WorldWideScience

Sample records for californium 255

  1. Metabolism and toxicity of californium

    International Nuclear Information System (INIS)

    Metabolism of californium can be compared with that of other transplutonium elements. The most important points are as follows: a fast blood clearance and fast bone uptake more important than liver uptake, a relatively high urinary excretion and kidney retention. Blood clearance of californium can be compared with that of americium. Distribution of californium 252 nitrate after intramuscular injection in rats was studied. There are very few experimental data on acute or long term toxicity of californium. (28 references)

  2. Magnetism in californium

    International Nuclear Information System (INIS)

    A SQUID-based magnetic susceptometer has been constructed for studying small radioactive samples at temperatures below 350 K and in magnetic fields up to 50 kilogauss. The device has been used to study californium (element 98) in a number of solid-state forms: the dhcp metal, several oxides (Cf2O3 in both the bcc and monoclinic structures, Cf7O12, CfO2 and BaCfO3), several monopnictides (CfN, CfAs and CfSb) and the trichloride (in both the hexagonal and orthorhombic structures). All of these materials were studied in polycrystalline form, and hexagonal CfCl3 was studied in single-crystal form as well. The susceptometer has the sensitivity to measure samples containing less than 10 micrograms of californium. The magnetic susceptibilities of all of the californium materials at temperatures above about 100 K are described well by the Curie-Weiss relationship. This behavior is consistent with the assumption that the magnetic 5f electrons are localized and that the paramagnetic behavior can be interpreted in terms of the properties of the free ion. The measured values of the effective paramagnetic moment, μ/sub eff/, for all the californium materials that were studied are reasonably consistent with theoretical values based on intermediate coupling models. All of the californium materials showed some indications of cooperative magnetic effects. The dhcp metal was observed to order ferromagnetically at 52 K, and all of the californium compounds studied showed signs of antiferromagnetic ordering, mostly at temperatures below 25 K. 91 refs., 50 figs., 19 tabs

  3. Californium Multiplier (CFX)

    International Nuclear Information System (INIS)

    The availability of 252Cf as an economical high-intensity neutron source has made it possible to construct compact neutron irradiation devices with widespread applications. The simplest such device consists of a single 252Cf source within a moderating and shielding medium. Higher neutron flux levels can be attained either through the use of more 252Cf or through source multiplication by means of a subcritical uranium assembly. Although the use of larger 252Cf sources to achieve higher neutron flux is technically straightforward, an economic penalty is paid as the source strength is increased. Larger californium sources imply larger initial investments to cover the cost of source material and larger operating costs resulting from the decay of the 252Cf source. A Californium Multiplier, the CFX, which produces a flux enhancement of 30 when compared to a conventional moderated 252Cf system has been designed, licensed, built, and tested by IRT Corporation. Such systems are now available on a commercial basis for both neutron radiography and neutron activation analysis. The first commercial CFX system was installed at the Research Laboratories of Eastman Kodak Company in Rochester, NY, in March 1975. This device, using 1 mg of 252Cf, is very stable and the neutron flux generated by the CFX is very reproducible. The performance characteristics of this system are summarized

  4. Californium--palladium metal neutron source material

    Science.gov (United States)

    Dahlen, B.L.; Mosly, W.C. Jr.; Smith, P.K.; Albenesius, E.L.

    1974-01-22

    Californium, as metal or oxide, is uniformly dispersed throughout a noble metal matrix, provided in compact, rod or wire form. A solution of californium values is added to palladium metal powder, dried, blended and pressed into a compact having a uni-form distribution of californium. The californium values are decomposed to californium oxide or metal by heating in an inert or reducing atmosphere. Sintering the compact to a high density closes the matrix around the dispersed californium. The sintered compact is then mechanically shaped into an elongated rod or wire form. (4 claims, no drawings) (Official Gazette)

  5. Californium-252 Neutron Sources for Medical Applications

    International Nuclear Information System (INIS)

    Californium-252 neutron sources are being prepared to investigate the value of this radionuclide in diagnosing and treating diseases. A source resembling a cell-loaded radium needle was developed for neutron therapy. Since therapy needles are normally implanted in the body, very conservative design criteria were established to prevent leakage of radioactive. Methods are being developed to prepare very intense californium sources that could be used eventually for neutron radiography and for diagnosis by neutron activation analysis. This paper discusses these methods

  6. Californium Electrodepositions at Oak Ridge National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Boll, Rose Ann [ORNL

    2015-01-01

    Electrodepositions of californium isotopes were successfully performed at Oak Ridge National Laboratory (ORNL) during the past year involving two different types of deposition solutions, ammonium acetate (NH4C2H3O2) and isobutanol ((CH3)2CHCH2OH). A californium product that was decay enriched in 251Cf was recovered for use in super-heavy element (SHE) research. This neutron-rich isotope, 251Cf, provides target material for SHE research for the potential discovery of heavier isotopes of Z=118. The californium material was recovered from aged 252Cf neutron sources in storage at ORNL. These sources have decayed for over 30 years, thus providing material with a very high 251Cf-to-252Cf ratio. After the source capsules were opened, the californium was purified and then electrodeposited using the isobutanol method onto thin titanium foils for use in an accelerator at the Joint Institute for Nuclear Research in Dubna, Russia. Another deposition method, ammonium acetate, was used to produce a deposition containing 1.7 0.1 Ci of 252Cf onto a stainless steel substrate. This was the largest single electrodeposition of 252Cf ever prepared. The 252Cf material was initially purified using traditional ion exchange media, such as AG50-AHIB and AG50-HCl, and further purified using a TEVA-NH4SCN system to remove any lanthanides, resulting in the recovery of 3.6 0.1 mg of purified 252Cf. The ammonium acetate deposition was run with a current of 1.0 amp, resulting in a 91.5% deposition yield. Purification and handling of the highly radioactive californium material created additional challenges in the production of these sources.

  7. Historical review of californium-252 discovery and development

    International Nuclear Information System (INIS)

    This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving 252Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed

  8. Californium-252: a remarkable versatile radioisotope

    Energy Technology Data Exchange (ETDEWEB)

    Osborne-Lee, I.W.; Alexander, C.W.

    1995-10-10

    A product of the nuclear age, Californium-252 ({sup 252}Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, {sup 252}Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of {sup 252}Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the {sup 252}Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, {sup 252}Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of {sup 252}Cf from ORNL is summarized herein.

  9. Californium-252: a remarkable versatile radioisotope

    International Nuclear Information System (INIS)

    A product of the nuclear age, Californium-252 (252Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, 252Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of 252Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the 252Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, 252Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of 252Cf from ORNL is summarized herein

  10. Californium-252 Neutron Therapy in China

    International Nuclear Information System (INIS)

    Californium-252 brachytherapy, believed to be the most successful source for neutron therapy, gives most of the cures as well as long-term and complication-free survivals. Chinese radiation oncologists were interested in californium neutron therapy (Cf-NT) in the early 1980s, but 252Cf sources for medical use were not available in China until 1992 when a californium joint venture was established by the China Institute of Atomic Energy (Beijing) and the Research Institute for Nuclear Reactors (Dimitrovgrad) of Russia. In 1995, 25 seeds of 252Cf with a strength of 3 μg each were sent to China for preclinical investigation. Three years later, a high dose rate (HDR) 252Cf source was imported and transferred into a home-made remote after-loader for intracavitary treatment in Chongqing, and a clinical trail was started in February 1999. This is the first time that Cf-NT was performed for cancer patients in China. Since then, Cf-NT in China has developed rapidly. It is estimated that one-tenth of those radiation oncology centers with brachytherapy practice will be equipped with californium units in 5 yr. That means more than 30 units will be in use in hospitals. That is significant compared with other countries, but it is just one, on average, for each province or one per 40 million people in China. Progress also has been achieved in the 252Cf treatment delivery equipment. Preliminary clinical trails showed complete response observed in all cases treated, with a rapid clearance of tumors and mild reactions in normal tissues. The short-term results are quite encouraging. To deal with problems due to the demand for Cf-NT in China, attention should be paid to the following particulars: (1) A high-strength miniature source is needed for HDR/MDR interstitial therapy to extend the Cf-NT coverage. (2) Basic work on radiophysics and radiobiology needs to be done, including source calibration, clinical dosimetry, clinical RBE determination, and Cf-NT quality assurance

  11. Californium-252 sales and loans at Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    The production and distribution in the United States of 252Cf has recently been consolidated at the Oak Ridge National Laboratory (ORNL). The 252Cf Industrial Sales/Loan Program and the 252Cf University Load Program, which were formerly located at the Savannah River Plant (SRP), have been combined with the californium production and distribution activities of the Transuranium Element Production Program at ORNL. Californium-252 is sold to commercial users in the form of bulk californium oxide, palladium-californium alloy pellets, or alloy wires. Neutron source capsules, which are fabricated for loans to DOE or other US government agencies, are still available in all forms previously available. The consolidation of all 252Cf distribution activities at the production site is expected to result in better service to users. In particular, customers for neutrons sources will be ale to select from a wider range of neutron source forms, including custom designs, through a single contact point

  12. The Enigmatic HH 255

    Science.gov (United States)

    Matt, Sean; Böhm, Karl-Heinz

    2003-03-01

    To gain insight into the nature of the peculiar Herbig-Haro object HH 255 (also called Burnham's nebula), we use previously published observations to derive information about the emission-line fluxes as a function of position within HH 255 and compare them with the well-studied and relatively well behaved bow shock HH 1. There are some qualitative similarities in the Hα and [O III] λ5007 lines in both objects. However, in contrast to the expectation of the standard bow-shock model, the fluxes of the [O I] λ6300, [S II] λ6731, and [N II] λ6583 lines are essentially constant along the axis of the flow, while the electron density decreases, over a large distance within HH 255. We also explore the possibility that HH 255 represents the emission behind a standing or quasi-stationary shock. The shock faces upwind, and we suggest, using theoretical arguments, that it may be associated with the collimation of the southern outflow from T Tauri. Using a simplified magnetohydrodynamic simulation to illustrate the basic concept, we demonstrate that the existence of such a shock at the north edge of HH 255 could indeed explain its unusual kinematic and ionization properties. Whether or not such a shock can explain the detailed emission-line stratification remains an open question.

  13. Californium-252 encapsulation at the Savannah River Laboratory

    International Nuclear Information System (INIS)

    More than 1 g of the neutron-emitting isotope californium-252 has been encapsulated at SRL for worldwide medical, industrial, and research uses. Bulk sales packages have been prepared for the USDOE sales program since 1971. Doubly-encapsulated sources have been prepared for USDOE's market evaluation program since 1968. Californium-252 sources for loan and sales packages satisfy the criteria for Special Form Radioactive Material. Encapsulation is performed in special neutron-shielded containment facilities at SRL. Development of improved source and shipping package designs and processes is continuing. 17 figures

  14. The Enigmatic HH 255

    CERN Document Server

    Matt, S; Matt, Sean; Bohm, Karl-Heinz

    2002-01-01

    To gain insight into the nature of the peculiar Herbig-Haro object HH 255 (also called Burnham's nebula), we use previously published observations to derive information about the emission line fluxes as a function of position within HH 255 and compare them with the well-studied, and relatively well-behaved bow shock HH 1. There are some qualitative similarities in the H$\\alpha$ and [O III] 5007 lines in both objects. However, in contrast to the expectation of the standard bow shock model, the fluxes of the [O I] 6300, [S II] 6731, and [N II] 6583 lines are essentially constant along the axis of the flow, while the electron density decreases, over a large distance within HH 255. We also explore the possibility that HH 255 represents the emission behind a standing or quasi-stationary shock. The shock faces upwind, and we suggest, using theoretical arguments, that it may be associated with the collimation of the southern outflow from T Tauri. Using a simplified magnetohydrodynamic simulation to illustrate the ba...

  15. Production, distribution and applications of californium-252 neutron sources

    International Nuclear Information System (INIS)

    The radioisotope 252Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-yr half-life. A source the size of a person's little finger can emit up to 1011 neutrons s-1. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement and minerals, as well as for detection and identification of explosives, land mines and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 yr of experience and by US Bureau of Mines tests of source survivability during explosions. The production and distribution center for the US Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells 252Cf to commercial reencapsulators domestically and internationally. Sealed 252Cf sources are also available for loan to agencies and subcontractors of the US government and to universities for educational, research and medical applications. The REDC has established the Californium User Facility (CUF) for Neutron Science to make its large inventory of 252Cf sources available to researchers for irradiations inside uncontaminated hot cells. Experiments at the CUF include a land mine detection system, neutron damage testing of solid-state detectors, irradiation of human cancer cells for boron neutron capture therapy experiments and irradiation of rice to induce genetic mutations

  16. Production, distribution and applications of californium-252 neutron sources.

    Science.gov (United States)

    Martin, R C; Knauer, J B; Balo, P A

    2000-01-01

    The radioisotope 252Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-yr half-life. A source the size of a person's little finger can emit up to 10(11) neutrons s(-1). Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement and minerals, as well as for detection and identification of explosives, land mines and unexploded military ordinance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 yr of experience and by US Bureau of Mines tests of source survivability during explosions. The production and distribution center for the US Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells 252Cf to commercial reencapsulators domestically and internationally. Sealed 252Cf sources are also available for loan to agencies and subcontractors of the US government and to universities for educational, research and medical applications. The REDC has established the Californium User Facility (CUF) for Neutron Science to make its large inventory of 252Cf sources available to researchers for irradiations inside uncontaminated hot cells. Experiments at the CUF include a land mine detection system, neutron damage testing of solid-state detectors, irradiation of human cancer cells for boron neutron capture therapy experiments and irradiation of rice to induce genetic mutations. PMID:11003521

  17. Production, Distribution, and Applications of Californium-252 Neutron Sources

    Energy Technology Data Exchange (ETDEWEB)

    Balo, P.A.; Knauer, J.B.; Martin, R.C.

    1999-10-03

    The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-year half-life. A source the size of a person's little finger can emit up to 10{sup 11} neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6- year half-life. A source the size of a person's little finger can emit up to 10 neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory(ORNL). DOE sells {sup 252}Cf to commercial

  18. Production of extra pure curium and californium preparations

    International Nuclear Information System (INIS)

    Preparations of curium-244,245,248 and californium-249,252 are used for the production of ionizing radiation sources for different applications and fundamental nuclear-physical investigations, placing high requirements on the radiochemical and chemical purity of the preparations. Extraction chromatography using di-(2-ethylhexyl)phosphoric acid (D2EHPA) as extractant was chosen to prepare extra pure curium and californium preparations. In order to identify the optimal conditions of Cm-Cf separation and to remove impurities from them (reagent and other impurities), investigations were performed into the effect of impurities (Na+, Ca2+, Al3+, Fe2+, Fe3+ taken as example), extractant and eluent concentration and solution flow rate on the efficiency of mutual purification of Cm and Cf. Both theoretical and experimental estimations were made of the maximum concentration at which the impurities do not affect the process. The conditions chosen allow mutual purification of milligram amounts of Cm and Cf from impurity elements at E(pur) =102 - 103 during a single chromatographic cycle (E(pur) =>103) using a column with 5 - 10 cm3 volume. In this case the production yield exceeds 98%. The purification of milligram amounts of curium and californium from fission products (lanthanides in general, cerium in particular) was performed in D2EHPA-decane-PbO2-HNO3 and D2EHPA-decane-DTPA-H3-Cit extraction chromatography systems. In order to establish the optimal conditions, the effect of [D2EHPA] and eluent on the mutual purification of Cm and Cf and on their purification from cerium and impurity elements was studied in the D2EHPA-decane-PbO2-HNO3 system. During a single chromatographic cycle the mutual purification factors of TPE and of their purification from impurity cations achieve 102-103, from cerium - E(pur) > 10. In the D2EHPA-decane-DTPA-H3Cit system, the effect of concentration of extractant and eluent pH on the efficiency of Cm and Cf purification from lanthanides was

  19. Prompt neutron spectrum of the spontaneous fission of californium-252

    International Nuclear Information System (INIS)

    The californium-252 spontaneous fission neutron spectrum was measured in the energy range of 0.01 to 10 MeV by the time-of-flight technique using various neutron detectors. The measurements of 252Cf neutron spectrum at energies of 0.01 to 5 MeV were performed as a function of fission fragment kinetic energy. The mean neutron spectrum energy in the range of 0.7 to 10 MeV was found from the results of measurements. The irregularity in the 252Cf neutron spectrum in the neutron energy range of less than 0.7 MeV compared to theoretical values is discussed. The mechanism of 252Cf neutron emission is also discussed on the basis of neutron yield angle measurements. 12 references

  20. 37 CFR 255.7 - Future proceedings.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Future proceedings. 255.7 Section 255.7 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT... MAKING AND DISTRIBUTING PHONORECORDS § 255.7 Future proceedings. The procedures specified in 17...

  1. 21 CFR 172.255 - Polyacrylamide.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Polyacrylamide. 172.255 Section 172.255 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN..., Films and Related Substances § 172.255 Polyacrylamide. Polyacrylamide containing not more than...

  2. 20 CFR 632.255 - Program planning.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Program planning. 632.255 Section 632.255... EMPLOYMENT AND TRAINING PROGRAMS Summer Youth Employment and Training Programs § 632.255 Program planning. (a... with its title IV program. (2) Native American grantees shall use the planning process described...

  3. 40 CFR 96.255 - Banking.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Banking. 96.255 Section 96.255 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) NOX BUDGET... Tracking System § 96.255 Banking. (a) CAIR SO2 allowances may be banked for future use or transfer in...

  4. 7 CFR 65.255 - United States.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false United States. 65.255 Section 65.255 Agriculture..., PEANUTS, AND GINSENG General Provisions Definitions § 65.255 United States. United States means the 50... United States....

  5. 40 CFR 264.255 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false 264.255 Section 264.255 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL FACILITIES Waste Piles § 264.255...

  6. 33 CFR 117.255 - Potomac River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Potomac River. 117.255 Section 117.255 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements District of Columbia § 117.255 Potomac River. (a)...

  7. 29 CFR 1910.255 - Resistance welding.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 5 2010-07-01 2010-07-01 false Resistance welding. 1910.255 Section 1910.255 Labor... OCCUPATIONAL SAFETY AND HEALTH STANDARDS Welding, Cutting and Brazing § 1910.255 Resistance welding. (a.... Ignitron tubes used in resistance welding equipment shall be equipped with a thermal protection switch....

  8. 42 CFR 447.255 - Related information.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Related information. 447.255 Section 447.255 Public... Facility Services Payment Rates § 447.255 Related information. The Medicaid agency must submit, with the assurances described in § 447.253(a), the following information: (a) The amount of the estimated...

  9. Separation of californium from actinides and lanthanides in aqueous solution by electrochemical formation of amalgams

    International Nuclear Information System (INIS)

    The electrochemical reduction of transneptunium elements (Pu to Cf) and rare earths (Eu, Tm) from aqueous complexing solutions to amalgams was studied over a wide range of cathodic potentials in order to achieve optimal separation of californium. The reduction in acetate media (pH 4.5-4.6) at potentials around -1.7 to -1.9 V1 leads to a quantitative extraction of californium into the mercury phase, while more negative potentials are required for the reduction of the lighter transuranium elements and of the lanthanides. Hence, the optimal conditions for the separation of californium from the investigated actinides and lanthanides were determined. Separation factors α between 25 and 90 were found except in the case of Cf/Eu, where poor values (α varying from 7 to 12) were observed. More negative cathodic potentials decrease the selectivity of the reduction process. A similar study with lithium citrate solutions (pH ∝6) shows that satisfactory separation of californium from lighter and heavier actinides is achievable. A separation factor of 88 is obtained for Cf/Am at -1.98 V. The anodic stripping of mixed amalgams (Pu, Am, Cm, Bk, Tm and Cf) Hg in nitric and acetic acid soultions at potentials ranging from +0.1 to -0.7 V proceeds slowly and proved to be ineffective for the separation of californium from light actinides under conditions described. (orig.)

  10. On-line slurry analyses by californium-252

    International Nuclear Information System (INIS)

    In chemical processing technology on-line activation methods gain an increasing importance for process monitoring and control. A method is described according to which the different fluorspar contents at various strategic points of a flotation plant are determined through neutron activation by 100 μg californium-252. A continuous analytical system for onstream process control of slurries was designed and constructed. A compact facility, called SUSAC, allows continuous application of the method on an industrial scale. The main components of the SUSAC facility are the irradiation and measurement cells. The cells are equipped with multistage countercurrent stirrers ensuring a proper radial and vertical distribution of the sample. The hollow shaft of the stirrer of the irradiation cell houses the Cf-source. The NaI-detector has been installed in a recess in the bottom of the measuring cell. The volumes are 9 dm3 for the irradiation cell, 7.5 dm3 for the measuring cell, 1/2 dm3 for the vonnection line and 4 dm3 for feed and drainage lines including the pump. Investigations on the following topics are discussed: selection of stirrers, residence time, flow rate, pulp density, calibration measurements. (T.G.)

  11. Biomedical neutron research at the Californium User Facility for neutron science

    International Nuclear Information System (INIS)

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact 252Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with 252Cf sources. Three projects at the CUF that demonstrate the versatility of 252Cf for biological and biomedical neutron-based research are described: future establishment of a 252Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded 252Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy

  12. Biomedical neutron research at the Californium User Facility for neutron science

    Energy Technology Data Exchange (ETDEWEB)

    Martin, R.C. [Oak Ridge National Lab., TN (United States); Byrne, T.E. [Roane State Community College, Harriman, TN (United States); Miller, L.F. [Univ. of Tennessee, Knoxville, TN (United States)

    1997-04-01

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact {sup 252}Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with {sup 252}Cf sources. Three projects at the CUF that demonstrate the versatility of {sup 252}Cf for biological and biomedical neutron-based research are described: future establishment of a {sup 252}Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded {sup 252}Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy.

  13. Proposed Californium-252 User Facility for Neutron Science at Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    The Radiochemical Engineering Development Center (REDC) at ORNL has petitioned to establish a Californium-252 User Facility for Neutron Science for academic, industrial, and governmental researchers. The REDC Californium Facility (CF) stores the national inventory of sealed 252Cf neutron source for university and research loans. Within the CF, the 252Cf storage pool and two uncontaminated hot cells currently in service for the Californium Program will form the physical basis for the User Facility. Relevant applications include dosimetry and experiments for neutron tumor therapy; fast and thermal neutron activation analysis of materials; experimental configurations for prompt gamma neutron activation analysis; neutron shielding and material damage studies; and hardness testing of radiation detectors, cameras, and electronics. A formal User Facility simplifies working arrangements and agreements between US DOE facilities, academia, and commercial interests

  14. Emergence of californium as the second transitional element in the actinide series.

    Science.gov (United States)

    Cary, Samantha K; Vasiliu, Monica; Baumbach, Ryan E; Stritzinger, Jared T; Green, Thomas D; Diefenbach, Kariem; Cross, Justin N; Knappenberger, Kenneth L; Liu, Guokui; Silver, Mark A; DePrince, A Eugene; Polinski, Matthew J; Van Cleve, Shelley M; House, Jane H; Kikugawa, Naoki; Gallagher, Andrew; Arico, Alexandra A; Dixon, David A; Albrecht-Schmitt, Thomas E

    2015-01-01

    A break in periodicity occurs in the actinide series between plutonium and americium as the result of the localization of 5f electrons. The subsequent chemistry of later actinides is thought to closely parallel lanthanides in that bonding is expected to be ionic and complexation should not substantially alter the electronic structure of the metal ions. Here we demonstrate that ligation of californium(III) by a pyridine derivative results in significant deviations in the properties of the resultant complex with respect to that predicted for the free ion. We expand on this by characterizing the americium and curium analogues for comparison, and show that these pronounced effects result from a second transition in periodicity in the actinide series that occurs, in part, because of the stabilization of the divalent oxidation state. The metastability of californium(II) is responsible for many of the unusual properties of californium including the green photoluminescence. PMID:25880116

  15. Fissile analysis of Hanford waste using Californium Multiplier/Delayed Neutron Counter system

    International Nuclear Information System (INIS)

    Measurement of low-level (10 ng/g or lower) fissile material (mainly plutonium) in Hanford waste and process samples is becoming increasingly important. A system has been designed consisting of a Californium Multiplier (CFX) and a Delayed Neutron Counter (DNC) to characterize these samples. This report describes hardware and analytical capability of the CFX/DNC system

  16. Study of the shielding for spontaneous fission sources of Californium-252

    International Nuclear Information System (INIS)

    A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)

  17. 40 CFR 97.255 - Banking.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Banking. 97.255 Section 97.255 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) FEDERAL NOX... Banking. (a) CAIR SO2 allowances may be banked for future use or transfer in a compliance account or...

  18. 24 CFR 221.255 - Assignment option.

    Science.gov (United States)

    2010-04-01

    ... DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES LOW COST AND MODERATE INCOME MORTGAGE INSURANCE-SAVINGS CLAUSE Contract Rights and Obligations-Low Cost Homes § 221.255... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Assignment option. 221.255...

  19. 40 CFR 255.30 - Responsibilities established.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Responsibilities established. 255.30 Section 255.30 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES... waste should be an identified responsibility throughout the State. In the event that no local...

  20. 24 CFR 983.255 - Tenant screening.

    Science.gov (United States)

    2010-04-01

    ... in 25 CFR part 5, subpart L, apply to tenant screening. ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Tenant screening. 983.255 Section... PROJECT-BASED VOUCHER (PBV) PROGRAM Occupancy § 983.255 Tenant screening. (a) PHA option. (1) The PHA...

  1. Californium (252Cf) and its use as neutron source in science medicine and technology

    International Nuclear Information System (INIS)

    The application of radionuclides in science and nuclear techniques basically is related to unstable isotopes, which are produced from stable elements in nuclear reactor. Their specifications are various from view point of application . Using of physical and chemical properties of radionuclides in chemistry, for with marking the organic compounds we can exactly explain the mechanism of chemical reactions in medical, biology and bio-chemistry. In these cases the behaviour of radionuclides is very important and the selection of the suitable radionuclides is determined between the elements for investigation aims. The special specification of radio-nuclides analysis such as, half-life, kind of ray and energy should be considered with an special accuracy as well as the laws security regulations from view point of ray-protection should be completely observed mean time working these radio-nuclides. It should be considered that application of radio-isotopes is very important from their special specifications point of view. Applying the radionuclides from technology point of view in sciences and nuclear techniques aren't only limited to three analyses of α, β, and γ, but we can use the share of neutron which are produced from spli ting of heavy nucleus such as Californium252 as a neutron source in the depths of the sea and also determining the concentration of low quantity elements on moon and other spheres. The radioisotope of Californium252 is a neutron useful radiator for investigation in nuclear medical and technology because of automatically rapid split to 3.2% Californium252 radiates 1.34 * 109N/m in each mil/GH which suitable replacement for neutron sources based on (a, n) reaction, for example, Radium-Brellium or Amersium-Brellium. The energy distribution of radiated neutrons from analyzing of Californium252 like the spectrum of neutron which is produced from splitting of U235, Pu239 nucleus has the maximum energy in quantity, En=1 MeV in the range of 1.5 MeV. The

  2. Contribution to clinical dosimetry of californium 252 sources used at Gustave Roussy institute

    International Nuclear Information System (INIS)

    The main characteristics of californium 252 sources are presented in the first part of the report. Dose measurements around Californium sources were performed with a pair of ionization multiplication chambers: the first one has an Aluminium wall and is filled with Argon, the second one a plastic tissue-equivalent gas. A set of experiments was performed in order to investigate the relative influence of beta rays on the response of both chambers. Besides the experimental work a computer program was written to calculate the dose distribution around the actual sources made of a series of small active sources placed in catheters. Theoretical data around small sources can be found in the litterature. The comparison between experimental results and theoretical ones has shown a good agreement. The computer program will be included as a sub-routine in the more general computer program used for patients treated with interstitial therapy

  3. Safety Analysis Report for Packaging (SARP) of the Oak Ridge National Laboratory TRU Californium Shipping Container

    International Nuclear Information System (INIS)

    An analytical evaluation of the Oak Ridge National Laboratory TRU Californium Shipping Container was made in order to demonstrate its compliance with the regulations governing off-site shipment of packages that contain radioactive material. The evaluation encompassed five primary categories: structural integrity, thermal resistance, radiation shielding, nuclear criticality safety, and quality assurance. The results of this evaluation demonstrate that the container complies with the applicable regulations

  4. Emergence of californium as the second transitional element in the actinide series

    OpenAIRE

    Cary, Samantha K.; Vasiliu, Monica; Baumbach, Ryan E.; Stritzinger, Jared T.; GREEN, THOMAS D.; Diefenbach, Kariem; Cross, Justin N.; Knappenberger, Kenneth L.; Liu, Guokui; Silver, Mark A.; DePrince, A. Eugene; Polinski, Matthew J.; Van Cleve, Shelley M.; House, Jane H.; Kikugawa, Naoki

    2015-01-01

    A break in periodicity occurs in the actinide series between plutonium and americium as the result of the localization of 5f electrons. The subsequent chemistry of later actinides is thought to closely parallel lanthanides in that bonding is expected to be ionic and complexation should not substantially alter the electronic structure of the metal ions. Here we demonstrate that ligation of californium(III) by a pyridine derivative results in significant deviations in the properties of the resu...

  5. Measurements of integral cross sections in the californium-252 fission neutron spectrum

    International Nuclear Information System (INIS)

    In a low-scattering arrangement cross sections averaged over the californium-252 spontaneous fission neutron spectrum were measured. The reactions 27Al(n,α)46Ti, 47Ti, 48Ti(n,p), 54Fe,56Fe(n,p), 58Ni(n,p), 64Zn(n,p), 115In(n,n') were studied in order to obtain a consistent set of threshold detectors used in fast neutron flux density measurements. Overall uncertainties between 2 and 2.5% could be achieved; corrections due to neutron scattering in source and samples are discussed

  6. Measurement of californium-252 gamma photons depth dose distribution in tissue equivalent material. Vol. 4

    International Nuclear Information System (INIS)

    Phantom of tissue equivalent material with and without bone was used measuring depth dose distribution of gamma-rays from californium-252 source. The source was positioned at center of perspex walled phantom. Depth dose measurements were recorded for X, Y and Z planes at different distances from source. TLD 700 was used for measuring the dose distribution. Results indicate that implantation of bone in tissue equivalent medium cause changes in the gamma depth dose distribution which varies according to variation in bone geometry. 9 figs

  7. Spontaneous Partitioning of Californium from Curium: Curious Cases from the Crystallization of Curium Coordination Complexes

    Energy Technology Data Exchange (ETDEWEB)

    Cary, Samantha K.; Silver, Mark A.; Liu, Guokui; Wang, Jamie C.; Bogart, Justin A.; Stritzinger, Jared T.; Arico, Alexandra A.; Hanson, Kenneth; Schelter, Eric J.; Albrecht-Schmitt, Thomas E.

    2015-12-07

    The reaction of 248CmCl3 with excess 2,6-pyridinedicarboxylic acid (DPA) under mild solvothermal conditions results in crystallization of the tris-chelate complex Cm(HDPA)3·H2O. Approximately half of the curium remains in solution at the end of this process, and evaporation of the mother liquor results in crystallization of the bis-chelate complex [Cm(HDPA)- (H2DPA)(H2O)2Cl]Cl·2H2O. 248Cm is the daughter of the α decay of 252Cf and is extracted in high purity from this parent. However, trace amounts of 249,250,251Cf are still present in all samples of 248Cm. During the crystallization of Cm(HDPA)3·H2O and [Cm(HDPA)(H2DPA)(H2O)2Cl]Cl·2H2O, californium(III) spontaneously separates itself from the curium complexes and is found doped within crystals of DPA in the form of Cf(HDPA)3. These results add to the growing body of evidence that the chemistry of californium is fundamentally different from that of earlier actinides.

  8. 49 CFR 178.255-12 - Pressure test.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Pressure test. 178.255-12 Section 178.255-12... Specifications for Portable Tanks § 178.255-12 Pressure test. (a) Each completed portable tank prior to... 100 °F during the test, and applying a pressure of 60 psig. The tank shall be capable of holding...

  9. 17 CFR 256.255 - Accumulated deferred investment tax credits.

    Science.gov (United States)

    2010-04-01

    ... investment tax credits. 256.255 Section 256.255 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 8. Deferred Credits § 256.255 Accumulated deferred investment tax credits. (a) This account shall be credited and account 411.5, Investment tax credit,...

  10. 49 CFR 178.255-3 - Expansion domes.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Expansion domes. 178.255-3 Section 178.255-3 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS MATERIALS SAFETY... Specifications for Portable Tanks § 178.255-3 Expansion domes. (a) Expansion domes, if applied, must have...

  11. 42 CFR 441.255 - Sterilization by hysterectomy.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Sterilization by hysterectomy. 441.255 Section 441.255 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Sterilizations § 441.255 Sterilization by hysterectomy. (a) FFP is not available in expenditures for...

  12. 27 CFR 24.255 - Bottling or packing wine.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Bottling or packing wine. 24.255 Section 24.255 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Storage, Treatment and Finishing of Wine Bottling, Packing, and Labeling of Wine § 24.255 Bottling...

  13. 33 CFR 106.255 - Security systems and equipment maintenance.

    Science.gov (United States)

    2010-07-01

    ... maintenance. 106.255 Section 106.255 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND... Shelf (OCS) Facility Security Requirements § 106.255 Security systems and equipment maintenance. (a... procedures for identifying and responding to security system and equipment failures or malfunctions....

  14. 33 CFR 110.255 - Ponce Harbor, P.R.

    Science.gov (United States)

    2010-07-01

    ...) Floats for marking anchors in place will be allowed; stakes or mooring piles are prohibited. 33 CFR Ch. I... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Ponce Harbor, P.R. 110.255... ANCHORAGE REGULATIONS Anchorage Grounds § 110.255 Ponce Harbor, P.R. (a) Small-craft anchorage. On...

  15. 49 CFR 234.255 - Gate arm and gate mechanism.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Gate arm and gate mechanism. 234.255 Section 234... Maintenance, Inspection, and Testing Inspections and Tests § 234.255 Gate arm and gate mechanism. (a) Each gate arm and gate mechanism shall be inspected at least once each month. (b) Gate arm movement shall...

  16. 15 CFR 25.5 - Review by the reviewing official.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Review by the reviewing official. 25.5... § 25.5 Review by the reviewing official. (a) If, based on the report of the investigating official under § 25.4(b), the reviewing official determines that there is adequate evidence to believe that...

  17. Fast and efficient charge breeding of the Californium rare isotope breeder upgrade electron beam ion source

    Energy Technology Data Exchange (ETDEWEB)

    Ostroumov, P. N., E-mail: ostroumov@anl.gov; Barcikowski, A.; Dickerson, C. A.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. P. [Argonne National Laboratory, Argonne, Illinois 60439 (United States); Pikin, A. I. [Brookhaven National Laboratory, Upton, New York 11973 (United States)

    2015-08-15

    The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz.

  18. Fast and efficient charge breeding of the Californium rare isotope breeder upgrade electron beam ion source

    International Nuclear Information System (INIS)

    The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz

  19. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252

    International Nuclear Information System (INIS)

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U233 when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO2(NO3)4 and 18% of thorium Th(NO3)4 as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 107 s-1. In the design the value of the effective multiplication factor, whose value turned out keff <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  20. Fast and efficient charge breeding of the Californium rare isotope breeder upgrade electron beam ion source.

    Science.gov (United States)

    Ostroumov, P N; Barcikowski, A; Dickerson, C A; Perry, A; Pikin, A I; Sharamentov, S I; Vondrasek, R C; Zinkann, G P

    2015-08-01

    The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz. PMID:26329185

  1. Neutron activation analysis at the Californium User Facility for Neutron Science

    International Nuclear Information System (INIS)

    The Californium User Facility (CUF) for Neutron Science has been established to provide 252Cf-based neutron irradiation services and research capabilities including neutron activation analysis (NAA). A major advantage of the CUF is its accessibility and controlled experimental conditions compared with those of a reactor environment The CUF maintains the world's largest inventory of compact 252Cf neutron sources. Neutron source intensities of ≤ 1011 neutrons/s are available for irradiations within a contamination-free hot cell, capable of providing thermal and fast neutron fluxes exceeding 108 cm-2 s-1 at the sample. Total flux of ≥109 cm-2 s-1 is feasible for large-volume irradiation rabbits within the 252Cf storage pool. Neutron and gamma transport calculations have been performed using the Monte Carlo transport code MCNP to estimate irradiation fluxes available for sample activation within the hot cell and storage pool and to design and optimize a prompt gamma NAA (PGNAA) configuration for large sample volumes. Confirmatory NAA irradiations have been performed within the pool. Gamma spectroscopy capabilities including PGNAA are being established within the CUF for sample analysis

  2. Long-term effects of an intracavitary treatment with californium-252 on normal tissue

    International Nuclear Information System (INIS)

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with 252Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from 252Cf and 7000 rad from 226Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for 252Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from 252Cf and 5000 rad from 226Ra

  3. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source

    International Nuclear Information System (INIS)

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction 55Mn (n.gamma)56 Mn, high concentration of manganese in the matrix and short half - life of 56Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions 56Fe(n,p)56Mn and 59 Co (n, α)56 were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  4. Five-year cure of cervical cancer treated using californium-252 neutron brachytherapy

    International Nuclear Information System (INIS)

    Female pelvic carcinoma is one of the common malignancies seen at the University of Kentucky Medical Center and often presents in an advanced stage. In 1976, the authors began to test californium-252 neutron brachytherapy (NT) for its efficacy for control of primary and recurrent advanced uterine, cervix, and vaginal cancers. The first protocol used was 5000-5500 rad of whole pelvis irradiation followed by 1-2 Cf-252 insertions using a single tandem placed in the utero-cervico-vaginal region. Of 27 patients with primary carcinomas treated, 10 are alive and well 5 year later (37%). Two of two recurrent tumors were locally controlled but failed later. These patients had advanced cervical, vaginal, or endometrial carcinomas. In 1977, a transitional year, treatment of only unfavorable stages and presentations with NT was initiated. Similar results were obtained with NT as compared to conventional photon therapy (PT). Further improvement in treatment results can be anticipated as NT brachytherapy is used for advanced cancer therapy by more effective treatment schedules and radiation doses. Cf-252 can be used as a radium substitute and achieved similar rates of tumor control and 5-year survivals. 21 references, 2 tables

  5. Uptake and distribution of californium-252 chloride administered intraperitoneally, intravenously or intratracheally and the effect of in vivo DTPA chelation on intratracheal instillation in the rat

    International Nuclear Information System (INIS)

    The first phase of this investigation, comprising of three groups of animals, was designed to study the fate of californium-252 chloride administered intraperitoneally, intravenously or intratracheally. The second phase, which consisted of two groups of animals, was designed to examine the effectiveness of DTPA chelation therapy in accelerating the excretion and preventing the deposition of californium-252 chloride instilled into the lungs of rats. Immediately following the dose administration of 2 uCi of californium-252 chloride which was dissolved in 0.2 ml of 0.9% NaCl at pH 3.5, each rat was placed in a metabolism cage. Each rat in the first group of phase II was given intraperitoneal injection of CaNa3 DTPA (50 mg/kg) and each rat in the second group was given intraperitoneal injections of 0.9% NaCl. Injections of the DTPA or the NaCl sham were initiated immediately after the intratracheal administration of californium-252 chloride and were continued every three days until sacrifice. Following intraperitoneal, intravenous or intratracheal administration, the whole body retention of californium as a function of time was described by a three component exponential equation. For each mode of administration the short term component exhibited a biological half-life of between 5 and 10 hours; the intermediate component between 4 and 6 days; and the long term component between 200 and 300 days. The organ data obtained following intraperitoneal and intravenous administration were indistinguishable. On day one, the liver retained about 9% of the administered dose and the kidneys retained 2.4%. Retention for these organs decreased to about 1% by day 32. The femurs maintained an almost constant level of 4.5% of the injected dose over the 32 days. The lungs, spleen, heart, and testes showed significant retention of californium

  6. ENEA results in the international comparison organized by BIPM for the measurament of neutron fluxes of a Californium source

    International Nuclear Information System (INIS)

    During the period between May 1978 and August 1984 under the auspices of Section III of CCEMRI of CIPM it has been carried out the international intercomparison of Californium neutron source emission rate. The previous intercomparison was based on Ra-Be (α -n) source measuraments, which took place between 1959 and 1965, and the results showed a total spread of +- 3%. Owing to the better accuracy achived over the following decade the Ra-Be intercomparison was no longer representative of the state of the art, therefore it was decided to arrange the intercomparison based on Californium which in the meantime reached a wide use in the world. Contributions to the intercomparison were received from fourteen laboratories representative of twelve Nations plus the BIPM. The results put into evidence a considerable advance on accuracy in the neutron source emission rate measuraments. The standard deviation of the residuals obtained from least square fit of normalized data resulted +- 0,57%. In the present report it is widely described the Manganese bath method used at ENEA, CRE Casaccia in Roma, and the experimental procedure followed for its absolute calibration. All measuraments are reported and analysed, including those effectuated for corrective factors determination. The final results obtained at ENEA for the circulated Californium source is (3,457 +- 0,013) 10*H7 neutron/s. The analysis of data from all partecipantes has been effectuated and concluded by J. Axton in March 1986 and the conclusions which have been showed in the present report put in evidence the satisfactory results achived by the ENEA

  7. 40 CFR 255.1 - Scope and purpose.

    Science.gov (United States)

    2010-07-01

    ... types (residential and commercial solid waste, hazardous wastes, industrial sludges and pretreatment... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES IDENTIFICATION OF REGIONS AND AGENCIES FOR SOLID WASTE MANAGEMENT General Provisions § 255.1 Scope and purpose. (a)...

  8. Feasibility and market potential of protein determination of wheat using californium-252

    International Nuclear Information System (INIS)

    To evaluate the feasibility of protein determination by capture gamma-ray analysis using californium-252 neutrons, an in-situ protein analysis system for use by grain handlers has been examined. Three 227 kilogram (approximately) lots of wheat were used to determine the amount of nitrogen present. Protein analyses by the Kjeldahl method were obtained from samples taken before and after the capture gamma-ray analyses. The 5.267-MeV gamma-ray was selected for use in this study as a compromise between efficiency and interference from other elements. The associated counting equipment was a multichannel analyzer with pulse shaping electronic and analysis computing equipment. A linear regression program was used to compare the regions of interest to the Kjeldahl protein averages. The counts composing each peak were summed and normalized using the total count of the hydrogen peak. The normalized nitrogen percentages indicate a significant correlation between the spectral regions and the Kjeldahl analyses. To a first approximation, the value of wheat is the wheat protein. At the present time, protein testing of wheat is destructive, cumbersome, and time-consuming as compared to the potential for capture gamma-ray analysis testing. Assuming that such a protein analysis unit can analyze 42 tonne of wheat per hour, over 120 units would be needed to monitor one-half the U.S. annual wheat production. A 0.5% improvement in processor realizations and grain throughput value of $167.00 per tonne will result in a projected savings of $150,000 per year per unit

  9. Oxygen enhancement ratio (OER) and therapeutic gain factor (GF) for californium-252 at low dose rate

    International Nuclear Information System (INIS)

    The potential benefit of the introduction of californium-252 in interstitial and intracavitary therapy is related to the greater efficiency of its neutron emission against anoxic cancer cells. In that respect, the oxygen enhancement ratio (OER) of the 252Cf emission has been determined for a continuous low dose rate irradiation. The biological system is growth inhibition in Vicia faba bean roots. A new Vicia faba ''BelB'' strain has been used, which better tolerates long periods (up to about 10 hours) of anoxia. In a first series of experiments, for a 252Cf (Dsub(n+γ)) dose rate of 0.11 Gy.h-1, an OER of 1.4+-0.1 was observed (the γ contribution Dγ to the total absorbed dose Dsub(n+γ) was 0.35 at the position of the root tips). In a second series of experiments, in somewhat different geometrical conditions with a 252Cf (Dsub(n+γ)) dose rate of 0.13 Gy.h-1, an OER of 1.5+-0.1 was observed (Dγ/Dsub(n+γ)=0.42). The OER values observed for similar irradiation times, with iridium-192 γ-rays, were 2.3+-0.2 and 2.6+-0.1 respectively, which leads to therapeutic gain factors (GF) of 1.6 and 1.7 respectively. These GF values are slightly lower than those previously obtained (GF=1.8) on the same system, with d(50)-Be p(75)-Be and 15 MeV neutron beams

  10. Application of TSH bioindicator for studying the biological efficiency of neutrons from californium-252 source

    International Nuclear Information System (INIS)

    The effectiveness of neutrons from a Californium-252 source in the induction of various abnormalities in the Tradescantia clone 4430 stamen hair cells (TSH-assay) was studied. The special attention was paid to check whether any enhancement in effects caused by process of boron neutron capture is visible in the cells enriched with boron ions. Two chemicals (borax and BSH) were applied to introduce boron-10 ions into cells. Inflorescence, normal or pretreated with chemicals containing boron, were irradiated in the air with neutrons from a Cf-252 source at KAERI, Taejon, Korea. To estimate the relative biological effectiveness (RBE) in the induction of gene mutations of the neutron beam under the study, Tradescantia inflorescences, without any chemical pretreatment, were irradiated with various doses of X-rays. The ranges of radiation doses used were 0-0.1 Gy in neutrons and 0-0.5 Gy in X-rays. After the time needed to complete the postirradiation repair Tradescantia cuttings were transferred to Cracow, where screening of gene and lethal; mutations, cell cycle alterations in somatic cells have been done, and dose response relationships were figured. The maximal RBE values were estimated in the range of 4.6-6.8. Alterations of RBE value were observed; from 6.8 to 7.8 in the case of plants pretreated with 240 ppm of B-10 from borax, and 4.6 to 6.1 in the case of 400 ppm of B-10 from BSH. Results showed a slight, although statistically insignificant increase in biological efficacy of radiation from the Cf-252 source in samples pretreated with boron containing chemicals. (author)

  11. Divalent and trivalent gas-phase coordination complexes of californium: evaluating the stability of Cf(ii).

    Science.gov (United States)

    Dau, Phuong D; Shuh, David K; Sturzbecher-Hoehne, Manuel; Abergel, Rebecca J; Gibson, John K

    2016-08-01

    The divalent oxidation state is increasingly stable relative to the trivalent state for the later actinide elements, with californium the first actinide to exhibit divalent chemistry under moderate conditions. Although there is evidence for divalent Cf in solution and solid compounds, there are no reports of discrete complexes in which Cf(II) is coordinated by anionic ligands. Described here is the divalent Cf methanesulfinate coordination complex, Cf(II)(CH3SO2)3(-), prepared in the gas phase by reductive elimination of CH3SO2 from Cf(III)(CH3SO2)4(-). Comparison with synthesis of the corresponding Sm and Cm complexes reveals reduction of Cf(III) and Sm(III), and no evidence for reduction of Cm(III). This reflects the comparative 3+/2+ reduction potentials: Cf(3+) (-1.60 V) ≈ Sm(3+) (-1.55 V) ≫ Cm(3+) (-3.7 V). Association of O2 to the divalent complexes is attributed to formation of superoxides, with recovery of the trivalent oxidation state. The new gas-phase chemistry of californium, now the heaviest element to have been studied in this manner, provides evidence for Cf(II) coordination complexes and similar chemistry of Cf and Sm. PMID:27424652

  12. Hypoxic versus normoxic external-beam irradiation of cervical carcinoma combined with californium-252 neutron brachytherapy. Comparative treatment results of a 5-year randomized study

    Czech Academy of Sciences Publication Activity Database

    Tačev, T.; Vacek, Antonín; Ptáčková, B.; Strnad, V.

