WorldWideScience

Sample records for californium 252

  1. Californium-252 progress, report No. 7, April 1971

    Energy Technology Data Exchange (ETDEWEB)

    1971-12-31

    This report contains discusses of the following topics on Californium-252: First sales of californium-252; encapsulation services discussed; three new participants in market evaluation program; summer training programs to use californium; Californium-252 shipping casks available; Californium-252 questions and answers, radiotherapy; neutron radiography; natural resources exploration; nuclear safeguards; process control; dosimetry; neutron radiography; neutron shielding; and nuclear safeguards.

  2. Californium-252: a remarkable versatile radioisotope

    Energy Technology Data Exchange (ETDEWEB)

    Osborne-Lee, I.W.; Alexander, C.W.

    1995-10-10

    A product of the nuclear age, Californium-252 ({sup 252}Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, {sup 252}Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of {sup 252}Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the {sup 252}Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, {sup 252}Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of {sup 252}Cf from ORNL is summarized herein.

  3. Historical review of californium-252 discovery and development

    Science.gov (United States)

    Stoddard, D. H.

    This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving (252)Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed.

  4. Californium-252 Program Equipment Evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Chattin, Fred Rhea [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Wilson, Kenton [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Ezold, Julie G. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-12-01

    To successfully continue the 252Cf production and meet the needs of the customers, a comprehensive evaluation of the Building 7920 processing equipment was requested to identify equipment critical to the operational continuity of the program.

  5. Production, Distribution, and Applications of Californium-252 Neutron Sources

    Energy Technology Data Exchange (ETDEWEB)

    Balo, P.A.; Knauer, J.B.; Martin, R.C.

    1999-10-03

    The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-year half-life. A source the size of a person's little finger can emit up to 10{sup 11} neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6- year half-life. A source the size of a person's little finger can emit up to 10 neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory(ORNL). DOE sells {sup 252}Cf to commercial

  6. Apparatus for the measurement of total body nitrogen using prompt neutron activation analysis with californium-252.

    Science.gov (United States)

    Mackie, A; Hannan, W J; Smith, M A; Tothill, P

    1988-01-01

    Details of clinical apparatus designed for the measurement of total body nitrogen (as an indicator of body protein), suitable for the critically ill, intensive-care patient are presented. Californium-252 radio-isotopic neutron sources are used, enabling a nitrogen measurement by prompt neutron activation analysis to be made in 40 min with a precision of +/- 3.2% for a whole body dose equivalent of 0.145 mSv. The advantages of Californium-252 over alternative neutron sources are discussed. A comparison between two irradiation/detection geometries is made, leading to an explanation of the geometry adopted for the apparatus. The choice of construction and shielding materials to reduce the count rate at the detectors and consequently to reduce the pile-up contribution to the nitrogen background is discussed. Salient features of the gamma ray spectroscopy system to reduce spectral distortion from pulse pile-up are presented.

  7. Automated absolute activation analysis with californium-252 sources

    Energy Technology Data Exchange (ETDEWEB)

    MacMurdo, K.W.; Bowman, W.W.

    1978-09-01

    A 100-mg /sup 252/Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from /sup 17/O. Detection sensitivities of < or = 400 ppB for natural uranium and 8 ppB (< or = 0.5 (nCi/g)) for /sup 239/Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level.

  8. Study of the shielding for spontaneous fission sources of Californium-252; Estudio de blindaje para fuentes de fision espontanea de Californio-252

    Energy Technology Data Exchange (ETDEWEB)

    Davila R, I

    1991-06-15

    A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)

  9. Application of TSH bioindicator for studying the biological efficiency of neutrons from californium-252 source

    Energy Technology Data Exchange (ETDEWEB)

    Cebulska-Wasilewska, A.; Rekas, K. [Institute of Nuclear Physics, Cracow (Poland); Kim, J.K. [Korea Atomic Energy Research Inst., Taejon (Korea, Republic of)

    1997-12-31

    The effectiveness of neutrons from a Californium-252 source in the induction of various abnormalities in the Tradescantia clone 4430 stamen hair cells (TSH-assay) was studied. The special attention was paid to check whether any enhancement in effects caused by process of boron neutron capture is visible in the cells enriched with boron ions. Two chemicals (borax and BSH) were applied to introduce boron-10 ions into cells. Inflorescence, normal or pretreated with chemicals containing boron, were irradiated in the air with neutrons from a Cf-252 source at KAERI, Taejon, Korea. To estimate the relative biological effectiveness (RBE) in the induction of gene mutations of the neutron beam under the study, Tradescantia inflorescences, without any chemical pretreatment, were irradiated with various doses of X-rays. The ranges of radiation doses used were 0-0.1 Gy in neutrons and 0-0.5 Gy in X-rays. After the time needed to complete the postirradiation repair Tradescantia cuttings were transferred to Cracow, where screening of gene and lethal; mutations, cell cycle alterations in somatic cells have been done, and dose response relationships were figured. The maximal RBE values were estimated in the range of 4.6-6.8. Alterations of RBE value were observed; from 6.8 to 7.8 in the case of plants pretreated with 240 ppm of B-10 from borax, and 4.6 to 6.1 in the case of 400 ppm of B-10 from BSH. Results showed a slight, although statistically insignificant increase in biological efficacy of radiation from the Cf-252 source in samples pretreated with boron containing chemicals. (author)

  10. Californium-252 Brachytherapy Combined With External-Beam Radiotherapy for Cervical Cancer: Long-Term Treatment Results

    Energy Technology Data Exchange (ETDEWEB)

    Lei Xin; Qian Chengyuan; Qing Yi; Zhao Kewei; Yang Zhengzhou; Dai Nan; Zhong Zhaoyang; Tang Cheng; Li Zheng; Gu Xianqing; Zhou Qian; Feng Yan; Xiong Yanli; Shan Jinlu [Cancer Center, Research Institute of Surgery and Daping Hospital, Third Military Medical University, Chongqing (China); Wang Dong, E-mail: dongwang64@hotmail.com [Cancer Center, Research Institute of Surgery and Daping Hospital, Third Military Medical University, Chongqing (China)

    2011-12-01

    Purpose: To observe, by retrospective analysis, the curative effects and complications due to californium-252 ({sup 252}Cf) neutron intracavitary brachytherapy (ICBT) combined with external-beam radiotherapy (EBRT) in the treatment of cervical cancer. Methods and Materials: From February 1999 to December 2007, 696 patients with cervical cancer (Stages IB to IIIB) were treated with {sup 252}Cf-ICBT in combination of EBRT. Of all, 31 patients were at Stage IB, 104 at IIA, 363 at IIB, 64 at IIIA, and 134 at IIIB. Californium-252 ICBT was delivered at 7-12 Gy per insertion per week, with a total dose of 29-45 Gy to reference point A in three to five insertions. The whole pelvic cavity was treated with 8-MV X-ray external irradiation at 2 Gy per fraction, four times per week. After 16-38 Gy of external irradiation, the center of the whole pelvic field was blocked with a 4-cm-wide lead shield, with a total external irradiation dose of 44-56 Gy. The total treatment course was 5 to 6 weeks. Results: Overall survival rate at 3 and 5 years for all patients was 76.0% and 64.9%, respectively. Disease-free 3- and 5-year survival rates of patients were 71.2% and 58.4%, respectively. Late complications included vaginal contracture and adhesion, radiation proctitis, radiation cystitis, and inflammatory bowel, which accounted for 5.8%, 7.1%, 6.2%, and 4.9%, respectively. Univariate analysis results showed significant correlation of stage, age, histopathologic grade, and lymph node status with overall survival. Cox multiple regression analysis showed that the independent variables were stage, histopathologic grade, tumor size, and lymphatic metastasis in all patients. Conclusion: Results of this series suggest that the combined use of {sup 252}Cf-ICBT with EBRT is an effective method for treatment of cervical cancer.

  11. Long-term effects of an intracavitary treatment with californium-252 on normal tissue. [Swine, /sup 226/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.

    1976-01-01

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with /sup 252/Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from /sup 252/Cf and 7000 rad from /sup 226/Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for /sup 252/Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from /sup 252/Cf and 5000 rad from /sup 226/Ra.

  12. Low-Dose-Rate Californium-252 Neutron Intracavitary Afterloading Radiotherapy Combined With Conformal Radiotherapy for Treatment of Cervical Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Min [Department of Oncology, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Xu Hongde [Cancer Center, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Pan Songdan; Lin Shan; Yue Jianhua [Department of Oncology, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Liu Jianren, E-mail: liujianren0571@hotmail.com [Second Affiliated Hospital, School of Medicine, Zhejiang University, Hangzhou, Zhejiang Province (China)

    2012-07-01

    Purpose: To study the efficacy of low-dose-rate californium-252 ({sup 252}Cf) neutron intracavitary afterloading radiotherapy (RT) combined with external pelvic RT for treatment of cervical cancer. Methods and Materials: The records of 96 patients treated for cervical cancer from 2006 to 2010 were retrospectively reviewed. For patients with tumors {<=}4 cm in diameter, external beam radiation was performed (1.8 Gy/day, five times/week) until the dose reached 20 Gy, and then {sup 252}Cf neutron intracavitary afterloading RT (once/week) was begun, and the frequency of external beam radiation was changed to four times/week. For patients with tumors >4 cm, {sup 252}Cf RT was performed one to two times before whole-pelvis external beam radiation. The tumor-eliminating dose was determined by using the depth limit of 5 mm below the mucosa as the reference point. In all patients, the total dose of the external beam radiation ranged from 46.8 to 50 Gy. For {sup 252}Cf RT, the dose delivered to point A was 6 Gy/fraction, once per week, for a total of seven times, and the total dose was 42 Gy. Results: The mean {+-} SD patient age was 54.7 {+-} 13.7 years. Six patients had disease assessed at stage IB, 13 patients had stage IIA, 49 patients had stage IIB, 3 patients had stage IIIA, 24 patients had stage IIIB, and 1 patient had stage IVA. All patients obtained complete tumor regression (CR). The mean {+-} SD time to CR was 23.5 {+-} 3.4 days. Vaginal bleeding was fully controlled in 80 patients within 1 to 8 days. The mean {+-} SD follow-up period was 27.6 {+-} 12.7 months (range, 6-48 months). Five patients died due to recurrence or metastasis. The 3-year survival and disease-free recurrence rates were 89.6% and 87.5 %, respectively. Nine patients experienced mild radiation proctitis, and 4 patients developed radiocystitis. Conclusions: Low-dose-rate {sup 252}Cf neutron RT combined with external pelvic RT is effective for treating cervical cancer, with a low incidence of

