . Neuroimage 36, 245–255. doi: 10.1016/j.neuroimage.2007.02.032

  1. All projects related to | Page 580 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2007-03-31

    Start Date: March 31, 2007. End Date: July 18, 2011. Topic: INFORMATION TECHNOLOGY, INFORMATION SOCIETY, GENDER EQUALITY, RESEARCH FELLOWSHIPS. Region: Middle East, Central Asia, Far East Asia, South Asia, Jordan, Lebanon, Malaysia, Syria, Yemen, Palestine. Total Funding: CA$ 1,255,000.00.

  2. 76 FR 16624 - Notice of Public Information Collection(s) Being Submitted for Review and Approval to the Office...

    Science.gov (United States)

    2011-03-24

    ...-0833. Title: Implementation of Section 255 of the Telecommunications Act of 1996: Complaint Filings..., added to the Communications Act by the Telecommunications Act of 1996; and section 4(i) (47 U.S.C. 154(i... Impact Assessment: Yes. The Privacy Impact Assessment (PIA) was completed on June 28, 2007. It may be...

  3. endemic cultivars

    African Journals Online (AJOL)

    allowing the continuation of natural evolutionary processes and for landraces that were selected for important traits overmany years by farmers. ... Human selection, climatic and physio-geographic influences could also have played a role ..... Genetic resources in breeding for adaptation. Euphytica 92:255-266. Ingram, D.S. ...

  4. Diagnostic values of digital rectal examination, prostate specific ...

    African Journals Online (AJOL)

    Results: There was a prostate adenocarcinoma incidence of 25.5%; all found among patients with PSA levels greater than 10ng/ml. The positive predictive value (PPV), sensitivity and specificity of DRE for prostate cancer were 0.67%, 66.7% and 88.6% with an accuracy of 82.8%; while for TRUS, the respective values were ...

  5. 75 FR 6040 - Center for Scientific Review; Amended Notice of Meeting

    Science.gov (United States)

    2010-02-05

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health Center for Scientific Review; Amended Notice of Meeting... Panel, February 24, 2010, 6 p.m. to February 26, 2010, 4 p.m., Hilton Salt Lake City Center, 255 South...

  6. High Blood Pressure Facts

    Science.gov (United States)

    ... Stroke Heart Disease Cholesterol Salt Million Hearts® WISEWOMAN High Blood Pressure Facts Recommend on Facebook Tweet Share Compartir On ... the facts about high blood pressure [PDF-255K] . High Blood Pressure in the United States About 75 million American ...

  7. Geologic Mapping of the Summit and Western Flank of Alba Mons, Mars

    Science.gov (United States)

    Crown, D. A.; Berman, D. C.; Platz, T.; Scheidt, S. P.; Hauber, E.; Weitz, C. M.

    2017-06-01

    This investigation employs imaging and topographic datasets to produce two 1:1M-scale geologic maps covering the Alba Mons summit (245-255°E, 32.5-47.5°N) and western flank (230-245°E, 37.5-47.5°N).

  8. Final report: Waterfowl activity and habitat use on the Swan Lake HREP Site

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — We studied diurnal activity and habitat use patterns of waterfowl on Swan Lake in Calhoun County, IL during fall and spring migrations 1992-93. Swan Lake, a 1,255 ha...

  9. Experimental Evaluation of MIMO Terminals with User Influence in OTA Setups

    DEFF Research Database (Denmark)

    Fan, Wei; Kyösti, Pekka; Hentilä, Lassi

    2017-01-01

    channel models in a practical 3D multi-probe anechoic chamber (MPAC) setup. A terminal mock-up, operating at 2.55 GHz, together with a realistic user phantom was used, and channel models with different spatial and polarization profiles, DUT with different operation modes and orientation angles were tested....

  10. 78 FR 77334 - Small Business Size Standards: Construction

    Science.gov (United States)

    2013-12-23

    ... ADMINISTRATION 13 CFR Part 121 RIN 3245-AG37 Small Business Size Standards: Construction AGENCY: U.S. Small Business Administration. ACTION: Final rule. SUMMARY: The United States Small Business Administration (SBA... Engineering Construction, from $20 million to $25.5 million. As part of its ongoing comprehensive size...

  11. Comparative study of the prevalence of leptospirosis in vaccinated ...

    African Journals Online (AJOL)

    This work presents serological reactions of vaccinated and unvaccinated dogs in Ibadan, Nigeria to eight leptospirtal serovars. The overall seroprevelence to leptospires was 16.7% while in unvaccinated dogs it was 14.4%. The following seroprevalences were obtained: L. canicola 27.5% L. grippotyphosa 25.5%, ...

  12. ziehl-neelsen microscopy in the diagnosis of tuberculosis in settings

    African Journals Online (AJOL)

    2012-08-01

    181/341) of them culture positive. ... Of the 695 suspects evaluated for both Mycobacterium and HIV infection,. 255 (36.7%) were ZN smear ..... specific DNA probes that hybridise with ribosomal. RNA (rRNA) released from the ...

  13. Motor Profile of Portuguese Preschool Children on the Peabody Developmental Motor Scales-2: A Cross-Cultural Study

    Science.gov (United States)

    Saraiva, Linda; Rodrigues, Luis P.; Cordovil, Rita; Barreiros, Joao

    2013-01-01

    This study was designed to examine the cultural sensitivity of the PDMS-2 for Portuguese preschool children aged 36-71 months. A total of 540 children (255 males and 285 females) from 15 public preschools of Viana do Castelo, Portugal, were assessed. Age and gender effects in motor performance were examined. Results indicated that PDMS-2 is valid…

  14. The Role of Self-Compassion and Emotional Approach Coping in the Relationship between Maladaptive Perfectionism and Psychological Distress among East Asian International Students

    Science.gov (United States)

    Seo, Heweon

    2012-01-01

    This study investigated the mediating and moderating roles of self-compassion and emotional approach coping in the relationship between maladaptive perfectionism and psychological distress among East Asian international students. Data were collected through an online survey completed by 255 East Asian international students in a large public…

  15. Chronic post-thoracotomy pain: a retrospective study.

    NARCIS (Netherlands)

    Pluijms, W.A.; Steegers, M.A.H.; Verhagen, A.F.T.M.; Scheffer, G.J.; Wilder-Smith, O.H.G.

    2006-01-01

    BACKGROUND: Chronic pain is common after thoracotomy. The primary goal of this study was to investigate the incidence of chronic post-thoracotomy pain. The secondary goal was to identify possible risk factors associated with the development of chronic post-operative pain. METHODS: We contacted 255

  16. Scaling Up Fertilizer Micro-Dosing and Indigenous Vegetable ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    They will connect women-led cooperatives and youth groups to the private sector and business organizations, directly reaching more than 255,000 households. The team's work will involve further developing commercial seed production, postharvest handling, and value chains. They will also strengthen producer groups.

  17. Page 1 * Regd. No. KRN-A 41 Vol. 98, No. 3, October 1989 ...

    Indian Academy of Sciences (India)

    M S Narayanam, P K Pal,. P C Joshi, M M Ali and Baby Simon 247. Canonical sound speed profile for the Central Bay of Bengal . . . . . . . . . . . T V Ramana Murty, S Prasanna Kumar, Y K Somayajulu, J S Sastry and. Rui J P De Figueiredo 255. Wave-induced nearshore circulation along the Calangute-Candolim beach,.

  18. Ecophysiological characterization of carnivorous plant roots: oxygen fluxes, respiration, and water exudation

    Czech Academy of Sciences Publication Activity Database

    Adamec, Lubomír

    2005-01-01

    Roč. 49, č. 2 (2005), s. 247-255 ISSN 0006-3134 R&D Projects: GA AV ČR(CZ) IAA6005909 Institutional research plan: CEZ:AV0Z6005908 Keywords : terrestrial carnivorous plants * soil anoxia * Genlisea traps Subject RIV: EF - Botanics Impact factor: 0.792, year: 2005

  19. Prevalence, severity and risk factors of allergic disorders among ...

    African Journals Online (AJOL)

    ). Of the total partici- pants, 362(90.5%) consumed mixed diet and 15(3.7%) were smokers. (Table 4). Table 4: Association of othe history. Characteristics. Allergy unl. Diet. Vegetarian. 30(78. Mixed. 255(70. Smoking. Yes. 13(86. No. 272(70.

  20. Ethiopian Journal of Environmental Studies and Management - Vol ...

    African Journals Online (AJOL)

    Rapid survey of Dragonflies (Insecta: Odonata) of Kribi forest and Campo Ma'am national Park, Southern Cameroon · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. BW Adu, SS Ogbogu, EO Akindele, 255-266. http://dx.doi.org/10.4314/ejesm.v9i3.1 ...

  1. 17 CFR 230.251 - Scope of exemption.

    Science.gov (United States)

    2010-04-01

    ....) immediately before the offering; (3) Is not a development stage company that either has no specific business...) Written offers under § 230.255 may be made; (C) Printed advertisements may be published or radio or... general character and location of its property. (iii) After the Form 1-A offering statement has been...

  2. Effects of stand development and weather on monthly leaf biomass dynamics of a loblolly pine (Pinus taeda L.) stand

    Science.gov (United States)

    P.M. Dougherty; T.C. Hennessey; Stanley J. Zarnoch; P.t> Stenberg; R.T. Holeman; R.F. Witter

    1995-01-01

    Annual leaf biomass production, monthly needle accretion and monthly needlefall were measured in an 1l- to 17-year-old thinned stand of loblolly pine. Initial thinning levels were 7.8 m2 ha-1, 12.6 m2 ha-1, and 25.5 m2 ha-1...

  3. The relationship between the doping levels and some physical ...

    Indian Academy of Sciences (India)

    [28] A Smith, J M Laurent, D S Smith, J P Bonnet and R R Clemente, Thin Solid Films 266, 20. (1995). [29] K Omura, P Veluchamy and M Murozono, J. Elecktrochem. Soc. 146, 2113 (1999). [30] A V Moholkar, S M Pawara, K Y Rajpure, C H Bhosale and J H Kim, Appl. Surface Sci. 255,. 9358 (2009). [31] N Menarian, S M ...