    2005-01-01

    Roč. 181, č. 5 (2005), s. 273-284. ISSN 0179-7158 Institutional research plan: CEZ:AV0Z50040507 Keywords : cervical carcinoma * hypoxyradiotherapy * californium-252 Subject RIV: BO - Biophysics Impact factor: 3.490, year: 2005

  13. Solving the Hydration Structure of the Heaviest Actinide Aqua Ion Known: The Californium(III) Case

    Energy Technology Data Exchange (ETDEWEB)

    Den Auwer, Ch.; Guillaumont, D. [CEA Marcoule, Nucl Energy Div, Radiochem Proc Dept, SCPS LILA, 30 (France); Galbis, E.; Pappalardo, Rafael R.; Marcos Sanchez, E. [Univ Seville, Dept Quim Fis, E-41012 Seville (Spain); Hernandez-Cobos, J. [Inst Ciencias Fis, Cuernavaca 62251, Morelos (Mexico); Le Naour, C.; Simoni, E. [Univ Paris Sud, Inst Phys Nucl Orsay, Paris (France)

    2010-07-01

    In summary, the first MC simulation of the trivalent cation of californium, based on an exchangeable hydrated ion-water intermolecular potential, has been shown to extend and improve the hydrated ion model. Likewise, the CfL{sub III}-edge EXAFS spectrum of an acidic 1 mm Cf(ClO{sub 4}){sub 3} aqueous solution recorded under optimized experimental conditions has greatly improved the signal/noise ratio of the only previously recorded spectrum. The comparison of the experimental EXAFS spectrum with the two computed ones, obtained from two different intermolecular potentials that predict eight (BP86) or nine (MP2) water molecules in the first coordination shell, leads to the conclusion that the lowest hydration number is preferred. Then, as Cf{sup III} is the heaviest actinide aqua ion for which there is experimental information, the actinide contraction is supported by the present study. (For U{sup III}, R{sub U-O}=2.56 Angstroms, and CN=9{+-}1; for Pu{sup III}, R{sub Pu-O}=2.51 Angstroms and CN=9{+-}1; for Cm{sup III}, R{sub Cm-O}=2.47 Angstroms and CN=9{+-}1). The role of the second hydration shell is important in defining the structure and dynamics of the Cf{sup III} aqua ion, but the contribution of second-shell water molecules to the EXAFS signal as back-scatters is marginal. Finally, this work gives an illustrative example of the benefits which can be achieved from the combination of experimental X-ray absorption spectroscopy and computer simulations. The usefulness of the simultaneous analysis of the results as well as the importance of the structural statistical average has been clearly demonstrated herein. Each technique independently was not adequate. We believe that this study traces out a still poorly explored combined methodology which may be extremely useful for many other complexes and chemical problems. A systematic theoretical and experimental examination of the other known actinide cations on the same basis should be undertaken to confirm the

  14. Construction of a 25.5-MHz rebuncher cavity

    International Nuclear Information System (INIS)

    A 25.5-MHz double-coaxial λ/4 resonator has been constructed as a rebuncher cavity which is used between a 25.5-MHz split coaxial RFQ and a 51-MHz interdigital-H linac in the INS linac complex for unstable nuclei. By using the double coaxial structure, we have reduced the resonator length from the natural λ/4 (294 cm at 25.5 MHz) to 130 cm. The resonator has six accelerating gaps, and its effective shunt impedance is 29.1 MΩ/m. When the total voltage generated by the 6 gaps is 200 kV (design voltage for q/A 1/10 ions), the required power is about 1.4 kW. (author)

  15. Dicty_cDB: CHR255 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available --- ---xsrrlw*nhxqlylnqiyyxvislvvexqxsxkkv Frame B: ilimkefxkelfmqeeqelmviffliriivn*qkqis*v--- ---xqedygktix...Ames section 3 of 18 of the complete genome. 46 2e-05 2 AE017355 |AE017355.1 Bacillus thuringiensis serovar konkukia...e) Enterobacter sp. 638, complete ... 67 2e-10 CP000946_1860( CP000946 |pid:none) Escherichia coli...CH (Link to library) CHR255 (Link to dictyBase) - - - Contig-U16458-1 CHR255P (Link to Ori...um discoideum catalase B (catB) mRNA, partial cds. 176 1e-40 1 AE017026 |AE017026.1 Bacillus anthracis str.

  16. Design, construction, and characterization of a facility for neutron capture gamma ray analysis of sulfur in coal using californium-252

    International Nuclear Information System (INIS)

    A study of neutron capture gamma ray analysis of sulfur in coal using californium-252 as a neutron source is reported. Both internal and external target geometries are investigated. The facility designed for and used in this study is described. The external target geometry is found to be inappropriate because of the low thermal neutron flux at the sample location, which must be outside the biological shielding. The internal target geometry is found to have a sufficient thermal neutron flux, but an excessive gamma ray background. A water filled plastic facility, rather than the paraffin filled steel one used in this study, is suggested as a means of increasing flexibility and decreasing the beackground in the internal target geometry

  17. 16 CFR 255.4 - Endorsements by organizations.

    Science.gov (United States)

    2010-01-01

    ... endorsement must be reached by a process sufficient to ensure that the endorsement fairly reflects the..., in conjunction with a proper exercise of its expertise in evaluating the product under § 255.3... products. Example: A mattress seller advertises that its product is endorsed by a chiropractic...

  18. 24 CFR 203.255 - Insurance of mortgage.

    Science.gov (United States)

    2010-04-01

    ... obligations under § 203.10 concerning informed consumer choice for prospective FHA mortgagors); (4) Not... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance of mortgage. 203.255... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER...

  19. 40 CFR 255.32 - Coordination with other programs.

    Science.gov (United States)

    2010-07-01

    ... criteria (§ 255.11) specify review of solid waste activities being conducted by water quality management planning agencies, underground injection control agencies, and air quality management agencies. There... IDENTIFICATION OF REGIONS AND AGENCIES FOR SOLID WASTE MANAGEMENT Responsibilities of Identified Agencies...

  20. Human Factors evaluation of LCS 254 and 255

    International Nuclear Information System (INIS)

    This report includes the results of the Human Factors evaluation of the local control stations (LCS) 254 and 255 performed by Savannah River Technology Center (SRTC) Human Factors. Recommendations are included in order that the panel designs will be upgraded to comply with human engineering design guidelines. Figures 1 and 2 are included as examples of recommended changes. Also, consideration was given to including the proposed engineering changes which are currently on-going for LCS 255. Appendix A identifies the human engineering requirements from NUREG-0700 which were used in the evaluation process, and the areas of the design which do not comply with the guidelines. Those areas of the panel design which fail to comply with the human engineering guidelines are label location, label content, location aids, panel layout, and control display integration. Each of these design deficiencies and proposed corrections are described in this report

  1. InP Heterojunction Bipolar Transistor Amplifiers to 255 GHz

    Science.gov (United States)

    Radisic, Vesna; Sawdai, Donald; Scott, Dennis; Deal, William; Dang, Linh; Li, Danny; Cavus, Abdullah; To, Richard; Lai, Richard

    2009-01-01

    Two single-stage InP heterojunction bipolar transistor (HBT) amplifiers operate at 184 and 255 GHz, using Northrop Grumman Corporation s InP HBT MMIC (monolithic microwave integrated circuit) technology. At the time of this reporting, these are reported to be the highest HBT amplifiers ever created. The purpose of the amplifier design is to evaluate the technology capability for high-frequency designs and verify the model for future development work.

  2. Operational experience with the Argonne National Laboratory Californium Rare Ion Breeder Upgrade facility and electron cyclotron resonance charge breeder

    Science.gov (United States)

    Vondrasek, R.; Clark, J.; Levand, A.; Palchan, T.; Pardo, R.; Savard, G.; Scott, R.

    2014-02-01

    The Californium Rare Ion Breeder Upgrade (CARIBU) of the Argonne National Laboratory Argonne Tandem Linac Accelerator System (ATLAS) facility provides low-energy and accelerated neutron-rich radioactive beams to address key nuclear physics and astrophysics questions. A 350 mCi 252Cf source produces fission fragments which are thermalized and collected by a helium gas catcher into a low-energy particle beam with a charge of 1+ or 2+. An electron cyclotron resonance (ECR) ion source functions as a charge breeder in order to raise the ion charge sufficiently for acceleration in the ATLAS linac. The ECR charge breeder has achieved stable beam charge breeding efficiencies of 10.1% for 23Na7+, 17.9% for 39K10+, 15.6% for 84Kr17+, and 12.4% for 133Cs27+. For the radioactive beams, a charge breeding efficiency of 11.7% has been achieved for 143Cs27+ and 14.7% for 143Ba27+. The typical breeding times are 10 ms/charge state, but the source can be tuned such that this value increases to 100 ms/charge state with the best breeding efficiency corresponding to the longest breeding times—the variation of efficiencies with breeding time will be discussed. Efforts have been made to characterize and reduce the background contaminants present in the ion beam through judicious choice of q/m combinations. Methods of background reduction are being investigated based upon plasma chamber cleaning and vacuum practices.

  3. Long-term effects of an intracavitary treatment with californium-252 on normal tissue. [Swine, /sup 226/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.

    1976-01-01

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with /sup 252/Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from /sup 252/Cf and 7000 rad from /sup 226/Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for /sup 252/Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from /sup 252/Cf and 5000 rad from /sup 226/Ra.

  4. Results with the electron cyclotron resonance charge breeder for the 252Cf fission source project (Californium Rare Ion Breeder Upgrade) at Argonne Tandem Linac Accelerator System

    International Nuclear Information System (INIS)

    The construction of the Californium Rare Ion Breeder Upgrade, a new radioactive beam facility for the Argonne Tandem Linac Accelerator System (ATLAS), is nearing completion. The facility will use fission fragments from a 1 Ci 252Cf source; thermalized and collected into a low-energy particle beam by a helium gas catcher. In order to reaccelerate these beams, an existing ATLAS electron cyclotron resonance (ECR) ion source was redesigned to function as an ECR charge breeder. Thus far, the charge breeder has been tested with stable beams of rubidium and cesium achieving charge breeding efficiencies of 9.7% into 85Rb17+ and 2.9% into 133Cs20+.

  5. Ab initio full-potential study of mechanical properties and magnetic phase stability of californium monopnictides (CfN and CfP)

    Science.gov (United States)

    Amari, S.; Bouhafs, B.

    2016-09-01

    Based on the first-principles methods, the structural, elastic, electronic, properties and magnetic ordering of californium monopnictides CfX (X = P) have been studied using the full-potential augmented plane wave plus local orbitals (FP-L/APW + lo) method within the framework of density functional theory (DFT). The electronic exchange correlation energy is described by generalized gradient approximation GGA and GGA+U (U is the Hubbard correction). The GGA+U method is applied to the rare-earth 5f states. We have calculated the lattice parameters, bulk modulii and the first pressure derivatives of the bulk modulii. The elastic properties of the studied compounds are only investigated in the most stable calculated phase. In order to gain further information, we have calculated Young's modulus, shear modulus, anisotropy factor and Kleinman parameter by the aid of the calculated elastic constants. The results mainly show that californium monopnictides CfX (X = P) have an antiferromagnetic spin ordering. Density of states (DOS) and charge densities for both compounds are also computed in the NaCl (B1) structure.

  6. 7 CFR 2.55 - Deputy Under Secretary for Food, Nutrition, and Consumer Services.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Deputy Under Secretary for Food, Nutrition, and Consumer Services. 2.55 Section 2.55 Agriculture Office of the Secretary of Agriculture DELEGATIONS OF AUTHORITY BY THE SECRETARY OF AGRICULTURE AND GENERAL OFFICERS OF THE DEPARTMENT Delegations of Authority by the Under Secretary for Food, Nutrition,...

  7. 38 CFR 17.255 - Applications for grants for programs which include construction projects.

    Science.gov (United States)

    2010-07-01

    ... specifications for the construction project, and where applicable, sufficient explanations of technical... for programs which include construction projects. 17.255 Section 17.255 Pensions, Bonuses, and... Applications for grants for programs which include construction projects. In addition to the documents...

  8. 40 CFR 80.255 - Compliance plans and demonstration of commitment to produce low sulfur gasoline.

    Science.gov (United States)

    2010-07-01

    ... commitment to produce low sulfur gasoline. 80.255 Section 80.255 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Gasoline Sulfur... gasoline. The requirements of this section apply to any refiner approved for small refiner standards...

  9. 20 CFR 255.9 - Individual enrolled under supplementary medical insurance plan.

    Science.gov (United States)

    2010-04-01

    ... XVIII of the Social Security Act (Supplementary Medical Insurance Benefits for the Aged and Disabled... medical insurance plan. 255.9 Section 255.9 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS... supplementary medical insurance plan. Where recovery of the overpayment is by setoff as provided for in §...

  10. Anatomy of a controversy: Application of the Langevin technique to the analysis of the Californium-252 Source-Driven Noise Analysis method for subcriticality determination

    International Nuclear Information System (INIS)

    The expressions for the power spectral density of the noise equivalent sources have been calculated explicitly for the (a) stochastic transport equation, (b) the one-speed transport equaton, (c) the one-speed P1 equations, (d) the one-speed diffusion equation and (e) the point kinetic equation. The stochastic nature of Fick's law in (d) has been emphasized. The Langevin technique has been applied at various levels of approximation to the interpretation of the Californium-252 Source-Driven Noise Analysis (CSDNA) experiment for determining the reactivity in subcritical media. The origin of the controversy surrounding this method has been explained. The foundations of the CSDNA method as a viable experimental technique to infer subcriticality from a measured ratio of power spectral densities of the outputs of two neutron detectors and a third external source detector has been examined by solving the one-speed stochastic diffusion equation for a point external Californium-252 source and two detectors in an infinite medium. The expression relating reactivity to the measured ratio of PSDs was found to depend implicitly on k itself. Through a numerical analysis fo this expression, the authors have demonstrated that for a colinear detector-source-detector configuration for neutron detectors far from the source, the expression for the subcritical multiplication factor becomes essentially insensitive to k, hence, demonstrating some possibility for the viability of this technique. However, under more realistic experimental conditions, i.e., for finite systems in which diffusion theroy is not applicable, the measurement of the subcritical multiplication factor from a single measured ratio of PSDs, without extensive transport calculations, remains doubtful

  11. Application of SCGE assay, classical cytogenetics and FISH for studying in vitro californium-252 neutrons irradiations and BSH pretreatment on human lymphocytes

    International Nuclear Information System (INIS)

    Recently, there has been observed a tendency to apply various energy neutrons for tumor therapy and particularly low energy neutrons from various sources, including californium-252 source, for cancer radiotherapy based on the neutron capture. In this study peripheral blood lymphocytes were used as a model for human cells and three methods were applied to assess the effectiveness of californium-252 neutrons irradiations in vitro in normal cells or pre-treated with compound enriched in B-10 ion. Human blood samples or isolated lymphocytes were irradiated with neutrons from isotopic 252Cf source at the Faculty of Nuclear Physics and Technics at University of Mining and Metallurgy (both neutron source and samples were placed in polyethylene block). Chemical pretreatment with BSH (Na210B12H11SH) was done to introduce boron-10 ion into cells in order to check any enhancement effect due to the process of boron neutron capture. Comet assay was done to investigate the DNA damage. Classical cytogenetics was applied to assess the frequencies of unstable aberrations (dicentrics and rings). Fluorescence in situ hybridization (FISH) with probes for chromosomes 1, 4 (14.3% of whole genome) and pancentromeric probe was performed to evaluate the frequencies of stable aberrations. Linear (or close to linear) increase of DNA damage and aberration frequency was observed with dose of radiation both for lymphocytes untreated or pre-treated with BSH. Very little differences (statistically insignificant) due to radiation dose and BSH pretreatment were observed in the frequencies of SCEs detected in the second mitosis. There is no significant difference between boron pre-treated and not treated cells, and even slightly higher effects were observed in case of the highest dose without BSH pretreatment. The level of translocations observed is comparable with the frequencies of dicentrics and rings. (author)

  12. Californium-252 neutron sources

    International Nuclear Information System (INIS)

    Major production programs for the Savannah River reactors and the High Flux Isotopes Reactor at Oak Ridge have made 252Cf one of the most available and, at the USAEC's sales price of $10/μg, one of the least-expensive isotopic neutron sources. Reactor production has totaled approximately 2 g, and, based on expected demand, an additional 10 g will be produced in the next decade. The approximately 800 mg chemically separated to date has been used to prepare over 600 neutron sources. Most, about 500, have been medical sources containing 1 to 5 μg of 252Cf plated in needles for experimental cancer therapy studies. The remainder have generally been point sources containing 10 μg to 12 mg of oxide for activation, well logging, or radiography uses. Bulk sources have also been supplied to the commercial encapsulators. The latest development has been the production of 252Cf cermet wire which can be cut into almost contamination-free lengths of the desired 252Cf content. Casks are available for transport of sources up to 50 mg. Subcritical assemblies have been developed to multiply the source neutrons by a factor of 10 to 40, and collimators and thermalizers have also been extensively developed to shape the neutron flux and energy distributions for special applications. (U.S.)

  13. Calculations of Nuclear Astrophysics and Californium Fission Neutron Spectrum Averaged Cross Section Uncertainties Using ENDF/B-VII.1, JEFF-3.1.2, JENDL-4.0 and Low-fidelity Covariances

    International Nuclear Information System (INIS)

    Nuclear astrophysics and californium fission neutron spectrum averaged cross sections and their uncertainties for ENDF materials have been calculated. Absolute values were deduced with Maxwellian and Mannhart spectra, while uncertainties are based on ENDF/B-VII.1, JEFF-3.1.2, JENDL-4.0 and Low-Fidelity covariances. These quantities are compared with available data, independent benchmarks, EXFOR library, and analyzed for a wide range of cases. Recommendations for neutron cross section covariances are given and implications are discussed

  14. Oxidation-reduction properties of americium, curium, berkelium, californium, einsteinium and fermium, and thermodynamic consequences for the 5f series

    International Nuclear Information System (INIS)

    The amalgamation of 5f elements from Am to Fm has been studied by using 241Am, 244Cm, 249Bk, 249Cf, 252Cf, 253Es, 254Es, 252Fm and 255Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10-16M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65<=Z<=71 and 97<=Z<=103)

  15. Californium interrogation prompt neutron (CIPN) instrument for non-destructive assay of spent nuclear fuel-Design concept and experimental demonstration

    Science.gov (United States)

    Henzlova, D.; Menlove, H. O.; Rael, C. D.; Trellue, H. R.; Tobin, S. J.; Park, Se-Hwan; Oh, Jong-Myeong; Lee, Seung-Kyu; Ahn, Seong-Kyu; Kwon, In-Chan; Kim, Ho-Dong

    2016-01-01

    This paper presents results of the first experimental demonstration of the Californium Interrogation Prompt Neutron (CIPN) instrument developed within a multi-year effort launched by the Next Generation Safeguards Initiative Spent Fuel Project of the United States Department of Energy. The goals of this project focused on developing viable non-destructive assay techniques with capabilities to improve an independent verification of spent fuel assembly characteristics. For this purpose, the CIPN instrument combines active and passive neutron interrogation, along with passive gamma-ray measurements, to provide three independent observables. This paper describes the initial feasibility demonstration of the CIPN instrument, which involved measurements of four pressurized-water-reactor spent fuel assemblies with different levels of burnup and two initial enrichments. The measurements were performed at the Post-Irradiation Examination Facility at the Korea Atomic Energy Institute in the Republic of Korea. The key aim of the demonstration was to evaluate CIPN instrument performance under realistic deployment conditions, with the focus on a detailed assessment of systematic uncertainties that are best evaluated experimentally. The measurements revealed good positioning reproducibility, as well as a high degree of insensitivity of the CIPN instrument's response to irregularities in a radial burnup profile. Systematic uncertainty of individual CIPN instrument signals due to assembly rotation was found to be orientation in the instrument.

  16. 24 CFR 960.255 - Self-sufficiency incentives-Disallowance of increase in annual income.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Self-sufficiency incentives... and Reexamination § 960.255 Self-sufficiency incentives—Disallowance of increase in annual income. (a... participation in any economic self-sufficiency or other job training program; or (iii) Whose annual...

  17. 21 CFR 111.255 - What is the requirement to establish a batch production record?

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false What is the requirement to establish a batch... System: Requirements for the Batch Production Record § 111.255 What is the requirement to establish a batch production record? (a) You must prepare a batch production record every time you manufacture...

  18. 42 CFR 440.255 - Limited services available to certain aliens.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Limited services available to certain aliens. 440... Limits Applicable to All Services § 440.255 Limited services available to certain aliens. (a) FFP for services. FFP is available for services provided to aliens described in this section which are necessary...

  19. 39 CFR 255.4 - Accessibility to electronic and information technology.

    Science.gov (United States)

    2010-07-01

    ... AND INFORMATION TECHNOLOGY § 255.4 Accessibility to electronic and information technology. (a) In... burden, that the electronic and information technology the agency procures allows— (1) Individuals with... 39 Postal Service 1 2010-07-01 2010-07-01 false Accessibility to electronic and...

  20. 40 CFR 255.33 - Inclusion of Federal facilities and Native American Reservations.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Inclusion of Federal facilities and... Responsibilities of Identified Agencies and Relationship to Other Programs § 255.33 Inclusion of Federal facilities and Native American Reservations. Major Federal facilities and Native American Reservations should...

  1. Biological Efficiency of Californium-252 Source Evaluated by Comet Assay, Classical Cytogenetics and FISH in Human Lymphocytes Irradiated without and with BSH Pretreatment

    International Nuclear Information System (INIS)

    Biological effectiveness of californium-252 source was evaluated after irradiations in vitro of normal or pre-treated with compound enriched in B-10 ion cells. Peripheral blood lymphocytes were used as a model for human cells. DNA and chromosomal damage were studied to compare biological effectiveness of irradiation. Human blood samples or isolated lymphocytes were irradiated with the isotopic source of 252Cf, at the Faculty of Physics and Nuclear Techniques at the University of Mining and Metallurgy (both neutron source and samples were placed in ''infinite'' polyethylene block). Chemical pretreatment with Na210B12H11SH (BSH) was performed to introduce boron-10 ion into cells in order to check any enhancement effect due to the process of boron neutron capture. Single cell gel electrophoresis also known as the Comet assay was done to investigate the DNA damage. Classical cytogenetic analysis was applied to assess the frequencies of unstable aberrations (dicentrics, rings and a centric fragments). To evaluate the frequencies of stable aberrations the fluorescence in situ hybridisation (FISH) with probes for chromosomes 1, 4 (14.3% of the whole genome) was performed. Linear (or close to linear) increase with radiation dose were observed for the DNA damage and aberration frequencies in lymphocytes both untreated or pre-treated with BSH. Levels of translocations evaluated for the whole genome were comparable with the frequencies of dicentrics and rings. No significant differences were detected due to radiation dose in the frequencies of sister chromatid exchanges (SCE) detected in the second mitosis. No statistically significant differences were observed in various biological end-points between normal or boron pre-treated cells. (author)

  2. A Multi-Wavelength High Resolution Study of the S255 Star Forming Region. General structure and kinematics

    CERN Document Server

    Zinchenko, I; Su, Y -N; Kurtz, S; Ojha, D K; Samal, M R; Ghosh, S K

    2012-01-01

    We present observational data for two main components (S255IR and S255N) of the S255 high mass star forming region in continuum and molecular lines obtained at 1.3 mm and 1.1 mm with the SMA, at 1.3 cm with the VLA and at 23 and 50 cm with the GMRT. The angular resolution was from ~ 2" to ~ 5" for all instruments. With the SMA we detected a total of about 50 spectral lines of 20 different molecules (including isotopologues). About half of the lines and half of the species (in particular N2H+, SiO, C34S, DCN, DNC, DCO+, HC3N, H2CO, H2CS, SO2) have not been previously reported in S255IR and partly in S255N at high angular resolution. Our data reveal several new clumps in the S255IR and S255N areas by their millimeter wave continuum emission. Masses of these clumps are estimated at a few solar masses. The line widths greatly exceed expected thermal widths. These clumps have practically no association with NIR or radio continuum sources, implying a very early stage of evolution. At the same time, our SiO data ind...

  3. Study on Thermomagnetic Treatment Fe-25.5Cr-12Co Permanent Magnetic Alloy

    Institute of Scientific and Technical Information of China (English)

    GAO Run-sheng; ZHEN Liang; SHAO Wen-zhu; SUN Xue-yin; ZHU Dan-yang; XU Ren-gen

    2004-01-01

    The magnetic properties and microstructure in a low cobalt Fe-25.5Cr-12Co alloy by different process of thermomagnetic treatment were investigated. It is found that magnetic properties are sensitive to parameters of thermomagnetic treatment process in magnetic field, including temperature, time and applied magnetic field. There are optimized isothermal aging temperature and time in different magnetic heat treatment conditions. High magnetic field strength could improve magnetic properties. Applied magnetic field has a great effect on microstructure of the Fe-25.5Cr-12Co alloy. The finer ferromagnetic α1 particles with suitable c/a ratio by high magnetic field magnetic heat treatment are attributed to improvement the magnetic properties.

  4. A software simulation study of a (255,223) Reed-Solomon encoder-decoder

    Science.gov (United States)

    Pollara, F.

    1985-04-01

    A set of software programs which simulates a (255,223) Reed-Solomon encoder/decoder pair is described. The transform decoder algorithm uses a modified Euclid algorithm, and closely follows the pipeline architecture proposed for the hardware decoder. Uncorrectable error patterns are detected by a simple test, and the inverse transform is computed by a finite field FFT. Numerical examples of the decoder operation are given for some test codewords, with and without errors. The use of the software package is briefly described.

  5. 25.5  fs dissipative soliton diamond Raman laser.

    Science.gov (United States)

    Lin, Jipeng; Spence, David J

    2016-04-15

    We have demonstrated a dissipative soliton diamond Raman laser that generates 25.5 fs pulses. Synchronously pumped by a 128 fs Ti:sapphire laser, the Raman cavity employed a pair of chirped mirrors to optimize the group delay dispersion, resulting in a Stokes field with 125 nm of spectral bandwidth from 840 to 965 nm. The Stokes pulse formation can be described as a dissipative soliton balancing self-phase modulation, normal dispersion, and gain due to stimulated Raman scattering (SRS). PMID:27082364

  6. Forced unbinding of GPR17 ligands from wild type and R255I mutant receptor models through a computational approach

    Directory of Open Access Journals (Sweden)

    Fantucci Piercarlo

    2010-03-01

    Full Text Available Abstract Background GPR17 is a hybrid G-protein-coupled receptor (GPCR activated by two unrelated ligand families, extracellular nucleotides and cysteinyl-leukotrienes (cysteinyl-LTs, and involved in brain damage and repair. Its exploitment as a target for novel neuro-reparative strategies depends on the elucidation of the molecular determinants driving binding of purinergic and leukotrienic ligands. Here, we applied docking and molecular dynamics simulations (MD to analyse the binding and the forced unbinding of two GPR17 ligands (the endogenous purinergic agonist UDP and the leukotriene receptor antagonist pranlukast from both the wild-type (WT receptor and a mutant model, where a basic residue hypothesized to be crucial for nucleotide binding had been mutated (R255I to Ile. Results MD suggested that GPR17 nucleotide binding pocket is enclosed between the helical bundle and extracellular loop (EL 2. The driving interaction involves R255 and the UDP phosphate moiety. To support this hypothesis, steered MD experiments showed that the energy required to unbind UDP is higher for the WT receptor than for R255I. Three potential binding sites for pranlukast where instead found and analysed. In one of its preferential docking conformations, pranlukast tetrazole group is close to R255 and phenyl rings are placed into a subpocket highly conserved among GPCRs. Pulling forces developed to break polar and aromatic interactions of pranlukast were comparable. No differences between the WT receptor and the R255I receptor were found for the unbinding of pranlukast. Conclusions These data thus suggest that, in contrast to which has been hypothesized for nucleotides, the lack of the R255 residue doesn't affect the binding of pranlukast a crucial role for R255 in binding of nucleotides to GPR17. Aromatic interactions are instead likely to play a predominant role in the recognition of pranlukast, suggesting that two different binding subsites are present on GPR17.

  7. Rett syndrome like phenotypes in the R255X Mecp2 mutant mouse are rescued by MECP2 transgene.

    Science.gov (United States)

    Pitcher, Meagan R; Herrera, José A; Buffington, Shelly A; Kochukov, Mikhail Y; Merritt, Jonathan K; Fisher, Amanda R; Schanen, N Carolyn; Costa-Mattioli, Mauro; Neul, Jeffrey L

    2015-05-01

    Rett syndrome (RTT) is a severe neurodevelopmental disorder that is usually caused by mutations in Methyl-CpG-binding Protein 2 (MECP2). Four of the eight common disease causing mutations in MECP2 are nonsense mutations and are responsible for over 35% of all cases of RTT. A strategy to overcome disease-causing nonsense mutations is treatment with nonsense mutation suppressing drugs that allow expression of full-length proteins from mutated genes with premature in-frame stop codons. To determine if this strategy is useful in RTT, we characterized a new mouse model containing a knock-in nonsense mutation (p.R255X) in the Mecp2 locus (Mecp2(R255X)). To determine whether the truncated gene product acts as a dominant negative allele and if RTT-like phenotypes could be rescued by expression of wild-type protein, we genetically introduced an extra copy of MECP2 via an MECP2 transgene. The addition of MECP2 transgene to Mecp2(R255X) mice abolished the phenotypic abnormalities and resulted in near complete rescue. Expression of MECP2 transgene Mecp2(R255X) allele also rescued mTORC1 signaling abnormalities discovered in mice with loss of function and overexpression of Mecp2. Finally, we treated Mecp2(R255X) embryonic fibroblasts with the nonsense mutation suppressing drug gentamicin and we were able to induce expression of full-length MeCP2 from the mutant p.R255X allele. These data provide proof of concept that the p.R255X mutation of MECP2 is amenable to the nonsense suppression therapeutic strategy and provide guidelines for the extent of rescue that can be expected by re-expressing MeCP2 protein. PMID:25634563

  8. The design plan of a VLSI single chip (255, 223) Reed-Solomon decoder

    Science.gov (United States)

    Hsu, I. S.; Shao, H. M.; Deutsch, L. J.

    1987-11-01

    The very large-scale integration (VLSI) architecture of a single chip (255, 223) Reed-Solomon decoder for decoding both errors and erasures is described. A decoding failure detection capability is also included in this system so that the decoder will recognize a failure to decode instead of introducing additional errors. This could happen whenever the received word contains too many errors and erasures for the code to correct. The number of transistors needed to implement this decoder is estimated at about 75,000 if the delay for received message is not included. This is in contrast to the older transform decoding algorithm which needs about 100,000 transistors. However, the transform decoder is simpler in architecture than the time decoder. It is therefore possible to implement a single chip (255, 223) Reed-Solomon decoder with today's VLSI technology. An implementation strategy for the decoder system is presented. This represents the first step in a plan to take advantage of advanced coding techniques to realize a 2.0 dB coding gain for future space missions.

  9. Retrospective Evaluation Of MRI Findings Of Knee Joint In 255 Patients

    Directory of Open Access Journals (Sweden)

    Ahmet Mete

    2003-03-01

    Full Text Available Retrospective evaluation of knee MRI obtained from 255 cases and to demonstrate most common knee joint pathologies in our region.In our study knee joints of 255 cases who admitted to different clinics of our hospital with various complains of knee between October 1996 and December 1998 were examined in wide spectrum with MRI. Via 1.0 Tesla MRI device and special knee coil in sagittal, coronal and axial plains MRI images were obtained. The number of male and female patients were 173 and 82 and their ages were ranged between 14 and 70, and the mean age was 3413.The most common knee pathologies were intra-articular fluid (%58.04, medial (%46,66 and lateral (%12.55 meniscal injuries, anterior cruciate ligament injury (%17.25 and osteoarthritis (%14.9. The other important lesions were degeneration of medial and lateral meniscus, Baker’s cyst, bursitis, posterior cruciate ligament injury , medial and lateral collateral ligament injuries, synovial hypertrophy, chondromalasia of patella, and contusion.In our images of knee the most common lesions were injuries of meniscus and ligament. Because of being noninvasive technique for knee joint pathologies, capacity of multiplanar imaging, high contrast resolution and chance of detailed anatomic evaluation MR imaging was found to be most appropriate imaging technique for knee joint pathologies.

  10. The disk-outflow system in the S255IR area of high mass star formation

    CERN Document Server

    Zinchenko, I; Su, Y -N; Salii, S V; Sobolev, A M; Zemlyanukha, P; Beuther, H; Ojha, D K; Samal, M R; Wang, Y

    2015-01-01

    We report the results of our observations of the S255IR area with the SMA at 1.3 mm in the very extended configuration and at 0.8 mm in the compact configuration as well as with the IRAM-30m at 0.8 mm. The best achieved angular resolution is about 0.4 arcsec. The dust continuum emission and several tens of molecular spectral lines are observed. The majority of the lines is detected only towards the S255IR-SMA1 clump, which represents a rotating structure (probably disk) around the young massive star. The achieved angular resolution is still insufficient for conclusions about Keplerian or non-Keplerian character of the rotation. The temperature of the molecular gas reaches 130-180 K. The size of the clump is about 500 AU. The clump is strongly fragmented as follows from the low beam filling factor. The mass of the hot gas is significantly lower than the mass of the central star. A strong DCN emission near the center of the hot core most probably indicates a presence of a relatively cold ($\\lesssim 80$ K) and r...

  11. Californium Recovery from Palladium Wire

    Energy Technology Data Exchange (ETDEWEB)

    Burns, Jon D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2014-08-01

    The recovery of 252Cf from palladium-252Cf cermet wires was investigated to determine the feasibility of implementing it into the cermet wire production operation at Oak Ridge National Laboratory’s Radiochemical Engineering Development Center. The dissolution of Pd wire in 8 M HNO3 and trace amounts of HCl was studied at both ambient and elevated temperatures. These studies showed that it took days to dissolve the wire at ambient temperature and only 2 hours at 60°C. Adjusting the ratio of the volume of solvent to the mass of the wire segment showed little change in the kinetics of dissolution, which ranged from 0.176 mL/mg down to 0.019 mL/mg. A successful chromatographic separation of 153Gd, a surrogate for 252Cf, from Pd was demonstrated using AG 50x8 cation exchange resin with a bed volume of 0.5 mL and an internal diameter of 0.8 cm.

  12. Development of tilted fibre Bragg gratings using highly coherent 255 nm radiation

    Indian Academy of Sciences (India)

    O Prakash; J Kumar; R Mahakud; U Kumbhkar; S V Nakhe; S K Dixit

    2014-02-01

    This paper reports the study on development of tilted fibre Bragg gratings using highly coherent 255 nm radiation, obtained from the second harmonic generation (SHG) of copper vapour laser (CVL). The transmission and reflection spectra of the tilted fibre Bragg gratings (TFBG) were studied for the tilt angles of 0° (normal FBG), 1°, 3° and 4° between the fibre axis and the interference fringe plane. It was observed that as the angle of fibre axis and phase mask increased, the main Bragg peak shifted towards the higher wavelength and transmission dip decreased. The transmission dip of the cladding mode first increased and then decreased after reaching a maximum with the increase in the tilt angle.

  13. Intraoperative electrocortical stimulation of Brodman area 4: a 10-year analysis of 255 cases

    Directory of Open Access Journals (Sweden)

    Brock Mario

    2006-07-01

    Full Text Available Abstract Background Brain tumor surgery is limited by the risk of postoperative neurological deficits. Intraoperative neurophysiological examination techniques, which are based on the electrical excitability of the human brain cortex, are thus still indispensable for surgery in eloquent areas such as the primary motor cortex (Brodman Area 4. Methods This study analyzed the data obtained from a total of 255 cerebral interventions for lesions with direct contact to (121 or immediately adjacent to (134 Brodman Area 4 in order to optimize stimulation parameters and to search for direct correlation between intraoperative potential changes and specific surgical maneuvers when using monopolar cortex stimulation (MCS for electrocortical mapping and continuous intraoperative neurophysiological monitoring. Results Compound muscle action potentials (CMAPs were recorded from the thenar muscles and forearm flexors in accordance with the large representational area of the hand and forearm in Brodman Area 4. By optimizing the stimulation parameters in two steps (step 1: stimulation frequency and step 2: train sequence MCS was successful in 91% (232/255 of the cases. Statistical analysis of the parameters latency, potential width and amplitude showed spontaneous latency prolongations and abrupt amplitude reductions as a reliable warning signal for direct involvement of the motor cortex or motor pathways. Conclusion MCS must be considered a stimulation technique that enables reliable qualitative analysis of the recorded potentials, which may thus be regarded as directly predictive. Nevertheless, like other intraoperative neurophysiological examination techniques, MCS has technical, anatomical and neurophysiological limitations. A variety of surgical and non-surgical influences can be reason for false positive or false negative measurements.

  14. The functional Thr130Ile and Val255Met polymorphisms of the hepatocyte nuclear factor-4alpha (HNF4A)

    DEFF Research Database (Denmark)

    Ek, Jakob; Rose, Christian Schack; Jensen, Dorit Packert;

    2005-01-01

    HNF4A encodes an orphan nuclear receptor that plays crucial roles in regulating hepatic gluconeogenesis and insulin secretion. The aim of the present study was to examine two rare missense polymorphisms of HNF4A, Thr130Ile and Val255Met, for altered function and for association with type 2 diabetes...

  15. Major complications after radiofrequency ablation for liver tumors: Analysis of 255 patients

    Institute of Scientific and Technical Information of China (English)

    Wen-Tao Kong; Wei-Wei Zhang; Yu-Dong Qiu; Tie Zhou; Jun-Lan Qiu; Wei Zhang; Yi-Tao Ding

    2009-01-01

    AIM: To investigate the major complications after radiofrequency ablation (RFA) for the treatment of liver tumors and analyze possible risk factors that precipitate these complications.METHODS: From March 2001 to April 2008, 255 patients with liver tumors (205 male, 50 female;age range, 18-89 years; mean age, 56.0 years) who received RFA were enrolled in this study. Of these patients, 212 had hepatocellular carcinoma, 39 had metastatic liver tumors and four had cholangiocellular carcinoma. One hundred and forty eight patients had a single tumor, and 107 had multiple tumors. Maximum diameter of the tumors ranged 1.3-20 cm (mean,5.1 cm). All patients were treated with a cooledtip perfusion electrode attached to a radiofrequency generator (Radionics, Burlington, MA, USA). RFA was performed via the percutaneous approach ( n = 257),laparoscopy ( n = 7), or open surgical treatment ( n = 86). The major complications related to RFA were recorded. The resultant data were analyzed to determine risk factors associated these complications.RESULTS: Among the 255 patients, 425 liver tumors were treated and 350 RFA sessions were performed.Thirty-seven (10%) major complications were observed which included 13 cases of liver failure, 10 cases of hydrothorax requiring drainage, three cases of tumor seeding, one case of upper gastrointestinal bleeding, one case of intrahepatic abscess, one case of bile duct injury, one case of cardiac arrest, and five cases of hyperglycemia. Seven patients had more than two complications. Liver failure was the most severe complication and was associated with the highest mortality. Eleven patients died due to worsening liver decompensation. Child-Pugh classification ( P = 0.001)and choice of approach ( P = 0.045) were related to post-treatment liver failure, whereas patient age,tumor size and number were not significant factors precipitating this complication.CONCLUSION: RFA can be accepted as a relatively safe procedure for the treatment of liver

  16. Sejong open cluster survey (SOS) - V. The active star forming region Sh 2-255 -- 257

    CERN Document Server

    Lim, Beomdu; Hur, Hyeonoh; Lee, Byeong-Cheol; Bessell, Michael S; Kim, Jinyoung S; Lee, Kang Hwan; Park, Byeong-Gon; Jeong, Gwanghui

    2015-01-01

    There is much observational evidence that active star formation is taking place in the HII regions Sh 2-255 -- 257. We present a photometric study of this star forming region (SFR) using imaging data obtained in passbands from the optical to the mid-infrared in order to study the star formation process. A total of 218 members were identified using various selection criteria based on their observational properties. The SFR is reddened by at least E(B-V) = 0.8 mag, and the reddening law toward the region is normal (R_V = 3.1). From the zero-age main sequence fitting method it is confirmed that the SFR is 2.1 +/- 0.3 kpc from the Sun. The median age of the identified members is estimated to be about 1.3 Myr from comparison of the Hertzsprung-Russell diagram (HRD) with stellar evolutionary models. The initial mass function (IMF) is derived from the HRD and the near-infrared (J, J-H) color-magnitude diagram. The slope of the IMF is about Gamma = -1.6 +/- 0.1, which is slightly steeper than that of the Salpeter/Kro...

  17. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252; Diseno de un reactor nuclear subcritico homogeneo a base de Torio con una fuente de Californio 252

    Energy Technology Data Exchange (ETDEWEB)

    Delgado H, C. E.; Vega C, H. R. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Sajo B, L., E-mail: ce_delgado89@hotmail.com [Universidad Simon Bolivar, Laboratorio de Fisica Nuclear, Apdo. 89000, 1080A Caracas (Venezuela, Bolivarian Republic of)

    2015-10-15

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U{sup 233} when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO{sub 2}(NO{sub 3}){sub 4} and 18% of thorium Th(NO{sub 3}){sub 4} as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 10{sup 7} s{sup -1}. In the design the value of the effective multiplication factor, whose value turned out k{sub eff} <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  18. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source; Determinacao de manganes em minerios, por analise por ativacao, usando californio-252 como fonte de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Antonio

    1976-07-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  19. Luminosity functions of YSO clusters in Sh-2 255, W3 Main and NGC 7538 star forming regions

    Science.gov (United States)

    Ojha, Devendra; Tamura, Motohide

    We have conducted deep near-infrared surveys of the Sh-2 255, W3 Main and NGC 7538 massive star forming regions using simultaneous observations of the JHKs-band with the near-infrared camera SIRIUS on the UH 88-inch telescope and with SUBARU. The near-infrared surveys cover a total area of ~72 square arcmin of three regions with 10-sigma limiting magnitudes of ~19.5, 18.4 and 17.3 in J, H and Ks-band, respectively. Based on the color-color and color-magnitude diagrams and their clustering properties, the candidate young stellar objects are identified and their luminosity functions are constructed in Sh-2 255, W3 Main and NGC 7538. A large number of previously unreported red sources (H-K > 2) have also been detected around these regions. We argue that these red stars are most probably pre-main sequence stars with intrinsic color excesses. The detected young stellar objects show a clear clustering pattern in each region: the Class I-like sources are mostly clustered in molecular cloud region, while the Class II-like sources in or around more evolved optical HII regions. We find that the slopes of the Ks-band luminosity functions of Sh-2 255, W3 Main and NGC 7538 are lower than the typical values reported for the young embedded clusters and their stellar populations are primarily composed of low mass pre-main sequence stars. From the slopes of the Ks-band luminosity functions, we infer that Sh-2 255, W3 Main and NGC 7538 star forming regions are rather young (age <=1 Myr).

  20. The nuclear matrix phosphoprotein p255 associates with splicing complexes as part of the [U4/U6.U5] tri-snRNP particle.

    OpenAIRE

    Chabot, B.; Bisotto, S; Vincent, M.

    1995-01-01

    The monoclonal antibody CC3 recognizes a phosphorylated epitope present on an interphase protein of 255 kDa. Previous work has shown that p255 is localized mainly to nuclear speckles and remains associated with the nuclear matrix scaffold following extraction with non-ionic detergents, nucleases and high salt. The association of p255 with splicing complexes is suggested by the finding that mAb CC3 can inhibit in vitro splicing and immunoprecipitate pre-messenger RNA and splicing products. Sma...

  1. Commission on the Advancement of Women and Minorities in Science, Engineering, and Technology Development Act. Public Law 105-255. 105th Congress.

    Science.gov (United States)

    Congress of the U.S., Washington, DC. House.

    This Public Law (PL-105-255) lays out the reasons for establishing the Commission; the duties of the Commission; membership, directorship, and powers of the commission; and expectations for the Commission's report. (WRM)

  2. Pharmacodynamic and Efficacy Profile of TGN 255, a Novel Direct Thrombin Inhibitor, in Canine Cardiopulmonary Bypass and Simulated Mitral Valve Repair

    OpenAIRE

    Nelson, David A.; Nelson, Katherine T.; Miller, Matthew W.; Dupe, Robert; Chahwala, Suresh B.; Kennedy, Anthony; Chander, Chaman; Fossum, Theresa W.

    2008-01-01

    Heparin-induced thrombocytopenia can be a life-threatening sequel to conventional use of unfractionated heparin in cardiopulmonary bypass (CPB). This study evaluated the pharmacokinetic/pharmacodynamic (PK/PD) and efficacy profile of a novel direct thrombin inhibitor, TGN 255, during cardiac surgery in dogs. Point-of-care coagulation monitoring was also compared against the plasma concentrations of TRI 50c, the active metabolite of TGN 255. The study was conducted in three phases using 10 ani...