  13. Californium-252 neutron intracavity brachytherapy alone for T1N0 low-lying rectal adenocarcinoma: A definitive anal sphincter-preserving radiotherapy

    Science.gov (United States)

    Xiong, Yanli; Shan, Jinlu; Liu, Jia; Zhao, Kewei; Chen, Shu; Xu, Wenjing; Zhou, Qian; Yang, Mei; Lei, Xin

    2017-01-01

    This study evaluated the 4-year results of 32 patients with T1N0 low-lying rectal adenocarcinoma treated solely with californium-252 (Cf-252) neutron intracavity brachytherapy (ICBT). Patients were solicited into the study from January 2008 to June 2011. All the patients had refused surgery or surgery was contraindicated. The patients were treated with Cf-252 neutron ICBT using a novel 3.5-cm diameter off-axis 4-channel intrarectal applicator designed by the authors. The dose reference point was defined on the mucosa surface, with a total dose of 55–62 Gy-eq/4 f (13–16 Gy-eq/f/wk). All the patients completed the radiotherapy in accordance with our protocol. The rectal lesions regressed completely, and the acute rectal toxicity was mild (≤G2). The 4-year local control, overall survival, disease-free survival, and late complication (≥G2) rates were 96.9%, 90.6%, 87.5% and 15.6%, respectively. No severe late complication (≥G3) occurred. The mean follow-up was 56.1 ± 16.0 months. At the end of last follow-up, 29 patients remained alive. The mean survival time was 82.1 ± 2.7 months. Cf-252 neutron ICBT administered as the sole treatment (without surgery) for patients with T1N0 low-lying rectal adenocarcinoma is effective with acceptable late complications. Our study and method offers a definitive anal sphincter-preserving radiotherapy for T1N0 low-lying rectal adenocarcinoma patients. PMID:28094790

  14. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source; Determinacao de manganes em minerios, por analise por ativacao, usando californio-252 como fonte de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Antonio

    1976-07-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  15. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252; Diseno de un reactor nuclear subcritico homogeneo a base de Torio con una fuente de Californio 252

    Energy Technology Data Exchange (ETDEWEB)

    Delgado H, C. E.; Vega C, H. R. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Sajo B, L., E-mail: ce_delgado89@hotmail.com [Universidad Simon Bolivar, Laboratorio de Fisica Nuclear, Apdo. 89000, 1080A Caracas (Venezuela, Bolivarian Republic of)

    2015-10-15

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U{sup 233} when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO{sub 2}(NO{sub 3}){sub 4} and 18% of thorium Th(NO{sub 3}){sub 4} as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 10{sup 7} s{sup -1}. In the design the value of the effective multiplication factor, whose value turned out k{sub eff} <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  16. Radiological Characterization Technical Report on Californium-252 Sealed Source Transuranic Debris Waste for the Off-Site Source Recovery Project at Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Feldman, Alexander [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-04-24

    This document describes the development and approach for the radiological characterization of Cf-252 sealed sources for shipment to the Waste Isolation Pilot Plant. The report combines information on the nuclear material content of each individual source (mass or activity and date of manufacture) with information and data on the radionuclide distributions within the originating nuclear material. This approach allows for complete and accurate characterization of the waste container without the need to take additional measurements. The radionuclide uncertainties, developed from acceptable knowledge (AK) information regarding the source material, are applied to the summed activities in the drum. The AK information used in the characterization of Cf-252 sealed sources has been qualified by the peer review process, which has been reviewed and accepted by the Environmental Protection Agency.

  17. Biomedical neutron research at the Californium User Facility for neutron science

    Energy Technology Data Exchange (ETDEWEB)

    Martin, R.C. [Oak Ridge National Lab., TN (United States); Byrne, T.E. [Roane State Community College, Harriman, TN (United States); Miller, L.F. [Univ. of Tennessee, Knoxville, TN (United States)

    1997-04-01

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact {sup 252}Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with {sup 252}Cf sources. Three projects at the CUF that demonstrate the versatility of {sup 252}Cf for biological and biomedical neutron-based research are described: future establishment of a {sup 252}Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded {sup 252}Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy.

  18. Beyond Californium-A Neutron Generator Alternative for Dosimetry and Instrument Calibration in the U.S.

    Science.gov (United States)

    Piper, Roman K; Mozhayev, Andrey V; Murphy, Mark K; Thompson, Alan K

    2017-09-01

    Evaluations of neutron survey instruments, area monitors, and personal dosimeters rely on reference neutron radiations, which have evolved from the heavy reliance on (α,n) sources to a shared reliance on (α,n) and the spontaneous fission neutrons of californium-252 (Cf). Capable of producing high dose equivalent rates from an almost point source geometry, the characteristics of Cf are generally more favorable when compared to the use of (α,n) and (γ,n) sources or reactor-produced reference neutron radiations. Californium-252 is typically used in two standardized configurations: unmoderated, to yield a fission energy spectrum; or with the capsule placed within a heavy-water moderating sphere to produce a softened spectrum that is generally considered more appropriate for evaluating devices used in nuclear power plant work environments. The U.S. Department of Energy Cf Loan/Lease Program, a longtime origin of affordable Cf sources for research, testing and calibration, was terminated in 2009. Since then, high-activity sources have become increasingly cost-prohibitive for laboratories that formerly benefited from that program. Neutron generators, based on the D-T and D-D fusion reactions, have become economically competitive with Cf and are recognized internationally as important calibration and test standards. Researchers from the National Institute of Standards and Technology and the Pacific Northwest National Laboratory are jointly considering the practicality and technical challenges of implementing neutron generators as calibration standards in the U.S. This article reviews the characteristics of isotope-based neutron sources, possible isotope alternatives to Cf, and the rationale behind the increasing favor of electronically generated neutron options. The evaluation of a D-T system at PNNL has revealed characteristics that must be considered in adapting generators to the task of calibration and testing where accurate determination of a dosimetric quantity is

  19. Unusual structure, bonding and properties in a californium borate

    Energy Technology Data Exchange (ETDEWEB)

    Polinski, Matthew J.; Garner, Edward B.; Maurice, Rémi; Planas, Nora; Stritzinger, Jared T.; Parker, T. Gannon; Cross, Justin N.; Green, Thomas D.; Alekseev, Evgeny V.; Van Cleve, Shelley M.; Depmeier, Wulf; Gagliardi, Laura; Shatruk, Michael; Knappenberger, Kenneth L.; Liu, Guokui; Skanthakumar, S.; Soderholm, Lynda; Dixon, David A.; Albrecht-Schmitt, Thomas E.

    2014-03-23

    The participation of the valence orbitals of actinides in bonding has been debated for decades. Recent experimental and computational investigations demonstrated the involvement of 6p, 6d and/or 5f orbitals in bonding. However, structural and spectroscopic data, as well as theory, indicate a decrease in covalency across the actinide series, and the evidence points to highly ionic, lanthanide-like bonding for late actinides. Here we show that chemical differentiation between californium and lanthanides can be achieved by using ligands that are both highly polarizable and substantially rearrange on complexation. A ligand that suits both of these desired properties is polyborate. We demonstrate that the 5f, 6d and 7p orbitals are all involved in bonding in a Cf(III) borate, and that large crystal-field effects are present. Synthetic, structural and spectroscopic data are complemented by quantum mechanical calculations to support these observations.

  20. Intracavitary moderator balloon combined with (252)Cf brachytherapy and boron neutron capture therapy, improving dosimetry in brain tumour and infiltrations.

    Science.gov (United States)

    Brandão, S F; Campos, T P R

    2015-07-01

    This article proposes a combination of californium-252 ((252)Cf) brachytherapy, boron neutron capture therapy (BNCT) and an intracavitary moderator balloon catheter applied to brain tumour and infiltrations. Dosimetric evaluations were performed on three protocol set-ups: (252)Cf brachytherapy combined with BNCT (Cf-BNCT); Cf-BNCT with a balloon catheter filled with light water (LWB) and the same set-up with heavy water (HWB). Cf-BNCT-HWB has presented dosimetric advantages to Cf-BNCT-LWB and Cf-BNCT in infiltrations at 2.0-5.0 cm from the balloon surface. However, Cf-BNCT-LWB has shown superior dosimetry up to 2.0 cm from the balloon surface. Cf-BNCT-HWB and Cf-BNCT-LWB protocols provide a selective dose distribution for brain tumour and infiltrations, mainly further from the (252)Cf source, sparing the normal brain tissue. Malignant brain tumours grow rapidly and often spread to adjacent brain tissues, leading to death. Improvements in brain radiation protocols have been continuously achieved; however, brain tumour recurrence is observed in most cases. Cf-BNCT-LWB and Cf-BNCT-HWB represent new modalities for selectively combating brain tumour infiltrations and metastasis.

  1. Intracavitary moderator balloon combined with 252Cf brachytherapy and boron neutron capture therapy, improving dosimetry in brain tumour and infiltrations

    Science.gov (United States)

    Brandão, S F

    2015-01-01

    Objective: This article proposes a combination of californium-252 (252Cf) brachytherapy, boron neutron capture therapy (BNCT) and an intracavitary moderator balloon catheter applied to brain tumour and infiltrations. Methods: Dosimetric evaluations were performed on three protocol set-ups: 252Cf brachytherapy combined with BNCT (Cf-BNCT); Cf-BNCT with a balloon catheter filled with light water (LWB) and the same set-up with heavy water (HWB). Results: Cf-BNCT-HWB has presented dosimetric advantages to Cf-BNCT-LWB and Cf-BNCT in infiltrations at 2.0–5.0 cm from the balloon surface. However, Cf-BNCT-LWB has shown superior dosimetry up to 2.0 cm from the balloon surface. Conclusion: Cf-BNCT-HWB and Cf-BNCT-LWB protocols provide a selective dose distribution for brain tumour and infiltrations, mainly further from the 252Cf source, sparing the normal brain tissue. Advances in knowledge: Malignant brain tumours grow rapidly and often spread to adjacent brain tissues, leading to death. Improvements in brain radiation protocols have been continuously achieved; however, brain tumour recurrence is observed in most cases. Cf-BNCT-LWB and Cf-BNCT-HWB represent new modalities for selectively combating brain tumour infiltrations and metastasis. PMID:25927876

  2. Safety Analysis Report for Packaging (SARP) of the Oak Ridge National Laboratory TRU Californium Shipping Container

    Energy Technology Data Exchange (ETDEWEB)

    Box, W.D.; Shappert, L.B.; Seagren, R.D.; Klima, B.B.; Jurgensen, M.C.; Hammond, C.R.; Watson, C.D.