  4. prevalance of alcohol abuse in calabar south local government ...

    African Journals Online (AJOL)

    Eyamba

    Overcoming shyness. 288. 72. Sleep aid. 102. 25.5. Overcome fatigue and boredom. 297. 74.25. * Multiple responses allowed. TABLE 7: Effect of alcohol consumption on the social behavior of the respondents. N=400. Effect. No. of respondents. Percent. Wife and child battering. 295. 73.75. Unwanted pregnancies. 83.

  5. Sociotropic personality traits positively correlate with the severity of ...

    African Journals Online (AJOL)

    teachers revealed that sociotropy could predict future shyness.[11] In a study of 255 students sociotropy scores were posi tively correlated with rated trait anxiety in situations of social evalua tion.[12] These studies indicate that there may be an association between sociotropy-autonomy traits and anxiety disorders. Several ...

  6. Schedule Risk Event Driven Methodology (SREDM): FY13 Army Studies Program Project Findings

    Science.gov (United States)

    2015-01-01

    TRADOC Analysis Center ATRC-PR/ Susan Matus 255 Sedgwick Avenue Fort Leavenworth, KS 66027-2345 susan.g.matus.civ@mail.mil US...Army TRAC- White Sands Missile Range ATRC-W/Dr. Lambert Bldg 1400 Martin Luther King Drive White Sands Missile Range, NM 88002-5502

  7. Army Independent Risk Assessment Guidebook

    Science.gov (United States)

    2014-04-01

    Rd. Aberdeen Proving Ground, MD 21005-5071 US Army TRADOC Analysis Center ATRC-PR/ Susan Matus 255 Sedgwick Avenue Fort Leavenworth, KS...66027-2345 susan.g.matus.civ@mail.mil US Army TRAC- White Sands Missile Range ATRC-W/Dr. Lambert Bldg 1400 Martin Luther King Drive White

  8. Evaluation of various pesticides-degrading pure bacterial cultures ...

    African Journals Online (AJOL)

    IASA

    2016-10-05

    Oct 5, 2016 ... consorcio microbiano aislado de humedales constantes en laboratorio. Actual. Biol. 37(102):255-265. Rodriguez E, Gamboa M (2009). Bacteriología General. 2da edición. Barcelona, España. Editorial García. Pp. 1-170. Rosenberg A, Alexander M (1979). Microbial cleavege of various organophosphorus ...

  9. Urogenital complications among girls with genital mutilation: a ...

    African Journals Online (AJOL)

    To explore paediatric complications of female genital mutilation (FGM), 255 consecutive girls aged 4–9 years presenting to an emergency ward in Sudan were included in this clinical study. Full examination, including inspection of genitalia, was performed. Dipsticks for nitrite and leucocytes were used to diagnose ...

  10. Electrochemical properties of dip-coated vanadium pentaoxide thin ...

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 39; Issue 6. Electrochemical properties of dip-coated vanadium pentaoxide thin films. R S INGOLE B J LOKHANDE. Volume 39 Issue 6 ... Author Affiliations. R S INGOLE1 B J LOKHANDE1. School of Physical Sciences, Solapur University, Solapur 413 255, India ...

  11. 50 CFR 14.253 - What are the restrictions contained in these regulations?

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 1 2010-10-01 2010-10-01 false What are the restrictions contained in these regulations? 14.253 Section 14.253 Wildlife and Fisheries UNITED STATES FISH AND WILDLIFE SERVICE....255, it is unlawful for any person to import, export, transport, sell, receive, acquire, or purchase...

  12. Moderator Role of Self-Esteem on the Relationship between Life Satisfaction and Depression in Early Adolescents

    Science.gov (United States)

    Civitci, Asim

    2010-01-01

    In this study, the moderator effects of global self-esteem on the relationship between life satisfaction domains (family, friends and school) and depression in early adolescents were examined. The participants consisted of 255 students, aged from 11 to 15 years, from three junior high schools in Turkey. Data were collected using the Rosenberg…

  13. Proceedings – Mathematical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Proceedings – Mathematical Sciences; Volume 116; Issue 2. Volume 116, Issue 2. May 2006, pages 121-255. pp 121-136 Invited Article. The Abstruse Meets the Applicable: Some Aspects of Time-Frequency Analysis · G B Folland · More Details Abstract Fulltext PDF. The area of Fourier analysis connected ...

  14. Formulation and Evaluation of Microspheres Based on Gelatin ...

    African Journals Online (AJOL)

    µg.h/ml for the control, 262±3.47 µg.h/ml for microspheres based on gelatine only and 328±2.55 µg.h/ml for microspheres formulated with equal parts of gelatin and mucin. Conclusion: The inclusion of S-mucin in the composition of the ...

  15. RETINOPATHY OF PREMATURITY IN INFANTS WITH BIRTH ...

    African Journals Online (AJOL)

    hi-tech

    2000-10-10

    %). 0.67. Maternal hypertension. 1 (7.7%). 14 (25.5%). 0.15. Premature rupture of membranes. 5 (38.5%). 5 (9.1%). 0.33. Tables 1 and 2 respectively show the neonatal and maternal risk factors associated with the disease.

  16. Managing Resource Teams in the Hellenic Navy

    Science.gov (United States)

    2011-12-01

    Cohesion effects team morale and both influence members staying in the group ( Festinger , Schachter & Back, 1950). Mutual trust connotes an...operative working, West, Tjosvold & Smith, 255–275. Chichester: John Wiley & Sons Ltd. Festinger , L. Schachter, S. & Back, K. (1950). Social

  17. EST Table: FS893092 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available -PA 10/09/10 41 %/255 aa gi|91078946|ref|XP_974065.1| PREDICTED: similar to Outer... dense fiber protein 2 (Outer dense fiber of sperm tails protein 2) (84 kDa outer dense fiber protein) (Cenexin) [Tribolium castaneum] FS892927 ftes ...

  18. Reliability and Validity of Adolescents' Scores on the Body Esteem Scale.

    Science.gov (United States)

    Cecil, Heather; Stanley, Melinda A.

    1997-01-01

    The psychometric properties of the Body Esteem Scale (BES) were studied with 255 girls and boys in grades 5 through 12. Internal consistency was found for the gender-specific subscales. Results provide preliminary evidence that the BES may be a psychometrically defensible assessment of body esteem among adolescents. (SLD)

  19. 1 Free radical scavenging activity of some fungi indigenous to ...

    African Journals Online (AJOL)

    Cheung, L., Cheung, P.C. K. & Ooi V.E. (2003) Antioxidant activity and total phenolics of edible mushroom extracts. Food Chemistry 81, 249–255. Jacobson, E., Hove, E. & Emery, H. (1995) Antioxidant function of melanin in black fungi. American Infection and Immunity 63, 4944-4945. Javanmardi, J., Stushnoff, C., Locke, ...

  20. Measurement of β-glucan and other nutritional characteristics in ...

    African Journals Online (AJOL)

    Maiara

    2013-10-23

    Oct 23, 2013 ... Cheung LM, Cheung PCK, Ooi VEC (2003). Antioxidant activity and total phenolics of edible mushroom extracts. Food Chem. 81:249-. 255. Colauto NB, Dias ES, Gimenes MA, Eira AF (2002). Genetic characterization of isolates of the basidiomycete Agaricus blazei by. RAPD. Braz. J. Microbiol. 33:131-133.

  1. When do trauma experts choose exposure therapy for PTSD patients? A controlled study of therapist and patient factors

    NARCIS (Netherlands)

    Minnen, A. van; Hendriks, L.; Olff, M.

    2010-01-01

    To investigate when and why therapists opt for or rule out imaginal exposure (IE) for patients with posttraumatic stress disorder (PTSD), 255 trauma experts were randomized to two conditions in which they were presented with four cases in which the patients' comorbidity and treatment preferences

  2. Examination of Relationship between Anxiety Sensitivity and Parenting Styles in Adolescents

    Science.gov (United States)

    Erozkan, Atilgan

    2012-01-01

    This research investigated the relationships between anxiety sensitivity and perceived parenting styles of adolescents and the predictive role of perceived parenting styles on anxiety sensitivity. The study group was composed by 545 (255 females; 290 males) students studying in different high schools in Mugla. The data were collected using the…

  3. Gclust Server: 120140 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 120140 PHSO_142121 Cluster Sequences Related Sequences(23) 255 estExt_fgenesh1_pg.C..._1080050; no annotation 1 1.00e-99 0.0 11.11 0.0 0.0 0.0 0.0 Show 120140 Cluster ID 120140 Sequence ID PHSO_

  4. Profile of cry from native Bacillus thuringiensis isolates and ...

    African Journals Online (AJOL)

    The characterization of 255 Bacillus thuringiensis isolates of Coorg, Sharavatti and BR hills, containing genes known to be active against coleopteran and lepidopteran insect species was done through PCR amplification using the specific and degenerate primers. The isolates were also tested for their insecticidal activity ...

  5. Dicty_cDB: Contig-U10778-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 255 e-128 DQ980509_1( DQ980509 |pid:none) Thaumatomonas sp. TMT002 alpha tub... 242 e-128 AY818731_1( AY8187... e-122 DQ980537_1( DQ980537 |pid:none) Leucocryptos marina clone lmtua10 ... 245 e-122 EF455794_1( EF455794 |pid:none) Thaumatomo

  6. The Relationship between Teachers' Trust in Students and Classroom Discipline Beliefs

    Science.gov (United States)

    Arslan, Yaser; Polat, Soner

    2016-01-01

    This study was aimed to identify the relationship between teachers' trust in students and their classroom discipline beliefs. Correlational research design was used in this study. Participants of the study were 255 teachers who worked in Kocaeli, a city from the Marmara region of Turkey. Data were gathered with trust instrument which was developed…

  7. Virtual high screening throughput and design of 14α-lanosterol ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-07-06

    Jul 6, 2009 ... Met, 433 Met, 78 Phe, 83 Phe, 255 Phe, 252 Ser,. 176 Thr, 76 Tyr and 434 Val. These residues were considered to be neighbouring the ligand as long as it was in its 3.5Å proximity. At the base of the binding pocket, there is a heme porphyrin that accounts for some binding free energy of some ligands.