  3. SUPERMODEL ANALYSIS OF A1246 AND J255: ON THE EVOLUTION OF GALAXY CLUSTERS FROM HIGH TO LOW ENTROPY STATES

    Energy Technology Data Exchange (ETDEWEB)

    Fusco-Femiano, R. [IAPS-INAF, Via Fosso del Cavaliere, I-00133 Roma (Italy); Lapi, A., E-mail: roberto.fuscofemiano@iaps.inaf.it [Dip. Fisica, Univ. " Tor Vergata" , Via Ricerca Scientifica 1, I-00133 Roma (Italy)

    2015-02-10

    We present an analysis of high-quality X-ray data out to the virial radius for the two galaxy clusters A1246 and GMBCG J255.34805+64.23661 (J255) by means of our entropy-based SuperModel. For A1246 we find that the spherically averaged entropy profile of the intracluster medium (ICM) progressively flattens outward, and that a nonthermal pressure component amounting to ≈20% of the total is required to support hydrostatic equilibrium in the outskirts; there we also estimate a modest value C ≈ 1.6 of the ICM clumping factor. These findings agree with previous analyses on other cool-core, relaxed clusters, and lend further support to the picture by Lapi et al. that relates the entropy flattening, the development of the nonthermal pressure component, and the azimuthal variation of ICM properties to weakening boundary shocks. In this scenario clusters are born in a high-entropy state throughout, and are expected to develop on similar timescales a low-entropy state both at the center due to cooling, and in the outskirts due to weakening shocks. However, the analysis of J255 testifies how such a typical evolutionary course can be interrupted or even reversed by merging especially at intermediate redshift, as predicted by Cavaliere et al. In fact, a merger has rejuvenated the ICM of this cluster at z ≈ 0.45 by reestablishing a high-entropy state in the outskirts, while leaving intact or erasing only partially the low-entropy, cool core at the center.

  4. G25.5 + 0.2: a very young supernova remnant or a galactic planetary nebula?

    International Nuclear Information System (INIS)

    G25.5 + 0.2, a radio source suggested by previous authors to be a very young galactic supernova remnant, is more likely to be a planetary nebula. Its IRAS colours and fluxes and its radio spectrum and morphology are all consistent with the properties of planetary nebulae; its radio flux and distance imply a large mass of ionized gas, which is expected from a Type I planetary nebula lying in the galactic plane. We suggest some definitive observations which should be able to determine whether this interesting object is a planetary nebula or a supernova remnant. (author)

  5. PRODUCT IRON-BEARING CONTROL TECHNOLOGY AND MEASURES FOR 25.5 MVA INDUSTRIAL SILICON FURNACE%25.5 MVA工业硅炉产品含铁量控制工艺及措施

    Institute of Scientific and Technical Information of China (English)

    赵兴凡; 周杰; 王子龙; 卢国洪

    2015-01-01

    In order to effectively control industrial silicon product iron-bearing, it analyzes and elaborates iron-bearing resource for 25.5 MVA industrial silicon furnace. It makes process treatment from raw materials, operation and products, obtaining the key factors affected the products’ quality. At the same time, it puts forward research area and prospect for future improvement on industrial silicon products.%为了有效控制工业硅产品的铁含量,分析和阐述了25.5 MVA工业硅炉产品中铁元素的来源,对其主要生产原料、生产操作工艺及产品进行了技术工艺处理,找出了影响产品质量的关键因素,同时也对未来工业硅产品质量技术的提升提出了一些研究方向和展望。

  6. Efficient program for decoding the /255, 223/ Reed-Solomon code over GF/2 to the 8th/ with both errors and erasures, using transform decoding

    Science.gov (United States)

    Miller, R. L.; Truong, T. K.; Reed, I. S.

    1980-07-01

    The paper deals with a method developed for decoding a (255, 223) Reed-Solomon code over GF(2 to the 8th) with both errors and erasures. The matrix of decoding times for correcting errors and erasures of the code using a simplified decoder is presented. It is shown that the algorithm proposed is faster by a factor of from three to seven.

  7. UV LED charge control of an electrically isolated proof mass in a Gravitational Reference Sensor configuration at 255 nm

    CERN Document Server

    Balakrishnan, Karthik; Alfauwaz, Abdul; Aljadaan, Ahmad; Almajeed, Mohammed; Alrufaydah, Muflih; Althubiti, Salman; Aljabreen, Homoud; Buchman, Sasha; Byer, Robert L; Conklin, John; DeBra, Daniel; Hanson, John; Hultgren, Eric; Saud, Turki Al; Shimizu, Seiya; Soulage, Michael; Zoellner, Andreas

    2012-01-01

    Precise control over the potential of an electrically isolated proof mass is necessary for the operation of devices such as a Gravitational Reference Sensor (GRS) and satellite missions such as LISA. We show that AlGaN UV LEDs operating at 255 nm are an effective substitute for Mercury vapor lamps used in previous missions because of their ability to withstand space qualification levels of vibration and thermal cycling. After 27 thermal and thermal vacuum cycles and 9 minutes of 14.07 g RMS vibration, there is less than 3% change in current draw, less than 15% change in optical power, and no change in spectral peak or FWHM (full width at half maximum). We also demonstrate UV LED stimulated photoemission from a wide variety of thin film carbide proof mass coating candidates (SiC, Mo2C, TaC, TiC, ZrC) that were applied using electron beam evaporation on an Aluminum 6061-T6 substrate. All tested carbide films have measured quantum efficiencies of 3.8-6.8*10^-7 and reflectivities of 0.11-0.15, which compare favor...

  8. High-average-power (15-W) 255-nm source based on second-harmonic generation of a copper laser master oscillator power amplifier system in cesium lithium borate

    Science.gov (United States)

    Brown, Daniel J. W.; Withford, Michael J.

    2001-12-01

    We have generated 15 W of UV (255-nm) radiation with an optical conversion efficiency of 28% by frequency doubling the 510.6-nm output of a high-beam-quality, high-power copper laser system in cesium borate lithium (CLBO). We found that the superior performance of CLBO relative to β-barium borate is attributable largely to the small UV absorption and wide temperature acceptance bandwidth of CLBO, which reduces thermal dephasing during high-power UV generation.

  9. Chemical, optical and other data collected aboard the THOMAS G. THOMPSON during cruise TN255 in the Coastal Waters of SE Alaska and North Pacific Ocean from 2010-10-16 to 2010-10-20 (NCEI Accession 0104360)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0104360 includes chemical, optical and other data collected aboard the THOMAS G. THOMPSON during cruise TN255 in the Coastal Waters of SE Alaska and...

  10. Quasielastic pion scattering near the (3,3) resonance. [255 MeV, differential cross section ratio

    Energy Technology Data Exchange (ETDEWEB)

    Varghese, P.

    1978-12-01

    The quasielastic pion scattering process (..pi..,..pi..p), in which an energetic pion scatters off a target nucleus, knocking-out a bound proton, was studied to determine the role of recoil nucleon charge exchange in the mechanism of the process near the (3,3) free particle pion-nucleon resonance. Calculations, which incorporate the hypothesis of final state charge exchange of the outgoing nucleon, were performed to predict expectations for observing the process. Experimental measurements were made on /sup 27/Al and /sup 208/Pb, using 255-MeV ..pi../sup +/ and ..pi../sup -/ beams. The outgoing protons were observed in a counter telescope in singles and coincidence modes. Singles spectra were measured at proton angles theta/sub rho/ = 45, 55, 64, and 90/sup 0/ and cross sections were calculated as a function of the energy of the detected proton, for each of the targets. Values of the ratio of ..pi../sup +/ to ..pi../sup -/ cross sections were calculated for each of the angles of observation. The results obtained indicate that the singles spectra contain events from processes other than quasielastic scattering and that the quasielastic events cannot be easily disentangled from the large background due to such events. The study has thus established the inadequacy of observing quasielastic pion scattering in a single arm measurement. Coincidence measurements were made by observing the recoil protons in coincidence with the scattered pions, which were detected in a scintillator counter telescope. The ratio of ..pi../sup +/ to ..pi../sup -/ cross sections were obtained for each target for the angular settings (theta/sub rho/, theta/sub ..pi../) = (55, 50/sup 0/) and (64, 37.5/sup 0/). The measured values of 7.0 +- 0.7 for /sup 27/Al and 4.5 +- 0.5 for /sup 208/Pb are substantially below the impulse approximation no-charge-exchange limit of 9. The observed A dependence of this cross section ratio is in agreement with the predictions of the semiclassical charge exchange

  11. 4.7-W, 255-nm source based on second-harmonic generation of a copper-vapor laser in cesium lithium borate.

    Science.gov (United States)

    Trickett, R I; Withford, M J; Brown, D J

    1998-02-01

    We have generated 4.7 W of UV (255-nm) radiation with wall plug efficiency of 0.12% by frequency doubling the green (511-nm) output of a kinetically enhanced medium-scale copper-vapor laser (CVL) in cesium lithium borate (CLBO). Frequency doubling in beta -barium borate produced 3.9 W of UV radiation with wall plug efficiency of 0.1%. We found that conversion was better with CLBO because of the reduced constraints on CVL beam quality, less UV absorption, and smaller UV walk-off. PMID:18084455

  12. Inactivation of a 25.5 µm Enterococcus faecalis biofilm by a room-temperature, battery-operated, handheld air plasma jet

    International Nuclear Information System (INIS)

    Effective biofilm inactivation using a handheld, mobile plasma jet powered by a 12 V dc battery and operated in open air without any external gas supply is reported. This cold, room-temperature plasma is produced in self-repetitive nanosecond discharges with current pulses of ∼100 ns duration, current peak amplitude of ∼6 mA and repetition rate of ∼20 kHz. It is shown that the reactive plasma species penetrate to the bottom layer of a 25.5 µm-thick Enterococcus faecalis biofilm and produce a strong bactericidal effect. This is the thickest reported biofilm inactivated using room-temperature air plasmas. (paper)

  13. Tachyzoites of Toxoplasma gondii irradiated with 255 Gy induces decrease of cysts and cerebral lesions in mice challenged with cysts of ME-49

    International Nuclear Information System (INIS)

    Toxoplasmosis can cause ocular lesions in normal individuals and several diseases in foetus, HIV infection and transplants. Toxoplasma gondii has a complex life cycle, involving cats, as the definitive host, and warm blood species, as intermediated hosts. The infection occurs by ingestion of food and water contaminated with infected cat faeces, contaminated milk and cheese or raw and undercook meat of the intermediated hosts. To date, there is no commercial vaccine of use in humans. In this work, tachyzoites of T. gondii RH strain were irradiated with 255 Gy and inoculated in C57Bl/6j mice (3 doses, biweekly), after mice were challenged with 1, 5, 10, 20 and 25 cysts of ME-49 by oral gavage. The lesions and cysts in the brain were analyzed in all mice, after 4-week post infection. The mortality was 20% in control mice (ME-49 cysts only) and not one in immunized mice. The number of cysts was high in the control group, but low in immunized 255 Gy mice (n<100). Immunized mice showed less cerebral pathology and necrosis foci. Ionizing radiation is an important tool in the study toxoplasmosis and vaccine development. (author)

  14. Frequency of primary uterine malignancy in hystrectomy specimens of postmenopausal women - a study of 255 cases at combined military hospital peshawar

    International Nuclear Information System (INIS)

    Objective: To determine the frequency of primary uterine malignancy in hysterectomy specimens in women with postmenopausal bleeding. Study Design: A descriptive cross-sectional study. Place and Duration of study: It was conducted in the department of histopathology at Combined Military Hospital, Peshawar from 1st September 2010 to 31st May 2011. Material and Methods: A total of 255 hysterectomy specimens of postmenopausal women were examined grossly and microscopically to analyse the underlying pathology. Results: The mean age of patients with malignant diseases was 56.4 years and with benign diseases 49.3 years. Out of 255 patients 215 (95.6%) were found to have benign pathologies and 10 (4.4%) had malignant lesions. The frequency and histological pattern of primary uterine malignancy was; endometrial carcinoma 3.1%, cervical carcinoma 0.9% and leiomyosarcoma 0.4%. The benign pathologies included leiomyoma 35.6%, atrophic endometritis 16.4%, endometrial hyperplasia 15.1%, adenomysis 11.1%, endometrial polyp 10.2%, adenomyoma 6.7% and endometrial stromal nodule 0.4%. Conclusion: This study shows that frequency of malignancy in postmenopausal women is low in our set up and most of the underlying pathologies are benign. The most frequent malignancy found in postmenopausal women is endometrial carcinoma followed by cervical carcinoma. (author)

  15. FPGA Implementation of A New Chien Search Block for Reed-Solomon Codes RS (255, 239 Used In Digital Video Broadcasting DVB-T

    Directory of Open Access Journals (Sweden)

    El Habti El Idrissi Anas

    2014-08-01

    Full Text Available The Reed-Solomon codes RS are widely used in communication systems, in particular forming part of the specification for the ETSI digital terrestrial television standard. In this paper a simple algorithm for error detection in the Chien Search block is proposed. This algorithm is based on a simple factorization of the error locator polynomial, which allows reducing the number of components required to implement the proposed algorithm on FPGA board. Consequently, it reduces the power consumption with a percentage which can reach 50 % compared to the basic RS decoder. First, we developed the design of Chien Search Block Second, we generated and simulated the hardware description language source code using Quartus software tools,finally we implemented the proposed algorithm of Chien search block for Reed-Solomon codesRS (255, 239 on FPGA board to show both the reduced hardware resources and low complexity compared to the basic algorithm.

  16. A low power 2.5-5 GHz low-noise amplifier using 0.5-μm GaAs pHEMT technology

    International Nuclear Information System (INIS)

    A two-stage 2.5-5 GHz monolithic low-noise amplifier (LNA) has been fabricated using 0.5-μm enhanced mode AlGaAs/GaAs pHEMT technology. To achieve wide operation bandwidth and low noise figure, the proposed LNA uses a wideband matching network and a negative feedback technique. Measured results from 2.5 to 5 GHz demonstrate a minimum of 2.4-dB noise figure and 17-dB gain. The input and output return loss exceeded −10-dB across the band. The power consumption of this LNA is 33 mW. According to the author's knowledge, this is the lowest power consumption LNA fabricated in 0.5-μm AlGaAs/GaAs pHEMT with the comparable performance.

  17. A low power 2.5-5 GHz low-noise amplifier using 0.5-μm GaAs pHEMT technology

    Institute of Scientific and Technical Information of China (English)

    Peng Yangyang; Lu Kejie; Sui Wenquan

    2012-01-01

    A two-stage 2.5-5 GHz monolithic low-noise amplifier (LNA) has been fabricated using 0.5-μm enhanced mode AlGaAs/GaAs pHEMT technology.To achieve wide operation bandwidth and low noise figure,the proposed LNA uses a wideband matching network and a negative feedback technique.Measured results from 2.5 to 5 GHz demonstrate a minimum of 2.4-dB noise figure and 17-dB gain.The input and output return loss exceeded-10-dB across the band.The Power consumption of this LNA is 33 mW.According to the author's knowledge,this is the lowest power consumption LNA fabricated in 0.5-μm A1GaAs/GaAs pHEMT with the comparable performance.

  18. Dosimetry for small fields in stereotactic radiosurgery using gafchromic MD-V2-55 film, TLD-100 and alanine dosimeters.

    Directory of Open Access Journals (Sweden)

    Guerda Massillon-J L

    Full Text Available This work investigated the suitability of passive dosimeters for reference dosimetry in small fields with acceptable accuracy. Absorbed dose to water rate was determined in nine small radiation fields with diameters between 4 and 35 mm in a Leksell Gamma Knife (LGK and a modified linear accelerator (linac for stereotactic radiosurgery treatments. Measurements were made using Gafchromic film (MD-V2-55, alanine and thermoluminescent (TLD-100 dosimeters and compared with conventional dosimetry systems. Detectors were calibrated in terms of absorbed dose to water in (60Co gamma-ray and 6 MV x-ray reference (10×10 cm(2 fields using an ionization chamber calibrated at a standards laboratory. Absorbed dose to water rate computed with MD-V2-55 was higher than that obtained with the others dosimeters, possibly due to a smaller volume averaging effect. Ratio between the dose-rates determined with each dosimeter and those obtained with the film was evaluated for both treatment modalities. For the LGK, the ratio decreased as the dosimeter size increased and remained constant for collimator diameters larger than 8 mm. The same behaviour was observed for the linac and the ratio increased with field size, independent of the dosimeter used. These behaviours could be explained as an averaging volume effect due to dose gradient and lack of electronic equilibrium. Evaluation of the output factors for the LGK collimators indicated that, even when agreement was observed between Monte Carlo simulation and measurements with different dosimeters, this does not warrant that the absorbed dose to water rate in the field was properly known and thus, investigation of the reference dosimetry should be an important issue. These results indicated that alanine dosimeter provides a high degree of accuracy but cannot be used in fields smaller than 20 mm diameter. Gafchromic film can be considered as a suitable methodology for reference dosimetry. TLD dosimeters are not

  19. Tachyzoites of Toxoplasma gondii irradiated with 255 Gy induces decrease of cysts and cerebral lesions in mice challenged with cysts of ME-49; Taquizoitos de Toxoplasma gondii irradiados com 255 Gy induzem diminuicao de cistos e lesoes cerebrais em camundongos desafiados com cistos da cepa ME-49

    Energy Technology Data Exchange (ETDEWEB)

    Hiramoto, Roberto Mitsuyoshi; Galisteo Juniorm Andres Jimenez; Nascimento, Nanci do; Andrade Junior, Heitor Franco de [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil). Lab. de Biologia Molecular]. E-mail: rmhiramoto@bol.com.br; hfandrad@usp.br

    2002-07-01

    Toxoplasmosis can cause ocular lesions in normal individuals and several diseases in foetus, HIV infection and transplants. Toxoplasma gondii has a complex life cycle, involving cats, as the definitive host, and warm blood species, as intermediated hosts. The infection occurs by ingestion of food and water contaminated with infected cat faeces, contaminated milk and cheese or raw and undercook meat of the intermediated hosts. To date, there is no commercial vaccine of use in humans. In this work, tachyzoites of T. gondii RH strain were irradiated with 255 Gy and inoculated in C57Bl/6j mice (3 doses, biweekly), after mice were challenged with 1, 5, 10, 20 and 25 cysts of ME-49 by oral gavage. The lesions and cysts in the brain were analyzed in all mice, after 4-week post infection. The mortality was 20% in control mice (ME-49 cysts only) and not one in immunized mice. The number of cysts was high in the control group, but low in immunized 255 Gy mice (n<100). Immunized mice showed less cerebral pathology and necrosis foci. Ionizing radiation is an important tool in the study toxoplasmosis and vaccine development. (author)

  20. Intermetallic Reactions during the Solid-Liquid Interdiffusion Bonding of Bi2Te2.55Se0.45 Thermoelectric Material with Cu Electrodes Using a Sn Interlayer

    Directory of Open Access Journals (Sweden)

    Chien-Hsun Chuang

    2016-04-01

    Full Text Available The intermetallic compounds formed during the diffusion soldering of a Bi2Te2.55Se0.45 thermoelectric material with a Cu electrode are investigated. For this bonding process, Bi2Te2.55Se0.45 was pre-coated with a 1 μm Sn thin film on the thermoelectric element and pre-heated at 250 °C for 3 min before being electroplated with a Ni barrier layer and a Ag reaction layer. The pre-treated thermoelectric element was bonded with a Ag-coated Cu electrode using a 4 μm Sn interlayer at temperatures between 250 and 325 °C. The results indicated that a multi-layer of Bi–Te–Se/Sn–Te–Se–Bi/Ni3Sn4 phases formed at the Bi2Te2.55Se0.45/Ni interface, ensuring sound cohesion between the Bi2Te2.55Se0.45 thermoelectric material and Ni barrier. The molten Sn interlayer reacted rapidly with both Ag reaction layers to form an Ag3Sn intermetallic layer until it was completely exhausted and the Ag/Sn/Ag sandwich transformed into a Ag/Ag3Sn/Ag joint. Satisfactory shear strengths ranging from 19.3 and 21.8 MPa were achieved in Bi2Te2.55Se0.45/Cu joints bonded at 250 to 300 °C for 5 to 30 min, dropping to values of about 11 MPa for 60 min, bonding at 275 and 300 °C. In addition, poor strengths of about 7 MPa resulted from bonding at a higher temperature of 325 °C for 5 to 60 min.

  1. HPV Prevalence and Prognostic Value in a Prospective Cohort of 255 Patients with Locally Advanced HNSCC: A Single-Centre Experience

    Directory of Open Access Journals (Sweden)

    E. Thibaudeau

    2013-01-01

    Full Text Available Background. HPV is a positive prognostic factor in HNSCC. We studied the prevalence and prognostic impact of HPV on survival parameters and treatment toxicity in patients with locally advanced HNSCC treated with concomitant chemoradiation therapy. Methods. Data on efficacy and toxicity were available for 560 patients. HPV was detected by PCR. Analysis was performed using Kaplan-Meier survival curves, Fisher’s test for categorical data, and log-rank statistics for failure times. Results. Median follow-up was 4.7 years. DNA extraction was successful in 255 cases. HPV prevalence was 68.6%, and 53.3% for HPV 16. For HPV+ and HPV−, median LRC was 8.9 and 2.2 years (P=0.0002, median DFS was 8.9 and 2.1 years (P=0.0014, and median OS was 8.9 and 3.1 years (P=0.0002. Survival was different based on HPV genotype, stage, treatment period, and chemotherapy regimen. COX adjusted analysis for T, N, age, and treatment remained significant (P=0.004. Conclusions. Oropharyngeal cancer is increasingly linked to HPV. This study confirms that HPV status is associated with improved prognosis among H&N cancer patients receiving CRT and should be a stratification factor for clinical trials including H&N cases. Toxicity of CRT is not modified for the HPV population.

  2. Self-Expanding Metal Stenting for Palliation of Patients with Malignant Colonic Obstruction: Effectiveness and Efficacy on 255 Patients with 12-Month's Follow-up

    Science.gov (United States)

    Meisner, Søren; González-Huix, Ferran; Vandervoort, Jo G.; Repici, Alessandro; Xinopoulos, Dimitrios; Grund, Karl E.; Goldberg, Paul; Registry Group, The WallFlex Colonic

    2012-01-01

    Background. Self-expanding metal stents can alleviate malignant colonic obstruction in incurable patients and avoid palliative stoma surgery. Objective. Evaluate stent effectiveness and safety on palliation of patients with malignant colorectal strictures. Design. Two prospective, one Spanish and one global, multicenter studies. Settings. 39 centers (22 academic, 17 community hospitals) from 13 countries. Patients. A total of 257 patients were enrolled, and 255 patients were treated with a WallFlex uncovered enteral colonic stent. Follow-up was up to 12 months or until death or retreatment. Interventions(s). Self-expanding metal stent placement. Main Outcome Measures. Procedural success, clinical success, and safety. Results. Procedural success was 98.4% (251). Clinical success rates were 87.8% at 30 days, 89.7% at 3 months, 92.8% at 6 months, and 96% at 12 months. Overall perforation rate was 5.1%. Overall migration rate was 5.5%. Overall death rate during follow-up was 48.6% (124), with 67.7% of deaths related to the patient's colorectal cancer, unrelated in 32.3%. Only 2 deaths were related to the stent or procedure. Limitations. No control group. Conclusions. The primary palliative option for patients with malignant colonic obstruction should be self-expanding metal stent placement due to high rates of technical success and efficacy in symptom palliation and few complications. PMID:22761609

  3. 255Gy irradiated tachyzoites of Toxoplasma gondii induce intestinal immune response in C57BL/6J immunized by oral route

    International Nuclear Information System (INIS)

    Toxoplasmosis, a prevalent widespread infection in man and animals, occurs mainly through ingestion of water and food contaminated with oocyst from cat feces, causing usually benign disease in humans, except in intrauterine fetal infection or in immunodeficient patients. We study the oral route for the development of a vaccine for toxoplasmosis, using parasites irradiated with 60 Cobalt, as an alternative for vaccine development to this worldwide parasitic infection. We evaluated the development of immunity at serum or mucosal levels, and their efficiency in protect the mice against challenge with oral cysts of the ME-49 strain. C57Bl/6j isogenic mice were immunized by oral route with 107 255 Gy irradiated tachyzoites from RH strain, at several protocols using milk as anti-peptic adjuvant and alum hydroxide as antacid. The preparations of irradiated tachyzoites induced production of serum IgG and IgA in immunized mice, as determined by ELISA, with IgG2a as the dominant subclass, similar to chronic infection. Their use with adjuvant allowed the excretion of significant amounts of IgA in stools also IgG, despite a lesser extent. All oral preparations induced some quantitative protection against challenge, which was similar to the parenteral route only isolated alum hydroxide was used as adjuvant. All these data support the possibility of the development of an oral vaccine against toxoplasmosis, using irradiated tachyzoites, which would be possible tool in near future for use in field baits, for immunizing either domestic or wild felids. (author)

  4. Self-Expanding Metal Stenting for Palliation of Patients with Malignant Colonic Obstruction: Effectiveness and Efficacy on 255 Patients with 12-Month's Follow-up

    Directory of Open Access Journals (Sweden)

    Søren Meisner

    2012-01-01

    Full Text Available Background. Self-expanding metal stents can alleviate malignant colonic obstruction in incurable patients and avoid palliative stoma surgery. Objective. Evaluate stent effectiveness and safety on palliation of patients with malignant colorectal strictures. Design. Two prospective, one Spanish and one global, multicenter studies. Settings. 39 centers (22 academic, 17 community hospitals from 13 countries. Patients. A total of 257 patients were enrolled, and 255 patients were treated with a WallFlex uncovered enteral colonic stent. Follow-up was up to 12 months or until death or retreatment. Interventions(s. Self-expanding metal stent placement. Main Outcome Measures. Procedural success, clinical success, and safety. Results. Procedural success was 98.4% (251. Clinical success rates were 87.8% at 30 days, 89.7% at 3 months, 92.8% at 6 months, and 96% at 12 months. Overall perforation rate was 5.1%. Overall migration rate was 5.5%. Overall death rate during follow-up was 48.6% (124, with 67.7% of deaths related to the patient’s colorectal cancer, unrelated in 32.3%. Only 2 deaths were related to the stent or procedure. Limitations. No control group. Conclusions. The primary palliative option for patients with malignant colonic obstruction should be self-expanding metal stent placement due to high rates of technical success and efficacy in symptom palliation and few complications.

  5. Predictions on the alpha decay half lives of Superheavy nuclei with Z = 113 in the range 255 l.e. A l.e. 314

    CERN Document Server

    Santhosh, K P; Nithya, C; Priyanka, B

    2016-01-01

    An intense study of the alpha decay properties of the isotopes of superheavy element Z=113 have been performed within the Coulomb and proximity potential model for deformed nuclei (CPPMDN) within the wide range 255 l.e. A l.e. 314. The predicted alpha decay half lives of $^{278}$113 and $^{282}$113 and the alpha half lives of their decay products are in good agreement with the experimental data. 6{\\alpha) chains and 4{\\alpha} chains predicted respectively for $^{278}$113 and $^{282}$113 are in agreement with the experimental observation. Our study shows that the isotopes in the mass range 278 l.e. A l.e. 286 will survive fission and can be synthesized and detected in the laboratory via alpha decay. In our study, we have predicted 6{\\alpha} chains from $^{279}$113, 4{\\alpha} chains from $^{286}$113, 3{\\alpha} chains from $^{280,281,283}$113, 2{\\alpha} chains from $^{284}$113 and 1{\\alpha} chain from $^{285}$113. We hope that these predictions will be a guideline for future experimental investigations.

  6. The effect of pH on the glucose response of the glucose-galactose binding protein L255C labeled with Acrylodan.

    Science.gov (United States)

    El-Sayed, Mayyada M H; Brown, Sheniqua R; Mupparapu, KarunaSri; Tolosa, Leah

    2016-05-01

    The glucose-galactose binding protein (GGBP) is used as an optical biosensor in medical and bioprocess applications. This paper investigates the effect of pH on the behavior of GGBP-L255C labeled with Acrylodan for the purpose of finding the optimum conditions for sensing purposes as well as for protein preparation, purification and storage. The Acrylodan-GGBP fluorescence response in absence and presence of glucose was measured under varying buffer and pH conditions. Dissociation constants (Kd) and Gibbs free energies (ΔG) for the protein-glucose binding were calculated. Binding was found to be energetically favored at slightly acidic to neutral conditions, specifically close to the pI of GBP (∼5.0). Minimal fluorescence response to glucose was exhibited at pH 3.0 accompanied by a blue shift in the steady state fluorescence spectrum. In contrast, an almost 45% response to glucose was shown at pH 4.5-9.0 with a 13-nm red shift. Frequency domain lifetime measurements and quenching with KI suggest that at highly acidic conditions both the glucose-free and the glucose-bound protein are in a conformation distinct from those observed at higher pH values. PMID:26812111

  7. Analiza korelacionih osobina pseudoslučajnih sekvenci dužine 255 za zaštitu upravljačkog signala bespilotne letelice / Analysis of correlation properties of pseudorandom sequences of length 255 for the UAV control signal protection

    Directory of Open Access Journals (Sweden)

    Vladimir D. Orlić

    2010-04-01

    Full Text Available Tehnike prenosa signala u proširenom spektru sa direktnom sekvencom predstavlja efikasan metod zaštite upravljačkog signala bespilotne letelice (BL. Zaštita signala se ostvaruje primenom pseudoslučajnih (PS sekvenci u predajniku, koje su poznate prijemniku, ali ne i neovlašćenom korisniku. Da bi se ostvario pouzdan prenos signala, PS sekvence treba da imaju dobre autokorelacione osobine. Ukoliko je prenos signala realizovan primenom nekoliko PS sekvenci, tada su od velike važnosti i njihove međukorelacione karakteristike. U radu su analizirane autokorelacione i međukorelacione osobine PS sekvenci dužine 255. Razmatrane su tri najčešće korišćene klase PS sekvenci: linearne sekvence maksimalne dužine, Goldove sekvence i Kasamijeve sekvence. Predložen je optimalan skup PS sekvenci za zaštitu upravljačkog signala BL. / The Direct Sequence Spread Spectrum technique represents an effective method for unmanned aerial vehicle (UAV control signal protection. Signal protection is obtained by applying pseudorandom (PR sequences within a transmitter, known by a receiver, but unknown to an unauthorized user. In order to achieve reliable signal transmission, PR sequences ought to have good autocorrelation properties. If the signal transmission is realized by using several PR sequences, their crosscorrelation properties are of high importance as well. In this paper autocorrelation and crosscorrelation properties of PR sequences of length 255 are analyzed. Three most frequently used classes of PR sequences: linear maximum length, Gold and Kasami sequences are considered. An optimal set of PR sequences for UAV control signal protection is recommended.

  8. Construction of two YAC contigs in human xp11.23-p11.22, one encompassing the loci OATL1, GATA, TFE3, and SYP, the other linking DXS255 to DXS146

    Energy Technology Data Exchange (ETDEWEB)

    Fisher, S.E.; Hatchwell, E.; Chand, A.; Ockenden, N.; Craig, I.W. [Univ. of Oxford, Oxford (United Kingdom)] [and others

    1995-09-20

    We have constructed two YAC contigs in the Xp11.23-p11.22 interval of the human X chromosome, a region that was previously poorly characterized. One contig, of at least 1.4 Mb, links the pseudogene OATL1 to the genes GATA1, TFE3, and SYP and also contains loci implicated in Wiskott-Aldrich syndrome and synovial sarcoma. A second contig, mapping proximal to the first, is estimated to be over 2.1 Mb and links the hypervariable locus DXS255 to DXS146, and also contains a chloride channel gene that is responsible for hereditary nephrolithiasis. We have used plasmid rescue, inverse PCR, and Alu-PCR to generate 20 novel markers from this region, 1 of which is polymorphic, and have positioned these relative to one another on the basis of YAC analysis. The order of previously known markers within our contigs, Xpter-OATL1-GATA-TFE3-SYP-DXS255-DXS146-Xcen, agrees with genomic pulsed-field maps of the region. In addition, we have constructed a rare-cutter restriction map for a 710-kb region of the DXS255-DXS146 contig and have identified three CpG islands. These contigs and new markers will provide a useful resource for more detailed analysis of Xp11.23-p11.22, a region implicated in several genetic diseases. 32 refs., 2 figs., 2 tabs.

  9. Rotational properties of the odd- Z transfermium nucleus 255Lr by a particle-number-conserving method in the cranked shell model

    Science.gov (United States)

    Li, Yu-Chun; He, Xiao-Tao

    2016-07-01

    Experimentally observed ground state band based on the 1/2-[521] Nilsson state and the first exited band based on the 7/2-[514] Nilsson state of the odd- Z nucleus 255Lr are studied by the cranked shell model (CSM) with the paring correlations treated by the particle-number-conserving (PNC) method. This is the first time the detailed theoretical investigations are performed on these rotational bands. Both experimental kinematic and dynamic moments of inertia ( J (1) and J (2)) versus rotational frequency are reproduced quite well by the PNC-CSM calculations. By comparing the theoretical kinematic moment of inertia J (1) with the experimental ones extracted from different spin assignments, the spin 17/2- → 13/2- is assigned to the lowest-lying 196.6(5) keV transition of the 1/2-[521] band, and 15/2- → 11/2- to the 189(1) keV transition of the 7/2-[514] band, respectively. The proton N = 7 major shell is included in the calculations. The intruder of the high- j low-Ω 1 j 15/2 (1/2-[770]) orbital at the high spin leads to band-crossings at ħω ≈ 0.20 ( ħω ≈ 0.25) MeV for the 7/2-[514] α = -1/2 ( α = +1/2) band, and at ħω ≈ 0.175 MeV for the 1/2-[521] α = -1/2 band, respectively. Further investigations show that the band-crossing frequencies are quadrupole deformation dependent.

  10. Shipment of 255 DIDO fuel elements to the Savannah River Site to empty the storage and reactor pools at Risoe National Laboratory

    International Nuclear Information System (INIS)

    The DR-3 reactor, owned and operated by the Danish National Laboratory, was built in the late 1950's and initiated operation in January 1960. At that time the DR-1 and DR-2 reactors were already in operation. The main purpose if of Danish research reactor DR-3 was material and fuel testing. Until 1989 the reactor utilized HEU fuel elements. Conversion to the LEU fuel cycle was accomplished in 1990. DOE restarted the return program of for Foreign Research Reactor fuel elements to the United States in 1994. From that time, through 1998, three IUO4 casks (one cask in 1994) operated by Transnucleaire (now named Cogema Logistics, ACL) were used to transport Risoe's fuel to the Savannah River Site (SRS) near Aiken, SC in the USA. In 1999, Risoe elected to issue a request for proposal to transport DR-3 the DIDO fuel elements to SRS with a new licensed cask designed to replace the IUO4 cask. ACL was awarded the contract to transport the irradiated fuel from DR-3 to SRS for the remainder of the FRR Fuel Return program (2009). However, on September 28, 2000, the Board of Governors of Risoe National Laboratory decided to shut down the Danish research reactor of DR3. There had been of R2 technical problems (corrosion on the aluminum reactor tank) and, due to anticipated increasing operational expenses, the Board elected to close the reactor facility. Shortly thereafter, the Danish Government asked the National Laboratory to empty the reactor and its reactor and storage pools containing a total of 255 Dido irradiated fuel elements and ship them to Savannah Rive Site. At that time, ACL was in the process of licensing the new TN-MTR package in the USA. The early shut down of the DR-3 reactor and consequently the resultant new shipping schedule was not compatible with ACL's equipment and licensing schedule for the cask. (author)

  11. 255Gy irradiated tachyzoites of Toxoplasma gondii induce intestinal immune response in C57BL/6J immunized by oral route

    Energy Technology Data Exchange (ETDEWEB)

    Galisteo Junior, Andres Jimenez; Alves, Janaina Baptista [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil). Lab. de Biologia Molecular]. E-mail: galisteo@usp.br; Hiramoto, Roberto Mitsuyoshi [Instituto Adolfo Lutz, Sao Paulo, SP (Brazil). Secao de Parasitoses Sistemicas]. E-mail: hiramoto@usp.br; Carmo, Claudia Villano do; Andrade Junior, Heitor Franco de [Instituto de Medicina Tropical de Sao Paulo, Sao Paulo, SP (Brazil). Lab. de Protozoologia]. E-mail: hfandrad@usp.br

    2005-07-01

    Toxoplasmosis, a prevalent widespread infection in man and animals, occurs mainly through ingestion of water and food contaminated with oocyst from cat feces, causing usually benign disease in humans, except in intrauterine fetal infection or in immunodeficient patients. We study the oral route for the development of a vaccine for toxoplasmosis, using parasites irradiated with 60 Cobalt, as an alternative for vaccine development to this worldwide parasitic infection. We evaluated the development of immunity at serum or mucosal levels, and their efficiency in protect the mice against challenge with oral cysts of the ME-49 strain. C57Bl/6j isogenic mice were immunized by oral route with 10{sup 7} 255 Gy irradiated tachyzoites from RH strain, at several protocols using milk as anti-peptic adjuvant and alum hydroxide as antacid. The preparations of irradiated tachyzoites induced production of serum IgG and IgA in immunized mice, as determined by ELISA, with IgG2a as the dominant subclass, similar to chronic infection. Their use with adjuvant allowed the excretion of significant amounts of IgA in stools also IgG, despite a lesser extent. All oral preparations induced some quantitative protection against challenge, which was similar to the parenteral route only isolated alum hydroxide was used as adjuvant. All these data support the possibility of the development of an oral vaccine against toxoplasmosis, using irradiated tachyzoites, which would be possible tool in near future for use in field baits, for immunizing either domestic or wild felids. (author)

  12. Survey of potential markets for devices using Californium-252

    International Nuclear Information System (INIS)

    Potential applications for devices or systems containing 252Cf in the years from 1975 to 1980 are estimated. The estimated number of devices and associated business value were derived from a survey of 46 industrial, educational and governmental organizations conducted from Jan. to May, 1975. Applications for devices and systems based on 252Cf are expected to increase by a factor of 7 in the 6-y period from 1975 to 1980. The annual business value of 252Cf devices should increase from 1.5 million dollars in 1975 to 10.8 million dollars in 1980. The potential European market should be several times as large as the US market, based on actual sales of 252Cf, which have been two to four times greater in Europe than in the US

  13. The protective cell petrus for the production of californium 252

    International Nuclear Information System (INIS)

    The alpha, beta, gamma, neutron cell which is described in the present paper is devoted to the transplutonium element production and study. It is located at the CEN in Fontenay-aux-Roses (France). The 4 feet ordinary concrete shielding made of stacked blocs allows the manipulation of radioactive sources as high as 1000 curies of 1 MeV gamma rays and with a fast neutrons flux of 109 n.cm-2.s-1. The airtight alpha containment box is equipped with two transfer systems, one consists of a parallelepiped shaped airtight box located in a turntable, the other uses standard cylindrical containers made of polyethylene. The general equipment and the main setting up are also described. (authors)

  14. Californium-252 neutron activation facility at the Savannah River Laboratory

    International Nuclear Information System (INIS)

    A neutron irradiation facility has been established to develop new analytical methods and for the support of research programs. A major component of this facility is a 252Cf source which provides both fission spectrum and thermal neutrons. (U.S.)

  15. Californium-252 brachytherapy for anal and ano-rectal carcinoma

    International Nuclear Information System (INIS)

    Surgery has historically been the standard treatment for anal, ano-rectal and rectal carcinoma but is prone to local or regional failure. Over the past 15 years there has been increasing interest in and success with radiation therapy and combined chemoradiotherapy for treatment of anal and ano-rectal cancers. Cf-252 brachytherapy combined with external beam teletherapy has been investigated for anal and ano-rectal lesions at the Univ. of Kentucky with encouraging results

  16. Mobile equipment for neutron radiography using a californium-252 source

    International Nuclear Information System (INIS)

    The basic requirements for successful neutron radiography are first summarised and the use of 252Cf is placed in perspective by comparing its properties with those of sources based on the Be (γ, n) and Be (α, n) reactions which have a broadly similar range of applications. The more essential design features of mobile neutron radiography equipment are next examined in some detail, to show how the often conflicting requirements of optimum beam production and adequate shielding may be reconciled. An assembly with a maximum dimension around 1 m with a source of 1 mg is used as an example. The design data used are reproduced in graphical form to permit designs to be scaled to suit the source available and the requirements. The selection of suitable image recorders for 252Cf radiography is discussed with the conclusion that the gadolinium foil-film combinations are likely to remain the normal choice. Demonstration radiographs are presented with particular reference to the location of residual casting sand in gas-cooled turbine blades. Finally, it is suggested that other applications for mobile 252Cf-based neutron radiography equipment will be found in the ordnance, aero-space, chemical and nuclear fuel manufacturing industries. (author)

  17. Automated absolute activation analysis with californium-252 sources

    Energy Technology Data Exchange (ETDEWEB)

    MacMurdo, K.W.; Bowman, W.W.

    1978-09-01

    A 100-mg /sup 252/Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from /sup 17/O. Detection sensitivities of < or = 400 ppB for natural uranium and 8 ppB (< or = 0.5 (nCi/g)) for /sup 239/Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level.

  18. Californium-based neutron radiography for corrosion detection in aircraft

    International Nuclear Information System (INIS)

    In support of an overall program aimed at minimizing disassembly and reducing inspection time during aircraft maintenance, a series of projects has been carried out to determine the feasibility of applying neutron radiographic techniques to the nondestructive (NDT) inspection of aircraft and aircraft components. These investigations have clearly demonstrated the superiority of neutron radiography over all other NDT techniques in its ability to detect surface and subsurface corrosion in aircraft structure. This capability is particularly significant where the corrosion is hidden behind thick metallic structural members. The neutron radiographic technique has been applied successfully to detect corrosion in the wing tank of E-2C, C-130, and DC-9 aircraft; rear stabilators of F-4 and F-111 aircraft; aft spar, starboard and port wing, and rudder of the F-8; fuselage skin of the 727; rotary blades of AH-1 and SH-3 helicopters; rotary tail flaps of the UH-2 helicopter; and nose landing gear of A-7 aircraft

  19. Automated absolute activation analysis with californium-252 sources

    International Nuclear Information System (INIS)

    A 100-mg 252Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from 17O. Detection sensitivities of 239Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level

  20. Structural study of Sr0.3Ba0.7Nb2O6 and La0.030Sr0.255Ba0.700Nb2O6 ceramic systems

    International Nuclear Information System (INIS)

    Sr0.3Ba0.7Nb2O6 (SBN) and La0.030Sr0.255Ba0.700Nb2O6 (LSBN) ceramic compounds have been prepared using the traditional ceramic method at two different calcination temperatures (900 and 1000 deg. C) and later sintered both at 1400 deg. C. A study of the effects of the calcination temperatures and La substitution on the morphological, compositional, and structural properties of SBN and LSBN is presented using scanning electronic microscopy (SEM), energy dispersive spectroscopy (EDS), and X-ray diffraction (XRD) analysis. From Rietveld refinement processes, the XRD patterns were interpreted to evaluate such effects in the structural parameters and the site occupation factors of the heavy metals and oxygen atoms. The effect of the incorporation of La resulted in a 0.25% cell contraction and turned out to be higher than the 0.08% dilation effect produced by the increase of calcination temperature. The La ion with similar effective ionic radius and higher electronegativity is incorporated into the structure occupying the A1 site just like the Sr ions in the SBN compound. Differences in the site occupation factors between the SBN and LSBN samples lead to substantial changes in the physical properties such as temperature of relative dielectric constant maximum, relative dielectric constant, and dielectric loss, correlated with the distortion and the relative orientation of the oxygen octahedra.

  1. Identification of L84F mutation with a novel nucleotide change c.255G > T in the superoxide dismutase gene in a North Indian family with amyotrophic lateral sclerosis.

    Science.gov (United States)

    Vats, Abhishek; Gourie-Devi, Mandaville; Verma, Meenakshi; Ramachandran, Srinivasan; Taneja, Bhupesh; Kukreti, Ritushree; Taneja, Vibha

    2016-01-01

    Mutations in the superoxide dismutase (SOD1) gene account for ∼15% and in the transactive response DNA binding protein (TARDBP) gene for ∼5% of familial amyotrophic lateral sclerosis (FALS) cases. These two genes were analysed in two siblings from North India with ALS and a positive family history. The coding region of SOD1 and TARDBP genes was sequenced in both siblings. Genetic variation identified in SOD1 was typed in unaffected family members (n = 11), sporadic ALS patients (n = 48) and healthy controls (n = 35). Molecular dynamic (MD) simulations were performed on wild-type (WT) and mutant monomers of SOD1 to determine structural changes due to the identified mutation. A novel heterozygous nucleotide variation (c.255G > T) was identified in exon 4 of SOD1 in the two siblings and two asymptomatic family members but not in SALS patients and healthy controls. This variation results in a known non-synonymous substitution from leucine to phenylalanine at position 84 (L84F), making it a triallelic variation. Large conformational changes were observed in the zinc loop and electrostatic loop in an L84F mutant compared to WT SOD1 in MD simulations. In conclusion, this is the first report of mutation in SOD1 associated with FALS in India. Structural perturbations in L84F SOD1 may cause dimer destabilization, with decreased metal affinity leading to oligomerization. PMID:26630559

  2. Is the Internet a useful and relevant source for health and health care information retrieval for German cardiothoracic patients? First results from a prospective survey among 255 Patients at a German cardiothoracic surgical clinic

    Directory of Open Access Journals (Sweden)

    Diez Claudius

    2006-10-01

    Full Text Available Abstract Background It is not clear how prevalent Internet use among cardiopathic patients in Germany is and what impact it has on the health care utilisation. We measured the extent of Internet use among cardiopathic patients and examined the effects that Internet use has on users' knowledge about their cardiac disease, health care matters and their use of the health care system. Methods We conducted a prospective survey among 255 cardiopathic patients at a German university hospital. Results Forty seven respondents (18 % used the internet and 8,8 % (n = 23 went online more than 20 hours per month. The most frequent reason for not using the internet was disinterest (52,3 %. Fourteen patients (5,4 % searched for specific disease-related information and valued the retrieved information on an analogous scale (1 = not relevant, 5 = very relevant on median with 4,0. Internet use is age and education dependent. Only 36 (14,1 % respondents found the internet useful, whereas the vast majority would not use it. Electronic scheduling for ambulatory visits or postoperative telemedical monitoring were rather disapproved. Conclusion We conclude that Internet use is infrequent among our study population and the search for relevant health and disease related information is not well established.