    1980-01-01

    An analytical evaluation of the Oak Ridge National Laboratory TRU Californium Shipping Container was made in order to demonstrate its compliance with the regulations governing off-site shipment of packages that contain radioactive material. The evaluation encompassed five primary categories: structural integrity, thermal resistance, radiation shielding, nuclear criticality safety, and quality assurance. The results of this evaluation demonstrate that the container complies with the applicable regulations.

  3. Gclust Server: 252 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available transferase/ transferase, transferring glycosyl groups 138 1.00e-90 57.14 0.0 4.0 0.0 0.0 0.0 Show 252...transferase/ transferase, transferring glycosyl groups Number of Sequences 138 Homologs 138 Clustering

  4. 14 CFR 252.13 - Small aircraft.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Small aircraft. 252.13 Section 252.13 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS SMOKING ABOARD AIRCRAFT § 252.13 Small aircraft. Air carriers shall prohibit smoking on aircraft...

  5. 14 CFR 252.9 - Ventilation systems.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Ventilation systems. 252.9 Section 252.9... REGULATIONS SMOKING ABOARD AIRCRAFT § 252.9 Ventilation systems. Air carriers shall prohibit smoking whenever the ventilation system is not fully functioning. Fully functioning for this purpose means operating so...

  6. Dicty_cDB: CFC252 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC252 (Link to dictyBase) - - - Contig-U16245-1 CFC252P (Link to Original site) CFC...252F 496 CFC252Z 676 CFC252P 1172 - - Show CFC252 Library CF (Link to library) Clone ID CFC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC2-C/CFC252Q.Seq.d/ Representative seq. ID CFC...252P (Link to Original site) Representative DNA sequence >CFC252 (CFC252Q) /CSM/CF/CFC2-C/CFC...ing significant alignments: (bits) Value CFC252 (CFC252Q) /CSM/CF/CFC2-C/CFC252Q.Seq.d/ 2278 0.0 SFI736 (SFI

  7. 48 CFR 53.301-252 - Standard Form 252, Architect-Engineer Contract.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Standard Form 252, Architect-Engineer Contract. 53.301-252 Section 53.301-252 Federal Acquisition Regulations System FEDERAL..., Architect-Engineer Contract. EC01MY91.035 EC01MY91.036 ...

  8. 48 CFR 252.237-7006 - Subcontracting.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Subcontracting. 252.237... Clauses 252.237-7006 Subcontracting. As prescribed in 237.7003(b), use the following clause: Subcontracting (DEC 1991) The Contractor shall not subcontract any work under this contract without the...

  9. 48 CFR 252.247-7018 - Subcontracting.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Subcontracting. 252.247... Clauses 252.247-7018 Subcontracting. As prescribed in 247.270-3(m), use the following clause: Subcontracting (DEC 1991) The Contractor shall not subcontract without the prior written approval of the...

  10. 48 CFR 252.217-7006 - Title.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Title. 252.217-7006... Clauses 252.217-7006 Title. As prescribed in 217.7104(a), use the following clause: Title (DEC 1991) (a) Unless otherwise provided, title to all materials and equipment to be incorporated in a vessel in the...

  11. 48 CFR 252.217-7010 - Performance.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Performance. 252.217-7010... Clauses 252.217-7010 Performance. As prescribed in 217.7104(a), use the following clause: Performance (JUL..., scrap or other ship's material of the Government resulting from performance of the work as items of...

  12. 24 CFR 221.252 - Substitute mortgagors.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Substitute mortgagors. 221.252... Cost Homes § 221.252 Substitute mortgagors. (a) Selling mortgagor. The mortgagee may effect the release... approval of a substitute mortgagor, as provided by this section. (b) Purchasing mortgagor. The Commissioner...

  13. 19 CFR 10.252 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Definitions. 10.252 Section 10.252 Customs Duties... ATPDEA beneficiary country, of which the manager or managers, chairman of the board of directors or of... duty and free of any quantitative restrictions in the case of tuna described in § 10.253(a)(1) and free...

  14. 40 CFR 265.252 - Waste analysis.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Waste analysis. 265.252 Section 265... FACILITIES Waste Piles § 265.252 Waste analysis. In addition to the waste analyses required by § 265.13, the... in the pile to which it is to be added. The analysis conducted must be capable of differentiating...

  15. 7 CFR 252.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 252.3 Section 252.3 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE... Administration. (a) Role of FNS. The Secretary will designate those commodities which will be available under the...

  16. 7 CFR 252.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... authorities, schools, service institutions, welfare agencies, nutrition programs for the elderly... 7 Agriculture 4 2010-01-01 2010-01-01 false Definitions. 252.2 Section 252.2 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE...

  17. 46 CFR 252.13 - Contract.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Contract. 252.13 Section 252.13 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION REGULATIONS AFFECTING SUBSIDIZED VESSELS AND OPERATORS OPERATING... Contract. Upon approval by the Board of an application for ODS, the applicant and the United States may...

  18. 15 CFR 904.252 - Witnesses.

    Science.gov (United States)

    2010-01-01

    ... the witness, or any other action deemed appropriate by the Judge. (f) Testimony in a foreign language. If a witness is expected to testify in a language other than the English language, the party... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Witnesses. 904.252 Section 904.252...

  19. A retrospective study of californium-252 neutron brachytherapy combined with EBRT versus 3D-CRT in the treatment of esophageal squamous cell cancer.

    Science.gov (United States)

    Wang, Qifeng; Li, Tao; Lang, Jinyi; Wang, Jie; Wang, Jian; Liu, Huiming; Jia, Xitang; Liu, Bo; Wang, C-K Chris

    2015-10-24

    We conducted a retrospective analysis on 884 patients who were diagnosed with esophageal squamous cell carcinoma (ESCC) and treated with either the neutron brachytherapy in combination with external beam radiotherapy (NBT + EBRT) or 3-dimensional conformal radiation therapy (3D-CRT) to determine the differences in efficacy and morbidity between the two treatment groups. The 884 ESCC patients treated with either NBT + EBRT or 3D-CRT between 2002 and 2012 were retrospectively reviewed and analyzed. Multivariable Cox regression was used to compare oncologic outcomes of the two groups of patients in the context of other clinically relevant variables. The acute and chronic toxicities associated with the two groups were compared using Fisher exact and log-rank tests, respectively. Among the 884 patients, 545 received NBT + EBRT and 339 received 3D-CRT (i.e. EBRT-only). The age range is 39-95 years (median 66). The follow-up time range is 3-145 months (median 32). The analysis shows that the NBT + EBRT group has higher overall survival rate and local control rate than that of the 3D-CRT group. The acute toxicity effects were acceptable for both groups of patients with the NBT + EBRT group showing higher rates of leukopenia and thrombocytopenia and the 3D-CRT group showing higher rates on fistula and massive bleeding. The patients treated with NBT + EBRT showed better oncologic outcomes than those treated with 3D-CRT. The toxicity effects were acceptable for both groups with the NBT + EBRT group showing higher rates on the acute effects and the 3D-CRT group showing higher rates on the late effects.

  20. 27 CFR 25.252 - Records.

    Science.gov (United States)

    2010-04-01

    ... TREASURY LIQUORS BEER Removal of Brewer's Yeast and Other Articles § 25.252 Records. (a) Production. The brewer shall keep records of the production of malt syrup, wort, and other articles which are removed...

  1. Sensitivity Analysis of Cf-252 (sf) Neutron and Gamma Observables in CGMF

    Energy Technology Data Exchange (ETDEWEB)

    Carter, Austin Lewis [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Talou, Patrick [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Stetcu, Ionel [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Kiedrowski, Brian Christopher [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Jaffke, Patrick John [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-12-06

    CGMF is a Monte Carlo code that simulates the decay of primary fission fragments by emission of neutrons and gamma rays, according to the Hauser-Feshbach equations. As the CGMF code was recently integrated into the MCNP6.2 transport code, great emphasis has been placed on providing optimal parameters to CGMF such that many different observables are accurately represented. Of these observables, the prompt neutron spectrum, prompt neutron multiplicity, prompt gamma spectrum, and prompt gamma multiplicity are crucial for accurate transport simulations of criticality and nonproliferation applications. This contribution to the ongoing efforts to improve CGMF presents a study of the sensitivity of various neutron and gamma observables to several input parameters for Californium-252 spontaneous fission. Among the most influential parameters are those that affect the input yield distributions in fragment mass and total kinetic energy (TKE). A new scheme for representing Y(A,TKE) was implemented in CGMF using three fission modes, S1, S2 and SL. The sensitivity profiles were calculated for 17 total parameters, which show that the neutron multiplicity distribution is strongly affected by the TKE distribution of the fragments. The total excitation energy (TXE) of the fragments is shared according to a parameter RT, which is defined as the ratio of the light to heavy initial temperatures. The sensitivity profile of the neutron multiplicity shows a second order effect of RT on the mean neutron multiplicity. A final sensitivity profile was produced for the parameter alpha, which affects the spin of the fragments. Higher values of alpha lead to higher fragment spins, which inhibit the emission of neutrons. Understanding the sensitivity of the prompt neutron and gamma observables to the many CGMF input parameters provides a platform for the optimization of these parameters.

  2. Simulation and design of an electron beam ion source charge breeder for the californium rare isotope breeder upgrade

    Directory of Open Access Journals (Sweden)

    Clayton Dickerson

    2013-02-01

    Full Text Available An electron beam ion source (EBIS will be constructed and used to charge breed ions from the californium rare isotope breeder upgrade (CARIBU for postacceleration into the Argonne tandem linear accelerator system (ATLAS. Simulations of the EBIS charge breeder performance and the related ion transport systems are reported. Propagation of the electron beam through the EBIS was verified, and the anticipated incident power density within the electron collector was identified. The full normalized acceptance of the charge breeder with a 2 A electron beam, 0.024π  mm mrad for nominal operating parameters, was determined by simulating ion injection into the EBIS. The optics of the ion transport lines were carefully optimized to achieve well-matched ion injection, to minimize emittance growth of the injected and extracted ion beams, and to enable adequate testing of the charge bred ions prior to installation in ATLAS.