  8. Missouri River Environmental Inventory, Vertebrate Section: Birds. Birds Along the Missouri River from Gavin’s Point Dam to Rulo, Nebraska with Special Reference to the Effects of Channelization on Breeding Birds.

    Science.gov (United States)

    1973-01-01

    common Fall arr. - Aug. 7 Fall dep. - Nov. 3 Sq. C. NWR 24/5 1 Sq. C. NWR 25/5 1 87. Ruddy Turnstone, Arenaria interpres, Spr., Fall migr. throughout...June 19 Sq. C. NWR - uncommon Bent - drier marshes, wet meadows or sedge meadows ( Carex ) nest is low-to-ground and globular. 9. Mimidae 189

  9. Isgur–Wise function in a QCD-inspired potential model with WKB ...

    Indian Academy of Sciences (India)

    2017-02-28

    Feb 28, 2017 ... 094022 (2004). [28] J L Rosner, Phys. Rev. D 42, 3732 (1990). [29] T Mannel, W Roberts and Z Ryzak, Phys. Rev. D 44, R18. (1991). [30] T Mannel, W Roberts and Z Ryzak, Phys. Lett. B 255, 593. (1993). [31] M Neubert, Phys. Lett. B 264, 455 (1991). [32] B Holdom, M Sutherland and J Mureika, Phys. Rev.

  10. Self-assembled growth of nanostructural Ge islands on bromine ...

    Indian Academy of Sciences (India)

    1997). [9] V L Thanh, Surf. Sci. 492, 255 (2001). [10] P O Hansson, M Albrecht, W Dorsch, H P Strunk and E Bauser, Phys. Rev. Lett. 73, 444 (1994). [11] K Sumitomo, T Nishioka and T Ogina, J. Vac. Sci. Technol. B13, 387 (1995). [12] Amal K Das, ...

  11. 77 FR 16091 - Order Modifying Licenses With Regard to Requirements for Mitigation Strategies for Beyond-Design...

    Science.gov (United States)

    2012-03-19

    ... operation and Units 4, 5, and 6 were shut down for routine refueling and maintenance activities. The Unit 4... operating units automatically shut down and offsite power was lost to the entire facility. The emergency.... 50-255, License No. DPR-20 Mr. Anthony J. Vitale, Site Vice President--Palisades, Entergy Nuclear...

  12. 78 FR 17259 - Self-Regulatory Organizations; Miami International Securities Exchange LLC; Notice of Filing and...

    Science.gov (United States)

    2013-03-20

    ... trades standardized option contracts on a number of equities, and soon will add exchange-traded fund... average equity option price of $255.02.\\5\\ Proportionately equivalent mini- options contracts on AAPL.... Strike Price 125 125. Bid/offer 3.20 3.20. Premium Multiplier $100 $10. Total Value of Deliverable...

  13. The Influence of Socio-Economic Status and Ethnicity on Speech and Language Development

    Science.gov (United States)

    Basit, Tehmina N.; Hughes, Amanda; Iqbal, Zafar; Cooper, Janet

    2015-01-01

    A number of factors influence the speech and language development of young children. Delays in the development of speech and language can have repercussions for school attainment and life chances. This paper is based on a survey of 3- to 4-year-old children in the city of Stoke-on-Trent in the UK. It analyses the data collected from 255 children…

  14. Gclust Server: 4957 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences(255) 1065 tRNA-splicing endonuclease positive effector-related 21 1.00e-70 42.86 0.0 0.0 0.0...Representative annotation tRNA-splicing endonuclease positive effector-related Number of Sequences 21 Homologs

  15. NOTES AND GLEANINGS / NOTE E CURIOSITÀ

    African Journals Online (AJOL)

    User

    forse, anche Michele, qualche volta, avrà finto di dormire. E che di questo continuo fingere di dormire e rimanere svegli nella propria angoscia è fatta la storia di un matrimonio esemplare. (255). The author was publicly condemned by the Vatican because of the liberal views on marriage and divorce she expressed in Epoca.

  16. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 250 of 255 ... Vol 7, No 1 (2015), Strategies to include sexual orientation and gender identity in health professions education, Abstract PDF. A Müller. Vol 5, No 2 (2013), Student and staff perceptions and experiences of the introduction of Objective Structured Practical Examinations: A pilot study, Abstract PDF.

  17. The Human Breast Cancer Cell DNA Synthesome Can Serve as a Novel In Vitro Model System for Studying the Mechanisms of Action of Anticancer Drugs

    Science.gov (United States)

    2001-07-01

    on an Old Drug. Critical Reviews in Oncology/Hematology, 29: 249-255. of Pharmacognosy , P-12, 1992. RAO, K. V.; MCBRIDE, T. J.; OLESON, J. (1968) J... Pharmacognosy , P-12. SEKOWSKI, J. W. et al. (1998) Human Breast Cancer Cells Contain an Error- prone DNA Replication Apparatus. Cancer Research, 58

  18. A random amplified polymorphic DNA (RAPD) molecular marker ...

    African Journals Online (AJOL)

    Jane

    2011-08-03

    bolting gene is presented. MATERIALS AND METHODS. P-28 (P1) was used as the early-bolting parent and P-27 (P2) was used as the late-bolting parent. The F2 (255 individuals) population was constructed by the progeny ...

  19. miRNAs: Small but deadly

    African Journals Online (AJOL)

    Jane

    2011-08-24

    Aug 24, 2011 ... Bandres E, Agirre X, Ramirez N, Zarate R, Garcia-Foncillas J (2007). MicroRNAs as cancer players: potential ... identification of individuals at risk for Lynch Syndrome. Fam. Cancer. 4(3): 255-265. ... microRNA genes are frequently located at fragile sites and genomic regions involved in cancers. Proc.

  20. Diverse retrotransposon families and an AT-rich satellite DNA revealed in giant genomes of Fritillaria lilies

    Czech Academy of Sciences Publication Activity Database

    Ambrožová, K.; Mandáková, T.; Bureš, P.; Neumann, Pavel; Leitch, I. J.; Koblížková, Andrea; Macas, Jiří; Lysák, M.

    2011-01-01

    Roč. 107, č. 2 (2011), s. 255-268 ISSN 0305-7364 R&D Projects: GA ČR GA521/07/0284; GA MŠk(CZ) LC06004 Institutional research plan: CEZ:AV0Z50510513 Keywords : Fritillaria * Liliaceae * repetitive DNA Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.030, year: 2011

  1. Stabilization of chromium salt in ordinary portland cement

    Indian Academy of Sciences (India)

    ent methods: differential microcalorimetry, conductometry and FTIR analysis. The main aim of this study is to ... Cement pastes for FTIR analysis were hydrated 28 days in a thermostat at a temperature of. 20. ◦. C. After this curing time they were .... additions containing concrete composites. J. Hazard. Mater. 160: 247–255.

  2. Attitudes and Behaviors toward Lesbian and Gay Persons: Critical Correlates and Mediated Relations

    Science.gov (United States)

    Goodman, Melinda B.; Moradi, Bonnie

    2008-01-01

    With data from 255 college women and men, this study examined the relative strength of relations of right-wing authoritarianism (RWA), social dominance orientation (SDO), and traditional gender role attitudes (TGRA) with anti-lesbian and gay (LG) attitudes. This study also tested the mediating role of anti-LG attitudes in the relations of RWA,…

  3. 76 FR 61354 - Agency Information Collection Activities; Submission to OMB for Review and Approval; Comment...

    Science.gov (United States)

    2011-10-04

    ... From the Federal Register Online via the Government Publishing Office ENVIRONMENTAL PROTECTION... D--Reformulated Gasoline, Subpart E--Anti-Dumping, and Subpart F--Attest Engagements, implementing.... In 2009 EPA received reports from 255 refineries, 60 importer facilities/facility groups, 44...

  4. 76 FR 50453 - Agenda and Notice of Public Meeting of the New Hampshire State Advisory Committee

    Science.gov (United States)

    2011-08-15

    ... Commission will meet at 10:30 a.m. (EDT) on Monday, August 29, 2011, in Room 255 of the Student Center at the University of New Hampshire, 400 Commercial Street, Manchester, NH 03101. The purpose of the briefing meeting... meeting is to discuss future activities. Members of the public are entitled to submit written comments...

  5. 42 CFR 436.128 - Coverage for certain qualified aliens.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Coverage for certain qualified aliens. 436.128... Mandatory Coverage of the Categorically Needy § 436.128 Coverage for certain qualified aliens. The agency... § 440.255(c) of this chapter to those aliens described in § 436.406(c) of this subpart. ...

  6. 42 CFR 435.139 - Coverage for certain aliens.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Coverage for certain aliens. 435.139 Section 435... Aliens § 435.139 Coverage for certain aliens. The agency must provide services necessary for the treatment of an emergency medical condition, as defined in § 440.255(c) of this chapter, to those aliens...

  7. 42 CFR 435.350 - Coverage for certain aliens.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Coverage for certain aliens. 435.350 Section 435... ISLANDS, AND AMERICAN SAMOA Optional Coverage of the Medically Needy § 435.350 Coverage for certain aliens... treatment of an emergency medical condition, as defined in § 440.255(c) of this chapter, to those aliens...

  8. Advantages of breath testing for the early diagnosis of lung cancer

    Czech Academy of Sciences Publication Activity Database

    Smith, D.; Španěl, Patrik; Sule-Suso, J.

    2010-01-01

    Roč. 10, č. 3 (2010), s. 255-257 ISSN 1473-7159 Institutional research plan: CEZ:AV0Z40400503 Keywords : mass spectrometry * breath analysis * lung cancer Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.652, year: 2010

  9. Learning the optimal buffer-stock consumption rule of Carroll

    NARCIS (Netherlands)

    Yıldızoğlu, M.; Sénégas, M.A.; Salle, I.; Zumpe, M.

    2014-01-01

    This article questions the rather pessimistic conclusions of Allen and Carroll [Macroeconomic Dynamics 5 (2001), 255-271] about the ability of consumers to learn the optimal buffer-stock-based consumption rule. To this end, we develop an agent-based model in which alternative learning schemes can be

  10. 77 FR 58747 - Small Business Size Standards: Real Estate and Rental and Leasing

    Science.gov (United States)

    2012-09-24

    ... Costume Rental....... 7.0 19.0 532230 Video Tape and Disc Rental 7.0 25.5 532291 Home Health Equipment and... reporting, record keeping, and other compliance requirements of the rule and an estimate of the classes of...