  3. Clinicopathologic features and pathogenesis of mycosis in head and neck%头颈部霉菌病255例临床病理特点及发病机制探讨

    Institute of Scientific and Technical Information of China (English)

    何春燕; 刘红刚; 张勇; 朴颖实; 张盛忠

    2009-01-01

    Objective To study the clinicopathologic characteristics and pathogenesis of mycosis in head and neck to enhance awareness of the disease. Methods The clinical and histopathologic data were retrospectively reviewed in 255 cases of mycosis. Pathologic changes of the mucosa of non- and invasive mycosis were observed, the fungi was displayed by modified Warthin-Starry (W-S) and PAS staining. 2 samples of noninvasive mycosis and 1 sample of invasive mycosis were observed under electron microscope. Results 234 cases were noninvasive mycosis, and 149 cases were fungal balls, of which 77.56% cases had calcified fungal hyphae. The mucosa of 15 cases had erosion under the fungal cenobium. 34 cases were allergic fungal sinusitis, and there were a large number of eosinophil infiltration inside mucosa and eosinophils exudation in the mucous secretions, and also Charcot-Leiden crystals and a small number Aspergillus hyphae and spores in the secretions. The remaining 36 cases were found in the mucosal surface inflammatory exudate and keratinization of the pharynx, sinus piriformis, larynx, hard palate, mastoid process and external auditory canal. 21 cases were invasive mycosis, invaded respectively in nasal cavity, unilateral or multilateral sinuses, pharynx, mastoid cavity and suhmandibular lymph nodes. 9 cases were accompanied with the same lateral orbita involvement. Conclusion Different types of mycosis have different pathological patterns, and the development of this disease has relations with the patient's immune state.%目的 观察头颈部霉菌病的临床病理特点,探讨发病机制.方法 对255例经病理组织学证实的头颈部霉菌病患者的临床和组织病理资料进行回顾性分析.以改良Warthin-Starry(W-S)、PAS染色显示真菌的形态特征.对2例非侵袭性和1例侵袭性霉菌病黏膜行透射电镜观察.结果 显微镜下检出非侵袭性霉菌病234例,149例为霉菌球,其中77.65%霉菌团块中菌丝有钙化;15例

  4. 24 CFR 990.255 - Overview.

    Science.gov (United States)

    2010-04-01

    ... management industry. PHAs shall also implement project-based management, project-based budgeting, and project...) Better preserve and protect each asset; (3) Provide appropriate mechanisms for monitoring performance...

  5. 21 CFR 173.255 - Methylene chloride.

    Science.gov (United States)

    2010-04-01

    ... the extraction of spice, at a level not to exceed 30 parts per million; Provided, That, if residues of... 30 parts per million. (b) In hops extract as a residue from the extraction of hops, at a level not to... section. (c) In coffee as a residue from its use as a solvent in the extraction of caffeine from...

  6. 15 CFR 255.2 - Qualifications.

    Science.gov (United States)

    2010-01-01

    ... stating that he is free from any communicable disease, physical deformity or disability that would... and possessing intellectual ability and suitable personal qualities; and (e) In possession of... recognized university, college or other institution of learning, with some training or experience in...

  7. 16 CFR 255.2 - Consumer endorsements.

    Science.gov (United States)

    2010-01-01

    ... testing demonstrating that the net impression of its advertisement with such a disclaimer is non-deceptive... should not expect to have similar results,” the ad is likely to be deceptive unless the advertiser has... likely to have similar results” is insufficient to prevent this ad from being deceptive because...

  8. 16 CFR 255.1 - General considerations.

    Science.gov (United States)

    2010-01-01

    ... convey any express or implied representation that would be deceptive if made directly by the advertiser... to halt the continued publication of deceptive representations when they are discovered....

  9. 16 CFR 255.3 - Expert endorsements.

    Science.gov (United States)

    2010-01-01

    ... example, chemical engineering, the endorsement would be deceptive. Example 2: An endorser of a hearing aid... deceptive. A non-medical “doctor” (e.g., an individual with a Ph.D. in exercise physiology) or a physician... endorsement would be deceptive. Even if the American Institute of Science is an independent bona fide...

  10. Capture cross section measurement analysis in the Californium-252 spectrum with the Monte Carlo method

    International Nuclear Information System (INIS)

    Absolute average capture cross sections of gold, thorium, tantalum, molybdenum, copper and strontium in 252Cf spontaneous fission neutron spectrum were simulated for two types of experiment setups preformed by Z. Dezso and J. Csikai and by L. Green. The experiments were simulated with MCNP5 using cross section data from the ENDF/B-VII.0 library. The determination of neutron backscattering was calculated with the use of neutron flagging. Correction factors to experimentally measured values were determined to obtain average cross sections in a pure 252Cf spontaneous fission spectrum. Influence of concrete wall thickness, air moisture and room size on the average cross section was analyzed. Correction factors amounted to about 30%. Corrected values corresponding to average cross sections in a pure 252Cf spectrum were calculated for 197Au, 232Th, 181Ta, 98Mo, 65Cu and 84Sr. Average cross sections were also calculated with the RR-UNC software using IRDFF-v.1.05 and ENDF/B-VII.0 libraries. The revised average radiative capture cross sections are 75.5±0.1 mb for 197Au, 87.0±1.6 mb for 232Th , 98.0±4.5 mb for 181Ta, 21.2±0.5 mb for 98Mo, 10.3±0.3 mb for 63Cu, and 34.9±6.5 mb for 84Sr. - Highlights: • Average capture cross sections in 252Cf spontaneous fission spectrum were simulated. • Calculations were done using MCNP5 code and ENDF/B-VII.0 library. • Correction factors for self-shielding and room return effects were taken into account. • The revised average radiative capture cross sections for different materials are published

  11. Multi-element neutron activation analysis of sediment using a californium-252 source

    International Nuclear Information System (INIS)

    The application of a 252Cf source to the neutron activation analysis of several elements in small (approximately 1.5 in. in dia) cores was studied using high-resolution gamma ray spectroscopy and manual data reduction. (U.S.)

  12. OER of californium-252 at low dose rate for growth inhibition in Vicia faba

    International Nuclear Information System (INIS)

    OER of 252Cf, at low dose rate, has been determined for growth inhibition in Vicia faba roots. A new strain ''BelB'' was used; it was found to be more resistant to prolonged anoxia. Two sets of linear 252Cf sources were used (linear activity 0.31 and 0.47 (μg.cm-1)) in somewhat different geometrical arrangements. The (n+γ) 252Cf dose rates at the level of the root tips were 0.11 and 0.13 Gy.h-1 respectively. The relative contribution of the γ component Dsub(γ) to the total absorbed dose Dsub(n+γ) at the level of the root tips was evaluated Dsub(γ)/Dsub(n+γ)=0.35 for the first source-geometry and 0.42 for the second source-geometry. The reference radiation was the γ emission of 192Ir, used in the same geometrical conditions and for similar irradiation times. Irradiations performed in aerobic and anoxic conditions were alternated. OER values of 1.4 +- 0.1 and 1.5 +- 0.1 were observed for the 252Cf emission with the first and second source-geometry respectively. The corresponding OER values for 192Ir were 2.3 +- 0.2 and 2.6 +- 0.1; the derived oxygen gain factors were then equal to 1.6 and 1.7 repectively

  13. Dicty_cDB: VSI255 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GTGTTTTATTAGAATTTT CAAATTTCTCATTTAAAATAAATTTTAAAAAG sequence update 2001. 3.22 Translated Amino Acid sequence straesnkdev**crctr...QGRDRGYIYSEPEFGRTRQVFY*nfqishlk*ilk Translated Amino Acid sequence (All Frames) Frame A: straesnkdev**crctr*r*rlhlf*tr... own update 2001.11.21 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N ( AU268402 ) Dict...yostelium discoideum vegetative cDNA clone:VS... 281 8e-72 1 ( AU271092 ) Dictyostelium disco...ideum vegetative cDNA clone:VS... 264 2e-66 1 ( AU270815 ) Dictyostelium discoide

  14. 40 CFR 255.10 - Criteria for identifying regions.

    Science.gov (United States)

    2010-07-01

    ... configuration should be considered, weighing transportation costs against economies of scale. (2) Left-over... economies of scale, and affect marketability of resources recovered. A region should include...

  15. Low-metallicity Star Formation (IAU S255)

    Science.gov (United States)

    Hunt, Leslie K.; Madden, Suzanne C.; Schneider, Raffaella

    2009-01-01

    Preface; SOC and LOC; Participants; Life at the conference; Conference photo; Session I. Population III and Metal-Free Star Formation: 1. Open questions in the study of population III star formation S. C. O. Glover, P. C. Clark, T. H. Greif, J. L. Johnson, V. Bromm, R. S. Klessen and A. Stacy; 2. Protostar formation in the early universe Naoki Yoshida; 3. Population III.1 stars: formation, feedback and evolution of the IMF Jonathan C. Tan; 4. The formation of the first galaxies and the transition to low-mass star formation T. H. Greif, D. R. G. Schleicher, J. L. Johnson, A.-K. Jappsen, R. S. Klessen, P. C. Clark, S. C. O. Glover, A. Stacy and V. Bromm; 5. Low-metallicity star formation: the characteristic mass and upper mass limit Kazuyuki Omukai; 6. Dark stars: dark matter in the first stars leads to a new phase of stellar evolution Katherine Freese, Douglas Spolyar, Anthony Aguirre, Peter Bodenheimer, Paolo Gondolo, J. A. Sellwood and Naoki Yoshida; 7. Effects of dark matter annihilation on the first stars F. Iocco, A. Bressan, E. Ripamonti, R. Schneider, A. Ferrara and P. Marigo; 8. Searching for Pop III stars and galaxies at high redshift Daniel Schaerer; 9. The search for population III stars Sperello di Serego Alighieri, Jaron Kurk, Benedetta Ciardi, Andrea Cimatti, Emanuele Daddi and Andrea Ferrara; 10. Observational search for population III stars in high-redshift galaxies Tohru Nagao; Session II. Metal Enrichment, Chemical Evolution, and Feedback: 11. Cosmic metal enrichment Andrea Ferrara; 12. Insights into the origin of the galaxy mass-metallicity relation Henry Lee, Eric F. Bell and Rachel S. Somerville; 13. LSD and AMAZE: the mass-metallicity relation at z > 3 F. Mannucci and R. Maiolino; 14. Three modes of metal-enriched star formation at high redshift Britton D. Smith, Matthew J. Turk, Steinn Sigurdsson, Brian W. O'Shea and Michael L. Norman; 15. Primordial supernovae and the assembly of the first galaxies Daniel Whalen, Bob Van Veelen, Brian W. O'Shea and Michael L. Norman; 16. Damped Lyα systems as probes of chemical evolution over cosmological timescales Miroslava Dessauges-Zavadsky; 17. Connecting high-redshift galaxy populations through observations of local damped Lyman alpha dwarf galaxies Regina E. Schulte-Ladbeck; 18. Chemical enrichment and feedback in low metallicity environments: constraints on galaxy formation Francesca Matteucci; 19. Effects of reionization on dwarf galaxy formation Massimo Ricotti; 20. The importance of following the evolution of the dust in galaxies on their SEDs A. Schurer, F. Calura, L. Silva, A. Pipino, G. L. Granato, F. Matteucci and R. Maiolino; 21. About the chemical evolution of dSphs (and the peculiar globular cluster ωCen) Andrea Marcolini and Annibale D'Ercole; 22. Young star clusters in the small Magellanic cloud: impact of local and global conditions on star formation Elena Sabbi, Linda J. Smith, Lynn R. Carlson, Antonella Nota, Monca Tosi, Michele Cignoni, Jay S. Gallagher III, Marco Sirianni and Margaret Meixner; 23. Modeling the ISM properties of metal-poor galaxies and gamma-ray burst hosts Emily M. Levesque, Lisa J. Kewley, Kirsten Larson and Leonie Snijders; 24. Dwarf galaxies and the magnetisation of the IGM Uli Klein; Session III. Explosive Events in Low-Metallicity Environments: 25. Supernovae and their evolution in a low metallicity ISM Roger A. Chevalier; 26. First stars - type Ib supernovae connection Ken'ichi Nomoto, Masaomi Tanaka, Yasuomi Kamiya, Nozomu Tominaga and Keiichi Maeda; 27. Supernova nucleosynthesis in the early universe Nozomu Tominaga, Hideyuki Umeda, Keiichi Maeda, Ken'ichi Nomoto and Nobuyuki Iwamoto; 28. Powerful explosions at Z = 0? Sylvia Ekström, Georges Meynet, Raphael Hirschi and André Maeder; 29. Wind anisotropy and stellar evolution Cyril Georgy, Georges Meynet and André Maeder; 30. Low-mass and metal-poor gamma-ray burst

  16. Dicty_cDB: AFK255 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 9196 |AW649196.1 EST327650 tomato germinating seedlings, TAMU Lycopersicon escule...E459798 |BE459798.1 EST415090 tomato developing/immature green fruit Lycopersicon esculentum cDNA clone cLEM...8G13, mRNA sequence. 74 2e-09 1 BE435540 |BE435540.1 EST406618 tomato breaker fruit, TIGR Lycopersico...ne cLEF48O8 5', mRNA sequence. 74 2e-09 1 AW033447 |AW033447.1 EST277018 tomato callus, TAMU Lycopersicon es...KLAAEKAAEKEAEEADEEEEEVAEED Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) V

  17. 16 CFR 255.0 - Purpose and definitions.

    Science.gov (United States)

    2010-01-01

    ... endorsements in advertising. Whether a particular endorsement or testimonial is deceptive will depend on the specific factual circumstances of the advertisement at issue. (b) For purposes of this part, an endorsement... this part, the term product includes any product, service, company or industry. (e) For purposes...

  18. 15 CFR 255.1 - Type of fellowships.

    Science.gov (United States)

    2010-01-01

    ... standardization and testing. (b) Practical laboratory training in various branches of physics, chemistry, and engineering research, under the direction of the National Institute of Standards & Technology, which will..., rubber, leather, paper, textiles, plastics, and clay and silicate products. (c) Observation and study...

  19. 14 CFR 25.5 - Incorporations by reference.

    Science.gov (United States)

    2010-01-01

    ...(a) and 1 CFR part 51. These materials are incorporated as they exist on the date of the approval.../federal_register/code_of_federal_regulations/ibr_locations.html. (b) The following materials are available..., document number DOT/FAA/AR-05/8, IBR approved for § 25.981 and Appendix N. It can also be obtained at...

  20. Dicty_cDB: SHK255 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available PQDDNNNESNEQIES NEDIENKDEDVENKDEDVENKDEDEEDQIEN*iykkf*ikikikk**kkyyffnfk Translated Amino Acid sequence (All Frames) Frame...e RPCI-23-89E14, genomic survey sequence. 36 0.004 3 CN775673 |CN775673.1 tae84a06.y1 Hydra EST Darmstadt I ...us purpuratus genomic clone Plate=1011 Col=7 Row=B, DNA sequence. 42 0.013 3 CN776161 |CN776161.1 tae78a10.y1 Hydra EST Darm.... 40 0.020 8 CN624142 |CN624142.1 tae59h05.y1 Hydra EST Darmstadt I Hydra magnipapillata cDNA 5', mRNA seq...uence. 40 0.023 2 CN628860 |CN628860.1 tae96h10.y1 Hydra EST Darmstadt I Hydra magnipapillata cDNA 5', mRNA

  1. 24 CFR 255.2 - GNMA right to assignment.

    Science.gov (United States)

    2010-04-01

    ... will have the right to perfect an assignment of the mortgage to itself. However, before exercising this right, GNMA will attempt to have the Mortgage assigned to another eligible coinsuring lender (unless... defaulting lender-issuer, GNMA will have the right to perfect an assignment of the Coinsured...

  2. 40 CFR 52.255 - Gasoline transfer vapor control.

    Science.gov (United States)

    2010-07-01

    ... Quality Control Regions, as described in 40 CFR part 81, dated July 1, 1979, with the following exceptions..., see the List of CFR Sections Affected, which appears in the Finding Aids section of the printed volume... 40 Protection of Environment 3 2010-07-01 2010-07-01 false Gasoline transfer vapor control....

  3. TASK 2.5.5 NATURAL EXPOSURE TESTING IN CALIFORNIA

    Energy Technology Data Exchange (ETDEWEB)

    Miller, William A [ORNL; Cheng, Mengdawn [ORNL; New, Joshua Ryan [ORNL; Ronnen, Levinson [Lawrence Berkeley National Laboratory (LBNL); Akbari, Hashem [Lawrence Berkeley National Laboratory (LBNL); Berhahl, Paul [Lawrence Berkeley National Laboratory (LBNL)

    2010-03-01

    Airborne particulate matter that settles on a roof can either reflect or absorb incoming solar radiation, dependent on the chemical content and size of the particles. These light scattering and absorption processes occur within a few microns of the surface, and can affect the solar reflectance of the roof. Wilkes et al. (2000) tested 24 different roof coatings on a low-slope test stand and observed about a 25% decrease in the solar reflectance of white-coated and aluminum-coated surfaces as the time of exposure increased; however, the decrease leveled off after 2 years. SPRI Inc. and its affiliates studied the effect of climatic exposure on the surface properties of white thermoplastic single-ply membranes and determined that membranes lose from 30 to 50% of their reflectance over 3 years (Miller et al. 2002). The CMRC and its affiliates AISI, NamZAC, MBMA, MCA and NCCA exposed unpainted and painted metal roofing on both steep- and low-slope test roofs and found that after 3 years, the painted polyvinylidene fluoride (PVDF) metal roofs lost less than 5% of their original reflectance (Miller et al. 2004). The results of the three different weathering studies are very interesting in terms of their solar reflectance after 3 years of exposure. The white thermoplastic membrane and white ceramic coating with white topcoat had original reflectance measures that were about 20 percentage points higher than the painted metal; however, after 3-years of field exposure the solar reflectance of the painted metal exceeds that of the thermoplastic membrane and equals that of the coating. The long-term loss of reflectance appears driven by the ability of the particulate matter to cling to the roof and resist being washed off by wind and or rain. Miller et al. (2002) discovered that aerosol deposition introduced biomass of complex microbial consortia onto the test roofs and the combination of contaminants and biomass accelerated the loss of solar reflectance for the thermoplastic membranes and the roof coatings. Airborne contaminants and biomass were also detected on the painted metal roofs; however, the loss of solar reflectance was less than 5% for the painted metal roofs. The chemistry of the PVDF paint resin system uses similar organic film bonding to that responsible for Teflon , making it extremely chemical resistant and dirt shedding. Miller and Rudolph (2003) found the PVDF painted metals maintained solar reflectance even after 30 years of climatic exposure. Therefore the reduction of roof reflectance is closely related to the composition of the roof and to the chemical profile of the contaminants soiling the roof. Contaminants collected from samples of roof products exposed at seven California weathering sites were analyzed for elements and carbons to characterize the chemical profile of the particles soiling each roof sample and to identify those elements that degrade or enhance solar reflectance. The losses in solar reflectance varied from site to site and also varied at a give site based on the color of the coupon. The least drop in reflectance was observed in the alpine climate of McArthur while the largest drop occurred in sites near urban development. Light color samples were soiled after just one year of exposure. The darker color coupons did not show the same seasonal variations in solar reflectance as observed for the lighter colors. However, after an additional year of exposure the samples at all sites regained most of their solar reflectance due to rain and/or wind washing. The loss of reflectance appears cyclical with the onset of seasons having more rainfall. Solar reflectance of the cool pigmented coupons always exceeded that of the conventional pigmented coupons. Climatic soiling did not cause the cool pigmented roof coupons to lose any more solar reflectance than their conventional pigmented counterparts. The effect of roof slope appears to have more of an effect on lighter color roofs whose solar reflectance exceeds at least 0.5 and visually shows the accumulation of airborne contaminants. The thermal emittance remained invariant with time and location and was therefore not affected by climatic soiling. A thin-film deposition model was developed based on first principles, which simulates light interaction with a soiled substrate. This model was used in combination with the measured data to determine the solar absorptance and reflectance of particulate matter at each of the sites calculated using least squares fitting routines. Principal Component Analysis was used to determine the most important combinations of chemicals correlated with changes in solar absorption. Linear regression helped extract an approximate correlation using chromium, iron and elemental carbon concentrations. It appears that chromium ranks first, iron ranks second, and elemental carbon ranks third in importance to soil absorptance in the data

  4. 24 CFR 234.255 - Cross-reference.

    Science.gov (United States)

    2010-04-01

    ....389Waived title objections. 203.420Nature of Mutual Mortgage Insurance Fund. 203.421Allocation of Mutual Mortgage Insurance Fund income or loss. 203.422Right and liability under Mutual Mortgage Insurance Fund...) to section 203 of the Act, one- to four-family, and the Mutual Mortgage Insurance Fund, shall...

  5. 40 CFR 98.255 - Procedures for estimating missing data.

    Science.gov (United States)

    2010-07-01

    ... estimating missing data. A complete record of all measured parameters used in the GHG emissions calculations... parameter shall be used in the calculations. (a) For stationary combustion sources, use the missing...

  6. 16 CFR 255.5 - Disclosure of material connections.

    Science.gov (United States)

    2010-01-01

    ... appearance by a well-known professional tennis player on a television talk show, the host comments that the... clinic in a television interview, the tennis player touts the results of her surgery - mentioning the... same television interview, the tennis player is wearing clothes bearing the insignia of an...

  7. 39 CFR 255.8 - Access to postal facilities.

    Science.gov (United States)

    2010-07-01

    ... cost of such restoration; (vi) The historic or architectural significance of the property in accordance... be made, due regard is to be given to: (i) The cost of the discretionary modification; (ii) The... basis in accordance with the criteria listed in paragraph (a)(2) of this section. If a...

  8. 6 CFR 25.5 - Obligations of seller.

    Science.gov (United States)

    2010-01-01

    ... SAFETY Act, an action for the recovery of damages proximately caused by a Qualified Anti-Terrorism... employees resulting from an activity resulting from an Act of Terrorism when Qualified Anti-Terrorism..., relating to, or resulting from an Act of Terrorism when the Seller's Qualified Anti-Terrorism...

  9. Major overhaul of bucket-wheel excavator 255 in the Inden opencast mine; Grundinstandsetzung Schaufelradbagger 255 im Tagebau Inden

    Energy Technology Data Exchange (ETDEWEB)

    Pachurka, Frank F. [RWE Power AG, Frechen (Germany). Technikzentrum Tagebaue

    2011-05-15

    The result of the project, carried out in-house merely with internal staff for the first time (responsibility for project, planning, engineering, fabrication and assembly), was excellent. There was no notifiable accident. In total, only two entries were made in the bandage book, all specified overhaul quality requirements were met and the cost budget and time schedule of the overall project were adhered to. A high level of occupational safety on the construction site was achieved by regulated site coordination supported by the mine's technical department for occupational safety, weekly site meetings focusing on occupational safety, regular occupational safety notices at the construction site and constant inspections of the assembly yard by authorities and executives. Everyone involved displayed a high degree of awareness of occupational safety. In-depth and detailed planning ensured that all roles, responsibilities, costs and the scope of services were clearly defined at an early stage of the project. Right from the start, the project team included persons responsible for the implementation of assembly, enabling purposeful instructions to be integrated into assembly engineering straight away. This procedure promoted the early specification of important technical conditions and, consequentially, allowed the assembly processes to be optimized during implementation. Accurate internal accounting management permitted the cost development and the assembly progress to be monitored in near real-time, so that deviations could be detected and countermeasures initiated in good time. To sum up, the opencast mining division of RWE Power has successfully launched its scheme of optimizing third-party maintenance services. (orig.)

  10. The determination of americium, curium and californium in biological samples by combined solvent extraction-liquid scintillation counting

    International Nuclear Information System (INIS)

    A method has been developed to extract Am, Cm and Cf from ashed biological samples dissolved in 8 M LiN03-10-2 M HN03 into a liquid/scintillation cocktail. This new method reduces tissue and instrument background and allows use of a larger sample for analysis than when using a commercial gelling cocktail. The extractant cocktail is 20% N,N,N-trioctyl-N-methylammonium chloride dissolved in toluene containing the scintillators p-terphenyl and 1,4-bis-2-(5-phenyl-oxazolyl)-benzene. Several different types of biological samples were analyzed and radionuclide recoveries greater than 90% were obtained in all cases. (author)

  11. Raman and absorption spectrophotometric studies of selected lanthanide, californium-doped lanthanide, and actinide trihalides in the solid state

    International Nuclear Information System (INIS)

    The solid-state absorption spectra of Cf(III) ions as a dopant in lanthanide trihalide hosts (LnCl3: Ln = Ce, Sm, and Y; LnBr3: Ln = Ce, Sm, Tb, and Y; LnI3: Ln = Ce and Y) have been recorded. The spectra of Cf(III) have been correlated with the various crystal structures. The phonon Raman spectra and solid-state absorption spectra of PmF3, PmCl3, PmBr3, and two crystal modifications of PmI3 have been recorded. Symmetry assignments have been made for the Raman-active bands for these trihalides and also the sesquioxide. The room-temperature absorption spectra have been correlated to crystal field effects. The symmetry assignments of the Raman-active phonon modes have been made based on polarized Raman spectra from single crystals of YF3-type orthorhombic TbF3 and PuBr3-type orthorhombic NdBr3. Raman spectra of other isostructural lanthanide compounds have been recorded and compared. Symmetry assignments for these compounds have been made by analogy to the single-crystal assignments. Raman spectra have been obtained and catalogued for a number of actinide compounds. Symmetry assignments have been made for the observed Raman-active phonon bands in this work based on the assignments made for isostructural lanthanide compounds. 29 figs., 22 tabs

  12. Optical Transitions in Highly Charged Californium Ions with High Sensitivity to Variation of the Fine-Structure Constant

    Science.gov (United States)

    Berengut, J. C.; Dzuba, V. A.; Flambaum, V. V.; Ong, A.

    2012-08-01

    We study electronic transitions in highly charged Cf ions that are within the frequency range of optical lasers and have very high sensitivity to potential variations in the fine-structure constant, α. The transitions are in the optical range despite the large ionization energies because they lie on the level crossing of the 5f and 6p valence orbitals in the thallium isoelectronic sequence. Cf16+ is a particularly rich ion, having several narrow lines with properties that minimize certain systematic effects. Cf16+ has very large nuclear charge and large ionization energy, resulting in the largest α sensitivity seen in atomic systems. The lines include positive and negative shifters.

  13. Optical transitions in highly-charged californium ions with high sensitivity to variation of the fine-structure constant

    CERN Document Server

    Berengut, J C; Flambaum, V V; Ong, A

    2012-01-01

    We study electronic transitions in highly-charged Cf ions that are within the frequency range of optical lasers and have very high sensitivity to potential variations in the fine-structure constant, alpha. The transitions are in the optical despite the large ionisation energies because they lie on the level-crossing of the 5f and 6p valence orbitals in the thallium isoelectronic sequence. Cf16+ is a particularly rich ion, having several narrow lines with properties that minimize certain systematic effects. Cf16+ has very large nuclear charge and large ionisation energy, resulting in the largest alpha-sensitivity seen in atomic systems. The lines include positive and negative shifters.

  14. AN INTEGRAL REACTOR PHYSICS EXPERIMENT TO INFER ACTINIDE CAPTURE CROSS-SECTIONS FROM THORIUM TO CALIFORNIUM WITH ACCELERATOR MASS SPECTROMETRY

    International Nuclear Information System (INIS)

    The principle of the proposed experiment is to irradiate very pure actinide samples in the Advanced Test Reactor (ATR) at INL and, after a given time, determine the amount of the different transmutation products. The determination of the nuclide densities before and after neutron irradiation will allow inference of effective neutron capture cross-sections. This approach has been used in the past and the novelty of this experiment is that the atom densities of the different transmutation products will be determined using the Accelerator Mass Spectroscopy (AMS) technique at the ATLAS facility located at ANL. It is currently planned to irradiate the following isotopes: 232Th, 235U, 236U, 238U, 237Np, 238Pu, 239Pu, 240Pu, 241Pu, 242Pu, 241Am, 243Am and 248Cm.

  15. Integral range, energy, residual range, and linear energy transfer distributions for Californium fission fragments in microelectronics materials

    International Nuclear Information System (INIS)

    This report discusses the advantages and limitations of using Cf-252 radiation sources for single event testing of microelectronics for space environments. Integral distributions for the range, energy, residual range, and linear energy transfer of Cf-252 fission fragments in absorber and microelectronic materials have been calculated. Techniques are suggested for determining when single event testing using Cf-252 is appropriate; also, techniques are given for estimating the saturation cross section and thresh old linear energy transfer from test data. 10 refs., 25 figs., 2 tabs

  16. Research and experimental work at Groote Schuur Hospital and the University of Cape Town using californium-252 sources

    International Nuclear Information System (INIS)

    Experiments have been undertaken to determine the high-LET and low-LET components of the absorbed dose from neutron beams. This is achieved by measuring the fluxes of the high-LET and low-LET radiations in a tissue-equivalent phantom individually and simultaneously using a scintillation probe fitted with a pulse shape discriminator. This system was successfully used with a 22 MeV neutron beam from the T(d,n) reaction and has been employed with 252Cf sources. Results obtained in the low-energy ranges (up to 3 MeV) indicate that the electron counts exceed the high-LET counts by a factor of 2 to 3. These results are related to the absorbed dose. Calculations have also been undertaken to establish whether the Paterson-Parker system could be used for the design of 252Cf treatments and the optimum needle activities to yield the desired dose. Experiments are under way to determine the variation of RBE and OER for 252Cf radiations around the source. The inhibition of root growth in Vicia Faba is being used to determine any such effects. Dose rates comparable to that employed in interstitial radiotherapy are being aimed at. A study of dose fractionation effects is also being undertaken. (author)

  17. Una mutación en el gen PARK2 causa enfermedad de Parkinson juvenil en una extensa familia colombiana Mutation c.255delA in the PARK2 gene as cause of juvenile Parkinson´s disease in a large Colombian family

    Directory of Open Access Journals (Sweden)

    Nicolas Pineda Trujillo

    2009-05-01

    Full Text Available

    La enfermedad de Parkinson (EP es común y se   debe   a degeneración de las neuronas dopaminérgicas en la sustancia nigra y en otras áreas del cerebro. Varios genes y mutaciones han sido implicados en ella y la mayoría de estas últimas han sido identificadas en el gen PARK2. Reportamos la evaluación de este gen PARK2 y de su región flanqueante en una gran familia de origen caucano, al suroccidente de Colombia. Los padres son primos hermanos y cuatro de sus diez hijos resultaron afectados en edad juvenil.

     

    La evaluación molecular incluyó tipificación de microsatélites (STR y la secuencia directa de los exones del gen. Nuestros hallazgos evidenciaron la presencia en condición homocigota de la mutación c.255delA, en el exón 2 de PARK2. Además, se pudo identificar un haplotipo portado por ambos padres y presente en condición homocigota en los hijos afectados. Del mismo modo se observó una alta tasa de recombinantes en la extensión de la región cromosómica analizada. La mutación c.255delA en PARK2 ya había sido reportada previamente en familias tanto de Francia como de España.

  18. Movilidad de pacientes y obstáculos a la libre prestación de servicios. A propósito del reintegro de gastos médicos no hospitalarios realizados en otro Estado miembro. Comentario a la Sentencia del Tribunal de Justicia de la Unión Europea de 27 de octubre de 2011. Asunto C-255/09. Comisión/contra Portugal

    Directory of Open Access Journals (Sweden)

    Mª de los Reyes Martínez Barroso

    2014-06-01

    Full Text Available La libre prestación de servicios incluye dos manifestaciones íntimamente ligadas entre sí: la prohibición de cualquier restricción a dicha libertad y la aplicación del principio de tratamiento igual con independencia de la nacionalidad del prestador de servicios. A partir de tal premisa, el Tribunal de Justicia de la Unión Europea ha debido intervenir para solucionar diversos litigios derivados de la prestación de servicios sanitarios o del denominado “turismo sanitario a la carta”. En concreto, a propósito de los gastos de atención médica en otros Estados miembros de la Unión Europea y su posterior reintegro en el Estado de origen del asegurado en función de las normas de Seguridad Social de éste último país. Ante la ausencia de una regulación sobre la cuestión hasta fechas muy recientes (Directiva 2011/24/UE del Parlamento Europeo y del Consejo de 9 de marzo de 2011, relativa a la aplicación de los derechos de los pacientes en la asistencia sanitaria transfronteriza la labor interpretativa efectuada por el órgano jurisdiccional comunitario ha sido determinante para comprender el alcance de esta materia, declarando que solamente respecto de aquellas prestaciones en las que efectivamente pudiera existir una justificación derivada de la sostenibilidad del sistema público, como sucede en las prestaciones sanitarias hospitalarias, procederá la exigencia de una autorización previa. Por el contrario, cuando no se requiere el empleo de materiales pesados y onerosos, la exigencia del requisito de autorización previa resulta contraria al actual art. 56 TFUE (antiguo art. 49 TCE, como determina la sentencia comentada, de 27 de octubre de 2011, Comisión contra Portugal, C-255/09. La protección a ultranza de la libre prestación de servicios sanitarios obliga a reflexionar, por último, sobre la situación de la asistencia sanitaria en nuestro país.

  19. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in 248Cm samples for transmutation studies

    International Nuclear Information System (INIS)

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (INcineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in 248Cm (∼97 %) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides formations ranged from 0.3% to 1.3%. This uncertainties range is quite acceptable for the nuclear data to be used in transmutation studies.

  20. MANTRA: An Integral Reactor Physics Experiment to Infer Actinide Capture Cross-sections from Thorium to Californium with Accelerator Mass Spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    G. Youinou; C. McGrath; G. Imel; M. Paul; R. Pardo; F. Kondev; M. Salvatores; G. Palmiotti

    2011-08-01

    The principle of the proposed experiment is to irradiate very pure actinide samples in the Advanced Test Reactor at INL and, after a given time, determine the amount of the different transmutation products. The determination of the nuclide densities before and after neutron irradiation will allow inference of effective neutron capture cross-sections. This approach has been used in the past and the novelty of this experiment is that the atom densities of the different transmutation products will be determined using the Accelerator Mass Spectrometry technique at the ATLAS facility located at ANL. It is currently planned to irradiate the following isotopes: 232Th, 235U, 236U, 238U, 237Np, 238Pu, 239Pu, 240Pu, 241Pu, 242Pu, 241Am, 243Am, 244Cm and 248Cm.

  1. Radiological Characterization Technical Report on Californium-252 Sealed Source Transuranic Debris Waste for the Off-Site Source Recovery Project at Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Feldman, Alexander [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-04-24

    This document describes the development and approach for the radiological characterization of Cf-252 sealed sources for shipment to the Waste Isolation Pilot Plant. The report combines information on the nuclear material content of each individual source (mass or activity and date of manufacture) with information and data on the radionuclide distributions within the originating nuclear material. This approach allows for complete and accurate characterization of the waste container without the need to take additional measurements. The radionuclide uncertainties, developed from acceptable knowledge (AK) information regarding the source material, are applied to the summed activities in the drum. The AK information used in the characterization of Cf-252 sealed sources has been qualified by the peer review process, which has been reviewed and accepted by the Environmental Protection Agency.

  2. The development and medical applications of a simple facility for partial body in vivo neutron activation analysis using californium-252 sources

    International Nuclear Information System (INIS)

    A simple and cheap facility for partial body neutron activation analysis has been designed, based on the use of two 100 μg 252Cf neutron sources. The results reported show that calcium can be measured in parts of the body such as the tibia with a precision as good as +- 1.6 % for a radiation dose of 2 rem. The uniformity of the thermal neutron flux density is better than +- 3 % over 10 cm. Some applications of this irradiation facility for studies of trace elements, in particular cadmium in liver and aluminium in liver or brain, have also been explored. However, the sensitivity attainable is not yet sufficient for the study of normal levels, but could be of interest in toxicological investigations

  3. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in Cm-248 samples for transmutation studies

    International Nuclear Information System (INIS)

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (Incineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in 248Cm (similar to 97%) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides' formations ranged from 0. 3% to 1. 3%. This uncertainties' range is quite acceptable for the nuclear data to be used in transmutation studies. (authors)

  4. MANTRA: An Integral Reactor Physics Experiment to Infer Actinide Capture Cross-sections from Thorium to Californium with Accelerator Mass Spectrometry

    International Nuclear Information System (INIS)

    The principle of the proposed experiment is to irradiate very pure actinide samples in the Advanced Test Reactor at INL and, after a given time, determine the amount of the different transmutation products. The determination of the nuclide densities before and after neutron irradiation will allow inference of effective neutron capture cross-sections. This approach has been used in the past and the novelty of this experiment is that the atom densities of the different transmutation products will be determined using the Accelerator Mass Spectrometry technique at the ATLAS facility located at ANL. It is currently planned to irradiate the following isotopes: 232Th, 235U, 236U, 238U, 237Np, 238Pu, 239Pu, 240Pu, 241Pu, 242Pu, 241Am, 243Am, 244Cm and 248Cm.

  5. 20 CFR 255.19 - Suspension or termination of the collection of overpayments.

    Science.gov (United States)

    2010-04-01

    ... suspend or terminate collection under the Federal Claims Collection Standards set forth in 4 CFR part 104... justify retention of the claim; (3) The cost of collection action will exceed the amount recoverable;...

  6. 7 CFR 1726.255 - Prior approved contract modifications related to indemnification.

    Science.gov (United States)

    2010-01-01

    ...) RUS Form 257, Contract to Construct Buildings, article IV, section 1(d). (4) RUS Form 786, Electric..., Electric System Construction Contract—Non-Site Specific Construction, article IV, section 1(g). (6) RUS Form 830, Electric System Construction Contract—Project Construction, article IV, section 1(g)....

  7. 47 CFR 15.255 - Operation within the band 57-64 GHz.

    Science.gov (United States)

    2010-10-01

    ...-61.5 GHz, the average power density of any emission, measured during the transmit interval, shall not... average power density of any emission outside of the 61-61.5 GHz band, measured during the transmit... shall not exceed the following: (1) For products other than fixed field disturbance sensors, the...

  8. Design the RS(255,239) encoder and interleaving in the space laser communication system

    Science.gov (United States)

    Lang, Yue; Tong, Shou-feng

    2013-08-01

    Space laser communication is researched by more and more countries. Space laser communication deserves to be researched. We can acquire higher transmission speed and better transmission quality between satellite and satellite, satellite and earth by setting up laser link. But in the space laser communication system,the reliability is under influences of many factors of atmosphere,detector noise, optical platform jitter and other factors. The intensity of the signal which is attenuated because of the long transmission distance is demanded to have higher intensity to acquire low BER. The channel code technology can enhance the anti-interference ability of the system. The theory of channel coding technology is that some redundancies is added to information codes. So it can make use of the checkout polynomial to correct errors at the sink port. It help the system to get low BER rate and coding gain. Reed-Solomon (RS) code is one of the channel code, and it is one kind of multi-ary BCH code, and it can correct both burst errors and random errors, and it is widely used in the error-control schemes. The new method of the RS encoder and interleaving based on the FPGA is proposed, aiming at satisfying the needs of the widely-used error control technology in the space laser communication field. An improved method for Finite Galois Field multiplier of encoding is proposed, and it is suitable for FPGA implementation. Comparison of the XOR gates cost between the optimization and original, the number of XOR gates is lessen more than 40% .Then give a new structure of interleaving by using the FPGA. By controlling the in-data stream and out-data stream of encoder, the asynchronous process of the whole frame is accomplished, while by using multi-level pipeline, the real-time transfer of the data is achieved. By controlling the read-address and write-address of the block RAM, the interleaving operation of the arbitrary depth is synchronously implemented. Compared with the normal method, it could reduce the complexity of the channel encoder and the hardware requirement effectively.

  9. Yeast Interacting Proteins Database: YDL239C, YPL255W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YDL239C ADY3 Protein required for spore wall formation, thought to mediate assembly...ait ORF YDL239C Bait gene name ADY3 Bait description Protein required for spore wall formation, thought to m

  10. Genome sequence of the chemolithoautotrophic nitrite-oxidizing bacterium Nitrobacter winogradskyi Nb-255

    Energy Technology Data Exchange (ETDEWEB)

    Hauser, Loren John [ORNL; Land, Miriam L [ORNL; Larimer, Frank W [ORNL; Arp, D J [Oregon State University; Hickey, W J [University of Wisconsin, Madison

    2006-03-01

    The alphaproteobacterium Nitrobacter winogradskyi (ATCC 25391) is a gram-negative facultative chemolithoautotroph capable of extracting energy from the oxidation of nitrite to nitrate. Sequencing and analysis of its genome revealed a single circular chromosome of 3,402,093 bp encoding 3,143 predicted proteins. There were extensive similarities to genes in two alphaproteobacteria, Bradyrhizobium japonicum USDA110 (1,300 genes) and Rhodopseudomonas palustris CGA009 CG (815 genes). Genes encoding pathways for known modes of chemolithotrophic and chemoorganotrophic growth were identified. Genes encoding multiple enzymes involved in anapleurotic reactions centered on C2 to C4 metabolism, including a glyoxylate bypass, were annotated. The inability of N. winogradskyi to grow on C6 molecules is consistent with the genome sequence, which lacks genes for complete Embden-Meyerhof and Entner-Doudoroff pathways, and active uptake of sugars. Two gene copies of the nitrite oxidoreductase, type I ribulose-1,5-bisphosphate carboxylase/oxygenase, cytochrome c oxidase, and gene homologs encoding an aerobic-type carbon monoxide dehydrogenase were present. Similarity of nitrite oxidoreductases to respiratory nitrate reductases was confirmed. Approximately 10% of the N. winogradskyi genome codes for genes involved in transport and secretion, including the presence of transporters for various organic-nitrogen molecules. The N. winogradskyi genome provides new insight into the phylogenetic identity and physiological capabilities of nitrite-oxidizing bacteria. The genome will serve as a model to study the cellular and molecular processes that control nitrite oxidation and its interaction with other nitrogen-cycling processes.

  11. 255 Chronic Obstructive Pulmonary Disease and Lung Cancer Share Inflammation Pathways

    OpenAIRE

    Kostas N. Syrigos; POLITI, EKATERINI; Makrilia, Nektaria; Tsimpoukis, Sotirios; Psarros, Fotis; Syrigou, Ekaterini; Dannos, Ioannis

    2012-01-01

    Background The relationship between inflammation, air obstruction and lung cancer is complex and there is still great uncertainty regarding their underlying pathophysiology. Our aim was to investigate the inflammation pathways that are implicated in both chronic obstructive pulmonary disease (COPD) and lung cancer. Methods A literature search was performed in PubMed to identify relative studies published until June 2011. Results The pathophysiology of both COPD and lung cancer includes dysreg...

  12. People and things. CERN Courier, Jun 1985, v. 25(5)

    International Nuclear Information System (INIS)

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. To honour one of the greatest physicists of the century, who died last October, and a staunch friend, the International Centre for Theoretical Physics in Trieste has announced the Paul Adrien Dirac Gold Medal Award, to be given annually for highest achievement in theoretical physics. The International Committee for Future Accelerators, ICFA, held its twelfth meeting at the Tata Institute of Fundamental Research, Bombay, on 10 April. The CERN Accelerator School was greatly encouraged by the response to the General Accelerator Physics Course organized last year in collaboration with the Orsay and Saclay Laboratories in France. On 11 March, the International Centre for Theoretical Physics (ICTP) in Trieste paid tribute to the memory of Alfred Kastler, Nobel Laureate for Physics 1966 and Chairman of the ICTP Scientific Council from 1970 to 1982, who died on 7 January 1984

  13. Yeast Interacting Proteins Database: YIL106W, YBR255W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available this prey as prey (1) Rows with this prey as bait Rows with this prey as bait (0) Literature on bait (YPD) 9 Literature... on prey (YPD) 5 Literature shared by bait and prey 2 Literature sharing score 2 CuraGen (0 or 1)

  14. 76 FR 255 - Amendments To Form ADV; Extension of Compliance Date

    Science.gov (United States)

    2011-01-04

    ... treatment for newly registering advisers, we are also persuaded that the limited extension of the compliance... COMMISSION 17 CFR Parts 275 and 279 RIN 3235-AI17 Amendments To Form ADV; Extension of Compliance Date AGENCY: Securities and Exchange Commission. ACTION: Final rule; extension of compliance date. SUMMARY: The...

  15. Far Infrared Variability of Sagittarius A*: 25.5 hr of Monitoring with Herschel

    Science.gov (United States)

    Stone, Jordan M.; Marrone, D. P.; Dowell, C. D.; Schulz, B.; Heinke, C. O.; Yusef-Zadeh, F.

    2016-07-01

    Variable emission from Sgr A*, the luminous counterpart to the super-massive black hole at the center of our Galaxy, arises from the innermost portions of the accretion flow. Better characterization of the variability is important for constraining models of the low-luminosity accretion mode powering Sgr A*, and could further our ability to use variable emission as a probe of the strong gravitational potential in the vicinity of the 4× {10}6{M}ȯ black hole. We use the Herschel Spectral and Photometric Imaging Receiver (SPIRE) to monitor Sgr A* at wavelengths that are difficult or impossible to observe from the ground. We find highly significant variations at 0.25, 0.35, and 0.5 mm, with temporal structure that is highly correlated across these wavelengths. While the variations correspond to \\lt 1 % changes in the total intensity in the Herschel beam containing Sgr A*, comparison to independent, simultaneous observations at 0.85 mm strongly supports the reality of the variations. The lowest point in the light curves, ∼0.5 Jy below the time-averaged flux density, places a lower bound on the emission of Sgr A* at 0.25 mm, the first such constraint on the THz portion of the spectral energy distribution. The variability on few hour timescales in the SPIRE light curves is similar to that seen in historical 1.3 mm data, where the longest time series is available, but the distribution of variations in the sub-mm do not show a tail of large-amplitude variations seen at 1.3 mm. Simultaneous X-ray photometry from XMM-Newton shows no significant variation within our observing period, which may explain the lack of very large submillimeter variations in our data if X-ray and submillimeter flares are correlated. Herschel is an ESA space observatory with science instruments provided by European-led Principal Investigator consortia and with important participation from NASA.