  3. Extraction of Trivalent Actinides and Lanthanides from Californium Campaign Rework Solution Using TODGA-based Solvent Extraction System

    Energy Technology Data Exchange (ETDEWEB)

    Benker, Dennis [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Delmau, Laetitia Helene [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Dryman, Joshua Cory [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-07-01

    This report presents the studies carried out to demonstrate the possibility of quantitatively extracting trivalent actinides and lanthanides from highly acidic solutions using a neutral ligand-based solvent extraction system. These studies stemmed from the perceived advantage of such systems over cationexchange- based solvent extraction systems that require an extensive feed adjustment to make a low-acid feed. The targeted feed solutions are highly acidic aqueous phases obtained after the dissolution of curium targets during a californium (Cf) campaign. Results obtained with actual Cf campaign solutions, but highly diluted to be manageable in a glove box, are presented, followed by results of tests run in the hot cells with Cf campaign rework solutions. It was demonstrated that a solvent extraction system based on the tetraoctyl diglycolamide molecule is capable of quantitatively extracting trivalent actinides from highly acidic solutions. This system was validated using actual feeds from a Cf campaign.

  4. 29 CFR 1910.252 - General requirements.

    Science.gov (United States)

    2010-07-01

    ... Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR OCCUPATIONAL SAFETY AND HEALTH STANDARDS Welding, Cutting and Brazing § 1910.252 General requirements. (a) Fire... Welding may produce fumes and gases hazardous to health. Avoid breathing these fumes and gases. Use...

  5. 40 CFR 25.2 - Scope.

    Science.gov (United States)

    2010-07-01

    ... CONSERVATION AND RECOVERY ACT, THE SAFE DRINKING WATER ACT, AND THE CLEAN WATER ACT § 25.2 Scope. (a) The... under the Clean Water Act and Resource Conservation and Recovery Act; (2) EPA issuance and modification... in Solid Waste Management) will no longer appear in the Code of Federal Regulations; however, they...

  6. 48 CFR 252.236-7002 - Obstruction of navigable waterways.

    Science.gov (United States)

    2010-10-01

    ... waterways. 252.236-7002 Section 252.236-7002 Federal Acquisition Regulations System DEFENSE ACQUISITION... of Provisions And Clauses 252.236-7002 Obstruction of navigable waterways. As prescribed in 236.570(b)(1), use the following clause: Obstruction of Navigable Waterways (DEC 1991) (a) The Contractor shall...

  7. 38 CFR 17.252 - Ex officio member of subcommittee.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Ex officio member of subcommittee. 17.252 Section 17.252 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS MEDICAL Grants for Exchange of Information § 17.252 Ex officio member of subcommittee. The Assistant Chief...

  8. 20 CFR 632.252 - Allocation of funds.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Allocation of funds. 632.252 Section 632.252 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR INDIAN AND NATIVE AMERICAN EMPLOYMENT AND TRAINING PROGRAMS Summer Youth Employment and Training Programs § 632.252 Allocation of funds...

  9. 48 CFR 252.246-7002 - Warranty of construction (Germany).

    Science.gov (United States)

    2010-10-01

    ... (Germany). 252.246-7002 Section 252.246-7002 Federal Acquisition Regulations System DEFENSE ACQUISITION... of Provisions And Clauses 252.246-7002 Warranty of construction (Germany). As prescribed in 246.710(4), use the following clause: Warranty of Construction (Germany) (JUN 1997) (a) In addition to any other...

  10. 48 CFR 252.229-7002 - Customs exemptions (Germany).

    Science.gov (United States)

    2010-10-01

    ... (Germany). 252.229-7002 Section 252.229-7002 Federal Acquisition Regulations System DEFENSE ACQUISITION... of Provisions And Clauses 252.229-7002 Customs exemptions (Germany). As prescribed in 229.402-70(b), use the following clause: Customs Exemptions (Germany) (JUN 1997) Imported products required for the...

  11. Dicty_cDB: AFI252 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFI252 (Link to dictyBase) - - - Contig-U13401-1 AFI252F (Link... to Original site) AFI252F 545 - - - - - - Show AFI252 Library AF (Link to library) Clone ID AFI252 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13401-1 Original site URL http://dict...ted Amino Acid sequence kxyn*KRFKXKEGSDYINANYIDGAYPKQFICTQGPLPNTIADFWRMVWENRCRIIVMLS RESENCRIKCDRYWPEQIGGEQF...*hprshstipsvxt*yhksxksnhtiir*kcsnhxxlxxxxx x--- Frame B: kxyn*KRFKXKEGSDYINANYIDGAYPKQFICTQGPLPNTIADFWRMVWEN

  12. Graphite moderated {sup 252}Cf source

    Energy Technology Data Exchange (ETDEWEB)

    Sajo B, L.; Barros, H.; Greaves, E. D. [Universidad Simon Bolivar, Nuclear Physics Laboratory, Apdo. 89000, 1080A Caracas (Venezuela, Bolivarian Republic of); Vega C, H. R., E-mail: fermineutron@yahoo.com [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas (Mexico)

    2014-08-15

    The thorium molten salt reactor is an attractive and affordable nuclear power option for developing countries with insufficient infrastructure and limited technological capability. In the aim of personnel training and experience gathering at the Universidad Simon Bolivar there is in progress a project of developing a subcritical thorium liquid fuel reactor. The neutron source to run this subcritical reactor is a {sup 252}Cf source and the reactor will use high-purity graphite as moderator. Using the MCNP5 code the neutron spectra of the {sup 252}Cf in the center of the graphite moderator has been estimated along the channel where the liquid thorium salt will be inserted; also the ambient dose equivalent due to the source has been determined around the moderator. (Author)

  13. 7 CFR 3560.252 - Authorized rental subsidies.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Authorized rental subsidies. 3560.252 Section 3560..., DEPARTMENT OF AGRICULTURE DIRECT MULTI-FAMILY HOUSING LOANS AND GRANTS Rental Subsidies § 3560.252 Authorized rental subsidies. (a) General. The purpose of rental subsidies is to reduce amounts paid by tenants for...

  14. 50 CFR 665.252 - Harvest limitation program.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Harvest limitation program. 665.252... Fisheries § 665.252 Harvest limitation program. (a) General. Harvest guidelines for the Necker Island... permit holders of the reporting method, schedule, and logistics at least 30 days prior to the opening of...

  15. 48 CFR 252.241-7001 - Government access.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Government access. 252.241... Clauses 252.241-7001 Government access. As prescribed in 241.501-70(b), use the following clause: Government Access (DEC 1991) Authorized representatives of the Government may have access to the Contractor's...

  16. 48 CFR 252.237-7011 - Preparation history.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Preparation history. 252... Provisions And Clauses 252.237-7011 Preparation history. As prescribed in 237.7003(b), use the following clause: Preparation History (DEC 1991) For each body prepared, or for each casket handled in a group...

  17. 9 CFR 2.52 - How to obtain tags.

    Science.gov (United States)

    2010-01-01

    ..., at their own expense, official tags from commercial tag manufacturers. 4 At the time the dealer or... list of the commercial manufacturers who produce these tags and are known to the Department may be... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false How to obtain tags. 2.52 Section 2.52...

  18. 48 CFR 252.239-7008 - Reuse arrangements.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Reuse arrangements. 252... Provisions And Clauses 252.239-7008 Reuse arrangements. As prescribed in 239.7411(a), use the following clause: Reuse Arrangements (DEC 1991) (a) When feasible, the Contractor shall reuse canceled or...

  19. 48 CFR 252.237-7007 - Termination for default.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Termination for default. 252.237-7007 Section 252.237-7007 Federal Acquisition Regulations System DEFENSE ACQUISITION..., solicits relatives or friends of the deceased to purchase supplies or services not under this contract...

  20. 48 CFR 252.217-7001 - Surge option.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Surge option. 252.217-7001... Clauses 252.217-7001 Surge option. As prescribed in 217.208-70(b), use the following clause: Surge Option... established by negotiation as provided in this clause. (b) Schedule. (1) When the Production Surge Plan (DI...

  1. 30 CFR 252.6 - Freedom of Information Act requirements.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Freedom of Information Act requirements. 252.6... CONTINENTAL SHELF (OCS) OIL AND GAS INFORMATION PROGRAM § 252.6 Freedom of Information Act requirements. (a... to the limitations of the Freedom of Information Act (5 U.S.C. 552), the regulations contained in 43...

  2. 46 CFR 252.23 - Financial and other reporting requirements.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Financial and other reporting requirements. 252.23... SERVICES Operation § 252.23 Financial and other reporting requirements. (a) Voyage report. The operator... total loss covered by a policy of insurance. (d) Financial statements. The operator shall submit, in...

  3. DWH MC 252: Subsurface Oil Transport

    Science.gov (United States)

    Beegle-Krause, C. J.; Boyer, T.; Murray, D.