  11. Population and forensic data for three sets of forensic genetic markers in four ethnic groups from Iran

    DEFF Research Database (Denmark)

    Poulsen, Lena; Farzad, Maryam Sharafi; Børsting, Claus

    2015-01-01

    A total of 255 individuals (Persians, Lurs, Kurds and Azeris) from Iran were typed for three sets of forensic genetic markers with the NGM SElect™, DIPplex(®) and Argus X-12 kits. Statistically significant deviations (P≤0.002) from Hardy-Weinberg expectations were observed for the insertion...

  12. Experiment list: SRX861688 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 4,5.0,1232 GSM1598228: wz255 input; Homo sapiens; ChIP-Seq source_name=Human prostate tumor || tissue=primar...y prostate tumor || antibody=none (input) || tumor id=Primary_3 http://dbarchive.biosciencedbc.jp/kyushu-u/h

  13. Students' Perception toward Personal Information and Privacy Disclosure in E-Learning

    Science.gov (United States)

    Yang, Fang; Wang, Shudong

    2014-01-01

    This research investigates East Asian students' perceptions towards e-learning privacy. The survey was first carried out in Japan (N1 = 255) and China (N2 = 307) in 2009. In 2012 the same survey was conducted again in these two countries but with different participants (N3 = 175, N4 = 63). To survey in different countries is to verify whether…

  14. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. Chandrabhas Narayana. Articles written in Bulletin of Materials Science. Volume 33 Issue 3 June 2010 pp 251-255 Polymers. Effect of substrate roughness on growth of diamond by hot filament CVD · Awadesh K Mallik S R Binu L N Satapathy Chandrabhas Narayana Md Motin ...

  15. The Effect of Teachers' Beliefs and Sense of Self-Efficacy on Iranian EFL Learners' Satisfaction and Academic Achievement

    Science.gov (United States)

    Rashidi, Nasser; Moghadam, Meisam

    2014-01-01

    The purpose of this study was to investigate the relationship between teachers' beliefs about their teaching methods and their sense of self-efficacy. The study also examined the effects of these characteristics on students' satisfaction and academic achievement. Participants included 16 instructors and 255 intermediate students (121 males and 127…

  16. Relationships between Primary Teachers' Beliefs and Their Practices in Relation to Writing Instruction

    Science.gov (United States)

    Gaitas, Sérgio; Alves Martins, Margarida

    2015-01-01

    Teachers' beliefs are directly connected to their practices and have an impact on students' educational experiences and results. The aim of this study was to describe and examine the relationship between beliefs and practices linked to teaching students to write in the first four years of primary school. A total of 255 Portuguese primary school…

  17. Complete Genome Sequence of Salinarchaeum sp. Strain HArcht-Bsk1T, Isolated from Hypersaline Lake Baskunchak, Russia

    NARCIS (Netherlands)

    Dominova, I.N.; Sorokin, D.Y.; Kublanov, I.V.; Patrushev, M.V.; Toshchakova, S.V.

    2013-01-01

    The complete genome sequence of a novel halophilic archaeon, Salinarchaeum sp. strain HArcht-Bsk1T, was determined using next-generation sequencing. The genome comprises a 3,255,260-bp circular chromosome with a G+C content of 66.7%. Automatic annotation of the genome revealed a single rRNA operon,

  18. HF-based clad etching of fibre Bragg grating and its utilization in ...

    Indian Academy of Sciences (India)

    2014-02-09

    Feb 9, 2014 ... This paper presents a fiber Bragg grating (FBG) based sensor to study the concentration of laser dye in dye–ethanol solution. The FBG used in this experiment is indigenously developed using 255 nm UV radiations from copper vapour laser. The cladding of the FBG was partially removed using HF-based ...

  19. Stress and PTSD Mechanisms as Targets for Pharmacotherapy of Alcohol Abuse, Addiction, and Relapse

    Science.gov (United States)

    2014-10-01

    traumatic stress to prevent subsequent development of a rat PTSD-like syndrome has already been initiated in year 1 instead of the originally proposed start...Alcohol Clin Exp Res 33:255-63. Sullivan GM, Coplan JD, Kent JM et al. (1999) The noradrenergic system in pathological anxiety: a focus on panic

  20. New species of Souroubea (Marcgraviaceae)

    NARCIS (Netherlands)

    Roon, de A.C.

    1969-01-01

    Frutex scandens. Folia petiolis 4-8 mm longis; lamina coriacea, obovatooblonga vel oblonga vel interdum lanceolata, valde asymmetrica, 7-14 cm longa, 2.5-5 cm lata, apice subacuta vel leviter acuminata vel obtusa, basi cuneala vel acuta, costa supra plana vel prominula, subtus prominente, nervis

  1. InterPro search result: AK059559 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK059559 001-029-G11 IPR008921 DNA polymerase III clamp loader subunit, C-terminal ...superfamily SSF48019 DNA polymerase III clamp loader subunits, C-terminal domain T255-347 1e-10 ...

  2. InterPro search result: AK103751 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK103751 J033142O15 IPR008921 DNA polymerase III clamp loader subunit, C-terminal s...uperfamily SSF48019 DNA polymerase III clamp loader subunits, C-terminal domain T255-347 1e-10 ...

  3. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2015-11-27

    Nov 27, 2015 ... pp 255-267 Research Articles. Estimation of light transport parameters in biological media using coherent backscattering · S Anantha Ramakrishna K Divakara Rao · More Details Abstract Fulltext PDF. The suitability of using the angular peak shape of the coherent backscattered light for estimating the light ...

  4. Microreactor as Efficient Tool for Light Induced Oxidation Reactions

    Czech Academy of Sciences Publication Activity Database

    Hejda, S.; Drhová, Magdalena; Křišťál, Jiří; Buzek, D.; Krystyník, Pavel; Klusoň, Petr

    2014-01-01

    Roč. 255, NOV 1 (2014), s. 178-184 ISSN 1385-8947 Grant - others:GA MŠMT(CZ) MŠk:CZ.1.07/2.2.00/28.0205 Institutional support: RVO:67985858 Keywords : photo microreactor * phthalocyanine * chlorophenol oxidation Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 4.321, year: 2014

  5. GJB2

    Indian Academy of Sciences (India)

    the W24X mutation in the gene encoding connexin-26 (GJB2) in Spanish Romani (gypsies) with autosomal recessive non- syndromic hearing loss. Am. J. Med. Genet. Suppl. A. 137, 255–. 258. Ballana E., Ventayol M., Rabionet R., Gasparini P. and Estivill X. 2001 Connexins and deafness homepage. URL: http//www.iro.

  6. Formulation and stability of topical water in oil emulsion containing ...

    African Journals Online (AJOL)

    Sciences. Philadelphia: Lippincott Williams & Wilkins;. 2011; p 410. 2. Gisby J, Bryant J. Efficacy of a new cream formulation of mupirocin: comparison with oral and topical agents in experimental skin infections. Antimicrob. Agents. Chemother 2000; 44(2): 255-260. 3. Swarbrick J, Rubino JT, Rubino OP. Coarse dispersions.

  7. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... 56:31. painpallcare 703 views 56:31 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer Program - Duration: 11:08. UCLA Health 255,892 views 11:08 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 62,046 views 5: ...

  8. AFWAL FY81 Technical Accomplishments.

    Science.gov (United States)

    1982-04-01

    recently fabricated and tested. Enik W. Linder , AFWAL/POTA, 513-255-4830 ............... •-. . . - . DEVLOPMENITS IN TUINE ENGINE COMBWTION SYSTEMS One of...and shear layer growth, flow separation, pressure, in direct relation to aft-end drag, were in good shock formation and reflection, and plume blockage

  9. TropJrnal Vol 31 No 1 PDF

    African Journals Online (AJOL)

    Mr Olusoji

    Obstetrician's Dilema. Aust N Z J Obstet. Gynaecol 1998; 38[1]:22. 14. Ijaiya MA, Aboyeji P. Caesarean delivery: The Trend over a Ten-Year Period at Ilorin,. Nigeria. Nig J Surg Res 2001; 3[1]: 11-18. 15. Waloch M. The treatment of cervical incompetence in Zambian women. Clin Exp. Obstet Gynecol 1996; 23(4): 255-262.

  10. The Contribution of Ideational Behavior to Creative Extracurricular Activities

    Science.gov (United States)

    Paek, Sue Hyeon; Park, Hyeri; Runco, Mark A.; Choe, Ho-Seong

    2016-01-01

    The prediction of creative performance from ideation has shown promise, but questions remain. In this study, the relationship of ideational behavior and the creative performance of elementary school children (N = 255) was examined across 6 domains of creative performance: science, mathematics, technology, fine arts, music, and writing.…

  11. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 255 ... Vol 17, No 1 (2017): Special Edition, Exploring Psychological Well-Being and Positive Emotions in School Children Using a Narrative Approach, Abstract PDF. Chiara Ruini ... Vol 5, No 2 (2005), Friendship Otherwise - Toward a Levinasian Description of Personal Friendship, Abstract PDF. Jack Marsh.

  12. Occurrence of methicillin resistant Staphylococcus aureus in chickens and farm personnel in Sokoto, North-western Nigeria

    Directory of Open Access Journals (Sweden)

    Iliya Dauda Kwoji

    2017-09-01

    Conclusion: This study established for the first time the occurrence of MRSA in both chickens and farm personnel from poultry farms in Sokoto, Nigeria. Thus, the study provided baseline information for further studies on the epidemiology of MRSA. [J Adv Vet Anim Res 2017; 4(3.000: 255-260

  13. Gclust Server: 89945 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Cluster Sequences Related Sequences(255) 349 Alpha/beta hydrolase fold-3 1 1.00e-22 0.0 0.0 0.0 0.0 3...Sequence length 349 Representative annotation Alpha/beta hydrolase fold-3 Number of Sequences 1 Homologs

  14. Drug: D04688 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D04688 Mixture, Drug Tribenoside - lidocaine mixt; Borraza-G (TN) Tribenoside [DR:D... 2 Agents affecting individual organs 25 Urogenital and anal organ agents 255 Hemorrhoidal preparations 2559 Others D04688 Tribenoside - lidocaine mixt PubChem: 17398139 ...