  16. 41 CFR 102-73.255 - What factors must Executive agencies consider when purchasing sites?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What factors must... Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION REAL PROPERTY 73-REAL ESTATE ACQUISITION Acquisition by Purchase or Condemnation Buildings §...

  17. Yeast Interacting Proteins Database: YBR270C, YPL255W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YBR270C BIT2 Subunit of TORC2, a membrane-associated complex that regulates actin cytos... gene name BIT2 Bait description Subunit of TORC2, a membrane-associated complex that regulates actin cytos...uplication, localized at the central plaque periphery; forms a complex with a nuclear envelope protein Mps2p and SPB compo... (SPB) duplication, localized at the central plaque periphery; forms a complex with a nuclear envelope protein Mps2p and SPB compo...in (YPD) 0 Alternative path with 2 intervening proteins (YPD) 0 IST hit 17 IST hit in the opposite bait/prey orientation - ...

  18. Yeast Interacting Proteins Database: YEL062W, YPL255W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YEL062W NPR2 Component, with Npr3p, of an evolutionarily conserved complex that mediates...cription Component, with Npr3p, of an evolutionarily conserved complex that mediates downregulation of TOR Comp... central plaque periphery; forms a complex with a nuclear envelope protein Mps2p and SPB components Spc29p a...lex with a nuclear envelope protein Mps2p and SPB components Spc29p and Kar1p; required for mit...rnative path with 1 intervening protein (YPD) 0 Alternative path with 2 intervening proteins (YPD) 0 IST hit 3 IST hit in the opposite bait/prey orientation - ...

  19. Far Infrared Variability of Sagittarius A*: 25.5 Hours of Monitoring with $Herschel$

    CERN Document Server

    Stone, Jordan M; Dowell, C D; Schulz, B; Heinke, C O; Yusef-Zadeh, F

    2016-01-01

    Variable emission from Sgr~A*, the luminous counterpart to the super-massive black hole at the center of our Galaxy, arises from the innermost portions of the accretion flow. Better characterization of the variability is important for constraining models of the low-luminosity accretion mode powering Sgr~A*, and could further our ability to use variable emission as a probe of the strong gravitational potential in the vicinity of the $4\\times10^{6}\\mathrm{M}_{\\odot}$ black hole. We use the \\textit{Herschel} Spectral and Photometric Imaging Receiver (SPIRE) to monitor Sgr~A* at wavelengths that are difficult or impossible to observe from the ground. We find highly significant variations at 0.25, 0.35, and 0.5 mm, with temporal structure that is highly correlated across these wavelengths. While the variations correspond to $<$1% changes in the total intensity in the \\textit{Herschel} beam containing Sgr~A*, comparison to independent, simultaneous observations at 0.85 mm strongly supports the reality of the var...

  20. 18 CFR 2.55 - Definition of terms used in section 7(c).

    Science.gov (United States)

    2010-04-01

    ... and maintenance, and stream and wetland crossings. (4) Annual report. On or before May 1 of each year... paper copies) an annual report that lists for the previous calendar year each replacement project that... company does not have to include in this annual report any above-ground replacement project that did...

  1. ERROR DETECTION USIN G BINARY BCH (255, 2 15, 5) CODES

    OpenAIRE

    Sahana C*, V Anandi

    2015-01-01

    Error - correction codes are the codes used to correct the errors occurred during the transmission of the data in the unreliable communication medi ums. Error detection is the detection of errors caused by noise or other impairments during transmission from the transmitter to the receiver. The idea behind these codes is to add redundancy bits to the data being transmitted so that even if some errors o ccur due to noise in the channel, the data can be ...

  2. 28 CFR 2.55 - Disclosure of file prior to parole hearing.

    Science.gov (United States)

    2010-07-01

    ... CFR 2.14 the Commission only considers information concerning significant developments or changes in... disclosure for interim hearings will be limited to such information. (c) Exemption to disclosure (18 U.S.C... of disclosure. When a timely request has been made for disclosure, if any document or summary of...

  3. Intergrated plant safety assessment. Systematic evaluation program. Palisades plant, Consumers Power Company, Docket No. 50-255. Final report

    International Nuclear Information System (INIS)

    The Nuclear Regulatory Commission (NRC) has published its Final Integrated Plant Safety Assessment Report (IPSAR) (NUREG-0820), under the scope of the Systematic Evaluation Program (SEP), for Consumers Power Company's Palisades Plant located in Covert, Van Buren County, Michigan. The SEP was initiated by the NRC to review the design of older operating nuclear reactor plants to reconfirm and document their safety. This report documents the review completed under the SEP for the Palisades Plant. The review has provided for (1) as assessment of the significance of differences between current technical positions on selected safety issues and those that existed when the Palisades Plant was licensed, (2) a basis for deciding on how these differences should be resolved in an integrated plant review, and (3) a documented evaluation of plant safety when all supplements to the Final IPSAR and the Safety Evaluation Report for converting the license from a provisional to a full-term license have been issued. The report also addresses the comments and recommendations made by the Advisory Committee on Reactor Safeguards in connection with its review of the Draft Report, issued in April 1982

  4. Safety Evaluation Report related to the full-term operating license for Palisades Nuclear Plant (Docket No. 50-255)

    International Nuclear Information System (INIS)

    The Safety Evaluation Report for the full-term operating license application filed by the Consumers Power Company for the Palisades Nuclear Plant has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. The facility is located in Van Buren County, South Haven, Michigan. The staff has evaluated the issues related to the conversion of the provisional operating license to a full-term operating license and concludes that the facility can continue to be operated without endangering the health and safety of the public. 98 refs., 1 fig

  5. Institutional Care and Iron Deficiency Increase ADHD Symptomology and Lower IQ 2.5-5 Years Post-adoption

    OpenAIRE

    Doom, Jenalee R.; Georgieff, Michael K.; Gunnar, Megan R.

    2014-01-01

    Increased ADHD symptomology and lower IQ have been reported in internationally adopted (IA) children compared to non-adopted peers (Hostinar et al., 2013; Kreppner, O’Connor, & Rutter, 2001). However, it is unclear whether these outcomes are due to institutional deprivation specifically or to co-occurring micronutrient deficiencies that disrupt brain development (Fuglestad et al., 2008). In this study, IA children were compared to children raised in their biological families to examine differ...

  6. 78 FR 62329 - Special Local Regulation; Tennessee River, Miles 255.0 to 256.5, Florence, AL

    Science.gov (United States)

    2013-10-17

    ... Security FR Federal Register NPRM Notice of Proposed Rulemaking A. Regulatory History and Information The... pursuant to authority under section 4(a) of the Administrative Procedure Act (APA) (5 U.S.C. 553(b)). This... ON NAVIGABLE WATERS 0 1. The authority citation for Part 100 continues to read as follows:...

  7. 41 CFR 102-75.255 - What are disposal agencies' specific responsibilities concerning the disposal of surplus property?

    Science.gov (United States)

    2010-07-01

    ... property? The disposal agency must determine that there is no further Federal need or requirement for the... this determination, the disposal agency must expeditiously make the surplus property available for... by public advertising, negotiation, or other disposal action. The disposal agency must consider...

  8. 20 CFR 645.255 - What nondiscrimination protections apply to participants in Welfare-to-Work programs?

    Science.gov (United States)

    2010-04-01

    ... requirements of 29 CFR 37.70-37.80. (c) Complaints alleging discrimination in violation of any applicable... funds, shall not be discriminated against because of gender. Participants alleging gender discrimination... subpart (section 403(a)(5)(J)(iii)) of the Act). Participants alleging gender discrimination in...

  9. Demaria C., 2004, Développement durable et finance, Paris : Maxima Laurent du Mesnil Editeur, 255 p.

    Directory of Open Access Journals (Sweden)

    Marianne Rubinstein

    2005-05-01

    Full Text Available L’objectif de l’ouvrage de Cyril Demaria est de mettre à jour le lien existant entre développement durable et logique financière, de traiter du paradoxe apparent selon lequel la transition des sociétés vers le développement durable doit plus aux forces de marché qu’à toute autre dynamique : « le fait que les principaux leviers au service du développement durable soient les fonds d’investissement et les marchés financiers rompt donc avec une vision ‘révolutionnaire’ associée au développement d...

  10. A novel mutation, Y255X, of the ARSB gene in a Chinese family with mucopolysaccharidosis type Ⅵ

    Institute of Scientific and Technical Information of China (English)

    林青雲; 陳安琪; 赖志刚; 陳(亻)雄; 陳恩和; 石志忠; 湯瑞芬

    2004-01-01

    @@ Mucopolysaccharidoses (MPS) are lysosomal storage diseases with defective degradation of glycosa-minoglycans. Mucopolysaccharidosis type Ⅵ (MPS Ⅵ) or Maroteaux-Lamy syndrome is caused by defective arylsulfatase B in the lysosomes (ARSB; N-acetylgalactosamine-4-sulfatase, EC 3.1.6.12). The clinical manifestations of MPS VI include coarse facial features, growth retardation, short stature, skeletal malformations, hepatosplenomegaly, corneal clouding, and cervical myelopathy. Heart failure is the usual cause of death in the second or third decade of life. Despite all the physical disabilities, the intellect of MPS Ⅵ patients is preserved.1

  11. Freeze drying method for preparing radiation source material

    International Nuclear Information System (INIS)

    Fabrication of a neutron source is specifically claimed. A palladium/californium solution is freeze dried to form a powder which, through conventional powder metallurgy, is shaped into a source containing the californium evenly distributed through a palladium metal matrix. (E.C.B.)

  12. Review of RBE and OER values for Cf-neutrons

    International Nuclear Information System (INIS)

    Californium-252, an isotope emitting neutrons, gamma photons and alpha particles, is being investigated for its practical use in intracavitary and interstitial brachytherapy. A review of published RBE and OER values for californium neutrons as a function of dose rate for a variety of biological endpoints is given. (Auth.)

  13. Detection of parent H2O and CO2 molecules in the 2.5--5 micron spectrum of comet C/2007 N3 (Lulin) observed with AKARI

    CERN Document Server

    Ootsubo, Takafumi; Kawakita, Hideyo; Ishiguro, Masateru; Furusho, Reiko; Hasegawa, Sunao; Ueno, Munetaka; Watanabe, Jun-ichi; Sekiguchi, Tomohiko; Wada, Takehiko; Ohyama, Youichi; Oyabu, Shinki; Matsuhara, Hideo; Onaka, Takashi; Nakagawa, Takao; Murakami, Hiroshi

    2010-01-01

    Comet C/2007 N3 (Lulin) was observed with the Japanese infrared satellite AKARI in the near-infrared at a post-perihelion heliocentric distance of 1.7 AU. Observations were performed with the spectroscopic (2.5--5.0 micron) and imaging (2.4, 3.2, and 4.1 micron) modes on 2009 March 30 and 31 UT, respectively. AKARI images of the comet exhibit a sunward crescent-like shape coma and a dust tail extended toward the anti-solar direction. The 4.1 micron image (CO/CO2 and dust grains) shows a distribution different from the 2.4 and 3.2 micron images (H2O and dust grains). The observed spectrum shows distinct bands at 2.66 and 4.26 micron, attributed to H2O and CO2, respectively. This is the fifth comet in which CO2 has been directly detected in the near-infrared spectrum. In addition, CO at 4.67 micron and a broad 3.2--3.6 micron emission band from C-H bearing molecules were detected in the AKARI spectrum. The relative abundance ratios CO2/H2O and CO/H2O derived from the molecular production rates are \\sim 4%--5% a...

  14. Fission coincident neutrons from the reactions p + sup(235,236,238)U with protons between 12,7 and 25.5 MeV

    International Nuclear Information System (INIS)

    With the proton beam of the Hamburg isochronous cyclotron (HAIZY) thin uranium targets with the mass numbers 235, 236, and 238 were bombarded. Both fragments from the fission of the Np reaction systems and the neutrons coincident with the fragments were detected in the plane perpendicular to the beam direction. Measured and stored event by event were for all particles the times of flight. The detection of the neutron succeeded in conventional time-of-flight technique with NE213 liquid scintillators. A fission detector system with plastic scintillator foils was developed. It permits high event rates over long measuring times and allows the choice of so long neutron flight paths that a neutron energy resolution between 2% and 4% could be reached. The determination of the fragment masses is in spite of the short flight paths of 15 respectively 21 cm possible to +-2 amu. The isotropic component das discussed under the assumption that it is composed of prefission and scission neutrons which were emitted befor fission respectively during the fragmentation. From the post fission results the distribution of the excitation energy to both fragments was determined in dependence of Esup(*) and the fragment mass. (orig./HSI)

  15. Determination of the Effectiveness of Intermediate Algebra-Accelerated (Math 255) as Preparation for Student Success in a Transferable Mathematics Course

    Science.gov (United States)

    Sworder, Steven C.

    2011-01-01

    Background: The Mathematics Department at Saddleback College created a 3-units intermediate algebra course as an alternative to the traditional 5-units intermediate algebra course. Forty percent of the material in the traditional course was composed of review topics from beginning algebra. The 3-units course did not contain that rehash of…

  16. A new shipping container for an intense neutron emitter

    International Nuclear Information System (INIS)

    Californium-252 is an intense neutron emitter (2.34 x 1012 n/s·g) used in medicine, research, and industry. The western world's sole source of this rare radioisotope is the Californium Facility at Oak Ridge National Laboratory's Radiochemical Engineering Development Center (REDC). A project has been initiated at the REDC to design a new Type B Californium Shipping Container. This effort is essential for future transportation of californium to meet the needs of users all over the world. The shipping container must meet all requirements for transport by motor freight, air, vessel, and rail, both domestic and foreign. There are unique problems in the design, fabrication, and licensing of a new Type B shipping container that will accommodate up to 60 milligrams of californium-252. One of the first challenges in the design phase of the project is the selection of a material to shield the high neutron flux. The more stringent safety precautions of today's world impel us to consider more exotic materials for such a purpose. The candidate materials must be examined not just for their neutron shielding properties, but also in conjunction with other properties such as thermal and structural requirements to withstand the hypothetical accident conditions. The design and building of such a container is a formidable task requiring much planning. The licensing process, with the complex, interactive federal codes, is a special challenge and may be the biggest on the project in terms of time and money

  17. Application of Cf for the quantitative measurement of nuclear reactor fuel materials

    International Nuclear Information System (INIS)

    Sensitive and rapid measurements of the quantity and geometric distribution of nuclear reactor fuel materials can be made using neutrons from californium. The neutron-induced fission rate in these materials may be measured by detection of either prompt radiations from fission or delayed radiations from radioactive fission products. A number of californium-based instruments are presently in use by the nuclear industry for purposes of process control, quality control, nuclear materials safeguards, and environmentl assessment. An Automated Fuel Rod Scanner (AFRS) is used for high-speed measurement of the uniformity of loading and total fissile content of reactor fuel rods. The fuel rods are moved first through an irradiator containing about 1 mg of californium, and subsequently through high-efficiency detectors for the measurement of fission-product gamma-rays. Multiple detectors on each of two irradiation channels are used to reduce the californium source strength requirement. The fuel loading of each 15-mm-long pellet is tested to +-10% on 100% of the plant throughput. By summing the response over length, the total fissile material content of the fuel rod is measured to better than 0.5%. An on-line computer for data processing allows the instrument to measure about 150 rods per hour with a single operator. The same activation concept is used with a 25-μg californium source in a Small Sample Assay System (SSAS) which measures the fissile content of fuel pellet sized samples with a precision of 0.5%

  18. Ewa Głażewska, Urszula Kusio, Komunikacja niewerbalna. Płeć i kultura. Wybrane zagadnienia, Lublin, Wydawnictwo Uniwersytetu Marii Curie-Skłodowskiej, 2012, 255 s., ISBN 978-83-7784-177-8

    Directory of Open Access Journals (Sweden)

    Paulina Banaśkiewicz

    2014-07-01

    Full Text Available Autorka recenzji opisuje pokrótce zawartość dwóch części książki na temat komunikacji niewerbalnej celem skupienia się na trzech walorach publikacji: konstrukcji książki, prezentacji niezbyt dobrze znanych w Polsce koncepcji wybitnych antropologów i socjologów oraz liczebności eksplikacji, które służą zilustrowaniu rozważań teoretycznych.English abstractThe author briefly describes the contents of the two parts of the book about non-verbal communication to focus on three qualities: design of the book, not very well known in Poland concepts of eminent anthropologists and sociologists and the number of explications, which illustrate the theoretical considerations. 

  19. Vlasov B. Natural properties of Karst lakes in Belarus / B. Vlasov // Lakes and artificial water reservoirs – functioning, revitalization and protection. – Cosnowiec, 2005. – Р. 249–255.

    OpenAIRE

    Vlasov, Boris

    2005-01-01

    Abstract: Karst lakes of Belarus belong to the azonal type and are distributed in Polesje region in the area of superficial deposition of chalk rocks. Specific features of these type lakes include: small water surface, tunneled form of a hollow, low water exchange rate and increased level of water mineralization; the lakes refer to mesotrophic or eutrophic types.

  20. DETECTION OF PARENT H2O AND CO2 MOLECULES IN THE 2.5-5 μm SPECTRUM OF COMET C/2007 N3 (LULIN) OBSERVED WITH AKARI

    International Nuclear Information System (INIS)

    Comet C/2007 N3 (Lulin) was observed with the Japanese infrared satellite AKARI in the near-infrared at a post-perihelion heliocentric distance of 1.7 AU. Observations were performed with the spectroscopic (2.5-5.0 μm) and imaging (2.4, 3.2, and 4.1 μm) modes on 2009 March 30 and 31 UT, respectively. AKARI images of the comet exhibit a sunward crescent-like shape coma and a dust tail extended toward the anti-solar direction. The 4.1 μm image (CO/CO2 and dust grains) shows a distribution different from the 2.4 and 3.2 μm images (H2O and dust grains). The observed spectrum shows distinct bands at 2.66 and 4.26 μm, attributed to H2O and CO2, respectively. This is the fifth comet in which CO2 has been directly detected in the near-infrared spectrum. In addition, CO at 4.67 μm and a broad 3.2-3.6 μm emission band from C-H bearing molecules were detected in the AKARI spectrum. The relative abundance ratios CO2/H2O and CO/H2O derived from the molecular production rates are ∼4%-5% and 2 among all observed comets.

  1. A Child Development Centre (C.D.C.) Based on the World of Work and Everyday Life: A Case of Quality Education Provision for 2.5-5 Year Old Children.

    Science.gov (United States)

    Frangos, Christos

    1993-01-01

    Outlines the organization and activities of the Child Development Centre (CDC) of Aristotle University in Thessaloniki, which operates as a model preschool and kindergarten for over 300 similar institutions throughout Greece. The CDC utilizes art, music, visits to workplaces, movement activities, foreign languages and customs, computers,and free…

  2. Application of PGNAA to preincineration assay of combustible waste for chlorine

    Energy Technology Data Exchange (ETDEWEB)

    Gehrke, R.J.; Pawelko, R.J.; Greenwood, R.C. [Idaho National Engineering Lab., Idaho Falls, ID (United States)

    1995-12-31

    A prompt gamma neutron activation analysis method is being developed for on-stream pre-incineration assay of low level radioactive combustible waste for it`s chlorine content. The assay system consists of three californium 252 sources and a germanium or scintillation gamma-ray spectrometer.

  3. Magnetic measurements of the transuranium elements. Progress report, January 1, 1984-December 31, 1984

    International Nuclear Information System (INIS)

    Measurements of the magnetic properties of dhcp californium-249 metal indicated the presence of three regions of differing magnetic character. Additional measurements are also reported. Magnetic moments and valence states of terbium in TbF3, BaTbO3, and TbO18 are discussed. Progress on high-field operation of the micro-magnetic susceptometer is reported

  4. Source storage and transfer cask: Users Guide

    International Nuclear Information System (INIS)

    The storage and shield cask for the dual californium source is designed to shield and transport up to 3.7 mg (2 Ci) of 252Cf. the cask meets Department of Transportation (DOT) license requirements for Type A materials (DOT-7A). The cask is designed to transfer sources to and from the Flourinel and Fuel Storage (FAST) facility delayed-neutron interrogator. Californium sources placed in the cask must be encapsulated in the SR-CF-100 package and attached to Teleflex cables. The cask contains two source locations. Each location contains a gear box that allows a Teleflex cable to be remotely moved by a hand crank into and out of the cask. This transfer procedure permits sources to be easily removed and inserted into the delayed-neutron interrogator and reduces personnel radiation exposure during transfer. The radiation dose rate with the maximum allowable quantity of californium (3.7 mg) in the cask is 30 mR/h at the surface and less than 2 mR/h 1 m from the cask surface. This manual contains information about the cask, californium sources, describes the method to ship the cask, and how to insert and remove sources from the cask. 28 figs

  5. Discovery of Isotopes of the Transuranium Elements with 93 <= Z <= 98

    OpenAIRE

    Fry, C; Thoennessen, M

    2012-01-01

    One hundred and five isotopes of the transuranium elements neptunium, plutonium, americium, curium, berkelium and californium have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  6. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC255 (Link to dictyBase) - - - Contig-U16272-1 VFC255P (Link... to Original site) VFC255F 198 VFC255Z 525 VFC255P 723 - - Show VFC255 Library VF (Link to library) Clone ID VFC255 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16272-1 Original site URL http://dict...oducing significant alignments: (bits) Value N L08391 |L08391.1 Dictyostelium discoideum ribosomal protein (...ic 32.0 %: nuclear 4.0 %: Golgi 4.0 %: mitochondrial >> prediction for VFC255 is cyt 5' end seq. ID VFC255F

  7. Effect of whole body exposure to fast neutrons on the liver function of rats

    International Nuclear Information System (INIS)

    The effect of low level radiation doses is the subject of serious investigations and there is concern that the degree of hazards may be higher than has been assumed in the past. The increasing number of individuals who are being exposed to low level of fast neutron doses during their work and radiotherapy raised the need for the estimation of the degree of hazards of low level fast neutron doses. The present study was conducted to investigate the direct effect of whole body exposure to low level doses of fast neutrons on the liver function of rats. Rats were divided into five groups; the first group was non-irradiated controls and the others were exposed to fast neutrons from californium-252 source at fluencies of 105, 106, 107 and 108 n/cm2, respectively. The activities of plasma glutamic oxaloacetic transaminase (GOT), glutamic pyruvic transaminase (GPT) and alkaline phosphatase (ALP) as well as the plasma concentrations of cholesterol and total bilirubin for all groups were estimated. Significant increases in GOT activity of values 4.27, 4.21, 2.55 and 1.49 times that of controls were observed for rats exposed to 105, 106, 107 and 108 n /cm2, respectively. On the other hand, significant increases in GPT activity of values 1.23, 1.57, 1.66 and 2.7 times that of controls were observed after whole body exposure to 105, 106, 107 and 108 n/cm2, respectively. A significant increase in ALP activity of percentage 12.49% was observed as a result of exposure to 105 n/cm2, while a net drop in the activity of this enzyme of percentages 49.7%, 72.52% and 78.85% was observed after exposure to 106, 107 and 108 n/cm2, respectively. Exposing rats to 105 n/cm2 led to a significant increase in plasma concentration of cholesterol of value 2.04 times that of controls, while the exposure to 106 and 107 n /cm2 led to a significant drop in the concentration of this compound with percentages of 45.14% and 24.05%, respectively, when compared to controls. The results showed significant

  8. Gclust Server: 145031 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 145031 HSA_21450717 Cluster Sequences - 255 NP_659443.1 sushi domain containing 3 ;...nk to cluster sequences Cluster Sequences Link to related sequences - Sequence length 255 Representative annotation NP_659443.1 sushi

  9. 76 FR 11254 - Agency Information Collection Activities: Declaration of Unaccompanied Articles

    Science.gov (United States)

    2011-03-01

    ... Unaccompanied Articles AGENCY: U.S. Customs and Border Protection (CBP), Department of Homeland Security. ACTION... the Declaration of Unaccompanied Articles (CBP Form 255). This request for comment is being made... Unaccompanied Articles. OMB Number: 1651-0030. Form Number: CBP Form 255. Abstract: CBP Form 255 is completed...

  10. Oxidation of microquantities of transplutonium elements to tetravalent state in mineral acid solutions and their stability

    International Nuclear Information System (INIS)

    Kinetics of americium(3) microquantity oxidation and stability of forming americium(4), as well as possibility of curium and californium oxidation to tetravalent state in solutions of sulfuric and nitric acids depending on the concentration of mineral acid, potassium tungstophosphate and ammonium persulfate are studied by the extraction method. It is shown that curium(3) and californium(3) in solutions of 0.05-2.5 mol/l H2SO4 and HNO3 containing 10-3 mol/l potassium tungstophosphate is not practically oxidized by the mixture of silver nitrate and ammonium persulfate. Americium(3) is oxidized to the utmost to Am(4) for 2-3 min at room temperature, but stability of Am(4) depends on the concentration of sulfuric acid and potassium tungstophosphate

  11. Characterization of berkelium(III) dipicolinate and borate compounds in solution and the solid state.

    Science.gov (United States)

    Silver, Mark A; Cary, Samantha K; Johnson, Jason A; Baumbach, Ryan E; Arico, Alexandra A; Luckey, Morgan; Urban, Matthew; Wang, Jamie C; Polinski, Matthew J; Chemey, Alexander; Liu, Guokui; Chen, Kuan-Wen; Van Cleve, Shelley M; Marsh, Matthew L; Eaton, Teresa M; van de Burgt, Lambertus J; Gray, Ashley L; Hobart, David E; Hanson, Kenneth; Maron, Laurent; Gendron, Frédéric; Autschbach, Jochen; Speldrich, Manfred; Kögerler, Paul; Yang, Ping; Braley, Jenifer; Albrecht-Schmitt, Thomas E

    2016-08-26

    Berkelium is positioned at a crucial location in the actinide series between the inherently stable half-filled 5f(7) configuration of curium and the abrupt transition in chemical behavior created by the onset of a metastable divalent state that starts at californium. However, the mere 320-day half-life of berkelium's only available isotope, (249)Bk, has hindered in-depth studies of the element's coordination chemistry. Herein, we report the synthesis and detailed solid-state and solution-phase characterization of a berkelium coordination complex, Bk(III)tris(dipicolinate), as well as a chemically distinct Bk(III) borate material for comparison. We demonstrate that berkelium's complexation is analogous to that of californium. However, from a range of spectroscopic techniques and quantum mechanical calculations, it is clear that spin-orbit coupling contributes significantly to berkelium's multiconfigurational ground state. PMID:27563098

  12. Neutron activation determination of gold in technogenic raw materials with different mineral composition

    OpenAIRE

    Yudakov Aleksandr A.; Ivannikov Sergey I.; Zheleznov Veniamin V.; Taskin Andrei V.; Tsybulskaya Oksana N.

    2015-01-01

    The methods used to determine the gold content in the technogenic objects of gold mining were analyzed regarding their non-homogeneity and complexity of chemical and mineral compositions. A possible application of the neutron activation analysis with the use of the californium source of neutrons for determining the content of fine-grained and extra-fine-grained gold in the technogenic objects, including the bottom-ash waste of energy providers, is considere...

  13. Jak bylo objeveno spontánní štěpení

    Czech Academy of Sciences Publication Activity Database

    Vobecký, Miloslav

    Praha: Spektroskopická společnost J.M. Marci, 2010 - (Vobecký, M.), s. 5-10 ISBN 978-80-904539-0-6. [Seminář Radioanalytické metody IAA 10. Praha (CZ), 30.06.2010-01.07.2010] Institutional research plan: CEZ:AV0Z40310501 Keywords : spontaneous fission * fission -track dating method * californium 252 neutron source Subject RIV: CB - Analytical Chemistry, Separation

  14. Study of heavy particle decay from superheavy elements by SK model

    International Nuclear Information System (INIS)

    Heavy nuclei usually decay by alpha decay or spontaneous fission. These two decay modes are generally the most probable competing processes. Another less probable decay process is cluster radioactivity in which nuclei from carbon to silicon are emitted from Radium to Californium leading to the most stable daughter nucleus, lead. This work reports such a study using the cubic plus Yukawa plus exponential model of Shanmugam and Kamalaharan (SK)

  15. Measurement of the energy spectra of fission fragments using nuclear track detectors and digital image processing

    International Nuclear Information System (INIS)

    Energy spectra of fission fragments were determined using a Nuclear Track Methodology (NTM) supported by digital image analysis and numerical data processing using a standard personal computer. The analysis of a californium (252Cf) spectrum with this approach shows improvement compared with the values reported previously using the standard procedure, in terms of resolution and accuracy. This new method adds full automation to the technical advantages and cost effectiveness of an NTM.

  16. Heavy ion tests on programmable VLSI

    International Nuclear Information System (INIS)

    The radiation from space environment induces operation damages in onboard computers systems. The definition of a strategy, for the Very Large Scale Integrated Circuitry (VLSI) qualification and choice, is needed. The 'upset' phenomena is known to be the most critical integrated circuit radiation effect. The strategies for testing integrated circuits are reviewed. A method and a test device were developed and applied to space applications candidate circuits. Cyclotron, synchrotron and Californium source experiments were carried out

  17. Properties of neutron sources

    International Nuclear Information System (INIS)

    The Conference presentations were divided into sessions devoted to the following topics: white neutron sources, primarily pulsed (6 papers); fast neutron fields (5 papers); Californium-252 prompt fission neutron spectra (14 papers); monoenergetic sources and filtered beams (11 papers); 14 MeV neutron sources (10 papers); selected special application (one paper); and a general interest session (4 papers). Individual abstracts were prepared separately for the papers

  18. Neutron multiplicities for the transplutonium nuclides

    International Nuclear Information System (INIS)

    This paper continues, with respect to the transplutonium nuclides, earlier efforts to collate and evaluate data from the scientific literature on the prompt neutron multiplicity distribution from fission and its first moment = ΣnuPnu. The isotopes considered here for which P/sub nu/ and or data (or both) were found in the literature are of americium (Am), curium (Cm), berkelium (Bk), californium (Cf), einsteinium (Es), fermium (Fm), and nobelium (No)

  19. 40 CFR 65.14 - Addresses.

    Science.gov (United States)

    2010-07-01

    ... Drive, Hanford, California 93230. (xiv) Lake County Air Pollution Control District, 255 North Forbes... Department of Health and Environment, Bureau of Air Quality and Radiation Control, Forbes Field,...

  20. Dependence of metal partition coefficients in D2EHPA capacity on extraction from acid solutions

    International Nuclear Information System (INIS)

    In devising solvent-extraction schemes for extracting the transplutonium elements (TPE), one usually employs the partition coefficients K/sub p/ for trace amounts; when the results are transferred to weighable amounts of the elements, there are difficulties because one lacks capacity characteristics for the extractants under the conditions used. They have determined the capacity of D2EHPA over a wide range in acidity (0.001-2 mole/liter) in relation to dysprosium (the analog of californium) in the system formed by D2EHPA with nitric acid by saturating a set volume of the extractant with dysprosium in nitric acid containing the necessary amount of free acid

  1. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  2. NONDESTRUCTIVE IDENTIFICATION OF CHEMICAL WARFARE AGENTS AND EXPLOSIVES BY NEUTRON GENERATOR-DRIVEN PGNAA

    International Nuclear Information System (INIS)

    Prompt gamma-ray neutron activation analysis (PGNAA) is now a proven method for the identification of chemical warfare agents and explosives in military projectiles and storage containers. Idaho National Laboratory is developing a next-generation PGNAA instrument based on the new Ortec Detective mechanically-cooled HPGe detector and a neutron generator. In this paper we review PGNAA analysis of suspect chemical warfare munitions, and we discuss the advantages and disadvantages of replacing the californium-252 radioisotopic neutron source with a compact accelerator neutron generator

  3. NONDESTRUCTIVE IDENTIFICATION OF CHEMICAL WARFARE AGENTS AND EXPLOSIVES BY NEUTRON GENERATOR-DRIVEN PGNAA

    Energy Technology Data Exchange (ETDEWEB)

    T. R. Twomey; A. J. Caffrey; D. L. Chichester

    2007-02-01

    Prompt gamma-ray neutron activation analysis (PGNAA) is now a proven method for the identification of chemical warfare agents and explosives in military projectiles and storage containers. Idaho National Laboratory is developing a next-generation PGNAA instrument based on the new Ortec Detective mechanically-cooled HPGe detector and a neutron generator. In this paper we review PGNAA analysis of suspect chemical warfare munitions, and we discuss the advantages and disadvantages of replacing the californium-252 radioisotopic neutron source with a compact accelerator neutron generator.

  4. Composition containing transuranic elements for use in the homeopathic treatment of aids

    International Nuclear Information System (INIS)

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)

  5. Neutron nondestructive essay of the plutonium metal parts

    International Nuclear Information System (INIS)

    Based on the principle of neutron multiplicity and data unfolding mathematics, this paper developed the software which can execute the neutron multiplicity analysis, neutron attenuation analysis, parameter calibration, Pu mass solution with the neutron pulse sequence acquisition method. The measurement system consisted of detector,nuclear electronic apparatus, pulsed sequence acquisition and analysis software was tested and calibrated by californium source. Three mental plutonium components with different mass were used for experimental assay and validation, which showed that the assay bias was within 15% against the nominal value of the samples. (authors)

  6. Physical-chemical studies of transuranium elements. Progress report, April 1, 1982-March 31, 1983

    International Nuclear Information System (INIS)

    Progress is reported on the following topics: electrochemical and spectroscopic studies of less-stable higher oxidation states of transuranium elements in complexing aqueous media; spectroscopic and electrochemical studies of selected lanthanides and actinides in molten dimethyl sulfone; spectroelectronchemical studies of the Ce(IV)/Ce(III) couple in aqueous carbonate solutions; characterization of actinide orthophosphates by Raman and absorption spectrophotometries and by x-ray diffraction; relativistic multiple scattering calculations on transuranium element compounds; Raman spectroscopic studies of natural minerals containing the uranyl ion; and solution calorimetry of californium metal

  7. Transuranium element production. II. Chemical processing of targets

    International Nuclear Information System (INIS)

    The chemical processing described concerns small experimental targets irradiated in OSIRIS or EL-III and industrial targets irradiated in the CELESTIN reactors. In view of the difficulties encountered when processing highly irradiated targets (760MWd.kg-1) by liquid-liquid extraction (interface sludges leading to stable emulsion) the new processes developed are based on inverse phase chromatography. This technique applied to targets of americium 241, plutonium 239 and a plutonium mixture rich in isotope 242 has given tens of milligrams of curium 242, grams of americium 243 and curium 244 and micrograms of californium 252

  8. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  9. Radiation protection data sheet. Radiation protection data sheets for the use of radionuclides in unsealed sources

    International Nuclear Information System (INIS)

    These radiation protection data sheet are devoted to responsible persons and employees of various laboratories or medical, pharmaceutical, university and industrial departments where radionuclides are handled as well as all the persons who attend to satisfy in this field. They contain the essential radiation protection data for the use of unsealed sources: physical characteristics, risk assessment, administrative procedures, recommendations, regulations and bibliography. This new series includes the following radionuclides: californium 252, curium 244, gallium 67, indium 113m, plutonium 238, plutonium 239, polonium 210, potassium 42, radium 226, thorium 232, uranium 238 and zinc 65. (O.M.)

  10. Study by thermochromatography of fluorides of transuranium elements

    International Nuclear Information System (INIS)

    Thermochromatography was made suitable for fluoride study. So, an investigation of actinide tetrafluorides was accomplished from uranium to californium. Pentavalent and hexavalent fluorospecies of uranium, neptunium, plutonium and ruthenium were studied. Some new compounds have been identified in gaseous phase, whose: PuF5, PuOF3 and PaOF3. Furthermore, some presomptions as for the existence in gaseous phase of EsF4 and of an heptavalent fluorospecies of plutonium have been established. An important analogy between plutonium and ruthenium behaviour with fluorine have been shown, these results could explain the difficulties encountered in the fluoride-volatility processes

  11. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  12. Method for measuring multiple scattering corrections between liquid scintillators

    Science.gov (United States)

    Verbeke, J. M.; Glenn, A. M.; Keefer, G. J.; Wurtz, R. E.

    2016-07-01

    A time-of-flight method is proposed to experimentally quantify the fractions of neutrons scattering between scintillators. An array of scintillators is characterized in terms of crosstalk with this method by measuring a californium source, for different neutron energy thresholds. The spectral information recorded by the scintillators can be used to estimate the fractions of neutrons multiple scattering. With the help of a correction to Feynman's point model theory to account for multiple scattering, these fractions can in turn improve the mass reconstruction of fissile materials under investigation.

  13. Surface fission tracks in diamond

    International Nuclear Information System (INIS)

    Scanning Probe Microscope (SPM) images reveal important fingerprint features of latent tracks induced in diamond by fission fragments from a californium source. Collimated fission fragments with a binary distribution of the predominant energies of 79.4 and 103.8 MeV, are assumed. Cavities, reticular formations around these cavities, and black spots of graphite were found. A brief discussion on the possible track formation mechanism is given on the basis of the explosion spike theory; an attempt to determine latent track core and halo parameters is included

  14. Use of trioctylphosphine oxide for transplutonium element extraction and purification

    International Nuclear Information System (INIS)

    Investigated was extraction of tri-valent curium, berkelium, californium, einsteinium as well as cerium and europium with trioctylphosphin oxide from lactic acid solutions, containing DTPA and aluminium nitrate depending on the aluminium nitrate and TOPO concentrations and nitric acid solutions of variable concentration as well. Under optimum conditions of extraction chromatography of berkelium studied was the distribution of cobalt, nickel, chromium, iron, aluminium, titanium, zirconium and niobium ions, and the coefficients of berkelium purification from cations investigated were determined. The effect of weight quantities of cation impurities on extraction chromatographic yield of berkelium has been investigated. Examples of practice application of the extraction chromatography with the use of TOPO are given

  15. Double spin asymmetry in exclusive rho(0) muoproduction at COMPASS

    Czech Academy of Sciences Publication Activity Database

    Alekseev, M.; Alexakhin, V. Yu.; Alexandrov, Yu.; Alexeev, G. D.; Amoroso, A.; Arbuzov, A.; Badelek, B.; Balestra, F.; Ball, J.; Baum, G.; Barth, J.; Bedfer, Y.; Bernet, C.; Bertini, R.; Bettinelli, M.; Birsa, R.; Bisplinghoff, J.; Bordalo, P.; Bradamante, F.; Bravar, A.; Bressan, A.; Brona, G.; Burtin, E.; Bussa, M.; Chapiro, A.; Chiosso, M.; Cicuttin, A.; Colantoni, M.; Costa, S.; Crespo, M.; d'Hose, N.; Dalla Torre, S.; Das, S.; Dasgupta, S. S.; De Masi, R.; Dedek, N.; Denisov, O.; Dhara, L.; Diaz, V.; Dinkelbach, A.; Donskov, S.; Dorofeev, V.; Doshita, N.; Duic, V.; Dünnweber, W.; Eversheim, P.; Eyrich, W.; Fabro, M.; Faessler, M.; Falaleev, V.; Ferrero, A.; Ferrero, L.; Finger, M.; Finger jr., M.; Fischer, H.; Franco, C.; Franz, J.; Friedrich, J.; Frolov, V.; Garfagnini, R.; Gautheron, F.; Gavrichtchouk, O.; Gazda, R.; Gerassimov, S.; Geyer, R.; Giorgi, M.; Gobbo, B.; Goertz, S.; Gorin, A. M.; Grabmüller, S.; Grajek, O.; Grasso, A.; Grube, B.; Gushterski, R.; Guskov, A.; Haas, F.; Hannappel, J.; von Harrach, D.; Hasegawa, T.; Heckmann, J.; Hedicke, S.; Heinsius, F.; Hermann, R.; Hess, C.; Hinterberger, F.; von Hodenberg, M.; Horikawa, N.; Horikawa, S.; Ilgner, C.; Ioukaev, A.; Ishimoto, S.; Ivanov, O.; Ivanshin, Yu.; Iwata, T.; Jahn, R.; Janata, A.; Jasinski, P.; Joosten, R.; Jouravlev, N. I.; Kabuss, E.; Kang, D.; Ketzer, B.; Khaustov, G.; Khokhlov, Y.; Kisselev, Y.; Klein, F.; Klimaszewski, K.; Koblitz, S.; Koivuniemi, J.; Kolosov, V.; Komissarov, E.; Kondo, K.; Königsmann, K.; Konorov, I.; Konstantinov, V.; Korentchenko, A.; Korzenev, A.; Kotzinian, A.; Koutchinski, N.; Kouznetsov, O.; Kravchuk, N.; Kral, A.; Kroumchtein, Z.; Kuhn, R.; Kunne, F.; Kurek, K.; Ladygin, M.; Lamanna, M.; Le Goff, J.; Lednev, A.; Lehmann, A.; Lichtenstadt, J.; Liska, T.; Ludwig, I.; Maggiora, A.; Maggiora, M.; Magnon, A.; Mallot, G.; Mann, A.; Marchand, C.; Marroncle, J.; Martin, A.; Marzec, J.; Massmann, F.; Matsuda, T.; Maximov, A.; Meyer, W.; Mielech, A.; Mikhailov, Y.; Moinester, M.; Mutter, M.; Nähle, O.; Nagaytsev, A.; Nagel, T.; Nassalski, J.; Neliba, S.; Nerling, F.; Neubert, S.; Neyret, D.; Nikolaenko, V.; Nikolaev, K.; Olshevsky, A.; Ostrick, M.; Padee, A.; Pagano, P.; Panebianco, S.; Panknin, R.; Panzieri, D.; Paul, S.; Pawlukiewicz-Kaminska, B.; Peshekhonov, D.; Peshekhonov, V.; Piragino, G.; Platchkov, S.; Pochodzalla, J.; Polak, J.; Polyakov, V.; Pretz, J.; Procureur, S.; Quintans, C.; Rajotte, J.; Rapatsky, V.; Ramos, S.; Reicherz, G.; Richter, A.; Robinet, F.; Rocco, E.; Rondio, E.; Rozhdestvensky, A.; Ryabchikov, D.; Samoylenko, V.; Sandacz, A.; Santos, H.; Sapozhnikov, M.; Sarkar, S.; Savin, I.; Schiavon, P.; Schill, C.; Schmitt, L.; Schönmeier, P.; Schröder, W.; Shevchenko, O.; Siebert, H.; Silva, L.; Sinha, L.; Sissakian, A.; Slunecka, M.; Smirnov, G.; Sosio, S.; Sozzi, F.; Sugonyaev, V.; Srnka, Aleš; Stinzing, F.; Stolarski, M.; Sulc, M.; Sulej, R.; Takabayashi, N.; Tchalishev, V.; Tessaro, S.; Tessarotto, F.; Teufel, A.; Tkatchev, L.; Venugopal, G.; Virius, M.; Vlassov, N.; Vossen, A.; Webb, R.; Weise, E.; Weitzel, Q.; Windmolders, R.; Wirth, S.; Wislicki, W.; Zaremba, K.; Zavertyaev, M.; Zemlyanichkina, E.; Zhao, J.; Ziegler, R.; Zvyagin, A.

    2007-01-01

    Roč. 52, č. 2 (2007), s. 255-265. ISSN 1434-6044 R&D Projects: GA MŠk ME 492 Institutional research plan: CEZ:AV0Z20650511 Keywords : double spin asymmetry * polarized deuterons * scattering * COMPASS Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 3.255, year: 2007

  16. Your Guide to Medicare Prescription Drug Coverage

    Science.gov (United States)

    ... from Medicaid paying $0 your Medicare Part B premiums $0 Generic and certain preferred drugs: No more than $2.55 Brand-name drugs: No more than $6.35 $0 ... cost per monthly yearly prescription at prescription at premium* deductible the pharmacy the ... more than $2.55 Brand-name drugs: No more than $6.35 $0 $ ...

  17. NCBI nr-aa BLAST: CBRC-ACAR-01-1153 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1153 ref|YP_319126.1| Multi antimicrobial extrusion protein MatE [Nitr...obacter winogradskyi Nb-255] gb|ABA05774.1| Multi antimicrobial extrusion protein MatE [Nitrobacter winogradskyi Nb-255] YP_319126.1 0.55 30% ...

  18. Monte Carlo aided enhanced design of an neutron scatterometer

    International Nuclear Information System (INIS)

    This paper will present a particular example for the use of the Monte Carlo Method to enhance the performance of a neutron scatterometer, currently employed to detect the void fraction in fast-transient high-pressure water-vapour flow in a rod-bundle channel. The scatterometer relies on measuring the slowing-down of californium-252 neutrons by the hydrogen in the water to determine the liquid, hence vapour (void) content. However, californium-252 is a relatively fast-decaying source and alternative isotopic sources are typically too energetic to provide sufficient moderation given the small amount of liquid in the channel. Monte Carlo simulation were utilized to examine various design enhancement possibilities, including: filtering out unthermalized fast neutrons, amplifying by a fissionable material the amount of detected thermal neutrons, adding a dissolvable contrast material to the liquid phase, or relying on the scattering of fast neutrons by oxygen in water. In addition, methods to determine the distribution of the pattern of liquid-vapour phase in the channel are devised

  19. Selective Nonroutine Microbial Surveillance of In-Use Hospital Nebulizers by Aerosol Entrapment and Direct Sampling Analyses of Solutions in Reservoirs

    OpenAIRE

    Reinhardt, Donald J.; Kennedy, Christopher; Malecka-Griggs, Blanche

    1980-01-01

    Effluent aerosols and liquid reservoir samples from 255 in-use hospital nebulization devices were analyzed by Aero-Test samplers (Olympic Corp.) and direct dilution procedures (0.1-, 0.01-, and 0.001-ml plated samples). Thirty-five percent (89 of 255) of the in-use hospital reservoir samples were positive by direct dilution, and 24% (61 of 255) were positive by Aero- Test samplers. Acinetobacter calcoaceticus var. anitratus was found either alone or in association with Pseudomonas spp. in 50%...