    2010-12-01

    Before reaching the ocean surface, the oil and gas released from the DWH MC 252 blowout at 1500 m moves as a buoyant plume until the trapping depth and plume transition point are reached (Zheng et al 2002). At the transition point, the oil droplets and bubbles move independently of each other, and rise at a rate related to their diameter. The oil density, droplet size distribution and currents primarily determine the distribution of the oil between: Large droplets that rise quickly and create a surface expression of the oil. Moderate size droplets that rise over the course of days, and so spread out quite differently than the surface oil, and commonly do not reach the surface in large enough quantities to create a surface sheen. These droplets separate in the currents, particularly in the strong current shear in upper 500 m currents. Very tiny droplets that rise very slowly, over the course or weeks to months, and may be removed by dissolution, biodegradation or marine snow before ever reaching the surface. Modeling and observations (Joint Analysis Group, 2010) confirm the presence of a deep layer of oil and gas between approximately 1100 and 1300 m over the release location and spreading out along the isopycnal surfaces. Later in the event, a small oxygen depression was a proxy for where oil and gas had been. The DWH MC252 well is located at intermediate depth in the Gulf of Mexico (GoM). The water mass is Antarctic Intermediate Water, which enters and exits the GoM through the Yucatan Straits. Surface influences, such as Loop Current Frontal Eddies (e.g. Berger et al 2000) can reach down to these depths, and alter the flow within De Soto Canyon. The water mass containing the deep layer of oil droplets changes depth within the GoM, but does not reach above a depth of about 900 m. There are no physical processes that could cause this deep layer of oil to reach the continental shelf or the Florida Straits. Observed and historical hydrographic data, observations

  4. Ab initio full-potential study of mechanical properties and magnetic phase stability of californium monopnictides (CfN and CfP)

    Energy Technology Data Exchange (ETDEWEB)

    Amari, S., E-mail: siham_amari@yahoo.fr [Faculté des Sciences de la Nature et de la Vie, Université Hassiba Benbouali, Chlef, 02000 (Algeria); Bouhafs, B. [Laboratoire de Modélisation et Simulation en Sciences des Matériaux, Université Djillali Liabès de Sidi Bel-Abbés, Sidi Bel-Abbés, 22000 (Algeria)

    2016-09-15

    Based on the first-principles methods, the structural, elastic, electronic, properties and magnetic ordering of californium monopnictides CfX (X = P) have been studied using the full-potential augmented plane wave plus local orbitals (FP-L/APW + lo) method within the framework of density functional theory (DFT). The electronic exchange correlation energy is described by generalized gradient approximation GGA and GGA+U (U is the Hubbard correction). The GGA+U method is applied to the rare-earth 5f states. We have calculated the lattice parameters, bulk modulii and the first pressure derivatives of the bulk modulii. The elastic properties of the studied compounds are only investigated in the most stable calculated phase. In order to gain further information, we have calculated Young’s modulus, shear modulus, anisotropy factor and Kleinman parameter by the aid of the calculated elastic constants. The results mainly show that californium monopnictides CfX (X = P) have an antiferromagnetic spin ordering. Density of states (DOS) and charge densities for both compounds are also computed in the NaCl (B1) structure.

  5. 46 CFR 252.30 - Amount of subsidy payable.

    Science.gov (United States)

    2010-10-01

    ... OPERATORS OPERATING-DIFFERENTIAL SUBSIDY FOR BULK CARGO VESSELS ENGAGED IN WORLDWIDE SERVICES Calculation of..., as described separately in § 252.32. The daily ODS rate represents the cost differential between the...

  6. Ternary-fragmentation-driving potential energies of 252Cf

    Science.gov (United States)

    Karthikraj, C.; Ren, Zhongzhou

    2017-12-01

    Within the framework of a simple macroscopic model, the ternary-fragmentation-driving potential energies of 252Cf are studied. In this work, all possible ternary-fragment combinations of 252Cf are generated by the use of atomic mass evaluation-2016 (AME2016) data and these combinations are minimized by using a two-dimensional minimization approach. This minimization process can be done in two ways: (i) with respect to proton numbers (Z1, Z2, Z3) and (ii) with respect to neutron numbers (N1, N2, N3) of the ternary fragments. In this paper, the driving potential energies for the ternary breakup of 252Cf are presented for both the spherical and deformed as well as the proton-minimized and neutron-minimized ternary fragments. From the proton-minimized spherical ternary fragments, we have obtained different possible ternary configurations with a minimum driving potential, in particular, the experimental expectation of Sn + Ni + Ca ternary fragmentation. However, the neutron-minimized ternary fragments exhibit a driving potential minimum in the true-ternary-fission (TTF) region as well. Further, the Q -value energy systematics of the neutron-minimized ternary fragments show larger values for the TTF fragments. From this, we have concluded that the TTF region fragments with the least driving potential and high Q values have a strong possibility in the ternary fragmentation of 252Cf. Further, the role of ground-state deformations (β2, β3, β4, and β6) in the ternary breakup of 252Cf is also studied. The deformed ternary fragmentation, which involves Z3=12 -19 fragments, possesses the driving potential minimum due to the larger oblate deformations. We also found that the ground-state deformations, particularly β2, strongly influence the driving potential energies and play a major role in determining the most probable fragment combinations in the ternary breakup of 252Cf.

  7. EMISSION OF PHOTONS IN SPONTANEOUS FISSION OF CF-252

    NARCIS (Netherlands)

    VANDERPLOEG, H; BACELAR, JCS; BUDA, A; LAURENS, CR; VANDERWOUDE, A; GAARDHOJE, JJ; ZELAZNY, Z; VANTHOF, G; KALANTARNAYESTANAKI, N

    1995-01-01

    High energy photon emission accompanying the spontaneous fission of Cf-252 is measured for different mass splits. The photon yields up to an energy of 20 MeV are obtained at several angles relative to the fission direction. Statistical model calculations are used to interpret the data. The photon

  8. 48 CFR 252.234-7002 - Earned Value Management System.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Earned Value Management... of Provisions And Clauses 252.234-7002 Earned Value Management System. As prescribed in 234.203(2), use the following clause: Earned Value Management System (APR 2008) (a) In the performance of this...

  9. 30 CFR 252.4 - Summary Report to affected States.

    Science.gov (United States)

    2010-07-01

    ... CONTINENTAL SHELF (OCS) OIL AND GAS INFORMATION PROGRAM § 252.4 Summary Report to affected States. (a) The Director, as soon as practicable after analysis, interpretation, and compilation of oil and gas data and... the onshore impacts of potential OCS oil and gas development and production. The Director shall...

  10. 48 CFR 252.225-7041 - Correspondence in English.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Correspondence in English... of Provisions And Clauses 252.225-7041 Correspondence in English. As prescribed in 225.1103(2), use the following clause: Correspondence in English (JUN 1997) The Contractor shall ensure that all...

  11. 48 CFR 252.229-7003 - Tax Exemptions (Italy).

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Tax Exemptions (Italy... of Provisions And Clauses 252.229-7003 Tax Exemptions (Italy). As prescribed in 229.402-70(c), use the following clause: Tax Exemptions (Italy) (JAN 2002) (a) The Contractor represents that the...

  12. Phenotype abnormality: 252 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available lant flowering stage in environment of short day length regimen in environment of short day length regimen h... 252 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u758i delayed whole p

  13. 48 CFR 252.229-7005 - Tax exemptions (Spain).

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Tax exemptions (Spain... of Provisions And Clauses 252.229-7005 Tax exemptions (Spain). As prescribed in 229.402-70(e), use the following clause: Tax Exemptions (Spain) (JUN 1997) (a) The Contractor represents that the...

  14. 252.pdf | aug102001 | currsci | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; currsci; aug102001; 252.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube · Twitter · Facebook · Blog. Academy News. IAS Logo. Live streaming of the Symposium on Dialogue: Science, Scientists, and Society starts at 2:00 pm IST on ...

  15. 48 CFR 252.225-7031 - Secondary Arab boycott of Israel.

    Science.gov (United States)

    2010-10-01

    ... Israel. 252.225-7031 Section 252.225-7031 Federal Acquisition Regulations System DEFENSE ACQUISITION... of Provisions And Clauses 252.225-7031 Secondary Arab boycott of Israel. As prescribed in 225.7605, use the following provision: Secondary Arab Boycott of Israel (JUN 2005) (a) Definitions. As used in...

  16. 48 CFR 252.222-7005 - Prohibition on use of nonimmigrant aliens-Guam.

    Science.gov (United States)

    2010-10-01

    ... nonimmigrant aliens-Guam. 252.222-7005 Section 252.222-7005 Federal Acquisition Regulations System DEFENSE... CLAUSES Text of Provisions And Clauses 252.222-7005 Prohibition on use of nonimmigrant aliens—Guam. As prescribed in 222.7302, use the following clause: Prohibition on Use of Nonimmigrant Aliens—Guam (SEP 1999...

  17. 48 CFR 252.216-7001 - Economic price adjustment-nonstandard steel items.

    Science.gov (United States)

    2010-10-01

    ...-nonstandard steel items. 252.216-7001 Section 252.216-7001 Federal Acquisition Regulations System DEFENSE... CLAUSES Text of Provisions And Clauses 252.216-7001 Economic price adjustment—nonstandard steel items. As prescribed in 216.203-4-70(b), use the following clause: Economic Price Adjustment—Nonstandard Steel Items...

  18. 44 CFR 206.252 - Insurance requirements for facilities damaged by flood.

    Science.gov (United States)

    2010-10-01

    ... facilities damaged by flood. 206.252 Section 206.252 Emergency Management and Assistance FEDERAL EMERGENCY... Assistance Insurance Requirements § 206.252 Insurance requirements for facilities damaged by flood. (a) Where an insurable building damaged by flooding is located in a special flood hazard area identified for...

  19. 48 CFR 252.222-7004 - Compliance with Spanish social security laws and regulations.

    Science.gov (United States)

    2010-10-01

    ... Condition of the Enterprise) from the Ministerio de Trabajo y S.S., Tesoreria General de la Seguridad Social... social security laws and regulations. 252.222-7004 Section 252.222-7004 Federal Acquisition Regulations... PROVISIONS AND CONTRACT CLAUSES Text of Provisions And Clauses 252.222-7004 Compliance with Spanish social...

  20. 37 CFR 2.52 - Types of drawings and format for drawings.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Types of drawings and format for drawings. 2.52 Section 2.52 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES Drawing § 2.52 Types of drawings and...

  1. 33 CFR 148.252 - What is the procedure for serving a subpoena?

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false What is the procedure for serving a subpoena? 148.252 Section 148.252 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... Hearings § 148.252 What is the procedure for serving a subpoena? (a) A party may submit a request for a...

  2. 252 Relation entre fracturation et morphologie et leurs implications ...

    African Journals Online (AJOL)

    pc

    252. ISSN 1813-548X, http://www.afriquescience.info. Chamekh KHEMISSI et al. Relation entre fracturation et morphologie et leurs implications hydrogéologiques : Exemple des calcaires fissurés de la région de Chéria, (NE Algérien). Chamekh KHEMISSI1, Kerboub DJAWHAR2* et Baali FATHI2. 1Université de Batna.