  15. EST Table: FS924668 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS924668 E_FL_fwgP_11D20_F_0 10/09/28 73 %/252 aa gb|AAQ12887.1| Z9-desaturase SFWG5A [Choristoneura paralle...la] gb|AAQ12888.1| Z9-desaturase SFWG5B [Choristoneura parallela] 10/09/13 52 %/255

  16. Dicty_cDB: SSF582 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available escentis AT... 40 0.065 CP000048_245( CP000048 |pid:none) Borrelia hermsii DAH, com...:none) Exiguobacterium sibiricum 255-1... 45 0.002 AP009256_1251( AP009256 |pid:none) Bifidobacterium adol

  17. Qajaa Excavations 1981 and 1982

    DEFF Research Database (Denmark)

    Fog Jensen, Jens

    2015-01-01

    This report is an account of excavations conducted in 1981 and 1982 by Jørgen Meldgaard (1927-2007) The National Museum of Denmark at the Qajaa site in West Greenland. A total of 388 wooden objects, 255 bone artefacts, 696 lithic tools and more than 4000 flakes have been excavated and are presented...

  18. JCSC_129_03_0397_0404_SI.docx

    Indian Academy of Sciences (India)

    dell

    Material, BET Surface area (m2/g), Specific capacitance (F/g) at 0.2 A/g. Graphene oxide, -, 255. Reduced graphene oxide, -, 14. Non Ac-Sugar, 787, 104. Ac-Sugar, 655, 140. AC-rice husk, 547, 369. AC-jute, 825, 476.

  19. Characterization by culture-dependent and culture-1 independent methods of the 2 bacterial population of suckling-lamb packaged in different atmospheres

    NARCIS (Netherlands)

    Oses, S.M.; Diez, A.M.; Melero, B.; Luning, P.A.; Jaime, I.; Rovira, J.

    2013-01-01

    This study offers insight into the dynamics of bacterial populations in fresh cuts of suckling lamb under four different atmospheric conditions: air (A), and three Modified Atmosphere Packaging (MAP) environments, 15%O2/30%CO2/55%N2 (C, commercial), 70%O2/30%CO2 (O), and 15%O2/85%CO2 (H) for 18

  20. Installation Restoration Program. Phase 2. Confirmation/Quantification. Stage 1. Volume 2.

    Science.gov (United States)

    1986-10-01

    COMMAND P.O. BOX 7699 - , AERONAUTICAL SYSTEMS DIV/PMRSC PHILADELPHIA PA 19101 WIGHT-PATTERSON AFB OH 45433 ,flk BUYER: DIANE C. CARSELLO PHONE: (513) 255...Credentials Prolect manager and principal investigator on clean-up of a site contaminated by pharmaceutical wastes in % B.A.-Queens College. CUNY

  1. European Scientific Notes. Volume 34. Number 5,

    Science.gov (United States)

    1980-05-31

    were two constraints, one each Case, and CUNY in the US, but he always for the capacity to order local and returns to the Technion. He also is foreign...in circa- have a spokesman for government tech- dian rhythm but this factor is ques- nology such as Frank Press (science tioned by others. 255 ESN 34

  2. Are Gross Motor Skills and Sports Participation Related in Children with Intellectual Disabilities?

    Science.gov (United States)

    Westendorp, Marieke; Houwen, Suzanne; Hartman, Esther; Visscher, Chris

    2011-01-01

    This study compared the specific gross motor skills of 156 children with intellectual disabilities (ID) (50 less than or equal to IQ greater than or equal to 79) with that of 255 typically developing children, aged 7-12 years. Additionally, the relationship between the specific gross motor skills and organized sports participation was examined in…

  3. Cluster Scheduling for Explicitly-Speculative Tasks

    Science.gov (United States)

    2004-12-01

    IEEE International Symposium on High Perfor- mance Distributed Computing ( HPDC ’99). Redondo Beach, CA, 47–54. 72 Bibliography · 255 Karp, R. M. and...Proceedings of the 9th IEEE Symposium on High Performance Distributed Computing ( HPDC ’00). Pittsburgh, PA, 211– 220. 42, 43 Sculley, J. 1989. The

  4. Jordan : tous les projets | Page 2 | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: INFORMATION TECHNOLOGY, INFORMATION SOCIETY, GENDER EQUALITY, RESEARCH FELLOWSHIPS. Région: Middle East, Central Asia, Far East Asia, South Asia, Jordan, Lebanon, Malaysia, Syria, Yemen, Palestine, Réunion. Financement total : CA$ 1,255,000.00. Rôle politique des tribus : une analyse du ...

  5. : tous les projets | Page 539 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: INFORMATION TECHNOLOGY, INFORMATION SOCIETY, GENDER EQUALITY, RESEARCH FELLOWSHIPS. Région: Middle East, Central Asia, Far East Asia, South Asia, Jordan, Lebanon, Malaysia, Syria, Yemen, Palestine, Réunion. Financement total : CA$ 1,255,000.00. Partage des avantages découlant des ...

  6. Malaria treatment practices in the transition from sulfadoxine ...

    African Journals Online (AJOL)

    Malaria treatment practices in the transition from sulfadoxine-pyrimethamine to artemether-lumefantrine: A pilot study in Temeke municipality, Tanzania. ... SP was the most commonly available antimalarial drug (81.8%); followed by amodiaquine (35.4%), quinine (25.5%), artemisinin monotherapies (3.2%) and chloroquine ...

  7. Role of Microstructure in High Temperature Oxidation.

    Science.gov (United States)

    1980-05-01

    all-nickel reaction tube and stainless steel ( AISI Type 316) gas * "Control of Environmental Surface Reactions," Final Report, June 15, 1972, to...215, 420 (1959). 10. J. C. Bokros and W. R. Wallace, Corrosion, 16, 117 (1960). 11. L. Berry and J. Paidassi, Compt. Rend., 255, 2253 (1962). 12. F. S

  8. 78 FR 68869 - Proposed Collection; Comment Request

    Science.gov (United States)

    2013-11-15

    ...- making in Nasdaq securities during a distribution. A distribution participant that seeks use of this... estimated internal labor cost of compliance for the respondents is approximately $16,065.00, resulting in an estimated internal labor cost of compliance per response of approximately $63.00 (i.e., $16,065.00/255...

  9. Download this PDF file

    African Journals Online (AJOL)

    Reprint Requests to: Dr. O.M. Oluwatosin, Division of Plastic Surgery, Department of. Surgery, University ... were popularized in Europe by Gilles3 and in the .... Plastic surgery of the face. London Oxford 1920. 4. Brown JB, Cannon B. Composite free grafts and cartilage from the ear. Surg Gynecol Obst 1946; 32: 253-255. 5.

  10. National Differences in Mindset among Students Who Plan to Be Teachers

    Science.gov (United States)

    Asbury, Kathryn; Klassen, Robert; Bowyer-Crane, Claudine; Kyriacou, Chris; Nash, Poppy

    2016-01-01

    A growth mindset has been found beneficial to students, particularly when they encounter academic setbacks (Dweck, 2000). Evidence suggests that teachers' own mindsets may influence those of their students. We assessed mindset among student teachers from different places of origin (UK and East Asia) in a UK university (N = 255). Although both…

  11. Physiological responses to exposure to carbon dioxide and human bioeffluents

    DEFF Research Database (Denmark)

    Zhang, Xiaojing; Wargocki, Pawel; Lian, Zhiwei

    2015-01-01

    Present paper describes physiological responses as a result of exposures to CO2 (between 500 ppm to 3,000 ppm) with and without bioeffluents. Twenty-five subjects participated. They were exposed in the climate chamber for 255 minutes in groups of five at a time. During exposure, they performed...

  12. Hepatitis C and blood transfusion among children attending the ...

    African Journals Online (AJOL)

    EB

    2013-06-02

    Jun 2, 2013 ... Background: Hepatitis C virus (HCV) accounts for 90% of post-transfusion hepatitis. In Uganda, there has been limited research ... African Health Sciences 2013; 13(2): 255 - 260 http://dx.doi.org/10.4314/ahs.v13i2.8. *Corresponding author: ... 6.4 computer software package. Analysis was done using SPSS ...

  13. How do private entrepreneurs transform local social capital into economic capital? Four case studies from rural Denmark

    DEFF Research Database (Denmark)

    Svendsen, Gunnar Lind Haase; Kjeldsen, Chris; Noe, Egon

    2010-01-01

    . Methodologically, we think that the ‘laws of conversion’ (Bourdieu, 1986:252-255) can best be observed at the micro level, by analyzing specific strings of capital conversion in time and space. Therefore, drawing on in-depth interviews with four private entrepreneurs in rural Denmark we try to analyze rational...

  14. Modulation by phytochrome of the blue light-induced extracellular acidification by leaf epidermal cells of pea (Pisum sativum L.) : a kinetic analysis

    NARCIS (Netherlands)

    Elzenga, JTM; Staal, M; Prins, HBA

    Blue light induces extracellular acidification, a prerequisite of cell expansion, in epidermis cells of young pea leaves, by stimulation of the proton pumping-ATPase activity in the plasma membrane. A transient acidification, reaching a maximum 2.5-5 min after the start of the pulse, could be

  15. Future Money-Related Worries among Adolescents after Divorce

    Science.gov (United States)

    Koerner, Susan Silverberg; Korn, Marcella; Dennison, Renee Peltz; Witthoft, Sara

    2011-01-01

    The present research examined adolescents' views of their future with respect to money and financial well-being via an open-ended question and inductive content analysis. The participants were adolescents (N = 255) whose parents were divorced between 5 and 24 months at the time of data collection. The most common worries pertained to (a) being…

  16. High-pressure X-ray diffraction of L-ALANINE crystal

    DEFF Research Database (Denmark)

    Olsen, J.S.; Gerward, Leif; Souza, A.G.