  20. Toxic Effects of Lithium Chloride during Early Neonatal Period of Rat Development.

    Science.gov (United States)

    Menshanov, P N; Bannova, A V; Dygalo, N N

    2016-02-01

    Lithium chloride (85, 255, or 255+127 μg/kg) or dexamethasone (0.2 or 2 mg/kg) were subcutaneously injected to 3-day-old rat pups, whose excretory system did not yet attain functional maturity. Both agents retarded the growth of rat pups and delayed the appearance of negative geotaxis. LD50 and therapeutic index of lithium chloride were 255 μg/kg and TI≤3, respectively. Thus, lithium salts even in low doses can be highly toxic for the developing organism. PMID:26906201

  1. Seasonal variability of mercury contents in street dust in Brno, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Coufalík, Pavel; Zvěřina, O.; Mikuška, Pavel; Komárek, J.

    2014-01-01

    Roč. 93, č. 4 (2014), s. 503-508. ISSN 0007-4861 Institutional support: RVO:68081715 Keywords : mercury * accumulation * dust Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 1.255, year: 2014

  2. Drug: D08825 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available tegory of drugs in Japan [BR:br08301] 2 Agents affecting individual organs 25 Urogenital and anal organ agents 255 Hemorrhoidal prepa...rations 2559 Others D08825 Hemolingual PubChem: 96025508 ...

  3. Local Government in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Vajdová, Zdenka; Lacina, K.

    Budapest: Local Government and Public Servise Reform Initiative, 2000 - (Horváth, T.), s. 255-296 ISBN 963 00 3210 4 Institutional research plan: CEZ:AV0Z7028912 Subject RIV: AO - Sociology, Demography

  4. The orientation-enhancing effect of diphenyl aluminium phosphate nanorods in a liquid-crystalline epoxy matrix ordered by magnetic field

    Czech Academy of Sciences Publication Activity Database

    Mossety-Leszczak, B.; Strachota, Beata; Strachota, Adam; Steinhart, Miloš; Šlouf, Miroslav

    2015-01-01

    Roč. 72, November (2015), s. 238-255. ISSN 0014-3057 Institutional support: RVO:61389013 Keywords : liquid-crystalline epoxy resins * magnetic field orientation * nanocomposites Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.005, year: 2014

  5. Introducing Undergraduates to Global Health Epidemiology, Emerging Infectious Diseases, and Parasitology: A Small Book with a Big Impact

    OpenAIRE

    Wegman-Geedey, Dara L.

    2014-01-01

    Review of: Forgotten People, Forgotten Diseases: The Neglected Tropical Diseases and their Impact on Global Health and Development, 2nd Edition; Peter J. Hotez; (2013). ASM Press, Washington, DC. 255 pages.

  6. Study of fusion and nucleon transfer channels in the Au-197 + He-6 reaction in an energy range of He-6 to 20 Mev/A

    Czech Academy of Sciences Publication Activity Database

    Skobelev, N. K.; Penionzhkevich, Y. E.; Kulko, A. A.; Demekhina, N. A.; Kroha, Václav; Kugler, Andrej; Lukyanov, S. M.; Mrázek, Jaromír; Sobolev, Yu. G.; Maslov, V. A.; Muzychka, Yu. A.; Voskoboynik, E. I.; Fomichev, A. S.

    2013-01-01

    Roč. 10, č. 3 (2013), s. 248-255. ISSN 1547-4771 Institutional support: RVO:61389005 Keywords : nuclear reactions * gamma activity * cross section Subject RIV: BG - Nuclear, Atomic and Molecular Physics , Colliders

  7. Introducing Undergraduates to Global Health Epidemiology, Emerging Infectious Diseases, and Parasitology: A Small Book with a Big Impact

    Directory of Open Access Journals (Sweden)

    Dara L. Wegman-Geedey

    2014-08-01

    Full Text Available Review of: Forgotten People, Forgotten Diseases: The Neglected Tropical Diseases and their Impact on Global Health and Development, 2nd Edition; Peter J. Hotez; (2013. ASM Press, Washington, DC. 255 pages.

  8. 78 FR 47703 - Food and Drug Administration Modernization Act of 1997: Modifications to the List of Recognized...

    Science.gov (United States)

    2013-08-06

    ... notice published in the Federal Register of February 25, 1998 (63 FR 9561), FDA announced the........... 11-255 ASTM F1717-13 Withdrawn and Standard Test replaced with Methods for Spinal a newer...

  9. Development of a universal stress sensor for graphene and carbon fibres

    Czech Academy of Sciences Publication Activity Database

    Frank, Otakar; Tsoukleri, G.; Riaz, I.; Papagelis, K.; Parthenios, J.; Ferrari, A.; Geim, A.K.; Novoselov, K. S.; Galiotis, C.

    2011-01-01

    Roč. 2, č. 1 (2011), s. 255. ISSN 2041-1723 Institutional research plan: CEZ:AV0Z40400503 Keywords : carbon fiber * graphene * Raman spectrometry Subject RIV: CG - Electrochemistry Impact factor: 7.396, year: 2011

  10. Pozycja spoleczna i prestiz kobiety pracujacej zawodowo w Czechach na przelomie XIX i XX wieku

    Czech Academy of Sciences Publication Activity Database

    Vošahlíková, Pavla

    Warszawa : DiG, 2000 - (Zarnowska, A.; Szwarc, A.), s. 255-266 ISBN 83-7181-141-1. - (6) Institutional research plan: CEZ:AV0Z8015903 Keywords : social history * feminism * education Subject RIV: AB - History

  11. Protein (Viridiplantae): 308811905 [

    Lifescience Database Archive (English)

    Full Text Available XP_003083260.1 33090:255 3041:4962 1035538:3528 13792:3528 70447:3840 70448:5111 T08009 probable ... ribosomal protein L5-green ... alga (ISS) Ostreococcus tauri MGKRRQKRKSQSVAKTTAYQ ...

  12. Main: -284MOTIFZMSBE1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available -284MOTIFZMSBE1 S000285 10-Feb-2000 (last modified) seki Located between -284 and -255 region of ... cells; Recognized by nuclear protein; See S000284; Starch -branching enzyme (Sbe1); starch ; kernel; sugar; en ...

  13. Pražský malíř Matěj Zimprecht (1624 - 1680). Životopis umělce v limitech historické paměti

    Czech Academy of Sciences Publication Activity Database

    Tibitanzlová, Radka; Vácha, Štěpán

    2012-01-01

    Roč. 60, 3/4 (2012), s. 255-280. ISSN 0049-5123 Institutional support: RVO:68378033 Keywords : baroque painting * Matthias Zimprecht * Prague * collective memory Subject RIV: AL - Art, Architecture, Cultural Heritage

  14. High Blood Pressure Facts

    Science.gov (United States)

    ... Heart Disease Cholesterol Salt Million Hearts® WISEWOMAN High Blood Pressure Facts Recommend on Facebook Tweet Share Compartir ... facts about high blood pressure [PDF-255K] . High Blood Pressure in the United States About 70 million ...

  15. 78 FR 29369 - Information Collections Being Reviewed by the Federal Communications Commission

    Science.gov (United States)

    2013-05-20

    ... of the Act. 47 U.S.C. 618. Section 255 of the Act requires telecommunications and interconnected VoIP... use of automated collection techniques or other forms of information technology; and ways to...

  16. Field Plot and Observation Points for Fossil Butte National Monument Vegetation Mapping Project

    Data.gov (United States)

    National Park Service, Department of the Interior — This point file contains 255 point locations of field plot and observation data used by, and collected for, the vegetation mapping project for Fossil Butte National...

  17. Understanding of hybrid PVD–PECVD process with the aim of growing hard nc-TiC/a-C:H coatings using industrial devices with a rotating cylindrical magnetron

    Czech Academy of Sciences Publication Activity Database

    Žemlička, R.; Jílek, M.; Vogl, P.; Souček, P.; Buršíková, V.; Buršík, Jiří; Vašina, P.

    2014-01-01

    Roč. 255, 25 September (2014), s. 118-123. ISSN 0257-8972 Institutional support: RVO:68081723 Keywords : nanocomposite * magnetron sputtering * process control Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.998, year: 2014

  18. Zygophyllum gaetulum attenuates hypercholesterolemia and protects against oxidative stress in rats fed a high-cholesterol diet

    Directory of Open Access Journals (Sweden)

    Sadia Berzou

    2014-12-01

    Conclusion: These results show that Zygophyllum gaetulum aqueous extract improves hypercholesterolemia and oxidative stress induced by a high cholesterol diet and consequently may protect against cardiovascular diseases. [J Exp Integr Med 2014; 4(4.000: 255-260

  19. Filosofie a společnost v českých zemích II

    Czech Academy of Sciences Publication Activity Database

    Hermann, Tomáš

    Pardubice : Univerzita Pardubice, 2011 - (Hejduk, T.), s. 255-269 ISBN 978-80-7395-383-6 Institutional research plan: CEZ:AV0Z80630520 Keywords : Czech philosophy * philosophy and culture * Czech history and Europe Subject RIV: AB - History

  20. Processus iudiciarius secundum stilum Pragensem Mikuláše Puchníka

    Czech Academy of Sciences Publication Activity Database

    Budský, Dominik

    2009-01-01

    Roč. 39, - (2009), s. 255-277. ISSN 0585-5691 Institutional research plan: CEZ:AV0Z90560517 Keywords : codicology * canon law * manuscripts * Puchnik, Nicolaus * procedural law Subject RIV: AJ - Letters, Mass-media, Audiovision

  1. AcEST: DK961536 [AcEST

    Lifescience Database Archive (English)

    Full Text Available EKFGMSPSKGVLFYGPPGCGKTLLA Sbjct: 473 VEVPNVSWEDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLA 532 Query: 359 KAIANECQANFIS...IKGPELLTMWFGESEANVRDVFDKARQSAPCVLFFDELDSIATQXXX 538 KAIANECQANFIS+KGPELLTMWFGESEANVR++FDKA...RQSAPCVLFFDELDSIATQ Sbjct: 533 KAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDE...VELPLRHPQLFKSIGVKPPKGILLYGPPGSGK 255 Query: 347 TLLAKAIANECQANFISIKGPELLTMWFGESEANVRDVFDKARQSAPCVLFFDELDSIAT...EKFEKFGMSPSKGVLFYGPPGCGKTLLA 532 Query: 359 KAIANECQANFISIKGPELLTMWFGESEANVRDVFDKARQSAPCVLFFDELDSIATQXXX 538 KAIANECQANFIS

  2. 2010 chemical treatment on the Malheur National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This report summarizes noxious weed control on Malheur National Wildlife Refuge in 2010. There were 4,255.4 acres treated on the refuge. The total cost for this...

  3. O použití Einsteinových rovnic v kosmologii

    Czech Academy of Sciences Publication Activity Database

    Křížek, Michal

    2015-01-01

    Roč. 60, č. 3 (2015), s. 255-272. ISSN 0032-2423 Institutional support: RVO:67985840 Keywords : dark matter * dark energy * Friedmann equation Subject RIV: BA - General Mathematics http://hdl.handle.net/10338.dmlcz/144419

  4. Structural and stress analysis of mining practice in the Upper Silesian Coal Basin

    Czech Academy of Sciences Publication Activity Database

    Waclawik, Petr; Ptáček, Jiří; Grygar, R.

    2013-01-01

    Roč. 10, č. 2 (2013), s. 255-265. ISSN 1214-9705 Institutional support: RVO:68145535 Keywords : horizontal stress * structural analysis * mine roadway stability * coal mining * rock burst Subject RIV: DH - Mining, incl. Coal Mining Impact factor: 0.667, year: 2013 http://www.irsm.cas.cz/materialy/acta_content/2013_02/acta_170_15_Waclawik_255-265.pdf

  5. Comparison Wind-Tunnel Experiment with Les Modelling of Atmospheric Dispersion over Complex Terrain

    Czech Academy of Sciences Publication Activity Database

    Nosek, Štěpán; Jaňour, Zbyněk; Fuka, V.; Kukačka, Libor; Jurčáková, Klára; Kellnerová, Radka; Gulíková, E.

    Hatfield: University of Hertfordshire, 2014 - (Mitto, T.; Fallmann, J.; Mikolajczyk, U.; Suppan, P.; Singh, V.; Sokhi, R.). s. 255-255 ISBN 978-1-909291-20-1. [International Conference on Air Quality - Science and Application /9./. 24.03.2014-28.03.2014, Garmisch-Partenkirchen] R&D Projects: GA TA ČR TA01020428 Institutional support: RVO:61388998 Keywords : wind-tunnel * atmospheric dispersion * LES * coal dust * air pollution * complex terrain Subject RIV: DG - Athmosphere Sciences, Meteorology

  6. Drug: D07716 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D07716 Drug Clobutinol (INN); Iversal (TN) C14H22ClNO 255.139 255.7836 D07716.gif Antitussive AT ... assification [BR:br08303] R RESPIRATORY SYSTEM R05 COUGH ... AND COLD PREPARATIONS R05D COUGH ... SUPPRESSANTS, EXC ... L. COMBINATIONS WITH EXPECTORANTS R05DB Other cough ... suppressants R05DB03 Clobutinol D07716 Clobutinol ...

  7. A review of the efficacy and safety of extended-release topiramate in the adjunctive treatment for refractory partial-onset seizures

    OpenAIRE

    Chung, Steve S

    2015-01-01

    Topiramate has been widely utilized worldwide as an effective medication against partial- and generalized-onset seizures. Extended-release topiramate was developed to provide patients with the convenience of once-daily dosing and potentially improved tolerability by reducing serum concentration fluctuation. USL255 is a once-daily, extended-release formulation of topiramate, which was recently approved in the USA. Compared with immediate-release topiramate taken twice daily, once-daily USL255 ...

  8. Binding of peptides to HLA-DQ molecules: peptide binding properties of the disease-associated HLA-DQ(alpha 1*0501, beta 1*0201) molecule

    DEFF Research Database (Denmark)

    Johansen, B H; Buus, S; Vartdal, F;

    1994-01-01

    assay. The MB 65 kDa 243-255Y peptide bound to DQ2 in a strictly pH-dependent fashion, with optimal binding around pH 5 and only weak binding at pH 7.4. The association of the MB 65 kDa 243-255Y peptide to DQ2 was slow, but once formed, the peptide-HLA complexes were very stable. The binding of peptides...

  9. AcEST: DK958168 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0030_E17 606 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0030_E17. 5' end seq ... 29/168 (76%) Frame = +1 Query: 76 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 255 MLVYQ ... LWEV+GKWVV+GA+DVDIGANPSA Sbjct: 1 MLVYQDLLTGDELLSDSFPY REIENGILWEVDGKWVVQGAIDVDIGANPSAEGGGDDEGV 60 Query: ... 29/168 (76%) Frame = +1 Query: 76 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 255 MLVYQ ... LWEV+G WVV+GAVDVDIGANPSA Sbjct: 1 MLVYQDKLSGDELLSDSFPY RELENGVLWEVDGHWVVQGAVDVDIGANPSAEGGGEDEGV 60 Query: ...

  10. Improved FEC Code Based on Concatenated Code for Optical Transmission Systems

    Institute of Scientific and Technical Information of China (English)

    YUAN Jian-guo; JIANG Ze; MAO You-ju

    2006-01-01

    The improved three novel schemes of the super forward error correction(super-FEC) concatenated codes are proposed after the development trend of long-haul optical transmission systems and the defects of the existing FEC codes have been analyzed. The performance simulation of the Reed-Solomon(RS)+Bose-Chaudhuri-Hocguenghem(BCH) inner-outer serial concatenated code is implemented and the conceptions of encoding/decoding the parallel-concatenated code are presented. Furthermore,the simulation results for the RS(255,239)+RS(255,239) code and the RS(255,239)+RS(255,223) code show that the two consecutive concatenated codes are a superior coding scheme with such advantages as the better error correction,moderate redundancy and easy realization compared to the classic RS(255,239) code and other codes,and their signal to noise ratio gains are respectively 2~3 dB more than that of the RS(255,239)code at the bit error rate of 1×10-13. Finally,the frame structure of the novel consecutive concatenated code is arranged to lay a firm foundation in designing its hardware.

  11. Neutron radiography for nondestructive testing

    International Nuclear Information System (INIS)

    Neutron radiography is similar to X-ray inspection in that both depend upon use of radiation that penetrates some materials and is absorbed by others to provide a contrast image of conditions not readily available for visual inspection. X-rays are absorbed by dense materials, such as metals, whereas neutrons readily penetrate metals, but are absorbed by materials containing hydrogen. The neutron radiography has been successfully applied to a number of inspection situations. These include the inspection of explosives, advanced composites, adhesively bonded structures and a number of aircraft engine components. With the availability of Californium-252, it has become feasible to construct mobile neutron radiography systems suitable for field use. Such systems have been used for in-situ inspection of flight line aircraft, particularly to locate and measure hidden corrosion

  12. Preparation of actinide targets by electrodeposition

    Science.gov (United States)

    Trautmann, N.; Folger, H.

    1989-10-01

    Actinide targets with varying thicknesses on different substrates have been prepared by electrodeposition either from aqueous solutions or from solutions of their nitrates in isopropyl alcohol. With these techniques the actinides can be deposited almost quantitatively on various backing materials within 15 to 30 min. Targets of thorium, uranium, neptunium, plutonium, americium, curium and californium with areal densities from almost carrier-free up to 1.4 mg/cm 2 on thin beryllium, carbon, titanium, tantalum and platinum foils have been prepared. In most cases, prior to the deposition, the actinides had to be purified chemically and for some of them, due to the limited amount of material available, recycling procedures were required. Applications of actinide targets in heavy-ion reactions are briefly discussed.

  13. An atomic beam source for actinide elements: concept and realization

    International Nuclear Information System (INIS)

    For ultratrace analysis of actinide elements and studies of their atomic properties with resonance ionization mass spectroscopy (RIMS), efficient and stable sources of actinide atomic beams are required. The thermodynamics and kinetics of the evaporation of actinide elements and oxides from a variety of metals were considered, including diffusion, desorption, and associative desorption. On this basis various sandwich-type filaments were studied. The most promising system was found to consist of tantalum as the backing material, an electrolytically deposited actinide hydroxide as the source of the element, and a titanium covering layer for its reduction to the metal. Such sandwich sources were experimentally proven to be well suited for the production of atomic beams of plutonium, curium, berkelium and californium at relatively low operating temperatures and with high and reproducible yields. (orig.)

  14. Environmental assessment of the thermal neutron activation explosive detection system for concourse use at US airports

    International Nuclear Information System (INIS)

    This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs

  15. A comparative study of bulk etch rate measurement methods in polycarbonate detectors

    International Nuclear Information System (INIS)

    The response of a plastic detector to an incoming charged particle is given by the ratio of track etch rate vt to bulk etch rate vg along its path. Although the accurate determination of vt offers no difficulty as cone length can be comfortably measured, there seems to be a certain ambiguity as how to measure vg. Several LEXAN and TUFFAK polycarbonate plates have been exposed to normally incident Californium-252 fission fragments, etched in a stirred aqueous NaOH solution saturated with etch products and with a 0.05% of Dowfax surfactant, for different etching times, concentrations and temperatures. We have used three methods to measure vg and we obtain consistent results in agreement with those published in the literature. Surface quality and, consequently, ellipses neatness, are far superior in TUFFAK than in LEXAN. (author)

  16. A Novel Approach to β-delayed Neutron Spectroscopy Using the Beta-decay Paul Trap

    International Nuclear Information System (INIS)

    A new approach to β-delayed neutron spectroscopy has been demonstrated that circumvents the many limitations associated with neutron detection by instead inferring the decay branching ratios and energy spectra of the emitted neutrons by studying the nuclear recoil. Using the Beta-decay Paul Trap, fission-product ions were trapped and confined to within a 1-mm3 volume under vacuum using only electric fields. Results from recent measurements of 137I+ and plans for development of a dedicated ion trap for future experiments using the intense fission fragment beams from the Californium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne National Laboratory are summarized. The improved nuclear data that can be collected is needed in many fields of basic and applied science such as nuclear energy, nuclear astrophysics, and stockpile stewardship

  17. Devices for rapid protein determination in grain products and mixed feeds by the neutron method

    International Nuclear Information System (INIS)

    Protein determination should be carried out using rapid techniques so that each truckful of grain can be checked for protein while mixed feeds can be checked for protein directly in the product flow lines with automatic correction of their work. The existing methods of protein determination do not meet the above requirements. In this connection, the Azot analyzer has beem developed based on the reaction of capture of thermal neutrons by the nuclei of the nitrogen present in the analyzed product and the registration of the resulting gamma-quanta emission of 10.8 Mev. Readings of the nitrogen will be converted to those of protein with the help of standard conversion coefficients. Alongside with protein content, the Azot can measure the test weight of the grain by absorbing californium 252 neutrons

  18. Probe for the exploration of deposits

    International Nuclear Information System (INIS)

    The exploration probes work by means of a prompt (n,γ) analysis, activation analysis or X-ray fluorescence analysis. The neutrons or gamma radiation are provided by a californium-252 source or a cobalt-57 source which are placed in the probe. The probe is in the form of a pipe consisting of single modules. Each module contains a part of the whole radiation producing, shielding, detector, detector cooling and detector electronic system. They can be screwed onto one another and can be exchanged for other parts. A melt cryostatat or a compressor is used as cooling device, a germanium-(Li) detector as detector, and bismuth and heavy water as shielding. All measuring process can thus be carried out in situ in a relatively short measuring time. (DG)

  19. Robotics and remote systems applications

    International Nuclear Information System (INIS)

    This article is a review of numerous remote inspection techniques in use at the Savannah River (and other) facilities. These include: (1) reactor tank inspection robot, (2) californium waste removal robot, (3) fuel rod lubrication robot, (4) cesium source manipulation robot, (5) tank 13 survey and decontamination robots, (6) hot gang valve corridor decontamination and junction box removal robots, (7) lead removal from deionizer vessels robot, (8) HB line cleanup robot, (9) remote operation of a front end loader at WIPP, (10) remote overhead video extendible robot, (11) semi-intelligent mobile observing navigator, (12) remote camera systems in the SRS canyons, (13) cameras and borescope for the DWPF, (14) Hanford waste tank camera system, (15) in-tank precipitation camera system, (16) F-area retention basin pipe crawler, (17) waste tank wall crawler and annulus camera, (18) duct inspection, and (19) deionizer resin sampling

  20. Utilization of radiation facilities at TNRC for shielding researches and related topics

    International Nuclear Information System (INIS)

    This paper presents the running shielding research activities at Tajura Nuclear research center. The main area of researches are concentrated on the investigation of different types of concrete made from local materials such as conventional concrete, Magnetite-Limonite concrete, and heat resistant concrete. The measuring techniques used were neutron-gamma spectrometry, and activation foils. The measurements were performed using collimated beam of reactor neutrons emitted from one of the horizontal channels, as well as from californium-252 neutron source. The transmitted neutron spectra through concrete barriers of different thicknesses were measured by a scintillation spectrometer with NE-213 liquid organic scintillator. A non-destructive testing of some reactor materials were also carried out using neutron and gamma ray computerized tomography technique (CT). Some experiments were also carried out related to measurements of neutron depth dose distributions inside tissue equivalent materials. 10 figs

  1. Nuclear fission and the transuranium elements

    International Nuclear Information System (INIS)

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs

  2. Potential nuclear safeguards applications for neutron generators

    International Nuclear Information System (INIS)

    Many nuclear safeguards inspection instruments use neutron sources to interrogate the fissile material (commonly 235U and 239Pu) to be measured. The neutron sources currently used in these instruments are isotopics such as Californium-252, Americium-Lithium, etc. It is becoming increasingly more difficult to transport isotopic sources from one measurement location to another. This represents a significant problem for the International Atomic Energy Agency (IAEA) safeguards inspectors because they must take their safeguards instruments with them to each nuclear installation to make an independent measurement. Purpose of this paper is to review the possibility of replacing isotopic neutron sources now used in IAEA safeguards instruments with electric neutron sources such as deuterium-tritium (D-T, 14-MeV neutrons) or deuterium-deuterium (D-D, 2-MeV neutrons). The potential for neutron generators to interrogate spent-light water reactor fuel assemblies in storage pools is also reviewed

  3. Reliability of semiconductor and gas-filled diodes for over-voltage protection exposed to ionizing radiation

    Directory of Open Access Journals (Sweden)

    Stanković Koviljka

    2009-01-01

    Full Text Available The wide-spread use of semiconductor and gas-filled diodes for non-linear over-voltage protection results in a variety of possible working conditions. It is therefore essential to have a thorough insight into their reliability in exploitation environments which imply exposure to ionizing radiation. The aim of this paper is to investigate the influence of irradiation on over-voltage diode characteristics by exposing the diodes to californium-252 combined neutron/gamma radiation field. The irradiation of semiconductor over-voltage diodes causes severe degradation of their protection characteristics. On the other hand, gas-filled over-voltage diodes exhibit a temporal improvement of performance. The results are presented with the accompanying theoretical interpretations of the observed changes in over-voltage diode behaviour, based on the interaction of radiation with materials constituting the diodes.

  4. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes

    International Nuclear Information System (INIS)

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of 241Am and 237Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the 241Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  5. Multi-purpose neutron radiography system

    International Nuclear Information System (INIS)

    A conceptual design is given for a low cost, multipurpose radiography system suited for the needs of the Los Alamos National Laboratory (LANL). The proposed neutron source is californium-252. One purpose is to provide an in-house capability for occasional, reactor quality, neutron radiography thus replacing the recently closed Omega-West Reactor. A second purpose is to provide a highly reliable standby transportable neutron radiography system. A third purpose is to provide for transportable neutron probe gamma spectroscopy techniques. The cost is minimized by shared use of an existing x-ray facility, and by use of an existing transport cask. The achievable neutron radiography and radioscopy performance characteristics have been verified. The demonstrated image qualities range from high resolution gadolinium - SR film, with L:D = 100:1, to radioscopy using a LIXI image with L:D = 30:1 and neutron fluence 3.4 x 105 n/cm2

  6. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes; Mesures des sections efficaces de capture et potentiels d'incineration des actinides mineurs dans les hauts flux de neutrons: Impact sur la transmutation des dechets

    Energy Technology Data Exchange (ETDEWEB)

    Bringer, O

    2007-10-15

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of {sup 241}Am and {sup 237}Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the {sup 241}Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  7. Triton and alpha-particle contribution from LiF converter for neutron dosimeter

    CERN Document Server

    Camacho, M E; Balcazar, M

    1999-01-01

    A personnel neutron dosimeter prototype based on chemical and electrochemical etched CR-39 detector, combined with LiF converter, has been calibrated using an ICRP-like phantom, under a heavy-water moderated Californium source neutron spectra; A conversion factor of 1.052+-126 spots cm sup - sup 2 mSv sup - sup 1 was obtained. The sealing properties of the detector holder showed a ten-fold reduction in radon background when it was tested in a high radon atmosphere. A convenient mechanical shock resistance was achieved in LiF converters by sintering to 11 tons pressure LiF powder at 650 deg. C, during one hour.

  8. Nuclear fission and the transuranium elements

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.

  9. General purpose nuclear irradiation chamber

    International Nuclear Information System (INIS)

    Nuclear technology has found a great need for use in medicine, industry, and research. Smoke detectors in our homes, medical treatments and new varieties of plants by irradiating its seeds are just a few examples of the benefits of nuclear technology. Portable neutron source such as Californium-252, available at Industrial Technology Division (BTI/ PAT), Malaysian Nuclear Agency, has a 2.645 year half-life. However, 252Cf is known to emit gamma radiation from the source. Thus, this chamber aims to provide a proper gamma shielding for samples to distinguish the use of mixed neutron with gamma-rays or pure neutron radiation. The chamber is compatible to be used with other portable neutron sources such as 241Am-Be as well as the reactor TRIGA PUSPATI for higher neutron dose. This chamber was designed through a collaborative effort of Kulliyyah Engineering, IIUM with the Industrial Technology Division (BTI) team, Malaysian Nuclear Agency. (Author)

  10. Experimental survey of the potential energy surfaces associated with fission

    International Nuclear Information System (INIS)

    Progress in the experimental determination of the properties of the potential energy surface associated with fission is reviewed. The importance of nuclear symmetry effects on the calculation of fission widths is demonstrated. Evidence is presented for the fragmentation of the mass-asymmetric second barrier in the thorium region and the axial asymmetric first barrier in the californium region. Detailed analyses of experimental data suggest the presence of two parallel second barriers; the normal mass-asymmetric, axial-symmetric barrier and a slightly higher mass-symmetric, axial-asymmetric barrier. Experimental barrier parameters are determined systematically and compared with calculations from various theoretical models. Techniques for expanding fission probability measurements to higher energies are discussed. (author)

  11. Separation of 248Cm (III) from 252Cf (III) and its use in time resolved fluorescence spectroscopic (TRFS) studies

    International Nuclear Information System (INIS)

    The present report gives a description of the methodology for the separation of 248Cm(III) from decayed 252Cf (III) waste solution. The waste solution was first assayed for 252Cf content by neutron counting using a neutron well coincidence counter. The sample was subjected to the chemical separation of 248Cm (III) from 252Cf (III) following anion and cation exchange chromatography. The alpha spectrum of the separated curium fraction showed peaks due to 246Cm and 248Cm while the corresponding alpha spectrum of californium fraction showed 249,250,251,252Cf. The gamma ray abundances of 249Cf were determined with respect to its gamma rays of 387 keV and the data agreed well with that in literature. Separated Cm(III) was further characterized by recording its time resolved fluorescence spectrum (TRFS) in aqueous medium. (author)

  12. Effects of 252Cf neutrons, transmitted through an iron block on human lymphocyte chromosome

    International Nuclear Information System (INIS)

    Chromosome aberration of human peripheral blood lymphocytes exposed to californium-252 (252Cf) neutrons transmitted through a 15 cm thick iron block was analysed. The spectrum of the filtered neutrons ranged from 0.1 to 2MeV with a peak at 0.7 MeV, simulating the Hiroshima atomic bomb neutron spectrum as shown in the Dosimetry System 1986 (DS86). Chromosome aberration frequencies after exposure to filtered and unfiltered 252Cf radiation were compared. Acentric ring chromosomes were significantly increased (p 0.1). The relative biological effectiveness (RBE) of the neutrons with respect to the formation of dicentrics and centric rings was 10.9 and 12.3 in the filtered and unfiltered conditions respectively, but the difference was not statistically significant. These results provide useful information for the re-evaluation of the biological effect of the Hiroshima atomic bomb radiations. (Author)

  13. Test and evaluation results of the 252Cf shuffler at the Savannah River Plant

    International Nuclear Information System (INIS)

    The 252Cf Shuffler, a nondestructive assay instrument employing californium neutron source irradiation and delayed-neutron counting, was developed for measuring 235U content of scrap and waste items generated at the Savannah River Plant (SRP) reactor fuel fabrication facility. The scrap and waste items include high-purity uranium-aluminum alloy ingots as well as pieces of castings, saw and lathe chips from machining operations, low-purity items such as oxides of uranium or uranium intermixed with flux materials found in recovery operations, and materials not recoverable at SRP such as floor sweepings or residues from the uranium scrap recovery operation. The uranium contains about 60% 235U with the remaining isotopes being 236U, 238U, and 234U in descending order. The test and evaluation at SRP concluded that the accuracy, safety, reliability, and ease of use made the 252Cf Shuffler a suitable instrument for routine use in an industrial, production-oriented plant

  14. Highly charged ions for atomic clocks and search for variation of the fine structure constant

    CERN Document Server

    Dzuba, V A

    2015-01-01

    We review a number of highly charged ions which have optical transitions suitable for building extremely accurate atomic clocks. This includes ions from Hf$^{12+}$ to U$^{34+}$, which have the $4f^{12}$ configuration of valence electrons, the Ir$^{17+}$ ion, which has a hole in almost filled $4f$ subshell, the Ho$^{14+}$, Cf$^{15+}$, Es$^{17+}$ and Es$^{16+}$ ions. Clock transitions in most of these ions are sensitive to variation of the fine structure constant, $\\alpha$ ($\\alpha = e^2/\\hbar c$). E.g., californium and einsteinium ions have largest known sensitivity to $\\alpha$-variation while holmium ion looks as the most suitable ion for experimental study. We study the spectra of the ions and their features relevant to the use as frequency standards.

  15. The CARIBU EBIS control and synchronization system

    Science.gov (United States)

    Dickerson, Clayton; Peters, Christopher

    2015-01-01

    The Californium Rare Isotope Breeder Upgrade (CARIBU) Electron Beam Ion Source (EBIS) charge breeder has been built and tested. The bases of the CARIBU EBIS electrical system are four voltage platforms on which both DC and pulsed high voltage outputs are controlled. The high voltage output pulses are created with either a combination of a function generator and a high voltage amplifier, or two high voltage DC power supplies and a high voltage solid state switch. Proper synchronization of the pulsed voltages, fundamental to optimizing the charge breeding performance, is achieved with triggering from a digital delay pulse generator. The control system is based on National Instruments realtime controllers and LabVIEW software implementing Functional Global Variables (FGV) to store and access instrument parameters. Fiber optic converters enable network communication and triggering across the platforms.

  16. Neutrons in cancer therapy

    Science.gov (United States)

    Allen, Barry J.

    1995-03-01

    The role of neutrons in the management of cancer has a long history. However, it is only in recent years that neutrons are beginning to find an accepted place as an efficacious radiation modality. Fast neutron therapy is already well established for the treatment of certain cancers, and clinical trials are ongoing. Californium neutron sources are being used in brachytherapy. Boron neutron capture therapy has been well tested with thermal neutrons and epithermal neutron dose escalation studies are about to commence in the USA and Europe. Possibilities of neutron induced auger electron therapy are also discussed. With respect to chemotherapy, prompt neutron capture analysis is being used to study the dose optimization of chemotherapy in the management of breast cancer. The rationales behind these applications of neutrons in the management of cancer are examined.

  17. Study of reproducibility of measurements with the spectrometer of Bonner multispheres

    Energy Technology Data Exchange (ETDEWEB)

    Azevedo, G.A.; Pereira, W.W.; Patrao, K.C.S.; Fonseca, E.S., E-mail: geisadeazevedo@gmail.com, E-mail: walsan@ird.gov.br, E-mail: karla@ird.gov.br, E-mail: evaldo@ird.gov.br [Instituto de Radionprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2013-07-01

    This work aims to study the metrological behavior of the Bonner Multisphere Spectrometer (BMS) of the LN / LNMRI / IRD - Laboratorio Metrologia de Neutrons / Laboratorio Nacional de Metrologia e Radiacao Ionizante / Instituto de Radioprotecao e Dosimetria, for measurements in repeatability and reproducibility conditions. Initially, a simulation was done by applying the Monte Carlo method, using the MCNP code and respecting the ISO 8529-1 (2001), using the sources of Californium ({sup 252} Cf), Americium-Beryllium ({sup 241} AmBe) and californium in heavy water (Cf + D{sub 2}O), all located at a distance of 100 cm from the neutron detector ({sup 6}Li (Eu) - crystal scintillator). In this program, the counting of neutrons that are captured by the detector was made. The source is located in the center of a sphere of radius 300 cm. Analyzes the impact of these neutrons in a point of the sphere wall, which in this case acted as a neutron detector and from there, it is estimated the number of neutrons that collide in the whole sphere. The purpose is to obtain the neutron count for different energy bands in a solid field of neutrons, since they have a spectrum ranging from a low to a high energy that can also vary within a particular environment. Wishes to obtain new fields with different sources and moderators materials to be used as new reference fields. Measurements are being conducted for these fields, with the aim of analyzing the variability conditions of the measurement (repeatability and reproducibility) in LEN - Laboratorio de Espectrometria de Neutrons of the LN/LMNRI/IRD. Thus, the spectrometer will be used to improve both the knowledge of the spectrum as the standard of neutrons of the lab, proving that a spectrometry is essential for correct measurement.

  18. Urinary stone composition in Oman: with high incidence of cystinuria.

    Science.gov (United States)

    Al-Marhoon, Mohammed S; Bayoumi, Riad; Al-Farsi, Yahya; Al-Hinai, Abdullhakeem; Al-Maskary, Sultan; Venkiteswaran, Krishna; Al-Busaidi, Qassim; Mathew, Josephkunju; Rhman, Khalid; Sharif, Omar; Aquil, Shahid; Al-Hashmi, Intisar

    2015-06-01

    Urinary stones are a common problem in Oman and their composition is unknown. The aim of this study is to analyze the components of urinary stones of Omani patients and use the obtained data for future studies of etiology, treatment, and prevention. Urinary stones of 255 consecutive patients were collected at the Sultan Qaboos University Hospital. Stones were analyzed by Fourier transform infrared spectrophotometer. The biochemical, metabolic, and radiological data relating to the patients and stones were collected. The mean age was 41 years, with M:F ratio of 3.7:1. The common comorbidities associated with stone formation were hypertension; diabetes, benign prostate hyperplasia; urinary tract infection; obesity; and atrophic kidney. The common presentation was renal colic and flank pain (96%). Stones were surgically retrieved in 70% of patients. Mean stone size was 9 ± 0.5 mm (range 1.3-80). Stone formers had a BMI ≥ 25 in 56% (P = 0.006) and positive family history of stones in 3.8%. The most common stones in Oman were as follows: Calcium Oxalates 45% (114/255); Mixed calcium phosphates & calcium oxalates 22% (55/255); Uric Acid 16% (40/255); and Cystine 4% (10/255). The most common urinary stones in Oman are Calcium Oxalates. Overweight is an important risk factor associated with stone formation. The hereditary Cystine stones are three times more common in Oman than what is reported in the literature that needs further genetic studies. PMID:25805105

  19. RGBEXCEL: AN RGB IMAGE DATA EXTRACTOR AND EXPORTER FOR EXCEL PROCESSING

    Directory of Open Access Journals (Sweden)

    Peter A. Larbi

    2016-02-01

    Full Text Available The objective of this paper was to develop a means of rapidly obtaining RGB image data, as part of an effort to develop a low-cost method of image processing and analysis based on Microsoft Excel. A simple standalone GUI (graphical user interface software application called RGBExcel was developed to extract RGB image data from any colour image files of any format. For a given image file, the output from the software is an Excel file with the data from the R (red, G (green, and B (blue bands of the image contained in different sheets. The raw data and any enhancements can be visualized by using the surface chart type in combination with other features. Since Excel can plot a maximum dimension of 255 by 255 pixels, larger images are downscaled to have a maximum dimension of 255 pixels. Results from testing the application are discussed in the paper.

  20. H2O masers in a jet-driven bowshock: Episodic ejection from a massive young stellar object

    CERN Document Server

    Burns, R A; Nagayama, T; Sunada, K; Omodaka, T

    2016-01-01

    We report the results of VERA multi-epoch VLBI 22 GHz water maser observations of S255IR-SMA1, a massive young stellar object located in the S255 star forming region. By annual parallax the source distance was measured as D = 1.78 +-0.12 kpc and the source systemic motion was (u alpha cos d, u d) = (-0.13 +- 0.20, -0.06 +- 0.27) mas yr-1. Masers appear to trace a U-shaped bow shock whose morphology and proper motions are well reproduced by a jet-driven outflow model with a jet radius of about 6 AU. The maser data, in the context of other works in the literature, reveal ejections from S255IR-SMA1 to be episodic, operating on timescales of ~1000 years.

  1. Dicty_cDB: Contig-U14670-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e) Pelotomaculum thermopropionicum... 51 4e-05 CP000514_51( CP000514 |pid:none) Marinobacte...... 38 0.46 CP000115_2918( CP000115 |pid:none) Nitrobacter winogradskyi Nb-255... 38 0.46 CP000514_3357( CP000514 |pid:non...00115_2922( CP000115 |pid:none) Nitrobacter winogradskyi Nb-255... 37 0.78 CP0011...mosom... 37 0.78 CP000115_2105( CP000115 |pid:none) Nitrobacter winogradskyi Nb-255... 37 0.78 CP0...mo... 50 0.13 1 ( EU369640 ) Carex scoparia clone S082 microsatellite sequence. 50 0.13 1 ( EU098096 ) Blumeria gram

  2. Reed Solomon Coding for Frequency Hopping Spread Spectrum in Jamming Environment

    Directory of Open Access Journals (Sweden)

    Othman Sidek

    2008-01-01

    Full Text Available Frequency hopping spread spectrum with noncoherent M-ary frequency shift keying system is considered. In this study Reed Solomon codes RS (255, 223 are employed in a standard error correction role to provide some Anti-Jamming (AJ capability with 8-bit symbols. Noise has been added to RS encoded data, which is demodulated at RS decoder perfectly. Matlab simulations have been implemented for numerical results. Graphical results have been plotted between the probability of an erasure versus ρ using RS (255, 223 code for 1 and 2 kHz frequencies. The simulation results have proved that system having RS (255, 223 code with M = 32 require substantially less signal to jammer power ratio to achieve the same bit error probability.

  3. Study on ameliorating the FEC coding techniques in current high-rate optical transmission systems

    Science.gov (United States)

    Yuan, Jianguo; Ye, Wenwei; Jiang, Ze; Mao, Youju; Wang, Wei

    2007-01-01

    In this paper, the three ameliorated new coding schemes of the Super-FEC (Forward Error Correction) concatenatedcodes (namely, the inner-outer concatenated-code, the parallel concatenated-code and the successive concatenated-code with interleaving) are proposed after the development trend of high-rate optical transmission systems and the defects of the FEC codes in the current optical transmission systems have been analyzed. The system simulation of the inner-outer concatenated-codes is implemented and the schemes of encoding/decoding the parallel concatenated-codes are proposed. Furthermore, the two successive concatenated-codes with interleaving of the RS(255,239)+RS(255,239) code and the RS(255,239)+RS(255,223) code are simulated, and the analyses for the simulation results show that the two successive concatenated-codes with interleaving, compared with the classic RS (255,239) code and other codes, are a superior code type with the advantages of the better correction error, moderate redundancy and easy realization. And their net coding gains (NCG) are respectively 1.5dB, 2.5dB more than that of the classic RS(255,239) code at the BER (Bit Error Rate) of 10 -12. At last, based on the ITU-T G.709, the frame format of the new concatenated-code on applying in high-rate optical transmission systems is proposed and designed, this lays a firm foundation in order to design its hardware in future and pioneers a direction in its physical application.

  4. Gclust Server: 31992 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 31992 SCE_YAL014C=SYN8 Cluster Sequences Related Sequences(21) 255 Endosomal SNARE related to mammal... Sequence length 255 Representative annotation Endosomal SNARE related to mammali...hetic bacteria (15species) (%) 0.0 Non-photosynthetic bacteria (31species) (%) 0.0 Opisthokonts (Animals...an syntaxin 8 Number of Sequences 3 Homologs 3 Clustering threshold 1.00e-40 Plants and algae (7species) (%)...: 0 Rrub: 0 Rde: 0 Rsh: 0 Rsp: 0 Eco: 0 Pst: 0 Vvy: 0 Bsu: 0 Sep: 0 Fal: 0 Fra: 0 Mtu: 0 Sco: 0 Rso: 0 Cvi: 0 Bma

  5. Two-Pipe Chilled Beam System for Both Cooling and Heating of Office Buildings

    OpenAIRE

    Afshari, Alireza; Gordnorouzi, Rouzbeh; Hultmark, Göran; Bergsøe, Niels Christian

    2013-01-01

    Simulations were performed to compare a conventional 4-pipe chilled beam system and a 2-pipe chilled beam system. The objective was to establish requirements, possibilities and limitations for a well-functioning 2-pipe chilled beam system for both cooling and heating of office buildings. The building model had a net volume of 3669 m3, (L*B: 25.5m*11.5 m) and net ceiling height of 2.55 m. The building model was assumed to consist of 78 office rooms, 6 meeting rooms and 5 corridors with a 50% o...

  6. Self-reported Occupational Skin Exposure and Risk of Physician-certified Long-term Sick Leave

    DEFF Research Database (Denmark)

    Alfonso, Jose H; Tynes, Tore; Thyssen, Jacob P;

    2016-01-01

    Little is known about the contribution of occupational skin exposure as a risk factor for physician-certified long-term sick leave in the general working population of Norway. This study drew a cohort (n = 12,255; response at baseline 69.9%) randomly from the general population of Norway. Occupat......Little is known about the contribution of occupational skin exposure as a risk factor for physician-certified long-term sick leave in the general working population of Norway. This study drew a cohort (n = 12,255; response at baseline 69.9%) randomly from the general population of Norway...

  7. Drug: D07473 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D07473 Drug Atomoxetine (INN); Tomoxetine C17H21NO 255.1623 255.3547 D07473.gif Ant...TROPICS N06BA Centrally acting sympathomimetics N06BA09 Atomoxetine D07473 Atomoxetine (INN) USP drug classi...ty Disorder Agents, Non- amphetamines Atomoxetine D07473 Atomoxetine (INN) Target-based classification of dr...ugs [BR:br08310] Transporters Solute carrier family SLC6 SLC6A2 (noradrenalin transporter) [HSA:6530] [KO:K05035] Atom...oxetine [ATC:N06BA09] D07473 Atomoxetine (INN) CAS: 83015-26-3 PubChem:

  8. Introduction to an ontology-driven documentation system of damages to cultural heritage

    Czech Academy of Sciences Publication Activity Database

    Cacciotti, Riccardo; Valach, Jaroslav; Kuneš, Petr; Čerňanský, Martin; Blaško, M.; Křemen, P.

    Vol. 3. Hockley: Multi Science Publishing, 2014 - (Grussenmeyer, P.), s. 255-270 ISSN 2047-4970. [CIPA International symposium. Recording, documentation and cooperation for cultural heritage /24./. Strasbourg (FR), 02.09.2013-06.09.2013] R&D Projects: GA MK(CZ) DF11P01OVV002 Keywords : cultural heritage * damage * MONDIS Subject RIV: AL - Art, Architecture, Cultural Heritage http://multi-science.metapress.com/content/58k516653850uw21/?genre=article&id=doi%3a10.1260%2f2047-4970.3.2.255

  9. 4H-SiC junction-barrier Schottky diodes with high forward current densities

    Science.gov (United States)

    Tone, Kiyoshi; Zhao, Jian H.; Weiner, Maurice; Pan, Menghan

    2001-07-01

    4H-SiC junction-barrier Schottky (JBS) diodes blocking 1000 V have been fabricated. I-V characteristics have been evaluated at room temperature and 255 °C in comparison with the Schottky barrier (SB) and pin diodes fabricated on the same wafer. While the low reverse leakage confirms the functioning of JBS, the high forward current densities of 630 and 210 A cm-2 at 4.0 V at room temperature and 255 °C, respectively, with only ~20% reduction from those of the SB diodes, clearly demonstrate that the SiC JBS diodes can be fabricated with acceptable sacrifice in the forward current capacities.