  3. Neutron shielding for a {sup 252} Cf source

    Energy Technology Data Exchange (ETDEWEB)

    Vega C, H.R.; Manzanares A, E.; Hernandez D, V.M. [Unidades Academicas de Estudios Nucleares e Ingenieria Electrica, Universidad Autonoma de Zacatecas, C. Cipres 10, Fracc. La Penuela, 98068 Zacatecas (Mexico); Eduardo Gallego, Alfredo Lorente [Depto. de Ingenieria Nuclear, ETS Ingenieros Industriales, Universidad Politecnica de Madrid, C. Jose Gutierrez Abascal 2, 28006 Madrid (Spain)]. e-mail: fermineutron@yahoo.com

    2006-07-01

    To determine the neutron shielding features of water-extended polyester a Monte Carlo study was carried out. Materials with low atomic number are predominantly used for neutron shielding because these materials effectively attenuate neutrons, mainly through inelastic collisions and absorption reactions. During the selection of materials to design a neutron shield, prompt gamma production as well as radionuclide production induced by neutron activation must be considered. In this investigation the Monte Carlo method was used to evaluate the performance of a water-extended polyester shield designed for the transportation, storage, and use of a {sup 252}Cf isotopic neutron source. During calculations a detailed model for the {sup 252}Cf and the shield was utilized. To compare the shielding features of water extended polyester, the calculations were also made for the bare {sup 252}Cf in vacuum, air and the shield filled with water. For all cases the calculated neutron spectra was utilized to determine the ambient equivalent neutron dose at four sites around the shielding. In the case of water extended polyester and water shielding the calculations were extended to include the prompt gamma rays produced during neutron interactions, with this information the Kerma in air was calculated at the same locations where the ambient equivalent neutron dose was determined. (Author)

  4. Position-sensitive spectroscopy of {sup 252}Cf fission fragments

    Energy Technology Data Exchange (ETDEWEB)

    Granja, C. [Institute of Experimental and Applied Physics, Czech Technical University, 128 00 Prague 2 (Czech Republic)]. E-mail: carlos.granja@utef.cvut.cz; Vykydal, Z. [Institute of Experimental and Applied Physics, Czech Technical University, 128 00 Prague 2 (Czech Republic); Kopatch, Y. [Joint Institute for Nuclear Research, 141 980 Dubna (Russian Federation); Jakubek, J. [Institute of Experimental and Applied Physics, Czech Technical University, 128 00 Prague 2 (Czech Republic); Pospisil, S. [Institute of Experimental and Applied Physics, Czech Technical University, 128 00 Prague 2 (Czech Republic); Telezhnikov, S.A. [Joint Institute for Nuclear Research, 141 980 Dubna (Russian Federation)

    2007-05-11

    The fission fragments from spontaneous fission of {sup 252}Cf have been measured with the spectrometric and position-sensitive semiconductor pixel detector Medipix2. Fragments are identified by pattern recognition of clusters generated in the Medipix2 pixel matrix sensor upon heavy particle hit. From analysis of cluster area, the distribution of kinetic energy of fission fragments is obtained. Together with a novel USB readout interface, the Medipix2/USB system operates as active nuclear emulsion in single-quantum and on-line tracking mode.

  5. 48 CFR 252.225-7026 - Acquisition Restricted to Products or Services from Iraq or Afghanistan.

    Science.gov (United States)

    2010-10-01

    ... Products or Services from Iraq or Afghanistan. 252.225-7026 Section 252.225-7026 Federal Acquisition... to Products or Services from Iraq or Afghanistan. As prescribed in 225.7703-5(c), use the following clause: Acquisition Restricted to Products or Services From Iraq or Afghanistan (APR 2010) (a...

  6. 48 CFR 252.225-7023 - Preference for products or services from Iraq or Afghanistan.

    Science.gov (United States)

    2010-10-01

    ... services from Iraq or Afghanistan. 252.225-7023 Section 252.225-7023 Federal Acquisition Regulations System... from Iraq or Afghanistan. As prescribed in 225.7703-5(a), use the following provision: Requirement for Products or Services from Iraq or Afghanistan (APR 2010) (a) Definitions. Product from Iraq or Afghanistan...

  7. 48 CFR 252.225-7024 - Requirement for products or services from Iraq or Afghanistan.

    Science.gov (United States)

    2010-10-01

    ... or services from Iraq or Afghanistan. 252.225-7024 Section 252.225-7024 Federal Acquisition... products or services from Iraq or Afghanistan. As prescribed in 225.7703-5(b), use the following clause: Requirement for Products or Services From Iraq or Afghanistan (SEP 2008) (a) Definitions. As used in this...

  8. 48 CFR 252.245-7000 - Government-furnished mapping, charting, and geodesy property.

    Science.gov (United States)

    2010-10-01

    ... mapping, charting, and geodesy property. 252.245-7000 Section 252.245-7000 Federal Acquisition Regulations..., charting, and geodesy property. As prescribed in 245.107-70, use the following clause: Government-Furnished Mapping, Charting, and Geodesy Property (DEC 1991) (a) Definition—Mapping, charting, and geodesy (MC&G...

  9. 38 CFR 3.252 - Annual income; pension; Mexican border period and later war periods.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Annual income; pension; Mexican border period and later war periods. 3.252 Section 3.252 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS ADJUDICATION Pension, Compensation, and Dependency and Indemnity Compensation...

  10. 48 CFR 252.222-7006 - Restrictions on the Use of Mandatory Arbitration Agreements.

    Science.gov (United States)

    2010-10-01

    ... Mandatory Arbitration Agreements. 252.222-7006 Section 252.222-7006 Federal Acquisition Regulations System... Arbitration Agreements. As prescribed in 222.7404, use the following clause: Restrictions on the Use of Mandatory Arbitration Agreements (MAY 2010) (a) Definitions. As used in this clause— Covered subcontractor...

  11. 48 CFR 53.236-2 - Architect-engineer services (SF's 252 and 330).

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Architect-engineer... ACQUISITION REGULATION (CONTINUED) CLAUSES AND FORMS FORMS Prescription of Forms 53.236-2 Architect-engineer...-engineer and related services: (a) SF 252 (Rev. 10/83), Architect-Engineer Contract. SF 252 is prescribed...

  12. 48 CFR 252.225-7030 - Restriction on Acquisition of Carbon, Alloy, and Armor Steel Plate.

    Science.gov (United States)

    2010-10-01

    ... of Carbon, Alloy, and Armor Steel Plate. 252.225-7030 Section 252.225-7030 Federal Acquisition... Acquisition of Carbon, Alloy, and Armor Steel Plate. As prescribed in 225.7011-3, use the following clause: Restriction on Acquisition of Carbon, Alloy, and Armor Steel Plate (DEC 2006) (a) Carbon, alloy, and armor...

  13. 48 CFR 252.225-7019 - Restriction on acquisition of anchor and mooring chain.

    Science.gov (United States)

    2010-10-01

    ... of anchor and mooring chain. 252.225-7019 Section 252.225-7019 Federal Acquisition Regulations System... and mooring chain. As prescribed in 225.7007-3, use the following clause: Restriction on Acquisition of Anchor and Mooring Chain (DEC 2009)) (a) Definition. “Component,” as used in this clause, means an...

  14. 8 CFR 252.5 - Special procedures for deserters from Spanish or Greek ships of war.

    Science.gov (United States)

    2010-01-01

    ... Spanish or Greek ships of war. 252.5 Section 252.5 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY... Greek ships of war. (a) General. Under E.O. 11267 of January 19, 1966 (31 FR 807) and 28 CFR 0.109, and... application of a Consul General, Consul, Vice-Consul, or Consular-Agent of the Spanish or Greek Government...

  15. 48 CFR 252.227-7014 - Rights in noncommercial computer software and noncommercial computer software documentation.

    Science.gov (United States)

    2010-10-01

    ... documentation. (d) Third party copyrighted computer software or computer software documentation. The Contractor... Government under any patent. (j) Limitation on charges for rights in computer software or computer software... computer software and noncommercial computer software documentation. 252.227-7014 Section 252.227-7014...

  16. 48 CFR 252.203-7002 - Requirement to Inform Employees of Whistleblower Rights.

    Science.gov (United States)

    2010-10-01

    ... Employees of Whistleblower Rights. 252.203-7002 Section 252.203-7002 Federal Acquisition Regulations System... Whistleblower Rights. As prescribed in 203.970, use the following clause: Requirement To Inform Employees of Whistleblower Rights (JAN 2009) The Contractor shall inform its employees in writing of employee whistleblower...

  17. 48 CFR 252.225-7044 - Balance of Payments Program-Construction Material.

    Science.gov (United States)

    2010-10-01

    ... Program-Construction Material. 252.225-7044 Section 252.225-7044 Federal Acquisition Regulations System...—Construction Material. As prescribed in 225.7503(a), use the following clause: Balance of Payments Program—Construction Material (JAN 2009) (a) Definitions. As used in this clause— Commercially available off-the-shelf...

  18. Design, Construction, and Modeling of a 252Cf Neutron Irradiator

    Directory of Open Access Journals (Sweden)

    Blake C. Anderson

    2016-01-01

    Full Text Available Neutron production methods are an integral part of research and analysis for an array of applications. This paper examines methods of neutron production, and the advantages of constructing a radioisotopic neutron irradiator assembly using 252Cf. Characteristic neutron behavior and cost-benefit comparative analysis between alternative modes of neutron production are also examined. The irradiator is described from initial conception to the finished design. MCNP modeling shows a total neutron flux of 3 × 105 n/(cm2·s in the irradiation chamber for a 25 μg source. Measurements of the gamma-ray and neutron dose rates near the external surface of the irradiator assembly are 120 μGy/h and 30 μSv/h, respectively, during irradiation. At completion of the project, total material, and labor costs remained below $50,000.

  19. 48 CFR 252.212-7001 - Contract terms and conditions required to implement statutes or Executive orders applicable to...

    Science.gov (United States)

    2010-10-01

    ...) Alternate I (SEP 2008). (12) __252.225-7027, Restriction on Contingent Fees for Foreign Military Sales (APR 2003) (22 U.S.C. 2779). (13) __252.225-7028, Exclusionary Policies and Practices of Foreign Governments.... 2534(a)(3)). (16) __252.226-7001, Utilization of Indian Organizations, Indian-Owned Economic...