    2006-01-01

    L-ALANINE has been studied by X-ray diffraction at ambient temperature and pressure up to 10.3 GPa. The material is found to transform to a tetragonal structure between 2 and 3 GPa. and to a monoclinic structure between 8 and 10 GPa. The experimental bulk modulus is 25(5) GPa for the orthorhombic...

  17. Data of evolutionary structure change: 2QN4A-4WBCA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 2QN4A-4WBCA 2QN4 4WBC A A APPPVYDTEGHELSADGSYYVLPASPGHGGGLTMAPRVL...46 ARG CA 462 VAL CA 470 GLU CA 352 4WBC... A 4WBCA PEKDILVFKFEARG CA 255 ALA CA 327 TRP CA 374 4WBC... A 4WBCA

  18. Magnitude and meaningfulness of change in SF-36 scores in four types of orthopedic surgery

    DEFF Research Database (Denmark)

    Busija, Lucy; Osborne, Richard H; Nilsdotter, Anna

    2008-01-01

    subscales following orthopedic surgery. METHODS: Longitudinal data on outcomes of total hip replacement (THR, n = 255), total knee replacement (TKR, n = 103), arthroscopic partial meniscectomy (APM, n = 74) and anterior cruciate ligament reconstruction (ACL, n = 62) were used to estimate the effect sizes...

  19. Eesti Akadeemiline Raamatukogu

    Index Scriptorium Estoniae

    2000-01-01

    Näitused "Esimesi Eesti klassikuid. Paar sammukest Kreutzwaldist Vildeni"; "Austraalia - olümpiamaa 2000" : kuulutus. Näitused: "Eestikeelne tarberaamat XVIII sajandist kuni 1940. aastani"; "Rahvas. Usund. Elujõud. Oskar Loorits - 100"; "Kirjamehed Johann Wilhelm Ludvig Luce - 250"; "Friedrich David Lenz - 255"; "Eesti Akadeemilise Raamatukogu väljaandeid läbi aegade": kuulutus

  20. Inhibitory Control in Preschool Predicts Early Math Skills in First Grade: Evidence from an Ethnically Diverse Sample

    Science.gov (United States)

    Ng, Florrie Fei-Yin; Tamis-LeMonda, Catherine; Yoshikawa, Hirokazu; Sze, Irene Nga-Lam

    2015-01-01

    Preschoolers' inhibitory control and early math skills were concurrently and longitudinally examined in 255 Chinese, African American, Dominican, and Mexican 4-year-olds in the United States. Inhibitory control at age 4, assessed with a peg-tapping task, was associated with early math skills at age 4 and predicted growth in such skills from age 4…

  1. 21 CFR 137.280 - Bolted yellow corn meal.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Bolted yellow corn meal. 137.280 Section 137.280... Flours and Related Products § 137.280 Bolted yellow corn meal. Bolted yellow corn meal conforms to the definition and standard of identity prescribed by § 137.255 for bolted white corn meal except that cleaned...

  2. Genetic diversity of Indonesia milkfish ( Chanos chanos ) using ...

    African Journals Online (AJOL)

    Genetic diversity of milkfish (Chanos chanos) from Indonesia was investigated using amplified fragment length polymorphism (AFLP) markers. A total of 255 loci were detected by combination of seven primers from 130 individuals collected at seven locations. AFLP analysis provided useful information in determining genetic ...

  3. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 255 ... Vol 9, No 2 (2017), Developing capability through peer-assisted learning activities among 4th-year medical students and community health workers in ... Vol 7, No 2 (2015), Examining the effects of a mindfulness-based professional training module on mindfulness, perceived stress, self-compassion and ...

  4. 76 FR 58822 - Announcement of Funding Awards; Fair Housing Initiatives Program; Fiscal Year 2010

    Science.gov (United States)

    2011-09-22

    ..., 413-233-1668.... 1 $121,637.00 2403. Champlain Valley Office of Economic Opportunity: Kevin Stapleton.... Neighborhood Economic Development Advocacy Project: Sarah Ludwig, 212-680-5100.... 2 125,000.00 176 Grand... Legal Equality, Inc.: 525 Cindy Hurst, 419-255-0814..... 5 499,999.00 Jefferson Avenue, Suite 300...

  5. Racial and Ego Identity Development in Black Caribbean College Students

    Science.gov (United States)

    Sanchez, Delida

    2013-01-01

    This study explored the relationships between racial identity attitudes and ego identity statuses among 255 Black Caribbean college students in the Northeast United States. Findings indicated that racial identity attitudes were predictive of ego identity statuses. Specifically, preencounter racial identity attitudes were predictive of lower scores…

  6. Evaluation of the Performance of the Malawian Local Pig:1 ...

    African Journals Online (AJOL)

    Stillbirths accounted for 3.5% and 25.5% in the first mating period and second mating period respectively. Insufficient nutrition was considered as an immediate factor contributing to large number of stillbirths in the second mating period. Reproductive performance of the pigs in this study compare favorably with most of the ...

  7. Emotion Understanding in Deaf Children with a Cochlear Implant

    Science.gov (United States)

    Wiefferink, Carin H.; Rieffe, Carolien; Ketelaar, Lizet; De Raeve, Leo; Frijns, Johan H. M.

    2013-01-01

    It is still largely unknown how receiving a cochlear implant affects the emotion understanding in deaf children. We examined indices for emotion understanding and their associations with communication skills in children aged 2.5-5 years, both hearing children (n = 52) and deaf children with a cochlear implant (n = 57). 2 aspects of emotion…

  8. Attitude change as a function of the observation of vicarious reinforcement and friendliness

    OpenAIRE

    Stocker-Kreichgauer, Gisela

    1982-01-01

    Attitude change as a function of the observation of vicarious reinforcement and friendliness : hostility in a debate / Lutz von Rosenstiel ; Gisela Stocker- Kreichgauer. - In: Group decision making / ed. by Gisela Stocker-Kreichgauer ... - London u.a. : Acad. Press, 1982. - S. 241-255. - (European monographs in social psychology ; 25)

  9. Global Self-Esteem and Self-Efficacy Correlates: Relation of Academic Achievement and Self-Esteem among Emirati Students

    Science.gov (United States)

    Afari, Ernest; Ward, Graeme; Khine, Myint Swe

    2012-01-01

    We investigated the relationships between global self-esteem, academic self-efficacy and academic performance among a sample of 255 college students in the United Arab Emirates. The widely used Rosenberg's Self-Esteem Scale (RSES; Rosenberg, 1965) and an academic self-efficacy scale, modified from (Jinks and Morgan, 1999) were used to assess…

  10. Depression and anxiety in multisomatoform disorder: prevalence ...

    African Journals Online (AJOL)

    2008-06-02

    Jun 2, 2008 ... disorder, followed by social anxiety disorder (N=10 - 19.6%), agoraphobia (N=3 - 5.9%) and panic disorder (N=2 - 3.9%). MDD. (49%) was the most common lifetime depressive disorder, and 13. (25.5%) patients met diagnostic criteria for a lifetime panic disorder. Any current co-morbid depressive disorder ...

  11. Association of aspirin use with vitamin B12 deficiency (results of the BACH study).

    NARCIS (Netherlands)

    Oijen, M.G.H. van; Laheij, R.J.F.; Peters, W.H.M.; Jansen, J.B.M.J.; Verheugt, F.W.A.

    2004-01-01

    We examined the prevalence of vitamin B(12) deficiency and its association with medication use and characteristics, including infection with Helicobacter pylori (H. pylori), in 255 patients hospitalized for cardiovascular disease. In almost half of the study population, vitamin B(12) deficiency was

  12. Mothers' Teaching Strategies and Children's Effortful Control: A Longitudinal Study

    Science.gov (United States)

    Eisenberg, Nancy; Vidmar, Masa; Spinrad, Tracy L.; Eggum, Natalie D.; Edwards, Alison; Gaertner, Bridget; Kupfer, Anne

    2010-01-01

    Findings on the relation of maternal verbal teaching strategies to children's effortful control (EC; i.e., self-regulation) are limited in quantity and somewhat inconsistent. In this study, children's EC was assessed at 18, 30, and 42 months (ns = 255, 229, and 209, respectively) with adults' reports and a behavioral measure. Mothers' verbal…

  13. Determination of polybutylene terephthalate polycondensation equilibrium constant using a batch reactor

    NARCIS (Netherlands)

    Darda, Pranay Jairam; Hogendoorn, Kees; Molenkamp, Tjaard; Versteeg, Geert

    2004-01-01

    The PBT polycondensation equilibrium constant at 255°C was determined using a batch reactor. Starting from a Polybutylene terephthalate (PBT) prepolymer having a degree of polymerisation of 12.7, equilibrium experiments were performed in the range of 1 to 50 mbar. The equilibrium degree of

  14. Improved decoding for a concatenated coding system

    DEFF Research Database (Denmark)

    Paaske, Erik

    1990-01-01

    The concatenated coding system recommended by CCSDS (Consultative Committee for Space Data Systems) uses an outer (255,233) Reed-Solomon (RS) code based on 8-b symbols, followed by the block interleaver and an inner rate 1/2 convolutional code with memory 6. Viterbi decoding is assumed. Two new...

  15. RJHS 5(4).cdr

    African Journals Online (AJOL)

    USER

    Methods:A descriptive study of consenting patients referred for colonoscopy at the endoscopy unit of the. University College Hospital, Ibadan, from January 2016 to March 2017. Bowel preparation consisted of liquid diet and Epsom salt. Pre-medications were intravenous Midazolam 2.5-5 mg and Pentazocine 15-. 30 mg in ...

  16. Fosterreduktion--en retrospektiv opgørelse

    DEFF Research Database (Denmark)

    Frederiksen, Mette Heinel; Henriksen, Stine Dam; Bønnelykke, Astrid Julie

    2009-01-01

    in two total foetal losses (5%), one stillborn and 82 live born, among which two died perinatally. The median gestational age was 255 days (36 weeks and three days), five children were born before week 32 (6%), the mean birth weight among live born was 2,390 +/- 578 grams (mean +/- standard deviation...