  10. 76 FR 14323 - Small Business Size Standards: Professional, Scientific and Technical Services

    Science.gov (United States)

    2011-03-16

    ... Agencies........ 10.0 14.0 5.0 $25.5 $10.0 541820 1.2 13.7 0.4 19.3 403.7 0.698 -21.6 7.0 7.0 Public Relations Agencies... 5.0 5.0 5.0 $5.0 $10.0 541830 4.3 65.3 36.0 320.1 0.834 25.5 7.0 Media Buying Agencies... standards was published in the Federal Register on July 18, 2008 (73 FR 41237). SBA recognizes that...

  11. Dicty_cDB: Contig-U15012-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available keidydylvvstglelywdrvkglke nlgkngvtsnysydscektfefikslkpgnvaiftvpttgvkcggapqkilwlcddylrk hgirdkvrldfnsagasmfp... used: 330555782440 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bi...um sp. YO3AOP1... 39 0.72 CP001022_2283( CP001022 |pid:none) Exiguobacterium sibiricum 255-1......omplete ... 36 6.1 CP001022_2275( CP001022 |pid:none) Exiguobacterium sibiricum 255-1... 36 6.1 AE016879_491...*fm*kdi*iy*iietr*ccnlystnhwc*mwwrttkdplvm*rlfkkt wys**g*irfqqcrclnvpseeil*gfg*ng*rkrckskfctqfsrdqr**YFIPKGAT

  12. About a new Smarandache-type sequence

    OpenAIRE

    Biro, Csaba

    1997-01-01

    The computers can operate with 256 characters and all of them has an ASCII code which is an integer from 0 to 255. If you press ALT key and you type a number, the character of the number will appear. But if you type a number that is greater than 255, the computer will calculate the remainder after division by 256, and the corresponding character will appear. "Can you show each character by pressing the same number key k-times?"

  13. High-output-power deep ultraviolet light-emitting diode assembly using direct bonding

    Science.gov (United States)

    Ichikawa, Masatsugu; Fujioka, Akira; Kosugi, Takao; Endo, Shinya; Sagawa, Harunobu; Tamaki, Hiroto; Mukai, Takashi; Uomoto, Miyuki; Shimatsu, Takehito

    2016-07-01

    We fabricated high-output-power 255 and 280 nm light-emitting diodes (LEDs) using direct bonding. The LED chips were bonded to sapphire lenses at room temperature using either atomic diffusion bonding or surface-activated bonding. The LEDs with lenses had a higher light extraction efficiency than conventionally structured LEDs. As a result, at a forward current of 350 mA, the output power of the 255 nm LED increased by a factor of 2.8, reaching 73.6 mW, while that of the 280 nm LED increased by a factor of 2.3, reaching 153 mW.

  14. Dicty_cDB: Contig-U14902-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3 CP000115_2105( CP000115 |pid:none) Nitrobacter winogradskyi Nb-255... 45 0.003 BX842648_169( BX842648 |pid:none) Bdellovibrio bac...as putida F1, complete... 44 0.006 AP009389_2124( AP009389 |pid:none) Pelotomaculum thermopropionicum.....e) Pelobacter propionicus DSM 2379... 42 0.027 CP000359_501( CP000359 |pid:non...bacter winogradskyi Nb-255... 38 0.30 CP001287_2532( CP001287 |pid:none) Cyanothece ...oplasmic 8.0 %: cytoskeletal 4.0 %: extracellular, including cell wall 4.0 %: plasma membrane >> prediction for Con

  15. A new type-B cask design for transporting 252Cf

    International Nuclear Information System (INIS)

    A project to design, certify, and build a new US Department of Energy (DOE) Type B container for transporting >5 mg of 252Cf is more than halfway to completion. This project was necessitated by the fact that the existing Oak Ridge National Laboratory (ORNL) Type B containers were designed and built many years ago and thus do not have the records and supporting data that current regulations require. Once the new cask is available, it will replace the existing Type B containers. The cask design is driven by the unique properties of 252Cf, which is a very intense spontaneous fission neutron source and necessitates a large amount of neutron shielding. The cask is designed to contain up to 60 mg of 252Cf in the form of californium oxide or californium oxysulfate, in pellet, wire, or sintered material forms that are sealed inside small special-form capsules. The new cask will be capable of all modes of transport (land, sea, and air). The ORNL team, composed of technical and purchasing personnel and using rigorous selection criteria, chose NAC, International (NAC), as the subcontractor for the project. In January 1997, NAC started work on developing the conceptual design and performing the analyses. The original design concept was for a tungsten alloy gamma shield surrounded by two concentric shells of NS-4-FR neutron shield material. A visit to US Nuclear Regulatory Commission (NRC) regulators in November 1997 to present the conceptual design for their comments resulted in a design modification when the question of potential straight-line cracking in the NS-4-FR neutron shield material arose. NAC's modified design includes offset, wedgelike segments of the neutron shield material. The new geometry eliminates concerns about straight-line cracking but increases the weight of the packaging and makes the fabrication more complex. NAC has now completed the cask design and performed the analyses (shielding, structural, thermal, etc.) necessary to certify the cask. The cask

  16. The Development of Neutron Radiography and Tomography on a SLOWPOKE-2 Reactor

    Science.gov (United States)

    Bennett, L. G. I.; Lewis, W. J.; Hungler, P. C.

    Development of neutron radiography at the Royal Military College of Canada (RMC) started by trying to interest the Royal Canadian Air Force (RCAF) in this new non-destructive testing (NDT) technique. A Californium-252 based device was ordered and then installed at RMC for development of applicable techniques for aircraft by the first author. A second and transportable device was then designed, modified and used in trials at RCAF Bases and other locations for one year. This activity was the only foreign loan of the U.S. Californium Loan Program. Around this time, SLOWPOKE-2 reactors were being installed at four Canadian universities, while a new science and engineering building was being built at RMC. A reactor pool was incorporated and efforts to procure a reactor succeeded a decade later with a SLOWPOKE-2 reactor being installed at RMC. The only modification by the vendor for RMC was a thermal column replacing an irradiation site inside the reactor container for a later installation of a neutron beam tube (NBT). Development of a working NBT took several years, starting with the second author. A demonstration of the actual worth of neutron radiography took place with a CF-18 Hornet aircraft being neutron and X-radiographed at McClellan Air Force Base, Sacramento, CA. This inspection was followed by one of the rudders that had indications of water ingress being radiographed successfully at RMC just after the NBT became functional. The next step was to develop a neutron radioscopy system (NRS), initially employing film and then digital imaging, and is in use today for all flight control surfaces (FCS). With the third author, a technique capable of removing water from affected FCS was developed at RMC. Heating equipment and a vacuum system were utilized to carefully remove the water. This technique was proven using a sequence of near real time neutron images obtained during the drying process. The results of the drying process were correlated with a relative humidity

  17. A single VLSI chip for computing syndromes in the (225, 223) Reed-Solomon decoder

    Science.gov (United States)

    Hsu, I. S.; Truong, T. K.; Shao, H. M.; Deutsch, L. J.

    1986-11-01

    A description of a single VLSI chip for computing syndromes in the (255, 223) Reed-Solomon decoder is presented. The architecture that leads to this single VLSI chip design makes use of the dual basis multiplication algorithm. The same architecture can be applied to design VLSI chips to compute various kinds of number theoretic transforms.

  18. Population structure and reproductive biology of Mesopodopsis orientalis (Crustacea: Mysida) in a tropical mangrove ecosystem in India

    Digital Repository Service at National Institute of Oceanography (India)

    Biju, A; Panampunnayil, S.U.

    ). The sampled population was found in a wide range of temperature (25.5 degree celsius to 34 degree celsius) and salinities (20.3 to 37.1). Carapace length significantly correlated with total body length (P < 0.01). Mesopodopsis orientalis breed throughout...

  19. Distribution of Aceria carvi Nal. in Caraway (Carum carvi L.) growing areas of Bohemia

    Czech Academy of Sciences Publication Activity Database

    Reindl, František; Kameníková, L.; Kurowská, M.; Zemková-Rovenská, Gabriela; Zemek, Rostislav

    2004-01-01

    Roč. 7, - (2004), s. 255-256. ISSN 1335-258X R&D Projects: GA ČR(CZ) GA522/02/1490 Institutional research plan: CEZ:AV0Z5007907 Keywords : Aceria carvi * caraway * Eriophyoid mites Subject RIV: EG - Zoology

  20. Changes in white blood cells in sheep blood during selenium supplementation

    Czech Academy of Sciences Publication Activity Database

    Písek, L.; Trávníček, J.; Salát, Jiří; Kroupová, V.; Soch, M.

    2008-01-01

    Roč. 53, č. 5 (2008), s. 255-259. ISSN 0375-8427 R&D Projects: GA ČR GD523/03/H076 Institutional research plan: CEZ:AV0Z60220518 Keywords : ewes * immunity * T lymphocytes * CD4(+) * CD8(+) Subject RIV: GG - Livestock Rearing Impact factor: 0.659, year: 2008

  1. Inhibitory Control in Preschool Predicts Early Math Skills in First Grade: Evidence from an Ethnically Diverse Sample

    Science.gov (United States)

    Ng, Florrie Fei-Yin; Tamis-LeMonda, Catherine; Yoshikawa, Hirokazu; Sze, Irene Nga-Lam

    2015-01-01

    Preschoolers' inhibitory control and early math skills were concurrently and longitudinally examined in 255 Chinese, African American, Dominican, and Mexican 4-year-olds in the United States. Inhibitory control at age 4, assessed with a peg-tapping task, was associated with early math skills at age 4 and predicted growth in such skills from…

  2. Comparison of Pb, Zn, Cd, As, Cr, Mo and Sb adsorption onto natural surface coatings in a stream draining natural As geochemical anomaly

    Czech Academy of Sciences Publication Activity Database

    Drahota, Petr; Škaloud, P.; Nováková, B.; Mihaljevič, M.

    2014-01-01

    Roč. 93, č. 3 (2014), s. 311-315. ISSN 0007-4861 Institutional research plan: CEZ:AV0Z30130516 Institutional support: RVO:67985831 Keywords : biofilm * biogenic Mn oxide * distribution coefficient * trace elements Subject RIV: DD - Geochemistry Impact factor: 1.255, year: 2014

  3. Recovery of soil nematode populations from cropping stress by natural secondary succession to meadow land

    Czech Academy of Sciences Publication Activity Database

    Háněl, Ladislav

    2003-01-01

    Roč. 22, - (2003), s. 255-270. ISSN 0929-1393 R&D Projects: GA ČR GA526/02/0036 Institutional research plan: CEZ:AV0Z6066911 Keywords : abundance * diversity * community structure Subject RIV: EH - Ecology, Behaviour Impact factor: 1.483, year: 2003

  4. Dicty_cDB: Contig-U10778-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 255 e-128 DQ980509_1( DQ980509 |pid:none) Thaumatomonas sp. TMT002 alpha tub... 242 e-128 AY818731_1( AY8187... e-122 DQ980537_1( DQ980537 |pid:none) Leucocryptos marina clone lmtua10 ... 245 e-122 EF455794_1( EF455794 |pid:none) Thaumatomo

  5. Cognitive Ability Is Associated with Different Outcome Trajectories in Autism Spectrum Disorders

    Science.gov (United States)

    Ben-Itzchak, Esther; Watson, Linda R.; Zachor, Ditza A.

    2014-01-01

    Variability in clinical expression and in intervention outcome has been described in autism spectrum disorder (ASD). The study examined progress after 1 and 2 years of intervention and compared the impact of baseline cognitive ability on outcome trajectories in 46 children (m = 25.5 months) with ASD. The entire group showed a gradual decrease in…

  6. The Contribution of Ideational Behavior to Creative Extracurricular Activities

    Science.gov (United States)

    Paek, Sue Hyeon; Park, Hyeri; Runco, Mark A.; Choe, Ho-Seong

    2016-01-01

    The prediction of creative performance from ideation has shown promise, but questions remain. In this study, the relationship of ideational behavior and the creative performance of elementary school children (N = 255) was examined across 6 domains of creative performance: science, mathematics, technology, fine arts, music, and writing.…

  7. ECCS used in DIDO and PLUTO

    International Nuclear Information System (INIS)

    DIDO and PLUTO are heavy water tank-type reactors with power levels of 25.5 MW. Measures are described that protect against failure of the smaller pipes in the primary system, and more importantly. against weld failure at the junction to a large pipe rather than in the small pipe itself. (author). 1 ref., 2 figs

  8. Self-Harm Experiences among Hispanic and Non-Hispanic White Young Adults

    Science.gov (United States)

    Croyle, Kristin L.

    2007-01-01

    Very little research exists on self-harm in Hispanic populations, although there is a strong literature that addresses suicidality in Hispanics. This study compares self-reported rates of self-harm in 255 non-Hispanic White (NHW) and 187 Hispanic (predominantly Mexican American) undergraduate students. Results indicated that self-harm is…

  9. Disease: H00860 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 70] [KO:K15225] ICD-10: G25.5 MeSH: D002819 OMIM: 118700 PMID:19501334 (description, gene) Gilbert DL Acute and chronic chorea in chi...ldhood. Semin Pediatr Neurol 16:71-6 (2009) PMID:21292530 (description, gene) Inzel

  10. High-pressure X-ray diffraction of L-ALANINE crystal

    DEFF Research Database (Denmark)

    Olsen, J.S.; Gerward, Leif; Souza, A.G.;

    2006-01-01

    L-ALANINE has been studied by X-ray diffraction at ambient temperature and pressure up to 10.3 GPa. The material is found to transform to a tetragonal structure between 2 and 3 GPa. and to a monoclinic structure between 8 and 10 GPa. The experimental bulk modulus is 25(5) GPa for the orthorhombic...

  11. Immunity

    Institute of Scientific and Technical Information of China (English)

    1997-01-01

    970239 The effect of interleukin 6 against cytopeniaand suppressed phagocytosis of macrophage caused bychemotherapy. ZHANG Lichao(张利朝), et al.Tangdu Hosp, 4th Milit Med Univ, Xian, 710038. ChinJ Clin Oncol 1997; 24(4): 252-255. Objective: To explore The effect of interleukin 6against cytopenia and suppressed phagocytosis ofmacrophage caused by chemotherapy. Methods:Inter-

  12. Keplerův Novoroční dar krystalografii

    Czech Academy of Sciences Publication Activity Database

    Fábry, Jan

    2012-01-01

    Roč. 62, č. 4 (2012), s. 253-255. ISSN 0009-0700 Institutional research plan: CEZ:AV0Z10100520 Keywords : Johannes Kepler * Strena Seu de nive sexangula * six-cornered snow-flakes * close-packed arrangements of spheres Subject RIV: AB - History

  13. Boron reinforced composites. 1976-April 1980 (citations from the NTIS Data Base). Report for 1976-April 1980

    Energy Technology Data Exchange (ETDEWEB)

    Cavagnaro, D.M.

    1980-05-01

    The bibliography cites Federally-funded research on boron fibers and boron compounds used as reinforcing material in composites. Included are studies on fabrication, testing, uses, and structural and mechanical properties. (This updated bibliography contains 255 abstracts, 19 of which are new entries to the previous edition.)

  14. Nové pohledy na mechanismus z Antikythery

    Czech Academy of Sciences Publication Activity Database

    Hadrava, Petr; Hadravová, Alena

    2008-01-01

    Roč. 41, č. 4 (2008), s. 255-264. ISSN 0300-4414 Institutional research plan: CEZ:AV0Z10030501; CEZ:AV0Z80630520 Keywords : analog ancient computer * turn of the 2nd to 1st century B. C * Antikythera island Subject RIV: AB - History

  15. Projevy mateřského citu nebo smyslu pro povinnost u bezdětné české královny Žofie?

    Czech Academy of Sciences Publication Activity Database

    Kopičková, Božena

    Praha: Filosofia, 2007 - (Silagiova, Z.; Šedinová, H.; Kitzler, P.), s. 178-188 ISBN 978-80-7007-255-4 Institutional research plan: CEZ:AV0Z80150510 Keywords : history of women * middle ages * queen Sofia of Bohemia Subject RIV: AB - History

  16. Pick-N Multiple Choice-Exams: A Comparison of Scoring Algorithms

    Science.gov (United States)

    Bauer, Daniel; Holzer, Matthias; Kopp, Veronika; Fischer, Martin R.

    2011-01-01

    To compare different scoring algorithms for Pick-N multiple correct answer multiple-choice (MC) exams regarding test reliability, student performance, total item discrimination and item difficulty. Data from six 3rd year medical students' end of term exams in internal medicine from 2005 to 2008 at Munich University were analysed (1,255 students,…

  17. 77 FR 60731 - Notice of Applications for Deregistration Under Section 8(f) of the Investment Company Act of 1940

    Science.gov (United States)

    2012-10-04

    ... asset value. Applicants have retained approximately $73,311 and $72,526, respectively, in a liquidating trust to pay contingent liabilities. Expenses of $67,715 incurred in connection with each liquidation..., made final distributions to shareholders based on net asset value. Expenses of $94,356, $276,255,...

  18. Protein (Viridiplantae): 15239547 [

    Lifescience Database Archive (English)

    Full Text Available NP_200221.1 33090:255 35493:10960 131221:10960 3193:10960 58023:6871 78536:476 58024:476 3398:47 ... 0:2583 980083:2583 3701:2583 3702:1873 SPFH/Band 7/PHB ... domain-containing membrane-associated protein Arab ...

  19. Protein (Viridiplantae): 18417021 [

    Lifescience Database Archive (English)

    Full Text Available NP_567778.1 33090:255 35493:10960 131221:10960 3193:10960 58023:6871 78536:476 58024:476 3398:47 ... 0:2583 980083:2583 3701:2583 3702:1873 SPFH/Band 7/PHB ... domain-containing membrane-associated protein Arab ...

  20. Investigating ESL Students' Academic Performance in Tenses

    Science.gov (United States)

    Javed, Muhammad; Ahmad, Atezaz

    2013-01-01

    The present study intends to assess the ESL students' performance in tenses at secondary school level. Grade 10 students were the target population of the study. A sample of 396 students (255 male and 141 female) was selected through convenience sampling technique from the District of Bahawalnagar, Pakistan. A test focusing on five different types…

  1. Česko-slovinská lexikografie ve20. století

    Czech Academy of Sciences Publication Activity Database

    Blažek, David

    Praha: Národní knihovna ČR - Slovanská knihovna, 2011 - (Jensterle-Doležalová, A.), s. 255-264. (Publikace Slovanské knihovny. 68). ISBN 978-80-7050-604-2 Institutional research plan: CEZ:AV0Z90920516 Keywords : dictionaries * bilingual lexicography * Czech-Slovenian relations * Czech * Slovenian Subject RIV: AI - Linguistics

  2. 19 CFR 148.114 - Shipment of unaccompanied articles.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Shipment of unaccompanied articles. 148.114 Section 148.114 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY... States § 148.114 Shipment of unaccompanied articles. One copy of the validated Customs Form 255 shall...

  3. Advantages of breath testing for the early diagnosis of lung cancer

    Czech Academy of Sciences Publication Activity Database

    Smith, D.; Španěl, Patrik; Sule-Suso, J.

    2010-01-01

    Roč. 10, č. 3 (2010), s. 255-257. ISSN 1473-7159 Institutional research plan: CEZ:AV0Z40400503 Keywords : mass spectrometry * breath analysis * lung cancer Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.652, year: 2010

  4. Dynamika dusíku a expanze ovsíku vyvýšeného (Arrhenatherum elatius) na vřesovištích v Národním parku Podyjí

    Czech Academy of Sciences Publication Activity Database

    Fabšičová, Martina; Sedláková, Iva; Holub, Petr; Tůma, Ivan; Chytrý, M.; Záhora, J.

    Praha: Agentura ochrany přírody a krajiny ČR, 2003 - (Pivničková, M.), s. 255-263 ISBN 80-86064-86-7 Institutional research plan: CEZ:AV0Z6005908 Keywords : atmospheric nitrogen deposition * Calluna vulgaris * Arrhenatherum elatius Subject RIV: EF - Botanics

  5. Zvířecí skelet z laténského objektu v Nových Dvorech, okr. Kutná Hora

    Czech Academy of Sciences Publication Activity Database

    Kyselý, René

    2011-01-01

    Roč. 63, č. 2 (2011), s. 253-255. ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : ritual * La Tène period * osteology * Bos taurus * cattle Subject RIV: AC - Archeology, Anthropology, Ethnology

  6. Is mamary gland growth a suitable model fof testing antiandrogens?

    Czech Academy of Sciences Publication Activity Database

    Škarda, Josef; Krejčí, Petr; Valík, David; Vašek, Vladimír; Snochowski, M.

    1996-01-01

    Roč. 41, č. 1 (1996), s. 37. ISSN 0044-4847. [International symposium of animal physiology /16./. Třešť, 22.11.1995-24.11.1995] R&D Projects: GA ČR GA505/94/0009 Impact factor: 0.255, year: 1996

  7. 18 CFR 740.7 - Administration of financial assistance.

    Science.gov (United States)

    2010-04-01

    ... STATE WATER MANAGEMENT PLANNING PROGRAM § 740.7 Administration of financial assistance. (a) Grants under...-102, Revised, (34 CFR part 256), entitled “Uniform Administrative Requirements for Grants-in-Aid to State and Local Governments;” (2) Federal Management Circular (FMC) 74-4 (34 CFR part 255),...

  8. Vocational Exploration in Middle School: Motivational Characteristics of Students and Perceptions of the Learning Climate

    Science.gov (United States)

    Duchesne, Stephane; Mercier, Adeline; Ratelle, Catherine F.

    2012-01-01

    The goal of this study was twofold: first, to identify vocational exploration profiles in the second year of middle school (Grade 8), and second, to distinguish these profiles in terms of sociomotivational variables. The sample included 521 students (255 boys, 266 girls) attending middle schools in Quebec. Results revealed three vocational…

  9. Comparative Evaluation of the Novel bioNexia Legionella Test with the BinaxNOW Legionella Card Assay and the Sofia Legionella FIA Assay for Detection of Legionella pneumophila (Serogroup 1) Antigen in Urine Samples.

    Science.gov (United States)

    Congestrì, Francesco; Crepaldi, Elisabetta; Gagliardi, Marina; Pedna, Maria Federica; Sambri, Vittorio

    2016-04-01

    A new immunochromatographic test (bioNexiaLegionella; bioMérieux) for the detection ofLegionella pneumophilaurinary antigen was evaluated in 255 urine samples. The results were compared with those obtained by the BinaxNOW and SofiaLegionellatests. The novel test compared well with those currently in use. PMID:26865691

  10. Hβ photometry of northern intermediate galactic latitude early-type stars and galactic structure away from the plane

    International Nuclear Information System (INIS)

    Photoelectric Hβ photometry is presented for 255 early-type stars at intermediate galactic latitudes. Absolute magnitudes and distances are derived for the more luminous stars. Those with Msub(v) =< -2.5 and at distances of up to 1 kpc from the galactic plane, may follow spiral structure in the plane. (author)

  11. Ultrastructural ontogeny of the labial gland apparatus in termite .I.Prorhinotermes simplex./I. (Isoptera, Rhinotermitidae)

    Czech Academy of Sciences Publication Activity Database

    Šobotník, Jan; Weyda, František

    2003-01-01

    Roč. 31, - (2003), s. 255-270. ISSN 1467-8039 R&D Projects: GA ČR GA522/97/0126 Institutional research plan: CEZ:AV0Z5007907; CEZ:AV0Z4055905 Keywords : acini * central cells * parietal cells Subject RIV: CE - Biochemistry Impact factor: 0.956, year: 2003

  12. Laser Spectroscopy of Transient Carbon Species in the Context of Soot Formation

    Czech Academy of Sciences Publication Activity Database

    Nevrlý, V.; Střižík, M.; Bitala, P.; Zelinger, Zdeněk

    Singapore: World Scientific Publishing Co. Pte. Ltd, 2011 - (Nemes, L.; Irle, S.), s. 255-282. (Advances in the Understanding of the Most Complex High-Temperature Elemental System). ISBN 978-981-283-765-3 Institutional research plan: CEZ:AV0Z40400503 Keywords : laser spectroscopy * carbon species Subject RIV: CF - Physical ; Theoretical Chemistry

  13. Argillization of topaz-bearing granites in the Hub stock, Horní Slavkov-Krásno SN-W ore district (Bohemian Massif, Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Šťastný, Martin; René, Miloš

    2014-01-01

    Roč. 11, č. 3 (2014), s. 255-267. ISSN 1214-9705 R&D Projects: GA ČR GA205/09/0540 Institutional support: RVO:67985831 ; RVO:67985891 Keywords : Bohemian Massif * Saxothuringian Zone * topaz granite * argillization * clay minerals * dickite * tosudite Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.389, year: 2014

  14. 76 FR 14661 - Notice of Public Information Collection(s) Being Submitted for Review and Approval to the Office...

    Science.gov (United States)

    2011-03-17

    ... Act of 1996: Access to Telecommunications Service, Telecommunications Equipment and Customer Premises... Number: 3060-1111. Title: Section 225 and 255 Interconnected Voice of Internet- Protocol Services (VoIP... of the Act, to providers of ``interconnected voice over Internet Protocol (VoIP) services,''...

  15. Comments on "The use of field dependence of magnetic susceptibility for monitoring variations in titanomagnetite composition - a case study on basanites from the Vogelsberg 1996 drillhole, Germany", by de Wall and Nano, Stud. Geophys. Geod., 48, 767-776

    Czech Academy of Sciences Publication Activity Database

    Petrovský, Eduard; Kapička, Aleš

    2005-01-01

    Roč. 49, č. 2 (2005), s. 255-258. ISSN 0039-3169 Institutional research plan: CEZ:AV0Z30120515 Keywords : magnetic susceptibility * Curie temperature * titanomagnetite composition Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 0.656, year: 2005

  16. 75 FR 61101 - Closed Captioning of Video Programming

    Science.gov (United States)

    2010-10-04

    ..., 2010. The provision in 47 CFR 79.1(i)(1) and (2), published at 74 FR 1594, January 13, 2009, requiring...- 255, (2008 Closed Captioning Order), published at 74 FR 1594, January 13, 2009, which, among other..., published at 74 FR 1594, January 13, 2009, was a non-major action pursuant to the CRA. Document DA...

  17. 75 FR 7368 - Closed Captioning of Video Programming

    Science.gov (United States)

    2010-02-19

    .... DATES: 47 CFR 79.1(i)(3), published at 74 FR 1594, January 13, 2009, and the revisions in this document... Proposed Rulemaking, FCC 08- 255 (2008 Closed Captioning Order), published at 74 FR 1594, January 13, 2009... COMMISSION 47 CFR Part 79 Closed Captioning of Video Programming AGENCY: Federal Communications...

  18. Exponential ergodicity for stochastic Burgers and 2D Navier-Stokes equations

    Czech Academy of Sciences Publication Activity Database

    Goldys, B.; Maslowski, Bohdan

    2005-01-01

    Roč. 226, č. 1 (2005), s. 230-255. ISSN 0022-1236 R&D Projects: GA ČR(CZ) GA201/04/0750 Institutional research plan: CEZ:AV0Z10190503 Keywords : exponential ergodicity * v-uniform ergodicity * stochastic Burgers equation Subject RIV: BA - General Mathematics Impact factor: 0.806, year: 2005

  19. Traditional Chinese Medicine

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    2010150 A prospective multicenter randomized double-blinded controlled clinical trial on effects of Tiantai No. 1 in treating mild cognitive impairment. WU Zhengzhi(吴正治),et al. Shenzhen Hosp,Southern Med Univ,Guangdong 518035.Chin J Integr Tradit & West Med 2010;30(3):255-258.

  20. Estimating climatological variability of solar energy production

    Czech Academy of Sciences Publication Activity Database

    Juruš, Pavel; Eben, Kryštof; Resler, Jaroslav; Krč, Pavel; Kasanický, Ivan; Pelikán, Emil; Brabec, Marek; Hošek, Jiří

    98 Part C, December (2013), s. 255-264. ISSN 0038-092X R&D Projects: GA MŠk LD12009 Institutional support: RVO:67985807 ; RVO:68378289 Keywords : MERRA * reanalysis * numerical weather prediction * photovoltaic power production Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 3.541, year: 2013

  1. Solomon Islands Botany

    NARCIS (Netherlands)

    Steenis, van C.G.G.J.

    1969-01-01

    A discussion of the Results of the Royal Society Expedition to the British Solomon Islands Protectorate, 1965. Organized by E.J.H. Corner. Phil. Trans. R. Soc. B 255 (1969) 185-631, 196 fig. University Printing House, Shaftesbury Road, Cambridge. Obtainable through booksellers or direct to the Royal

  2. Moderator Role of Self-Esteem on the Relationship between Life Satisfaction and Depression in Early Adolescents

    Science.gov (United States)

    Civitci, Asim

    2010-01-01

    In this study, the moderator effects of global self-esteem on the relationship between life satisfaction domains (family, friends and school) and depression in early adolescents were examined. The participants consisted of 255 students, aged from 11 to 15 years, from three junior high schools in Turkey. Data were collected using the Rosenberg…

  3. Final report: Waterfowl activity and habitat use on the Swan Lake HREP Site

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — We studied diurnal activity and habitat use patterns of waterfowl on Swan Lake in Calhoun County, IL during fall and spring migrations 1992-93. Swan Lake, a 1,255...

  4. Nomen virtutibus aequas. Některé typy latinských příjmení a přezdívek v antice a ve středověku

    Czech Academy of Sciences Publication Activity Database

    Šedinová, Hana

    Praha : Filosofia, 2007 - (Silagiova, Z.; Šedinová, H.; Kitzler, P.), s. 94-117 ISBN 978-80-7007-255-4 Institutional research plan: CEZ:AV0Z90090514 Keywords : cognomen * nicknames * antique period Subject RIV: AA - Philosophy ; Religion

  5. Diverse retrotransposon families and an AT-rich satellite DNA revealed in giant genomes of Fritillaria lilies

    Czech Academy of Sciences Publication Activity Database

    Ambrožová, K.; Mandáková, T.; Bureš, P.; Neumann, Pavel; Leitch, I. J.; Koblížková, Andrea; Macas, Jiří; Lysák, M.

    2011-01-01

    Roč. 107, č. 2 (2011), s. 255-268. ISSN 0305-7364 R&D Projects: GA ČR GA521/07/0284; GA MŠk(CZ) LC06004 Institutional research plan: CEZ:AV0Z50510513 Keywords : Fritillaria * Liliaceae * repetitive DNA Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.030, year: 2011

  6. Drugs, guns and early motherhood in Colombia

    OpenAIRE

    Millán-Quijano, Jaime

    2015-01-01

    This paper examines the effect of violent crime on the prevalence of early motherhood in Colombia. To instrument for the predominance of violent crime I use geographical and temporal variation in drug trafficking networks. My results suggest that one standard deviation increase in the homicide rate induces a 2.55 percentage points increase in the probability of early motherhood

  7. The Influence of Sample Drying Procedures on Mercury Concentrations Analyzed in Soils

    Czech Academy of Sciences Publication Activity Database

    Hojdová, Maria; Rohovec, Jan; Chrastný, V.; Penížek, V.; Navrátil, Tomáš

    2015-01-01

    Roč. 94, č. 5 (2015), s. 570-576. ISSN 0007-4861 R&D Projects: GA ČR GP526/09/P404; GA ČR(CZ) GAP210/11/1369 Institutional support: RVO:67985831 Keywords : sample preparation * drying procedures * microbial activity * freeze - drying * contamination Subject RIV: DD - Geochemistry Impact factor: 1.255, year: 2014

  8. The importance of species phylogenetic relationships and species traits for the intensity of plant-soil feedback

    Czech Academy of Sciences Publication Activity Database

    Münzbergová, Zuzana; Šurinová, Mária

    2015-01-01

    Roč. 6, č. 11 (2015), s. 1-16. ISSN 2150-8925 R&D Projects: GA ČR(CZ) GA15-11635S Institutional support: RVO:67985939 Keywords : phylogenetic relationships * species traits * plant-soil feedback Subject RIV: EF - Botanics Impact factor: 2.255, year: 2014

  9. The Subsequent Dissemination of Material Presented in Sessions of the Metallurgical Society at the 96th AIME Annual Meeting.

    Science.gov (United States)

    Johns Hopkins Univ., Baltimore, MD. Center for Research in Scientific Communication.

    Studies of 255 authors of program material at the Metallurgical Society session of the 96th American Institute of Mining, Metallurgical, and Petroleum Engineers (AIME) Annual Meeting yielded data on the subsequent dissemination of presented material during the year following the meeting. Data showed that three-fourths of the authors who made…

  10. A graphical representation of equivalence classes of AMP chain graphs

    Czech Academy of Sciences Publication Activity Database

    Roverato, A.; Studený, Milan

    2006-01-01

    Roč. 7, č. 6 (2006), s. 1045-1078. ISSN 1532-4435 R&D Projects: GA ČR GA201/04/0393 Institutional research plan: CEZ:AV0Z10750506 Keywords : chain graph * AMP Markov equivalence * strong equivalence * largest deflagged graph Subject RIV: BA - General Mathematics Impact factor: 2.255, year: 2006

  11. Oblagium aneb dobrodružství latinského slovníku

    Czech Academy of Sciences Publication Activity Database

    Koronthályová, Markéta

    Praha : Filosofia, 2007 - (Silagiova, Z.; Šedinová, H.; Kitzler, P.), s. 189-201 ISBN 978-80-7007-255-4 Institutional research plan: CEZ:AV0Z90090514 Keywords : oblagium - charge * sacrifice * some religious act Subject RIV: AA - Philosophy ; Religion

  12. Factors Affecting the Effectiveness and Use of Moodle: Students' Perception

    Science.gov (United States)

    Damnjanovic, Vesna; Jednak, Sandra; Mijatovic, Ivana

    2015-01-01

    The purpose of this research paper is to identify the factors affecting the effectiveness of Moodle from the students' perspective. The research hypotheses derived from the suggested extended Seddon model have been empirically validated using the responses to a survey on e-learning usage among 255 users. We tested the model across higher education…

  13. Effect of red wine and red grape extract on blood lipids, haemostatic factors, and other risk factors for cardiovascular disease

    DEFF Research Database (Denmark)

    Hansen, Alice Schmidt; Marckmann, P.; Dragsted, L.O.;

    2005-01-01

    ( males: 300 ml/day, 38.3 g alcohol/day, female subjects: 200 ml/ day, 25.5 g alcohol/day), 2: water+red grape extract tablets ( wine-equivalent dose), 3: water+red grape extract tablets ( half dose), or 4: water+placebo tablets for a period of 4 weeks. No other sources of alcohol or anthocyanin were...

  14. Spruce bark beetle (Ips typographus L.) infestation and Norway spruce status: is there a causal relationship?

    Czech Academy of Sciences Publication Activity Database

    Moravec, Ivo; Cudlín, Pavel; Polák, T.; Havlíček, František

    2002-01-01

    Roč. 8, - (2002), s. 255-264. ISSN 1211-7420 R&D Projects: GA MŠk OK 389 Institutional research plan: CEZ:AV0Z6087904 Keywords : bark beetle infestation * crown status * Picea abies Subject RIV: GK - Forestry

  15. Identity Theft and Consumer Health Education: A Case Study Teaching the Skill of Decision Making

    Science.gov (United States)

    Jefson, Cristy A.

    2007-01-01

    Identity theft is the fastest growing white-collar crime in America, increasing 40% annually. Identity theft occurs when personal-identifying information, such as a social security number, date of birth, or address, is used to commit fraud. From January 1, 2005, to December 31, 2005, 255,565 people in the United States were victims of identity…

  16. Effect of pressure and high magnetic field on phase transitions and magnetic properties of Ni.sub.1.92./sub.Mn.sub.1.56./sub.Sn.sub.0.52./sub. and Ni.sub.2./sub.MnSn Heusler compounds

    Czech Academy of Sciences Publication Activity Database

    Kaštil, Jiří; Kamarád, Jiří; Isnard, O.; Skourski, Y.; Míšek, Martin; Arnold, Zdeněk

    2015-01-01

    Roč. 650, Nov (2015), s. 248-255. ISSN 0925-8388 R&D Projects: GA ČR GA15-03777S Institutional support: RVO:68378271 Keywords : intermetallics * crystal structure * high pressure * magnetocaloric * magentisation Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.999, year: 2014

  17. The impact of materials technology and operational constraints on the economics of cruise speed selection

    Science.gov (United States)

    Clauss, J. S., Jr.; Bruckman, F. A.; Horning, D. L.; Johnston, R. H.; Werner, J. V.

    1981-01-01

    Six material concepts at Mach 2.0 and three material concepts at Mach 2.55 were proposed. The resulting evaluations, based on projected development, production, and operating costs, indicate that aircraft designs with advanced composites as the primary material ingredient have the lowest fare premiums at both Mach 2.0 and 2.55. Designs having advanced metallics as the primary material ingredient are not economical. Advanced titanium, employing advanced manufacturing methods such as SFF/DB, requires a fare premium of about 30 percent at both Mach 2.0 and 2.55. Advanced aluminum, usable only at the lower Mach number, requires a fare premium of 20 percent. Cruise speeds in the Mach 2.0-2.3 regime are preferred because of the better economics and because of the availability of two material concepts to reduce program risk - advanced composites and advanced aluminums. This cruise speed regime also avoids the increase in risk associated with the more complex inlets and airframe systems and higher temperature composite matrices required at the higher Mach numbers typified by Mach 2.55.

  18. Fosterreduktion--en retrospektiv opgørelse

    DEFF Research Database (Denmark)

    Frederiksen, Mette Heinel; Henriksen, Stine Dam; Bønnelykke, Astrid Julie;

    2009-01-01

    two total foetal losses (5%), one stillborn and 82 live born, among which two died perinatally. The median gestational age was 255 days (36 weeks and three days), five children were born before week 32 (6%), the mean birth weight among live born was 2,390 +/- 578 grams (mean +/- standard deviation...

  19. The Impact of Perceived Discrimination and Social Support on the School Performance of Multiethnic Sexual Minority Youth

    Science.gov (United States)

    Craig, Shelley L.; Smith, Mark S.

    2014-01-01

    Sexual minority youth are known to face increased risk of poor school performance; however, little research has focused on the educational experiences of multiethnic sexual minority youth (MSMY) in particular. Using venue-based sampling approaches, this study surveyed 255 MSMY at 15 urban high schools. The majority of participants identified as…

  20. Kapalinová extrakce fytosterolů a dalších cenných látek z tálových mýdel

    Czech Academy of Sciences Publication Activity Database

    Rousková, Milena; Heyberger, Aleš; Tříska, Jan; Krtička, M.

    2011-01-01

    Roč. 105, č. 4 (2011), s. 251-255. ISSN 0009-2770 Institutional research plan: CEZ:AV0Z40720504; CEZ:AV0Z60870520 Keywords : liquid-liquid extraction * tall soap * phytosterols Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 0.529, year: 2011

  1. Racial and Ego Identity Development in Black Caribbean College Students

    Science.gov (United States)

    Sanchez, Delida

    2013-01-01

    This study explored the relationships between racial identity attitudes and ego identity statuses among 255 Black Caribbean college students in the Northeast United States. Findings indicated that racial identity attitudes were predictive of ego identity statuses. Specifically, preencounter racial identity attitudes were predictive of lower scores…

  2. Association between age at menarche and early-life nutritional status in rural Bangladesh

    NARCIS (Netherlands)

    Bosch, A.M.; Willekens, F.J.C.; Baqui, A.H.; van Ginneken, J.K.S.; Hutter, I.

    2008-01-01

    Age at menarche is associated with anthropometry in adolescence. Recently, there has been growing support for the hypothesis that timing of menarche may be set early in life but modified by changes in body size and composition in childhood. To evaluate this, a cohort of 255 girls aged

  3. Microreactor as Efficient Tool for Light Induced Oxidation Reactions

    Czech Academy of Sciences Publication Activity Database

    Hejda, S.; Drhová, Magdalena; Křišťál, Jiří; Buzek, D.; Krystyník, Pavel; Klusoň, Petr

    2014-01-01

    Roč. 255, NOV 1 (2014), s. 178-184. ISSN 1385-8947 Grant ostatní: GA MŠMT(CZ) MŠk:CZ.1.07/2.2.00/28.0205 Institutional support: RVO:67985858 Keywords : photo microreactor * phthalocyanine * chlorophenol oxidation Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 4.321, year: 2014

  4. A survey of aphid parasitoids in Kahramanmaras, Turkey (Hymenoptera: Braconidae, Aphidiinae, and Hymenoptera: Aphelinidae)

    Czech Academy of Sciences Publication Activity Database

    Aslan, M. M.; Uygun, N.; Starý, Petr

    2004-01-01

    Roč. 32, č. 3 (2004), 255-263. ISSN 0334-2123 R&D Projects: GA AV ČR(CZ) IAA6007105; GA AV ČR(CZ) IBS5007102 Institutional research plan: CEZ:AV0Z5007907 Keywords : parasitoids Subject RIV: EG - Zoology Impact factor: 0.543, year: 2004

  5. Fraktály a chaos: další z vědeckých revolucí 20. století?

    Czech Academy of Sciences Publication Activity Database

    Drahoš, Jiří; Punčochář, Miroslav

    Brno: VUTIUM, 2002 - (Mizerová, A.; Sedlák, J.; Dub, P.), s. 255-277 ISBN 80-214-1872-9 Institutional research plan: CEZ:AV0Z4072921 Keywords : fractals * chaos Subject RIV: BE - Theoretical Physics

  6. NEK6-mediated phosphorylation of human TPP1 regulates telomere length through telomerase recruitment.

    Science.gov (United States)

    Hirai, Yugo; Tamura, Miki; Otani, Junji; Ishikawa, Fuyuki

    2016-08-01

    Shelterin component TPP1 plays critical roles in chromosome end protection and telomere length regulation. Specifically, TPP1 contains an OB-fold domain that provides an interface to recruit telomerase. However, it remains largely unknown how telomerase recruitment is regulated by cell cycle regulators. We show that TPP1 interacts with the cell cycle regulator kinase NEK6 in human cells. We found that NEK6-mediated phosphorylation of TPP1 Ser255 in G2/M phase regulates the association between telomerase activity and TPP1. Furthermore, we found evidence that POT1 negatively regulates TPP1 phosphorylation because the level of Ser255 phosphorylation was elevated when telomeres were elongated by a POT1 mutant lacking its OB-fold domains. Ser255 is located in the intervening region between the telomerase-recruiting OB-fold and the POT1 recruitment domains. Ser255 and the surrounding amino acids are conserved among vertebrates. These observations suggest that a region adjacent to the OB-fold domain of TPP1 is involved in telomere length regulation via telomerase recruitment. PMID:27396482

  7. Ideál lékaře pohledem autora hippokratovského spisu De medico. Poznámky k interpretaci a překladu první kapitoly

    Czech Academy of Sciences Publication Activity Database

    Černá, Julie

    Praha: Filosofia, 2007 - (Silagiova, Z.; Šedinová, H.; Kitzler, P.), s. 25-40 ISBN 978-80-7007-255-4 Institutional research plan: CEZ:AV0Z90090514 Keywords : Greek medicine * Hippocrates * medical ethics Subject RIV: AA - Philosophy ; Religion

  8. Examination of Relationship between Anxiety Sensitivity and Parenting Styles in Adolescents

    Science.gov (United States)

    Erozkan, Atilgan

    2012-01-01

    This research investigated the relationships between anxiety sensitivity and perceived parenting styles of adolescents and the predictive role of perceived parenting styles on anxiety sensitivity. The study group was composed by 545 (255 females; 290 males) students studying in different high schools in Mugla. The data were collected using the…

  9. Chemical Route for Si/C Coated Germanium Nanowires

    Czech Academy of Sciences Publication Activity Database

    Dřínek, Vladislav; Šubrt, Jan; Klementová, Mariana; Fajgar, Radek

    2010-01-01

    Roč. 89, č. 2 (2010), s. 255-260. ISSN 0165-2370 R&D Projects: GA ČR GA203/09/1088 Institutional research plan: CEZ:AV0Z40720504; CEZ:AV0Z40320502 Keywords : nanowire * germanium * germylene Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.234, year: 2010

  10. 18 CFR 35.13 - Filing of changes in rate schedules, tariffs or service agreements.

    Science.gov (United States)

    2010-04-01

    .... (21) AU—Revenue credits. (22) AV—Rate of return. (23) AW—Cost of short-term debt. (24) AX—Other recent... of Accounts, 18 CFR part 101. (i) The utility shall state total electric balances for accumulated deferred investment tax credits Account 255, and shall separate the credits into balances applicable to...

  11. Can 13C stable isotope record of Norway spruce tree rings display the effect of environmental conditions?

    Czech Academy of Sciences Publication Activity Database

    Píšová, L.; Svoboda, M.; Šantrůček, Jiří; Šantrůčková, H.

    2008-01-01

    Roč. 54, č. 6 (2008), s. 255-261. ISSN 1212-4834 R&D Projects: GA ČR GA206/07/1200 Institutional research plan: CEZ:AV0Z50510513 Keywords : atmospheric pollution * soil pH * tree physiology Subject RIV: GK - Forestry

  12. Income Is Not Enough: Incorporating Material Hardship into Models of Income Associations with Parenting and Child Development

    Science.gov (United States)

    Gershoff, Elizabeth T.; Aber, J. Lawrence; Raver, C. Cybele; Lennon, Mary Clare

    2007-01-01

    Although research has clearly established that low family income has negative impacts on children's cognitive skills and social-emotional competence, less often is a family's experience of material hardship considered. Using the Early Childhood Longitudinal Study, Kindergarten Class of 1998-1999 (N=21,255), this study examined dual components of…

  13. Domain Modeling: NP_066574.2 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_066574.2 chr2 CRYSTAL STRUCTURE OF A DESIGNED ZINC FINGER PROTEIN BOUND TO DNA c1meyf_ chr2/NP_066574.2.../NP_066574.2_holo_254-335.pdb blast 255K,259C,261E,262C,263G,264K,265A,266F,267F,268D

  14. Geophysical Characteristic of Epikarst: Case Studies from Zagros Mts. (Iran) and the Koněprusy Region

    Czech Academy of Sciences Publication Activity Database

    Bosák, Pavel; Beneš, V.