  20. Aspects of charge distribution measurement for 252Cf(sf)

    Science.gov (United States)

    Wang, Taofeng; Li, Guangwu; Zhu, Liping; Hen, Or; Zhang, Gaolong; Meng, Qinghua; Wang, Liming; Han, Hongyin; Xia, Haihong

    2017-09-01

    Measurements of charge distributions of fragments in the spontaneous fission of 252Cf have been performed using a unique detector setup consisting of a typical grid-ionization chamber coupled with a Δ E -E charged particle telescope. We find that the fragment mass dependency of the kinetic-energy-averaged width of the charge distribution shows a systematically decreasing trend with obvious fluctuations. The variation of the widths of the charge distribution with kinetic energy shows a pan-like shape. This is due to the large number of neutrons emitted at the high excitation energies and cold fragmentation at the low excitation energies. Deviation of the kinetic-energy-averaged most probable charge Zp from the unchanged charge distribution (UCD), Δ Z , as a function of the mass number of primary fragments, A*, changes from negative for mass asymmetric fission to positive near the symmetric fissions. Concerning the kinetic energy dependence of Zp given primary mass number A*, obvious increasing tendencies of Zp with increasing kinetic energy are observed.

  1. Charge distribution in the ternary fragmentation of {sup 252}Cf

    Energy Technology Data Exchange (ETDEWEB)

    Senthil Kannan, M.T.; Balasubramaniam, M. [Bharathiar University, Department of Physics, Coimbatore (India)

    2017-08-15

    We present here, for the first time, a study on ternary fragmentation charge distribution of {sup 252}Cf using the convolution integral method and the statistical theory. The charge distribution for all possible charge combinations of a ternary breakup are grouped as a bin containing different mass partitions. Different bins corresponding to various third fragments with mass numbers from A{sub 3} = 16 to 84 are identified with the available experimental masses. The corresponding potential energy surfaces are calculated using the three cluster model for the two arrangements A{sub 1} + A{sub 2} + A{sub 3} and A{sub 1} + A{sub 3} + A{sub 2}. The ternary fragmentation yield values are calculated for the ternary combination from each bin possessing minimum potential energy. The yields of the resulting ternary combinations as a function of the charge numbers of the three fragments are analyzed for both the arrangements. The calculations are carried out at different excitation energies of the parent nucleus. For each excitation energy the temperature of the three fragments are iteratively computed conserving the total energy. The distribution of fragment temperatures corresponding to different excitation energies for some fixed third fragments are discussed. The presence of the closed shell nucleus Sn in the favourable ternary fragmentation is highlighted. (orig.)

  2. Neutron Spectra, Fluence and Dose Rates from Bare and Moderated Cf-252 Sources

    Energy Technology Data Exchange (ETDEWEB)

    Radev, Radoslav P. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2016-04-01

    A new, stronger 252Cf source (serial number SR-CF-3050-OR) was obtained from Oak Ridge National Laboratory (ORNL) in 2014 to supplement the existing 252Cf sources which had significantly decayed. A new instrument positioning track system was designed and installed by Hopewell Designs, Inc. in 2011. The neutron field from the new, stronger 252Cf source in the modified calibration environment needed to be characterized as well as the modified neutron fields produced by the new source and seven different neutron moderators. Comprehensive information about our 252Cf source, its origin, production, and isotopic content and decay characteristics needed to be compiled as well. This technical report is intended to address these issues.

  3. Functional design criteria for project W-252, phase II liquid effluent treatment and disposal. Revision 2

    Energy Technology Data Exchange (ETDEWEB)

    Hatch, C.E.

    1995-05-01

    This document is the Functional Design Criteria for Project W-252. Project W-252 provides the scope to provide BAT/AKART (best available technology...) to 200 Liquid Effluent Phase II streams (B-Plant). This revision (Rev. 2) incorporates a major descoping of the project. The descoping was done to reflect a combination of budget cutting measures allowed by a less stringent regulatory posture toward the Phase II streams

  4. Enhancement of a 252Cf-based neutron beam via subcritical multiplication for neutron capture therapy.

    Science.gov (United States)

    Wang, C K; Zino, J F; Kessler, G

    2000-01-01

    Previous studies indicated that an epithermal-neutron beam based on bare 252Cf is not feasible for neutron capture therapy (NCT). It was reported that a clinically useful epithermal-neutron beam requires a minimum of 1.0 g of 252Cf, which is more than twice the US current annual supply. However, it was reasoned that the required quantity of 252Cf could be dramatically reduced when used with a subcritical multiplying assembly (SMA). This reasoning is based on the assumption that the epithermal-neutron beam intensity for NCT is directly proportional to the fission neutron population, and that the neutron multiplying factor of the SMA can be estimated by 1/(1 - k(eff)). We have performed detailed Monte Carlo calculations to investigate the validity of the above reasoning. Our results show that 1/(1 - k(eff)) grossly overestimates the beam enhancement factor for NCT. For example, Monte Carlo calculations predict a beam enhancement factor of 6.0 for an optimized SMA geometry with k(eff) = 0.968. This factor is much less than 31 predicted by 1/(1 - k(eff)). The overestimation is due to the fact that most of the neutrons produced in the SMA are self-shielded, whereas self-shielding is negligible in a bare 252Cf source. Since the beam intensity of a 0.1 g 252Cf with the optimized SMA enhancement is still more than an order of magnitude too low compared to the existing reactor beams, we conclude that the enhancement via an SMA for a 252Cf-based epithermal-neutron beam is inadequate for NCT.

  5. [sup 252]Cf: neutron multiplicities in correlation with fission-fragment mass and energy

    Energy Technology Data Exchange (ETDEWEB)

    Van Aarle, J. (Philipps-Universitaet Marburg, F.B. 14-Kernchemie, D-35032 Marburg (Germany)); Westmeier, W. (Philipps-Universitaet Marburg, F.B. 14-Kernchemie, D-35032 Marburg (Germany)); Esterlund, R.A. (Philipps-Universitaet Marburg, F.B. 14-Kernchemie, D-35032 Marburg (Germany)); Patzelt, P. (Philipps-Universitaet Marburg, F.B. 14-Kernchemie, D-35032 Marburg (Germany))

    1994-10-03

    The number of neutrons emitted in the spontaneous fission of [sup 252]Cf has been measured, using a large Gd-doped liquid scintillator tank. A total of 1.7x10[sup 7] [sup 252]Cf fission events were assayed, and the correlations between the number of neutrons emitted by the fission fragments and the total kinetic energy (TKE) released in a particular fission event were investigated. From these correlations, spontaneous-fission parameters were derived and compared to exit-channel predictions given by the multi-modal random neck-rupture model of Brosa and co-workers. ((orig.))

  6. Design of a setup for {sup 252}Cf neutron source for storage and analysis purpose

    Energy Technology Data Exchange (ETDEWEB)

    Hei, Daqian [Department of Nuclear Science and Engineering, College of Materials Science and Engineering, Nanjing University of Aeronautics and Astronautics, Nanjing 211106 (China); Zhuang, Haocheng [Xi’an Middle School of Shanxi Province, Xi’an 710000 (China); Jia, Wenbao, E-mail: jiawenbao@163.com [Department of Nuclear Science and Engineering, College of Materials Science and Engineering, Nanjing University of Aeronautics and Astronautics, Nanjing 211106 (China); Collaborative Innovation Center of Radiation Medicine of Jiangsu Higher Education Institutions, Suzhou 215000 (China); Cheng, Can; Jiang, Zhou; Wang, Hongtao [Department of Nuclear Science and Engineering, College of Materials Science and Engineering, Nanjing University of Aeronautics and Astronautics, Nanjing 211106 (China); Chen, Da [Department of Nuclear Science and Engineering, College of Materials Science and Engineering, Nanjing University of Aeronautics and Astronautics, Nanjing 211106 (China); Collaborative Innovation Center of Radiation Medicine of Jiangsu Higher Education Institutions, Suzhou 215000 (China)

    2016-11-01

    {sup 252}Cf is a reliable isotopic neutron source and widely used in the prompt gamma ray neutron activation analysis (PGNAA) technique. A cylindrical barrel made by polymethyl methacrylate contained with the boric acid solution was designed for storage and application of a 5 μg {sup 252}Cf neutron source. The size of the setup was optimized with Monte Carlo code. The experiments were performed and the results showed the doses were reduced with the setup and less than the allowable limit. The intensity and collimating radius of the neutron beam could also be adjusted through different collimator.

  7. 75 FR 32273 - Safety Zone; DEEPWATER HORIZON at Mississippi Canyon 252 Outer Continental Shelf MODU in the Gulf...

    Science.gov (United States)

    2010-06-08

    ... SECURITY Coast Guard 33 CFR Part 147 RIN 1625-AA00 Safety Zone; DEEPWATER HORIZON at Mississippi Canyon 252... DEEPWATER HORIZON, a Mobile Offshore Drilling Unit (MODU), at Mississippi Canyon 252 in the Outer... impacted by the oil spill. Basis and Purpose The Coast Guard is establishing a safety zone in the deepwater...

  8. 48 CFR 252.239-7012 - Title to telecommunication facilities and equipment.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Title to telecommunication... CLAUSES Text of Provisions And Clauses 252.239-7012 Title to telecommunication facilities and equipment. As prescribed in 239.7411(b), use the following clause: Title to Telecommunication Facilities and...

  9. 48 CFR 252.239-7016 - Telecommunications security equipment, devices, techniques, and services.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Telecommunications... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions And Clauses 252.239-7016 Telecommunications... clause: Telecommunications Security Equipment, Devices, Techniques, and Services (DEC 1991) (a...