  17. Chikungunya risk assessment for europe: recommendations for action

    NARCIS (Netherlands)

    Depoortere, E.; Coulombier, D.; Boutin, J.P.; Brooker, S.; Valk, de H.; Dieckmann, S.; Fontenille, D.; Gould, E.; Nathan, M.; Nilsson, M.; Schaffner, F.; Sonnenburg, von F.; Takken, W.

    2006-01-01

    Since March 2005, 255 000 cases of chikungunya fever are estimated to have occurred on the island of Réunion, a French overseas department in the Indian Ocean [1]. An huge increase in estimated cases occurred at the end of December 2005, culminating in an estimated peak incidence of more than 40 000

  18. Motor traffic injuries in Sub-Saharan Africa | Tarimo | Dar Es Salaam ...

    African Journals Online (AJOL)

    I hereby conclude with the motto by the National Road Safety Council of Tanzania which says “Road safety is NO ACCIDENT” and that “Road safety is for sharing”. Corresponding author: Hipolite T.T. Address: P.O BOX 10398 ARUSHA, Telephone number: +255 753 642 882, E-mail: hipolitethomas@yahoo.com ...

  19. Download this PDF file

    African Journals Online (AJOL)

    assessing vaccine effectiveness. [Ethi0p.J.Health Dev. 2003;17(3): 1 ... by which to assess and refine immunization policy. This includes ..... testing saliva. J Med Virol 1989;28:255—. 260. 5. Parry JV. Simple and reliable salivary tests for HIV and hepatitis A and B virus diagnosis and surveillance.- Ann NY Acad. Sci 1993 ...

  20. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 24; Issue 2. Issue front cover thumbnail. Volume 24, Issue 2. April 2001, pages 95-255. pp 95-95. Foreword · B K Sarkar · More Details Fulltext PDF. pp 97-100. Some numerical approaches of creep, thermal shock, damage and delayed failure of ceramics and ...

  1. 7 CFR 800.71 - Fees assessed by the Service.

    Science.gov (United States)

    2010-01-01

    ... the specific field office (per-metric ton): (a) League City 0.167 (b) New Orleans 0.067 (c) Portland 0...) Ship (per stowage space) (minimum $255.00 per ship) 51.00 (ii) Subsequent ship examinations (same as... at $0.011 per metric ton inspected and/or weighed. (b) Registration certificates and renewals. (1...

  2. Exploring Pre-Service Elementary Teachers' Mental Models of the Environment

    Science.gov (United States)

    Taskin-Ekici, Fatma; Ekici, Erhan; Cokadar, Hulusi

    2015-01-01

    This study aims to explore pre-service elementary teachers' understandings of the environment. A survey method was carried out in this study. A close-ended questionnaire and Draw-An-Environment Test (DAET) are administered to pre-service teachers (N = 255) after instruction of an Environmental Education course. A rubric (DAET-R) is used for…

  3. Thymol Hydrogenation in Bench Scale Trickle Bed Reactor

    Czech Academy of Sciences Publication Activity Database

    Dudas, J.; Hanika, Jiří; Lepuru, J.; Barkhuysen, M.

    2005-01-01

    Roč. 19, č. 3 (2005), s. 255-262 ISSN 0352-9568 Institutional research plan: CEZ:AV0Z40720504 Keywords : thymol hydrogenation * trickle bed reactor * gas-liquid-solid reaction Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 0.632, year: 2005

  4. Factors Affecting the Effectiveness and Use of Moodle: Students' Perception

    Science.gov (United States)

    Damnjanovic, Vesna; Jednak, Sandra; Mijatovic, Ivana

    2015-01-01

    The purpose of this research paper is to identify the factors affecting the effectiveness of Moodle from the students' perspective. The research hypotheses derived from the suggested extended Seddon model have been empirically validated using the responses to a survey on e-learning usage among 255 users. We tested the model across higher education…

  5. Vertical Transmission of Bacterial Eye Infections, Angola, 2011–2012

    Science.gov (United States)

    Alexandre, Isabel; Martínez, Prudencio; Sanz, Iván; Rodriguez-Fernandez, Ana; Fernandez, Itziar; Pastor, Jose Carlos; Ortiz de Lejarazu, Raúl

    2015-01-01

    To determine transmission rates for neonatal conjunctivitis causative microorganisms in Angola, we analyzed 312 endocervical and 255 conjunctival samples from mothers and newborns, respectively, during 2011–2012. Transmission rates were 50% for Chlamydia trachomatis and Neisseria gonorrhoeae and 10.5% for Mycoplasma genitalium. Possible pathogenic effects of M. genitalium in children’s eyes are unknown. PMID:25695394

  6. 78 FR 37417 - Small Business Size Standards: Arts, Entertainment, and Recreation

    Science.gov (United States)

    2013-06-20

    ... received comments that its size standards have not kept up with changes in the economy, and in particular... application of anchor size standards is appropriate in the current economy; whether there are gaps in SBA's... Groups and Artists $7.0 $10.0 711190 Other Performing Arts Companies $7.0 $25.5 711211 Sports Teams and...

  7. Parent Involvement, Emotional Support, and Behavior Problems: An Ecological Approach

    Science.gov (United States)

    McCormick, Meghan P.; Cappella, Elise; O'Connor, Erin E.; McClowry, Sandee G.

    2013-01-01

    We examined relations between parent involvement and kindergarten students' behavior problems in classrooms with varying levels of teacher emotional support. Multi-informant data were collected on "n" = 255 low-income Black and Hispanic students, and "n" = 60 kindergarten classrooms in the baseline year of an intervention…

  8. THE BACTERIOLOGICAL SAFETY AND ANTIMICROBIAL ...

    African Journals Online (AJOL)

    GB

    2013-03-01

    Mar 1, 2013 ... the bacteriological quality of waters used for soaking white lupin. Key Words: ... insects and other household rodents, which may ..... Meng J. Retail meat and poultry as a reservoir of antimicrobial- resistant Escherichia coli. Food Microbiol,. 2004; 21: 244-255. 9. Muleta D, Ashenafi M. Bacteriological profile.

  9. Missouri River Environmental Inventory. Measurements of the Species Diversity of Planktonic and Microbenthic Organisms.

    Science.gov (United States)

    1973-01-01

    British Phycological Journal, Vol. 7, No. 2, July, 1972. Academic Press, London and New York. Pg. 213-220, 255-270, and 277-278. Clapham, W. B...of the Metolius River, 1971. Journal of Phycology , Vol. 7(4). Smith, Gilbert M., The Fresh-Water Algae of the United States, 1950. McGraw-Hill Book

  10. Classification and expression analyses of homeobox genes

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences; Volume 40; Issue 2 ... Articles Volume 40 Issue 2 June 2015 pp 241-255 ... When individual homeobox genes were compared with members of known class or family, we could further classify them into 3 groups, namely, TALE, OTHER and NOVEL classes, but no HOX family was ...

  11. Gender Differences in Social Network Influence among Injection Drug Users: Perceived Norms and Needle Sharing

    National Research Council Canada - National Science Library

    Davey-Rothwell, Melissa A; Latkin, Carl A

    2007-01-01

    ... (descriptive and injunctive norms) and needle sharing. Results were stratified by gender. Descriptive norms were significantly related to needle sharing among males (AOR = 1.58, 95%CI = 1.20–2.40) and females (AOR = 1.78; 95%CI = 1.24–2.55...

  12. System Level Applications of Adaptive Computing (SLAAC)

    Science.gov (United States)

    2003-11-01

    and is approved for publication APPROVED: WILMAR SIFRE Project Engineer FOR THE DIRECTOR: JAMES A. COLLINS, Acting...AGENCY REPORT NUMBER AFRL-IF-RS-TR-2003-255 11. SUPPLEMENTARY NOTES AFRL Project Engineer: Wilmar Sifre/IFTC/(315) 330-2075

  13. Allergy in bakers' apprentices and factors associated to non-participation in a cohort study of allergic sensitization

    DEFF Research Database (Denmark)

    Skjold, Tina; Nielsen, Sven C; Adolf, Katja

    2006-01-01

    to methacholine (PD20 ≤ 1,440 μg) was determined. Results  Prevalence of atopy was 32%. The prevalence of symptoms from the lungs and nose was 19.8 and 25.5%, respectively. Significantly, more SPT reactions were seen in males compared to females (39 vs. 22%, P 

  14. Gclust Server: 204200 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 204200 DPTM_GSPATP00024525001 Cluster Sequences - 255 no annotation 1 1.00e-99 0.0 ...11.11 0.0 0.0 0.0 0.0 Show 204200 Cluster ID 204200 Sequence ID DPTM_GSPATP00024525001 Link to cluster seque

  15. 1992-IJBCS-Article-Joel Okon

    African Journals Online (AJOL)

    hp

    Zoo., 1(3): 255-260. Karamoko Y, Soro S, Traoré B, Fantodji A. 2014. Distributions of Hydrolytic. Enzimes activity in the Digestive Tract of. Grasscutter. Int. J. P. App. Zoo., 2(1)1-7. Lebas F. 2011. La Biologie du Lapin. INRA : France. Poku JPA, Annor SY, Djang-Fordjour KT. 2013. Growth , Reproduction and carcass.