    2003-01-01

    Roč. 32, č. 2 (2003), s. 255-267. ISSN 0583-6050 Institutional research plan: CEZ:AV0Z3013912 Keywords : epikarst * refraction seismic * Zagros Mts. and Koněprusy Devonian Subject RIV: DB - Geology ; Mineralogy http://carsologica.zrc-sazu.si/downloads/322/bosak.pdf

  15. 75 FR 42455 - Novartis Pharmaceuticals Corp. et al.; Withdrawal of Approval of 27 New Drug Applications and 58...

    Science.gov (United States)

    2010-07-21

    ... Capsules ANDA 61-016 Terra-Cortril (hydrocortisone acetate Do. and oxytetracycline HCl) ANDA 61-410 Veetids... (diatrizoate sodium) GE Healthcare, Inc., 101 Carnegie Center, Princeton, NJ 08540 NDA 9-658 Hydrocortisone...-255 Meticortelone (prednisolone acetate) Schering Corp., Galloping Hill Rd., Injection and...

  16. Vliv vegetačního krytu na disipaci energie a vodní režim v krajině - dopady na interakce biotických a abiotických složek v povrchových vodách

    Czech Academy of Sciences Publication Activity Database

    Pechar, Libor; Pokorný, Jan; Procházka, J.; Wotavová, K.; Pecharová, E.; Švehla, J.

    2004-01-01

    Roč. 3, č. 21 (2004), s. 249-255. ISSN 1212-0731. [Agroregion 2004. České Budějovice, 06.09.2004-07.09.2004] Institutional research plan: CEZ:AV0Z6087904 Keywords : Landscape function * water cycle * remote sensing Subject RIV: DO - Wilderness Conservation

  17. Alternative Funding Sources for Migrant Education.

    Science.gov (United States)

    Binder, Eugene

    Despite 1983 Elementary and Secondary Education ACT (ESEA) Title I federal funding of over $255 million for more than 3,000 projects for some 600,000 migrant children and youth, there is still need for alternate funding sources to overcome spiraling inflation and increasing program costs and numbers of eligible children. Other federal, state,…

  18. Development of the Self-Directed Learning Skills Scale

    Science.gov (United States)

    Ayyildiz, Yildizay; Tarhan, Leman

    2015-01-01

    The purpose of this study was to develop a valid and reliable scale for assessing high school students' self-directed learning skills. Based on a literature review and data obtained from similar instruments, all skills related to self-directed learning were identified. Next, an item pool was prepared and administered to 255 students from various…

  19. Hematopoiesis in 5-Fluorouracil-Treated Adenosine A(3) Receptor Knock-Out Mice

    Czech Academy of Sciences Publication Activity Database

    Hofer, Michal; Pospíšil, Milan; Dušek, L.; Hoferová, Zuzana; Komůrková, Denisa

    2015-01-01

    Roč. 64, č. 2 (2015), s. 255-262. ISSN 0862-8408 Institutional support: RVO:68081707 Keywords : Adenosine A(3) receptor knock-out mice * Hematopoiesis * 5-fluorouracil-induced hematotoxicity Subject RIV: BO - Biophysics Impact factor: 1.293, year: 2014

  20. Zeyer, Vrchlický, Lier: Česká próza v dotyku s parnasismem

    Czech Academy of Sciences Publication Activity Database

    Fránek, Michal

    Brno : Host, 2015, s. 293-341 ISBN 978-80-7491-255-9 R&D Projects: GA ČR(CZ) GAP406/12/0347 Keywords : parnassianism * Czech prose * parody * ruchovci * lumírovci * Julius Zeyer * Jaroslav Vrchlický * Jan Lier * Svatopluk Čech Subject RIV: AJ - Letters, Mass-media, Audiovision

  1. Auxin transporters controlling plant development

    Czech Academy of Sciences Publication Activity Database

    Petrášek, Jan; Malínská, Kateřina; Zažímalová, Eva

    Heidelberg: Springer Verlag, 2010 - (Geisler, M.; Venema, K.), s. 255-290 ISBN 978-3-642-14368-7 R&D Projects: GA MŠk(CZ) LC06034 Institutional research plan: CEZ:AV0Z50380511 Keywords : Auxin * polar auxin transport * auxin carriers Subject RIV: ED - Physiology

  2. Precipitate scanning in Ni-base gamma/gamma '-superalloyse

    Czech Academy of Sciences Publication Activity Database

    Roth, SV.; Burghammer, M.; Gilles, R.; Mukherji, D.; Rösler, J.; Strunz, Pavel

    2003-01-01

    Roč. 200, - (2003), s. 255-260. ISSN 0168-583X Institutional research plan: CEZ:AV0Z1048901 Keywords : microdiffraction * superalloy * SAXS Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.041, year: 2003

  3. Drug: D04688 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D04688 Mixture, Drug Tribenoside - lidocaine mixt; Borraza-G (TN) Tribenoside [DR:D01095], Lidocai... 2 Agents affecting individual organs 25 Urogenital and anal organ agents 255 Hemorrhoidal preparations 2559 Others D04688 Tribenoside - lidocaine mixt PubChem: 17398139 ...

  4. Drug: D07360 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D07360 Drug Tenonitrozole (INN); Atrican (TN) C8H5N3O3S2 254.9772 255.2736 D07360.gif Antiprotozoa...ROTOZOAL DISEASES P01AX Other agents against amoebiasis and other protozoal disea...st Amebiasis and other antiprotozoals Others Tenonitrozole [ATC:P01AX08] D07360 Tenonitrozole (INN) CAS: 381

  5. 24 CFR 207.259 - Insurance benefits.

    Science.gov (United States)

    2010-04-01

    ... insurance pursuant to 24 CFR parts 251, 252, or 255, the amount of the fee set forth through Federal... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance benefits. 207.259 Section... DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES...

  6. High quality crystalline silicon surface passivation by combined intrinsic and n-type hydrogenated amorphous silicon

    NARCIS (Netherlands)

    Schuttauf, J.A.; van der Werf, C.H.M.; Kielen, I.M.; van Sark, W.G.J.H.M.; Rath, J.K.

    2011-01-01

    We investigate the influence of thermal annealing on the passivation quality of crystalline silicon (c-Si) surfaces by intrinsic and n-type hydrogenated amorphous silicon (a-Si:H) films. For temperatures up to 255 C, we find an increase in surface passivation quality, corresponding to a decreased da

  7. Strategic Analysis of Family Support in EHDI Systems

    Science.gov (United States)

    Bradham, Tamala S.; Houston, K. Todd; Guignard, Gayla Hutsell; Hoffman, Jeff

    2011-01-01

    State coordinators of early hearing detection and intervention (EHDI) programs completed a strengths, weaknesses, opportunities, and threats, or SWOT, analysis that examined 12 areas within state EHDI programs. For the family support area, 47 EHDI coordinators listed 255 items, and themes were identified within each category. A threats,…

  8. Use of the Childhood Autism Rating Scale (CARS) for Children with High Functioning Autism or Asperger Syndrome

    Science.gov (United States)

    Mayes, Susan Dickerson; Calhoun, Susan L.; Murray, Michael J.; Morrow, Jill D.; Yurich, Kirsten K. L.; Cothren, Shiyoko; Purichia, Heather; Mahr, Fauzia; Bouder, James N.; Petersen, Christopher

    2012-01-01

    The authors of the "Childhood Autism Rating Scale" (CARS) state in the manual that the best cutoff score for distinguishing low functioning autism (LFA) from intellectual disability is 30 for children and 28 for adolescents and adults. This study determined that a cutoff score of 25.5 was most accurate in differentiating between high functioning…

  9. Model of fasciculation and sorting in mixed populations of axons

    Czech Academy of Sciences Publication Activity Database

    Chaudhuri, D.; Borowski, P.; Zápotocký, Martin

    2011-01-01

    Roč. 84, č. 2 (2011), e021908. ISSN 1539-3755 R&D Projects: GA MŠk(CZ) LC554 Institutional research plan: CEZ:AV0Z50110509 Keywords : axon guidance * neurogenesis * mathematical model Subject RIV: FH - Neurology Impact factor: 2.255, year: 2011

  10. 77 FR 42962 - Airworthiness Directives; The Boeing Company Airplanes

    Science.gov (United States)

    2012-07-23

    ... production when maskant was removed from the affected skin panels during the chemical milling process. We are...-255-AD; Amendment 39-17117; AD 2012-14-03] RIN 2120-AA64 Airworthiness Directives; The Boeing Company... new airworthiness directive (AD) for certain The Boeing Company Model 777-200 and -300...

  11. 40 CFR 1043.41 - EIAPP certification process.

    Science.gov (United States)

    2010-07-01

    ... related to your application (see 40 CFR 1068.5). (e) An authorized representative of your company must approve and sign the application. (f) See 40 CFR 1042.255 for provisions describing how we will process... indicated effective date and is valid for any production until such time as the design of the engine...

  12. 42 CFR 436.128 - Coverage for certain qualified aliens.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Coverage for certain qualified aliens. 436.128... Mandatory Coverage of the Categorically Needy § 436.128 Coverage for certain qualified aliens. The agency... § 440.255(c) of this chapter to those aliens described in § 436.406(c) of this subpart....

  13. 42 CFR 436.330 - Coverage for certain aliens.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Coverage for certain aliens. 436.330 Section 436... Coverage of the Medically Needy § 436.330 Coverage for certain aliens. If an agency provides Medicaid to... condition, as defined in § 440.255(c) of this chapter to those aliens described in § 436.406(c) of...

  14. 42 CFR 435.139 - Coverage for certain aliens.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Coverage for certain aliens. 435.139 Section 435... Aliens § 435.139 Coverage for certain aliens. The agency must provide services necessary for the treatment of an emergency medical condition, as defined in § 440.255(c) of this chapter, to those...

  15. 42 CFR 435.350 - Coverage for certain aliens.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Coverage for certain aliens. 435.350 Section 435... ISLANDS, AND AMERICAN SAMOA Optional Coverage of the Medically Needy § 435.350 Coverage for certain aliens... treatment of an emergency medical condition, as defined in § 440.255(c) of this chapter, to those...

  16. Ecophysiological characterization of carnivorous plant roots: oxygen fluxes, respiration, and water exudation

    Czech Academy of Sciences Publication Activity Database

    Adamec, Lubomír

    2005-01-01

    Roč. 49, č. 2 (2005), s. 247-255. ISSN 0006-3134 R&D Projects: GA AV ČR(CZ) IAA6005909 Institutional research plan: CEZ:AV0Z6005908 Keywords : terrestrial carnivorous plants * soil anoxia * Genlisea traps Subject RIV: EF - Botanics Impact factor: 0.792, year: 2005

  17. Global Self-Esteem and Self-Efficacy Correlates: Relation of Academic Achievement and Self-Esteem among Emirati Students

    Science.gov (United States)

    Afari, Ernest; Ward, Graeme; Khine, Myint Swe

    2012-01-01

    We investigated the relationships between global self-esteem, academic self-efficacy and academic performance among a sample of 255 college students in the United Arab Emirates. The widely used Rosenberg's Self-Esteem Scale (RSES; Rosenberg, 1965) and an academic self-efficacy scale, modified from (Jinks and Morgan, 1999) were used to assess…

  18. Mother-Child Attachment Patterns and Different Types of Anxiety Symptoms: Is There Specificity of Relations?

    Science.gov (United States)

    Brumariu, Laura E.; Kerns, Kathryn A.

    2010-01-01

    The purpose of this study was to test Manassis' proposal (Child-parent relations: Attachment and anxiety disorders, 255-272, 2001) that attachment patterns (secure, ambivalent, avoidant, and disorganized) may relate to different types of anxiety symptoms, and that behavioral inhibition may moderate these relations. Using a story stem interview to…

  19. Measurement of the Collins and Sivers asymmetries on transversely polarised protons

    Czech Academy of Sciences Publication Activity Database

    Alekseev, M.; Alexakhin, V. Yu.; Alexandrov, Yu.; Alexeev, G. D.; Amoroso, A.; Austregisilio, A.; Badelek, B.; Balestra, F.; Ball, J.; Barth, J.; Baum, G.; Bedfer, Y.; Bernhard, J.; Bertini, R.; Bettinelli, M.; Birsa, R.; Bisplinghoff, J.; Bordalo, P.; Bradamante, F.; Bravar, A.; Bressan, A.; Brona, G.; Burtin, E.; Bussa, M.; Chaberny, D.; Chiosso, M.; Chung, S.U.; Cicuttin, A.; Colantoni, M.; Crespo, M.; Dalla Torre, S.; Das, S.; Dasgupta, S. S.; Denisov, O.; Dhara, L.; Diaz, V.; Donskov, S.; Doshita, N.; Duic, V.; Dünnweber, W.; Efremov, A.V.; El Alaoui, A.; Elia, C.; Eversheim, P.; Eyrich, W.; Faessler, M.; Ferrero, A.; Filin, A.; Finger, M.; Finger jr., M.; Fischer, H.; Franco, C.; Friedrich, J.; Garfagnini, R.; Gautheron, F.; Gavrichtchouk, O.; Gazda, R.; Gerassimov, S.; Geyer, R.; Giorgi, M.; Gnesi, I.; Gobbo, B.; Goertz, S.; Grabmüller, S.; Grasso, A.; Grube, B.; Gushterski, R.; Guskov, A.; Haas, F.; von Harrach, D.; Hasegawa, T.; Heinsius, F.; Hermann, R.; Herrmann, F.; Hess, C.; Hinterberger, F.; Horikawa, N.; Höppner, Ch.; d'Hose, N.; Ilgner, C.; Ishimoto, S.; Ivanov, O.; Ivanshin, Yu.; Iwata, T.; Jahn, R.; Jasinski, P.; Jegou, G.; Joosten, R.; Kabuss, E.; Käfer, W.; Kang, D.; Ketzer, B.; Khaustov, G.; Khokhlov, Y.; Kisselev, Y.; Klein, F.; Klimaszewski, K.; Koblitz, S.; Koivuniemi, J.; Kolosov, V.; Kondo, K.; Königsmann, K.; Konopka, R.; Konorov, I.; Konstantinov, V.; Korzenev, A.; Kotzinian, A.; Kouznetsov, O.; Kowalik, K.; Krämer, M.; Kral, A.; Kroumchtein, Z.; Kuhn, R.; Kunne, F.; Kurek, K.; Lauser, L.; Le Goff, J.; Lednev, A.; Lehmann, A.; Levorato, S.; Lichtenstadt, J.; Liska, T.; Maggiora, A.; Maggiora, M.; Magnon, A.; Mallot, G.; Mann, A.; Marchand, C.; Martin, A.; Marzec, J.; Massmann, F.; Matsuda, T.; Meyer, W.; Michigami, T.; Mikhailov, Y.; Moinester, M.; Mutter, A.; Nagaytsev, A.; Nagel, T.; Nassalski, J.; Negrini, S.; Nerling, F.; Neubert, S.; Neyret, D.; Nikolaenko, V.; Nunes, A.S.; Olshevsky, A.; Ostrick, M.; Padee, A.; Panknin, R.; Panzieri, D.; Parsamyan, B.; Paul, S.; Pawlukiewicz-Kaminska, B.; Perevalova, E.; Pesaro, G.; Peshekhonov, D.; Piragino, G.; Platchkov, S.; Pochodzalla, J.; Polak, J.; Polyakov, V.; Pontecorvo, G.; Pretz, J.; Quintans, C.; Rajotte, J.; Ramos, S.; Rapatsky, V.; Reicherz, G.; Richter, A.; Robinet, F.; Rocco, E.; Rondio, E.; Ryabchikov, D.; Samoylenko, V.; Sandacz, A.; Santos, H.; Sapozhnikov, M.; Sarkar, S.; Savin, I.; Sbrizzai, G.; Schiavon, P.; Schill, C.; Schlütter, T.; Schmitt, L.; Schopferer, S.; Schröder, W.; Shevchenko, O.; Siebert, H.; Silva, L.; Sinha, L.; Sissakian, A.; Slunecka, M.; Smirnov, G.; Sosio, S.; Sozzi, F.; Srnka, Aleš; Stolarski, M.; Sulc, M.; Sulej, R.; Takekawa, S.; Tessaro, S.; Tessarotto, F.; Teufel, A.; Tkatchev, L.; Uhl, S.; Uman, I.; Virius, M.; Vlassov, N.; Vossen, A.; Weitzel, Q.; Windmolders, R.; Wislicki, W.; Wollny, H.; Zaremba, K.; Zavertyaev, M.; Zemlyanichkina, E.; Ziembicki, M.; Zhao, J.; Zhuravlev, N.; Zvyagin, A.

    2010-01-01

    Roč. 692, č. 4 (2010), s. 240-246. ISSN 0370-2693 R&D Projects: GA MŠk ME 492 Institutional research plan: CEZ:AV0Z20650511 Keywords : transverse spin effects * proton * Collins asymmetry * Sivers asymmetry Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 5.255, year: 2010

  20. Quark helicity distributions from longitudinal spin asymmetries in muon-proton and muon-deuteron scattering

    Czech Academy of Sciences Publication Activity Database

    Alekseev, M.; Alexakhin, V. Yu.; Alexandrov, Yu.; Alexeev, G. D.; Amoroso, A.; Austregisilio, A.; Badelek, B.; Balestra, F.; Barth, J.; Baum, G.; Bedfer, Y.; Bernhard, J.; Bertini, R.; Bettinelli, M.; Birsa, R.; Bisplinghoff, J.; Bordalo, P.; Bradamante, F.; Bravar, A.; Bressan, A.; Brona, G.; Burtin, E.; Bussa, M.; Chaberny, D.; Chiosso, M.; Chung, S.U.; Cicuttin, A.; Colantoni, M.; Crespo, M.; Dalla Torre, S.; Das, S.; Dasgupta, S. S.; Denisov, O.; Dhara, L.; Diaz, V.; Donskov, S.; Doshita, N.; Duic, V.; Dünnweber, W.; Efremov, A.V.; El Alaoui, A.; Eversheim, P.; Eyrich, W.; Faessler, M.; Ferrero, A.; Filin, A.; Finger, M.; Finger jr., M.; Fischer, H.; Franco, C.; Friedrich, J.; Garfagnini, R.; Gautheron, F.; Gavrichtchouk, O.; Gazda, R.; Gerassimov, S.; Geyer, R.; Giorgi, M.; Gnesi, I.; Gobbo, B.; Goertz, S.; Grabmüller, S.; Grasso, A.; Grube, B.; Gushterski, R.; Guskov, A.; Haas, F.; von Harrach, D.; Hasegawa, T.; Heinsius, F.; Herrmann, F.; Hess, C.; Hinterberger, F.; Horikawa, N.; Höppner, Ch.; d'Hose, N.; Ilgner, C.; Ishimoto, S.; Ivanov, O.; Ivanshin, Yu.; Iwata, T.; Jahn, R.; Jasinski, P.; Jegou, G.; Joosten, R.; Kabuss, E.; Kang, D.; Ketzer, B.; Khaustov, G.; Khokhlov, Y.; Kisselev, Y.; Klein, F.; Klimaszewski, K.; Koblitz, S.; Koivuniemi, J.; Kolosov, V.; Kondo, K.; Königsmann, K.; Konopka, R.; Konorov, I.; Konstantinov, V.; Korzenev, A.; Kotzinian, A.; Kouznetsov, O.; Kowalik, K.; Krämer, M.; Kral, A.; Kroumchtein, Z.; Kuhn, R.; Kunne, F.; Kurek, K.; Lauser, L.; Le Goff, J.; Lednev, A.; Lehmann, A.; Levorato, S.; Lichtenstadt, J.; Liska, T.; Maggiora, A.; Maggiora, M.; Magnon, A.; Makke, N.; Mallot, G.; Mann, A.; Marchand, C.; Martin, A.; Marzec, J.; Massmann, F.; Matsuda, T.; Meyer, W.; Michigami, T.; Mikhailov, Y.; Moinester, M.; Mutter, A.; Nagaytsev, A.; Nagel, T.; Nassalski, J.; Negrini, S.; Nerling, F.; Neubert, S.; Neyret, D.; Nikolaenko, V.; Nunes, A.S.; Olshevsky, A.; Ostrick, M.; Padee, A.; Panknin, R.; Panzieri, D.; Parsamyan, B.; Paul, S.; Pawlukiewicz-Kaminska, B.; Perevalova, E.; Pesaro, G.; Peshekhonov, D.; Piragino, G.; Platchkov, S.; Pochodzalla, J.; Polak, J.; Polyakov, V.; Pontecorvo, G.; Pretz, J.; Quintans, C.; Rajotte, J.; Ramos, S.; Rapatsky, V.; Reicherz, G.; Richter, A.; Robinet, F.; Rocco, E.; Rondio, E.; Ryabchikov, D.; Samoylenko, V.; Sandacz, A.; Santos, H.; Sapozhnikov, M.; Sarkar, S.; Savin, I.; Sbrizzai, G.; Schiavon, P.; Schill, C.; Schlütter, T.; Schmitt, L.; Schopferer, S.; Schröder, W.; Shevchenko, O.; Siebert, H.; Silva, L.; Sinha, L.; Sissakian, A.; Slunecka, M.; Smirnov, G.; Sosio, S.; Sozzi, F.; Srnka, Aleš; Stolarski, M.; Sulc, M.; Sulej, R.; Takekawa, S.; Tessaro, S.; Tessarotto, F.; Teufel, A.; Tkatchev, L.; Uhl, S.; Uman, I.; Virius, M.; Vlassov, N.; Vossen, A.; Weitzel, Q.; Windmolders, R.; Wislicki, W.; Wollny, H.; Zaremba, K.; Zavertyaev, M.; Zemlyanichkina, E.; Ziembicki, M.; Zhao, J.; Zhuravlev, N.; Zvyagin, A.

    2010-01-01

    Roč. 693, č. 3 (2010), s. 227-235. ISSN 0370-2693 R&D Projects: GA MŠk ME 492 Institutional research plan: CEZ:AV0Z20650511 Keywords : semi-inclusive deep inelastic scattering * structure function * parton distribution functions Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 5.255, year: 2010

  1. The spin-dependent structure function of the proton g(1)(p) and a test of the Bjorken sum rule

    Czech Academy of Sciences Publication Activity Database

    Alekseev, M.; Alexakhin, V. Yu.; Alexandrov, Yu.; Alexeev, G. D.; Amoroso, A.; Austregisilio, A.; Badelek, B.; Balestra, F.; Ball, J.; Barth, J.; Baum, G.; Bedfer, Y.; Bernhard, J.; Bertini, R.; Bettinelli, M.; Birsa, R.; Bisplinghoff, J.; Bordalo, P.; Bradamante, F.; Bravar, A.; Bressan, A.; Brona, G.; Burtin, E.; Bussa, M.; Chaberny, D.; Chiosso, M.; Chung, S.U.; Cicuttin, A.; Colantoni, M.; Cotic, D.; Crespo, M.; Dalla Torre, S.; Das, S.; Dasgupta, S. S.; Denisov, O.; Dhara, L.; Diaz, V.; Donskov, S.; Doshita, N.; Duic, V.; Dünnweber, W.; Efremov, A.V.; El Alaoui, A.; Eversheim, P.; Eyrich, W.; Faessler, M.; Ferrero, A.; Filin, A.; Finger, M.; Finger jr., M.; Fischer, H.; Franco, C.; Friedrich, J.; Garfagnini, R.; Gautheron, F.; Gavrichtchouk, O.; Gazda, R.; Gerassimov, S.; Geyer, R.; Giorgi, M.; Gnesi, I.; Gobbo, B.; Goertz, S.; Grabmüller, S.; Grasso, A.; Grube, B.; Gushterski, R.; Guskov, A.; Haas, F.; von Harrach, D.; Hasegawa, T.; Heinsius, F.; Hermann, R.; Herrmann, F.; Hess, C.; Hinterberger, F.; Horikawa, N.; Höppner, Ch.; d'Hose, N.; Ilgner, C.; Ishimoto, S.; Ivanov, O.; Ivanshin, Yu.; Iwata, T.; Jahn, R.; Jasinski, P.; Jegou, G.; Joosten, R.; Kabuss, E.; Käfer, W.; Kang, D.; Ketzer, B.; Khaustov, G.; Khokhlov, Y.; Kisselev, Y.; Klein, F.; Klimaszewski, K.; Koblitz, S.; Koivuniemi, J.; Kolosov, V.; Kondo, K.; Königsmann, K.; Konopka, R.; Konorov, I.; Konstantinov, V.; Korzenev, A.; Kotzinian, A.; Kouznetsov, O.; Kowalik, K.; Krämer, M.; Kral, A.; Kroumchtein, Z.; Kuhn, R.; Kunne, F.; Kurek, K.; Lauser, L.; Le Goff, J.; Lednev, A.; Lehmann, A.; Levorato, S.; Lichtenstadt, J.; Liska, T.; Maggiora, A.; Maggiora, M.; Magnon, A.; Mallot, G.; Mann, A.; Marchand, C.; Marroncle, J.; Martin, A.; Marzec, J.; Massmann, F.; Matsuda, T.; Meyer, W.; Michigami, T.; Mikhailov, Y.; Moinester, M.; Mutter, A.; Nagaytsev, A.; Nagel, T.; Nassalski, J.; Negrini, S.; Nerling, F.; Neubert, S.; Neyret, D.; Nikolaenko, V.; Nunes, A.S.; Olshevsky, A.; Ostrick, M.; Padee, A.; Panknin, R.; Panzieri, D.; Parsamyan, B.; Paul, S.; Pawlukiewicz-Kaminska, B.; Perevalova, E.; Pesaro, G.; Peshekhonov, D.; Piragino, G.; Platchkov, S.; Pochodzalla, J.; Polak, J.; Polyakov, V.; Pontecorvo, G.; Pretz, J.; Quintans, C.; Rajotte, J.; Ramos, S.; Rapatsky, V.; Reicherz, G.; Richter, A.; Robinet, F.; Rocco, E.; Rondio, E.; Ryabchikov, D.; Samoylenko, V.; Sandacz, A.; Santos, H.; Sapozhnikov, M.; Sarkar, S.; Savin, I.; Sbrizzai, G.; Schiavon, P.; Schill, C.; Schlütter, T.; Schmitt, L.; Schopferer, S.; Schröder, W.; Shevchenko, O.; Siebert, H.; Silva, L.; Sinha, L.; Sissakian, A.; Slunecka, M.; Smirnov, G.; Sosio, S.; Sozzi, F.; Srnka, Aleš; Stolarski, M.; Sulc, M.; Sulej, R.; Takekawa, S.; Tessaro, S.; Tessarotto, F.; Teufel, A.; Tkatchev, L.; Uhl, S.; Uman, I.; Virius, M.; Vlassov, N.; Vossen, A.; Weitzel, Q.; Windmolders, R.; Wislicki, W.; Wollny, H.; Zaremba, K.; Zavertyaev, M.; Zemlyanichkina, E.; Ziembicki, M.; Zhao, J.; Zhuravlev, N.; Zvyagin, A.

    2010-01-01

    Roč. 690, č. 5 (2010), s. 466-472. ISSN 0370-2693 R&D Projects: GA MŠk ME 492 Institutional research plan: CEZ:AV0Z20650511 Keywords : deep inelastic scattering * structure function * QCD analysis * Bjorken sum rule Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 5.255, year: 2010

  2. Eesti Akadeemiline Raamatukogu

    Index Scriptorium Estoniae

    2000-01-01

    Näitused "Esimesi Eesti klassikuid. Paar sammukest Kreutzwaldist Vildeni"; "Austraalia - olümpiamaa 2000" : kuulutus. Näitused: "Eestikeelne tarberaamat XVIII sajandist kuni 1940. aastani"; "Rahvas. Usund. Elujõud. Oskar Loorits - 100"; "Kirjamehed Johann Wilhelm Ludvig Luce - 250"; "Friedrich David Lenz - 255"; "Eesti Akadeemilise Raamatukogu väljaandeid läbi aegade": kuulutus

  3. Bolestná Panna Marie z Jirkova

    Czech Academy of Sciences Publication Activity Database

    Dáňová, Helena

    Chomutov : Oblastní muzeum v Chomutově, 2014 - (Dáňová, H.; Gubíková, R.), s. 251-255 ISBN 978-80-87898-07-9 Institutional support: RVO:68378033 Keywords : Our Lady of Sorrows * Jirkov * Josef Opitz Subject RIV: AL - Art, Architecture, Cultural Heritage

  4. Hydride generation in-atomizer collection atomic absorption spectrometry for the determination of antimony in acetic acid leachates from pewter cups

    Czech Academy of Sciences Publication Activity Database

    Dessuy, M. B.; Kratzer, Jan; Vale, M. G. R.; Welz, B.; Dědina, Jiří

    2011-01-01

    Roč. 87, - (2011), s. 255-261. ISSN 0039-9140 R&D Projects: GA ČR GA203/09/1783 Institutional research plan: CEZ:AV0Z40310501 Keywords : in-atomizer trapping * in-atomizer trapping * tin interference Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 3.794, year: 2011

  5. Interactions between Personality Type and the Experimental Methods

    Science.gov (United States)

    Emerson, Tisha L. N.; Taylor, Beck A.

    2007-01-01

    The authors bring together two research streams in the literature that examine separately the effectiveness of using experiments in the principles classroom and the relationship between different personality types and student achievement. Using a sample of 255 principles of microeconomics students, 48 of whom were enrolled in sections that relied…

  6. The Need for Federal Legislation and Regulation Prohibiting Telecommunications and Information Services Discrimination

    Science.gov (United States)

    Strauss, Karen Peltz

    2006-01-01

    This paper explores the need to adopt legislative and regulatory safeguards to guarantee equal access by people with disabilities to evolving high speed broadband, wireless and Internet-based technologies. Recommendations include: (1) Communications Access--FCC or Congress: Extend the telecommunications accessibility requirements of Section 255 of…

  7. Active-active and active-sterile neutrino oscillation solutions to the atmospheric neutrino anomaly

    CERN Document Server

    González-Garciá, M Concepción; Peres, O L G; Valle, José W F

    1999-01-01

    We perform a fit to the full data set corresponding to 25.5 kt-yr of data of the Super-Kamiokande experiment as well as to all other experiments in order to compare the two most likely solutions to the atmospheric neutrino anomaly in terms of oscillations in the $\

  8. Characterization by culture-dependent and culture-1 independent methods of the 2 bacterial population of suckling-lamb packaged in different atmospheres

    NARCIS (Netherlands)

    Oses, S.M.; Diez, A.M.; Melero, B.; Luning, P.A.; Jaime, I.; Rovira, J.

    2013-01-01

    This study offers insight into the dynamics of bacterial populations in fresh cuts of suckling lamb under four different atmospheric conditions: air (A), and three Modified Atmosphere Packaging (MAP) environments, 15%O2/30%CO2/55%N2 (C, commercial), 70%O2/30%CO2 (O), and 15%O2/85%CO2 (H) for 18 days

  9. AcEST: BP918316 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_B01 479 Adiantum capillus-veneris mRNA. clone: YMU001_000112_B01. BP918316 CL1887C ... -LPRFQAENLENNKNL 255 Query: 300 YERIANLAKKHVCTPGQLALAW VLRQGDDVVPIPGTTKAKYFDENV 163 YERI +A + CTP QLALAW V ... QG+DV PIPGTTK + ++N+ Sbjct: 256 YERICEMAVRKGCTPSQLALAW VHHQGNDVCPIPGTTKIENLNQNM 301 >sp|Q09923|YAKC_SCHPO ...

  10. ... jak někteří trampují

    Czech Academy of Sciences Publication Activity Database

    Altman, Karel

    Brno : Etnologický ústav AV ČR Brno, 2003 - (Pospíšilová, J.), s. 255-285 ISBN 80-7239-146-1 R&D Projects: GA AV ČR ICE9058202 Institutional research plan: CEZ:AV0Z9058907 Keywords : leisture time * life in the nature * tramps Subject RIV: AC - Archeology, Anthropology, Ethnology

  11. A remark on polyconvex functions with symmetry

    Czech Academy of Sciences Publication Activity Database

    Šilhavý, Miroslav

    2016-01-01

    Roč. 122, č. 2 (2016), s. 255-260. ISSN 0374-3535 Institutional support: RVO:67985840 Keywords : polyconvexity * symmetry * convexity * elasticity Subject RIV: BA - General Mathematics Impact factor: 1.348, year: 2014 http://link.springer.com/article/10.1007%2Fs10659-015-9537-2

  12. 77 FR 12837 - Information Collection Being Submitted to OMB for Review and Approval

    Science.gov (United States)

    2012-03-02

    ....C. 618. Section 255 of the Act requires telecommunications and interconnected VoIP services and...'', in the Federal Register on December 15, 2009 (74 FR 66356) which became effective on January 25, 2010... the use of automated collection techniques or other forms of information technology; and (e) ways...

  13. 76 FR 82297 - Information Collection Being Reviewed by the Federal Communications Commission

    Science.gov (United States)

    2011-12-30

    ... VoIP services and equipment to be accessible, if readily achievable. See 47 U.S.C. 255. Section 718... ``Informal Complaints and Inquiries,'' in the Federal Register on December 15, 2009 (74 FR 66356) which..., including the use of automated collection techniques or other forms of information technology; and (e)...

  14. High temperature instability of hollow nanoparticles

    Czech Academy of Sciences Publication Activity Database

    Fischer, F. D.; Svoboda, Jiří

    2008-01-01

    Roč. 10, č. 2 (2008), s. 255-261. ISSN 1388-0764 R&D Projects: GA AV ČR IAA200410601 Institutional research plan: CEZ:AV0Z20410507 Keywords : hollow nanoparticle * instability * modelling Subject RIV: BJ - Thermodynamics Impact factor: 2.299, year: 2008

  15. Conjugated polymers in a strong longitudinal electric field

    Czech Academy of Sciences Publication Activity Database

    Drechster, S. L.; Paasch, G.; Málek, Jiří

    2001-01-01

    Roč. 119, - (2001), s. 255-256. ISSN 0379-6779 Institutional research plan: CEZ:AV0Z1010914 Keywords : many-body and quasiparticle theories * polyacetylene and derivatives * conjugated and/or conducting polymers Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.158, year: 2001

  16. QTL Information Table: 500 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available Morphological trait Root Root thickness 20-25 cm Mixture C)Interval DHL CT9993 IR62266 A RG476 R ... ification of Quantitative Trait Loci for Rice Root Morphology ... under Anaerobic Conditions. Crop Sci. 42, 255-265. ...

  17. QTL Information Table: 497 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available Morphological trait Root Deep root per tiller Mixture C)Interval DHL CT9993 IR62266 B RM212 R241 ... ification of Quantitative Trait Loci for Rice Root Morphology ... under Anaerobic Conditions. Crop Sci. 42, 255-265. ...

  18. QTL Information Table: 498 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available Morphological trait Root Rooting depth Mixture C)Interval DHL CT9993 IR62266 B C119 C859 pha Kam ... ification of Quantitative Trait Loci for Rice Root Morphology ... under Anaerobic Conditions. Crop Sci. 42, 255-265. ...

  19. QTL Information Table: 499 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available Morphological trait Root Root thickness 0-10 cm Mixture C)Interval DHL CT9993 IR62266 A RG476 RG ... ification of Quantitative Trait Loci for Rice Root Morphology ... under Anaerobic Conditions. Crop Sci. 42, 255-265. ...

  20. QTL Information Table: 496 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available Morphological trait Root Deep root mass Mixture C)Interval DHL CT9993 IR62266 B CDO20 RG409 pha ... ification of Quantitative Trait Loci for Rice Root Morphology ... under Anaerobic Conditions. Crop Sci. 42, 255-265. ...

  1. 7 CFR 1755.397 - RUS performance specification for line concentrators.

    Science.gov (United States)

    2010-01-01

    ... reference was approved by the Director of the Federal Register in accordance with 5 U.S.C. 552 (a) and 1 CFR... noise (idle channel at 900 ohm impedance). Steady noise: Measure on terminated call. Noise measurements... using the mu-255 encoding law and D3 encoding format, and arranged to interface with a T1 span...

  2. Role of diatom-attached choanoflagellates of the genus Salpingoeca as pelagic bacterivores

    Czech Academy of Sciences Publication Activity Database

    Šimek, Karel; Jezbera, Jan; Horňák, Karel; Vrba, Jaroslav; Seďa, Jaromír

    2004-01-01

    Roč. 36, č. 3 (2004), s. 257-269. ISSN 0948-3055 R&D Projects: GA ČR(CZ) GA206/02/0003 Keywords : reservoir * microbial food webs * protistan bacterivory Subject RIV: EE - Microbiology, Virology Impact factor: 2.255, year: 2004

  3. Assessment of trends in predation pressure on insects across temperate forest microhabitats

    Czech Academy of Sciences Publication Activity Database

    Šipoš, Jan; Drozdová, M.; Drozd, P.

    2013-01-01

    Roč. 15, č. 3 (2013), s. 255-261. ISSN 1461-9555 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0073; GA MŠk LC06073 Institutional support: RVO:67179843 Keywords : forest layers * predation rate * refuge * spatial variability * temporal variability Subject RIV: EH - Ecology, Behaviour Impact factor: 1.556, year: 2013

  4. Parental Involvement, Children's Aspirations, and Achievement in New Immigrant Families

    Science.gov (United States)

    Jung, Eunjoo; Zhang, Yue

    2016-01-01

    The authors investigated the relationships among multiple aspects of parental involvement (English proficiency, school involvement, control and monitoring of children), children's aspirations, and achievement in new immigrant families in the United States. They used data on immigrant parents and school-age children (N = 1,255) from the New…

  5. 48 CFR 32.202-4 - Security for Government financing.

    Science.gov (United States)

    2010-10-01

    ... financing. 32.202-4 Section 32.202-4 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Commercial Item Purchase Financing 32.202-4 Security for Government financing. (a) Policy. (1) 10 U.S.C. 2307(f) and 41 U.S.C. 255(f) require...

  6. Relativistic effects in spectroscopy and photophysics of heavy-metal complexes illustrated by spin–orbit calculations of [Re(imidazole)(CO)3(phen)]+

    Czech Academy of Sciences Publication Activity Database

    Baková, Radka; Chergui, M.; Daniel, CH.; Vlček Jr., Antonín; Záliš, Stanislav

    2011-01-01

    Roč. 255, 7-8 (2011), s. 975-989. ISSN 0010-8545 R&D Projects: GA MŠk(CZ) ME10124; GA MŠk LD11086 Institutional research plan: CEZ:AV0Z40400503 Keywords : rhenium * carbonyl * diimine Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 12.110, year: 2011

  7. The electron cyclotron resonance coupled to laser ion source for charge state enhancement experiment: production of high inensity ion beams by means of hybrid ion source

    Czech Academy of Sciences Publication Activity Database

    Gammino, S.; Torrisi, L.; Ciavola, G.; Andó, L.; Celona, L.; Manciagli, S.; Krása, Josef; Láska, Leoš; Pfeifer, Miroslav; Rohlena, Karel; Mazzasalma, A. M.; Gentile, C.; Picciotto, A.; Wolowski, J.; Woryna, E.; Badziak, J.; Parys, P.; Hitz, D.; Shirkov, G. D.

    2004-01-01

    Roč. 96, č. 5 (2004), s. 2961-2967. ISSN 0021-8979 Institutional research plan: CEZ:AV0Z1010921 Keywords : laser ion sources * ECR ion sources Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.255, year: 2004

  8. Evoluce Toll-like receptorů 4, 5 a 7 u ptáků ze skupiny Galloanserae

    Czech Academy of Sciences Publication Activity Database

    Vinkler, M.; Bainová, H.; Bryja, Josef

    Brno: Ústav biologie obratlovců AV ČR, 2015 - (Bryja, J.; Řehák, Z.; Zukal, J.). s. 254-255 ISBN 978-80-87189-18-4. [Zoologické dny. 12.02.2015-13.02.2015, Brno] Institutional support: RVO:68081766 Keywords : Toll-like receptors * birds Subject RIV: EG - Zoology

  9. News

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    Major Export Markets Going Up in Frist Four Months According to Customs Data,the export of textile and clothing accumulated to 70.255 billion USD in first four months,rising 27.05% from the same period last year.

  10. Kolísání a tendence v režimu odtoků povodí českého Labe

    Czech Academy of Sciences Publication Activity Database

    Buchtele, Josef; Buchtelová, Marie; Fořtová, Magda

    2008-01-01

    Roč. 58, č. 7 (2008), s. 251-255. ISSN 1211-0760 Grant ostatní: EU(CZ) NeWater No. 511179 Institutional research plan: CEZ:AV0Z20600510 Keywords : runoff changes * natural affection * antropogenic changes * identification of changes Subject RIV: BK - Fluid Dynamics

  11. Magnetic alginate microparticles for purification of .alpha.-amylases

    Czech Academy of Sciences Publication Activity Database

    Šafaříková, Miroslava; Roy, I.; Gupta, M. N.; Šafařík, Ivo

    2003-01-01

    Roč. 105, - (2003), s. 255-260. ISSN 0168-1656 R&D Projects: GA MŠk OC 523.80; GA AV ČR IBS6087204 Institutional research plan: CEZ:AV0Z6087904 Keywords : alginate * ferrofluid * amalyses Subject RIV: CE - Biochemistry Impact factor: 2.543, year: 2003

  12. Race without Racism: How Higher Education Researchers Minimize Racist Institutional Norms

    Science.gov (United States)

    Harper, Shaun R.

    2012-01-01

    This article analyzes 255 articles published in seven peer-reviewed journals over a 10-year period and presents examples of how higher education researchers undertake the study of campus racial climates; racial differences in access, outcomes, and attainment; and the experiences of students, faculty, and administrators of color on predominantly…

  13. Distribution and Pools of Mercury in Czech Forest Soils

    Czech Academy of Sciences Publication Activity Database

    Navrátil, Tomáš; Shanley, J.; Rohovec, Jan; Hojdová, Maria; Penížek, V.; Buchtová, Jana

    2014-01-01

    Roč. 255, č. 3 (2014), s. 1-17. ISSN 0049-6979 R&D Projects: GA ČR(CZ) GAP210/11/1369 Institutional support: RVO:67985831 Keywords : mercury * carbon * sulfur * oxalate-extractable Al * Oxalate-extractable Fe * Hg/C ratio * Central Europe * Black Triangle Subject RIV: DD - Geochemistry Impact factor: 1.554, year: 2014

  14. Tumour-initiating cells vs. cancer "stem" cells and CD133: What's in the name?

    Czech Academy of Sciences Publication Activity Database

    Neužil, Jiří; Stantic, M.; Zobalová, Renata; Chladová, Jaromíra; Wang, X. F.; Procházka, L.; Dong, L.; Anděra, Ladislav; Ralph, S.J.

    2007-01-01

    Roč. 255, č. 4 (2007), s. 855-859. ISSN 0006-291X Institutional research plan: CEZ:AV0Z50520514; CEZ:AV0Z50520701 Keywords : tumour-initiating cells * CD133 * resistance to treatment Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.749, year: 2007

  15. Main: 1XQ1 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available cs (Cesg) Center For Eukaryotic Structural Genomics X-Ray Structure Of Putative T...E; PS00061; ADH_SHORT; 1. X-Ray Diffraction, Resolution: 2.10 Angstrom, R-Factor: 0.255, R-Free: 0.316 Lengt

  16. FADS single-nucleotide polymorphisms are associated with behavioral outcomes in children, and the effect varies between sexes and is dependent on PPAR genetype

    DEFF Research Database (Denmark)

    Nielsen, Maria Søgaard; AR Jensen, Heidi; BS Harsløf, Laurine;

    2014-01-01

    cohort. Blood samples were taken to determine erythrocyte DHA-status (n=192) and the three FADS tag-SNPs (n=255). All outcomes were analyzed using multiple regression models including the three SNPs, SNP-gender interactions, and adjustment for parental education, siblings, birth-weight, and duration of...

  17. Afløbsinstallationer - systemer og dimensionering

    DEFF Research Database (Denmark)

    Brandt, Erik; Faldager, Inge

    SBi-anvisning 255 beskriver afløbssystemer og retningslinjer for dimensionering af afløbssystemer i henhold til Bygningsreglementet og derigennem DS 432:2009. Anvisningen henvender sig til projekterende og udførende af afløbsinstallationer i nybyggeri eller eksisterende byggeri, eller som skal re...

  18. On the control of deposition process for enhanced mechanical properties of nc-TiC/a-C: H coatings with DC magnetron sputtering at low or high ion flux

    Czech Academy of Sciences Publication Activity Database

    Souček, P.; Schmidtová, T.; Zábranský, L.; Buršíková, V.; Vašina, P.; Caha, O.; Buršík, Jiří; Peřina, Vratislav; Mikšová, Romana; Pei, Y.; de Hosson, J. T. M.

    2014-01-01

    Roč. 255, 25 September (2014), s. 8-14. ISSN 0257-8972 Institutional support: RVO:68081723 ; RVO:61389005 Keywords : enhanced mechanical properties * ion flux on the substrate * magnetron sputtering Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.998, year: 2014

  19. Analyzing the In Vivo Status of Exogenously Applied Auxins: A HPLC-Based Method to Characterize the Intracellularly Localized Auxin Transporters

    Czech Academy of Sciences Publication Activity Database

    Simon, Sibu; Skůpa, Petr; Dobrev, Petre; Petrášek, Jan; Zažímalová, Eva; Friml, J.

    Totowa: Humana Press, 2014 - (Hicks, G.; Robert, S.), s. 255-264. (Methods in Molecular Biology). ISBN 978-1-62703-591-0 R&D Projects: GA ČR(CZ) GAP305/11/0797 Institutional support: RVO:61389030 Keywords : Auxin * Auxin metabolism * BY-2 tobacco cells Subject RIV: EB - Genetics ; Molecular Biology

  20. Latin American literature: a translator’s visible legacy

    Directory of Open Access Journals (Sweden)

    Kara O'Neil

    2013-03-01

    Full Text Available http://dx.doi.org/10.5007/2175-7968.2013v1n31p255Book review of Gregory Rabassa’s Latin American literature: a translator’s visible legacy by María Costanza Guzmán. Affiliated with Dr. Steven White with St. Lawrence University.