  16. AcEST: DK951452 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ncharacterized protein OS=Medic... 255 2e-66 tr|B5LWQ7|B5LWQ7_ZIZJJ Ubiquitin extensive-like protein OS=Zizi...: 121 CPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 >tr|B5LWQ7|B5LWQ7_ZIZJJ Ubiquitin extensive

  17. AcEST: DK959090 [AcEST

    Lifescience Database Archive (English)

    Full Text Available _MEDTR Putative uncharacterized protein OS=Medic... 255 2e-66 tr|B5LWQ7|B5LWQ7_ZIZJJ Ubiquitin extensive-lik...KCGLTYVYQKA Sbjct: 121 CPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 >tr|B5LWQ7|B5LWQ7_ZIZJJ Ubiquitin extensive

  18. AcEST: DK949125 [AcEST

    Lifescience Database Archive (English)

    Full Text Available tative uncharacterized protein OS=Medic... 255 2e-66 tr|B5LWQ7|B5LWQ7_ZIZJJ Ubiquitin extensive-like protein...KA Sbjct: 121 CPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 >tr|B5LWQ7|B5LWQ7_ZIZJJ Ubiquitin extensive

  19. AcEST: DK948834 [AcEST

    Lifescience Database Archive (English)

    Full Text Available utative uncharacterized protein OS=Medic... 255 2e-66 tr|B5LWQ7|B5LWQ7_ZIZJJ Ubiquitin extensive-like protei...QKA Sbjct: 121 CPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 >tr|B5LWQ7|B5LWQ7_ZIZJJ Ubiquitin extensive

  20. AcEST: BP912606 [AcEST

    Lifescience Database Archive (English)

    Full Text Available d protein OS=Medic... 255 2e-66 tr|B5LWQ7|B5LWQ7_ZIZJJ Ubiquitin extensive-like p...LTYVYQKA Sbjct: 121 CPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 >tr|B5LWQ7|B5LWQ7_ZIZJJ Ubiquitin extensive-like p

  1. AcEST: DK948611 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ative uncharacterized protein OS=Medic... 255 2e-66 tr|B5LWQ7|B5LWQ7_ZIZJJ Ubiquitin extensive-like protein ...A Sbjct: 121 CPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 >tr|B5LWQ7|B5LWQ7_ZIZJJ Ubiquitin extensive

  2. Fourier Series-Based Bidirectional Propagation Algorithm With Adaptive Spatial Resolution

    Czech Academy of Sciences Publication Activity Database

    Čtyroký, Jiří; Kwiecien, P.; Richter, I.

    2010-01-01

    Roč. 28, č. 20 (2010), s. 2969-2976 ISSN 0733-8724 R&D Projects: GA MŠk OC09061 Institutional research plan: CEZ:AV0Z20670512 Keywords : optical waveguide theory * modelling * integrated optics Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.255, year: 2010

  3. Domain Modeling: NP_878908.2 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_878908.2 chr9 FUSION OF N-TERMINAL DOMAIN OF THE MINOR COAT PROTEIN FROM GENE II...I IN PHAGE M13, AND C-TERMINAL DOMAIN OF E. COLI PROTEIN-TOLA c1tola_ chr9/NP_878908.2/NP_878908.2_apo_70-255.pdb swppa 0 ...

  4. 42 CFR 447.253 - Other requirements.

    Science.gov (United States)

    2010-10-01

    ..., must submit the related information required by § 447.255 of this subpart, and must comply with all... State and Federal laws, regulations, and quality and safety standards. (ii) With respect to inpatient... situation of hospitals which serve a disproportionate number of low income patients with special needs; (B...

  5. Chronic kidney disease in children as seen in a tertiary hospital in ...

    African Journals Online (AJOL)

    2013-07-14

    Jul 14, 2013 ... Edema, oliguria and hypertension were the most frequent clinical features. The most common etiology was glomerular disease (63.6%) and 44.9% presented in CKD stage 4 and 5. Renal replacement therapy (RRT) was offered to 25 (25.5%) of the patients; 6 (24%) of whom had hemodialysis and 3 (12%) ...

  6. Psychological Engagement of Students in Distance and Online Learning: Effects of Self-Efficacy and Psychosocial Processes

    Science.gov (United States)

    Vayre, Emilie; Vonthron, Anne-Marie

    2017-01-01

    The aim of this study is to test a model of online learners' engagement, which integrates social support (from teachers, peers, and family members) and sense of community as direct and indirect factors, with academic self-efficacy playing a mediating role. Survey results based on a questionnaire administered to 255 students enrolled in an online…

  7. 77 FR 20094 - Intent To Prepare an Environmental Impact Statement on the Durham-Orange Light Rail (LRT) Project...

    Science.gov (United States)

    2012-04-03

    ... University, and downtown and east Durham. IV. Alternatives Analysis and Results The Durham-Orange County... projected to add about 74,000 people and 81,000 jobs, which is expected to generate 255,000 additional daily... retail developments between them is limited to two Triangle Transit routes and the Duke University...

  8. The impact of materials technology and operational constraints on the economics of cruise speed selection

    Science.gov (United States)

    Clauss, J. S., Jr.; Bruckman, F. A.; Horning, D. L.; Johnston, R. H.; Werner, J. V.

    1981-01-01

    Six material concepts at Mach 2.0 and three material concepts at Mach 2.55 were proposed. The resulting evaluations, based on projected development, production, and operating costs, indicate that aircraft designs with advanced composites as the primary material ingredient have the lowest fare premiums at both Mach 2.0 and 2.55. Designs having advanced metallics as the primary material ingredient are not economical. Advanced titanium, employing advanced manufacturing methods such as SFF/DB, requires a fare premium of about 30 percent at both Mach 2.0 and 2.55. Advanced aluminum, usable only at the lower Mach number, requires a fare premium of 20 percent. Cruise speeds in the Mach 2.0-2.3 regime are preferred because of the better economics and because of the availability of two material concepts to reduce program risk - advanced composites and advanced aluminums. This cruise speed regime also avoids the increase in risk associated with the more complex inlets and airframe systems and higher temperature composite matrices required at the higher Mach numbers typified by Mach 2.55.

  9. Research Article

    African Journals Online (AJOL)

    2016-06-05

    Jun 5, 2016 ... questionnaires were distributed; the 255 questionnaires were evaluated by SPSS software in order to have a ... organizations and financial institutes to use managers who are talented and spunky enough in utilizing these ... investigation is trying to analyze the effective factors on enriching the managers of.

  10. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. D S Patil. Articles written in Bulletin of Materials Science. Volume 30 Issue 3 June 2007 pp 255-261 Lasers. Theoretical analysis of effect of temperature on threshold parameters and field intensity in GaN material based heterostructure · S A Gaikwad E P Samuel D S Patil D K ...

  11. Counseling Chinese Patients about Cigarette Smoking: The Role of Nurses

    Science.gov (United States)

    Li, Han Zao; Zhang, Yu; MacDonell, Karen; Li, Xiao Ping; Chen, Xinguang

    2012-01-01

    Purpose: The main purpose of this study is to determine the cigarette smoking rate and smoking cessation counseling frequency in a sample of Chinese nurses. Design/methodology/approach: At the time of data collection, the hospital had 260 nurses, 255 females and five males. The 200 nurses working on the two daytime shifts were given the…

  12. Studies of surfactants in photogalvanic cells-NaLS-EDTA and azur-B ...

    Indian Academy of Sciences (India)

    Photogalvanic effects were studied in photogalvanic cells containing sodium lauryl sulphate as surfactant, EDTA as reductant and azur-B as photosensitizer. The photopotential and photocurrent generated were 814.0 mV and 255.0 A respectively. The observed conversion efficiency was 1.2% and the maximum power of ...

  13. Download this PDF file

    African Journals Online (AJOL)

    2003-05-01

    May 1, 2003 ... transmission to determine what factors are associated with increased risk of malaria transmission in the .... characteristics of patients with malaria. Tea estate workers do not receive malaria chemoprophylaxis, but. EAST AFRICAN MEDICAL JOURNAL 255 are given ..... this finding is of no real clinical use.

  14. 75 FR 12749 - Ocean Transportation Intermediary License Revocations

    Science.gov (United States)

    2010-03-17

    ... Number: 015530F. Name: Distinction Cargo Management, Inc. Address: Cargo Bldg. 9, Suite 255, JFK Int'l...: Consolidation Shipping & Logistic, (USA) Inc. Address: 219 Stuyvesant Avenue, Lynhurst, NJ 01071. Date Revoked.... License Number: 019908NF. Name: International Trade Management Group, LLC dba Patriot Lines dba ITM...

  15. Nylon 46-polytetramethylene oxide segmented block copolymers

    NARCIS (Netherlands)

    Gaymans, R.J.; Schwering, P.; de Haan, J.L.

    1989-01-01

    Block copolymers were synthesized from amine-terminated polytetramethylene oxide (PMTO) (Mw 800 and 1130) and polyamide 4,6 salt. First prepolymers were prepared at 200–210°C in the presence of a solvent (pyrrolidone). The prepolymers were postcondensed at 255°C (where possible in the solid state)

  16. LAGOS UNIVERSITY TEACHING HOSPITAL (LUTH) NIGERIA

    African Journals Online (AJOL)

    Sinus neoplasia. Arch. Otolaryngol. Head Neck. Surg. 1994; (120) l9~28. 11. Lewis J S. Castro EB. Cancer of the nasal cavity and paranasal sinuses. J. Laryngol Otol. 1972; 86: 255—262. 12. GWI Eon Kim. MD Eunji Churg. MD Clinical signif~cance of. Necl Node. Metastasis in squamous cell carcinoma of maxillary antrum.

  17. Download this PDF file

    African Journals Online (AJOL)

    Dr Olaleye

    REM sleep deprivation decreased the antinociceptive property of enkephalinase- inhibition, morphine and cold water swim .Gen. Pharmacol, 15, 255-258 . Wagner H , Ott S ,Jurcic K, Morton J and Neszmelyi. A (1983) . Chemistry, 12C NMR study and pharmacology of two saponins from Colubrina asiatica . Planta Medica ...

  18. Suitability of Broken Bottles as Fine Aggregate for Production of ...

    African Journals Online (AJOL)

    The use of broken bottles as partial replacement of river sand for production of concrete was investigated. The grading of the broken bottles and sand fell in zone II. The specific gravity of the bottles was 2.55 and that of sand was 2.65. Sand was replaced with the broken bottles in the proportions of 0%, 10%, 20%, 30%, 40%, ...

  19. Prenatal Tests for Down Syndrome

    Science.gov (United States)

    ... for a lifetime™ AMERICAN COLLEGE OF NURSE- MIDWIVES Journal of Midwifery & Women’s Health • www.jmwh.org © 2005 by the American College of Nurse-Midwives Issued by Elsevier Inc. 255 1526-9523/05/$30.00 • doi: ...

  20. 4. Primary Malignant Bone Tumours at the University Teaching ...

    African Journals Online (AJOL)

    46987.2

    The highest number of patients, 39 (25.5%) was recorded in 2012 and the lowest number 20 (13%) was recorded in 2011. Based on National Cancer Registry data, from 2008 to 2011, the overall proportion of patients with primary malignant bone tumours compared to all the other cancers recorded at UTH ranged between ...