  10. Changes of mandibular incisor in Fgfr2 S252W mutant mice

    Directory of Open Access Journals (Sweden)

    Xia ZHOU

    2013-11-01

    Full Text Available Objective To compare the phenotypic differences of mandibular incisor between the wild-type mice and fibroblast growth factor receptor 2 (Fgfr2 gene S252W mutant mice, and explore the influence of gain-of-function mutation in Fgfr2 gene on mandibular incisors in mice. Methods The male EⅡa-Cre mice were mated with Fgfr2S252W-neo/+ females to obtain the Fgfr2 S252W mutant mice. On the 56th day after offspring's birth (P56, samples were taken for Micro-CT, HE staining and calcein double fluorescent labeling to observe the gross appearance, tissue morphology and mineral apposition rate of mandibular incisors, respectively. Results The newborn mutant mice showed short cranial deformity, which became more obvious on P56. Micro-CT showed a significant elongation and cross-bite deformity of mandibular incisors. HE staining showed that there were more ameloblasts and odontoblasts in the mutant mice, mostly with irregular appearance; epithelial diaphragm composed of inner and outer enamel epithelium shrank. Calcein double fluorescent labeling showed that the mineral apposition rate of dentin in mutant mice was significantly higher than that in controls. Conclusion Fgfr2 S252W mutation accelerates the growth of mandibular incisors in mice, resulting in the elongation and cross-bite deformity of mandibular incisors. DOI: 10.11855/j.issn.0577-7402.2013.10.005

  11. 31 CFR 363.252 - May Public Debt amend or supplement these regulations?

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false May Public Debt amend or supplement... Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY BUREAU OF THE PUBLIC DEBT REGULATIONS GOVERNING SECURITIES HELD IN TREASURYDIRECT Subpart H Miscellaneous § 363.252 May Public Debt amend or...

  12. 48 CFR 252.228-7006 - Compliance with Spanish laws and insurance.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Compliance with Spanish... CLAUSES Text of Provisions And Clauses 252.228-7006 Compliance with Spanish laws and insurance. As prescribed at 228.370(e), use the following clause: Compliance with Spanish Laws and Insurance (DEC 1998) (a...

  13. 48 CFR 252.237-7019 - Training for Contractor Personnel Interacting with Detainees.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Training for Contractor... PROVISIONS AND CONTRACT CLAUSES Text of Provisions And Clauses 252.237-7019 Training for Contractor Personnel Interacting with Detainees. As prescribed in 237.171-4, use the following clause: Training for Contractor...

  14. 48 CFR 252.242-7004 - Material management and accounting system.

    Science.gov (United States)

    2010-10-01

    ... CLAUSES Text of Provisions And Clauses 252.242-7004 Material management and accounting system. As prescribed in 242.7204, use the following caluse: Material Management and Accounting System (JUL 2009) (a) Definitions. As used in this clause— (1) Material management and accounting system (MMAS) means the Contractor...

  15. 48 CFR 252.227-7039 - Patents-reporting of subject inventions.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Patents-reporting of... CLAUSES Text of Provisions And Clauses 252.227-7039 Patents—reporting of subject inventions. As prescribed in 227.303(1), use the following clause: Patents—Reporting of Subject Inventions (APR 1990) The...

  16. 48 CFR 252.227-7012 - Patent license and release contract.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Patent license and release... of Provisions And Clauses 252.227-7012 Patent license and release contract. As prescribed at 227.7012, insert the following clause in patent releases, license agreements, and assignments: (Contract No...

  17. 48 CFR 252.219-7004 - Small business subcontracting plan (test program).

    Science.gov (United States)

    2010-10-01

    ... AND CONTRACT CLAUSES Text of Provisions And Clauses 252.219-7004 Small business subcontracting plan... contract or subcontract. (b) The Offeror's comprehensive small business subcontracting plan and its... “Utilization of Small Business Concerns,” or (2) an approved plan required by this clause, shall be a material...

  18. 48 CFR 252.219-7003 - Small business subcontracting plan (DoD contracts).

    Science.gov (United States)

    2010-10-01

    ... AND CONTRACT CLAUSES Text of Provisions And Clauses 252.219-7003 Small business subcontracting plan...-9, Small Business Subcontracting Plan, clause of this contract. (a) Definitions. Historically black... division-wide commercial items subcontracting plans, the term small disadvantaged business, when used in...

  19. 48 CFR 252.225-7010 - Commercial Derivative Military Article-Specialty Metals Compliance Certificate.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Commercial Derivative... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions And Clauses 252.225-7010 Commercial Derivative... provision: Commercial Derivative Military Article—Specialty Metals Compliance Certificate (JUL 2009) (a...

  20. 48 CFR 252.235-7011 - Final scientific or technical report.

    Science.gov (United States)

    2010-10-01

    ... CLAUSES Text of Provisions And Clauses 252.235-7011 Final scientific or technical report. As prescribed in 235.072(d), use the following clause: Final Scientific or Technical Report (NOV 2004) The Contractor shall— (a) Submit two copies of the approved scientific or technical report delivered under this...

  1. 48 CFR 252.227-7007 - License term-running royalty.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false License term-running... of Provisions And Clauses 252.227-7007 License term—running royalty. As prescribed at 227.7009-4(b), insert the following clause in patent releases, license agreements, and assignments: License Term—Running...

  2. 48 CFR 252.227-7006 - License grant-running royalty.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false License grant-running... of Provisions And Clauses 252.227-7006 License grant—running royalty. As prescribed at 227.7009-4(a...—Running Royalty (AUG 1984) (a) The Contractor hereby grants to the Government, as represented by the...

  3. 48 CFR 252.227-7016 - Rights in bid or proposal information.

    Science.gov (United States)

    2010-10-01

    ... with respect to technical data or computer software contained in the Contractor's bid or proposal that... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Rights in bid or proposal... of Provisions And Clauses 252.227-7016 Rights in bid or proposal information. As prescribed in 227...

  4. The Implications of the Excited Rotation of Comet 252P/2000 G1 (LINEAR)

    Science.gov (United States)

    Li, Jian-Yang; Samarasinha, Nalin H.; Kelley, Michael S. P.; Farnocchia, Davide; Mutchler, Max J.; Ren, Yanqiong; Lu, Xiaoping; Tholen, David J.; Lister, Tim; Micheli, Marco

    2018-01-01

    Jupiter Family comet (JFC) 252P/LINEAR had a close encounter to Earth on 2016 March 21. We imaged the comet with the Hubble Space Telescope Wide Field Camera 3 UVIS channel through the V- and r’-band filters spanning ~8 hours on 2016 April 4. The pixel scale of 2.7 km/pixel allowed us to study the structure of the cometary coma at scales of a few kilometers to a few hundred kilometers from the nucleus, a characteristic that is unique to our data. The dust coma of 252P showed a strong, well defined, narrow and nearly linear feature in the sunward direction, and its projected position angle moved about the nucleus for ~60 deg in 8 hours, consistent with an apparent periodicity of ~7.24 hours. On the other hand, the lightcurve measured in both V- and r’-band images from a 13 km radius aperture, after corrected for color term, showed a variability of >0.14 mag that is consistent with an apparent periodicity of ~5.4 hours or its multiples. We suggest that the two different periodicities derived from coma morphology and the lightcurve is a strong indication that the nucleus of 252P is in a non-principal axis (NPA) rotation, joining two other confirmed NPA rotators (1P/Halley and 103P/Hartley 2) and comets that are potentially in NPA rotational states (e.g., 2P/Encke). However, this apparition has been unusual for 252P. In the past three perihelion passages since discovery, the comet was very weakly active compared to other JFCs. Meteor evidence also exists that it probably has been very weakly active for a few hundred years. But in our data, we saw a very active comet in this 2016 apparition with an active fraction of 40% to >100%, representing an increase of 100x with respect to its recent past. Based on our observations, 252P has a small nucleus with a radius of ~0.3 km, which suggests that its rotational state could be relatively easily changed by torques caused by outgassing. Since the very weak outgassing in the past is not likely to change the rotational state

  5. Therapeutic effect of nanogel-based delivery of soluble FGFR2 with S252W mutation on craniosynostosis.

    Directory of Open Access Journals (Sweden)

    Masako Yokota

    Full Text Available Apert syndrome is an autosomal dominantly inherited disorder caused by missense mutations in fibroblast growth factor receptor 2 (FGFR2. Surgical procedures are frequently required to reduce morphological and functional defects in patients with Apert syndrome; therefore, the development of noninvasive procedures to treat Apert syndrome is critical. Here we aimed to clarify the etiological mechanisms of craniosynostosis in mouse models of Apert syndrome and verify the effects of purified soluble FGFR2 harboring the S252W mutation (sFGFR2IIIcS252W on calvarial sutures in Apert syndrome mice in vitro. We observed increased expression of Fgf10, Esrp1, and Fgfr2IIIb, which are indispensable for epidermal development, in coronal sutures in Apert syndrome mice. Purified sFGFR2IIIcS252W exhibited binding affinity for fibroblast growth factor (Fgf 2 but also formed heterodimers with FGFR2IIIc, FGFR2IIIcS252W, and FGFR2IIIbS252W. Administration of sFGFR2IIIcS252W also inhibited Fgf2-dependent proliferation, phosphorylation of intracellular signaling molecules, and mineralization of FGFR2S252W-overexpressing MC3T3-E1 osteoblasts. sFGFR2IIIcS252W complexed with nanogels maintained the patency of coronal sutures, whereas synostosis was observed where the nanogel without sFGFR2S252W was applied. Thus, based on our current data, we suggest that increased Fgf10 and Fgfr2IIIb expression may induce the onset of craniosynostosis in patients with Apert syndrome and that the appropriate delivery of purified sFGFR2IIIcS252W could be effective for treating this disorder.

  6. Bacterial community shift in the coastal Gulf of Mexico salt-marsh sediment microcosm in vitro following exposure to the Mississippi Canyon Block 252 oil (MC252)

    KAUST Repository

    Koo, Hyunmin

    2014-07-10

    In this study, we examined the responses by the indigenous bacterial communities in salt-marsh sediment microcosms in vitro following treatment with Mississippi Canyon Block 252 oil (MC252). Microcosms were constructed of sediment and seawater collected from Bayou La Batre located in coastal Alabama on the Gulf of Mexico. We used an amplicon pyrosequencing approach on microcosm sediment metagenome targeting the V3–V5 region of the 16S rRNA gene. Overall, we identified a shift in the bacterial community in three distinct groups. The first group was the early responders (orders Pseudomonadales and Oceanospirillales within class Gammaproteobacteria), which increased their relative abundance within 2 weeks and were maintained 3 weeks after oil treatment. The second group was identified as early, but transient responders (order Rhodobacterales within class Alphaproteobacteria; class Epsilonproteobacteria), which increased their population by 2 weeks, but returned to the basal level 3 weeks after oil treatment. The third group was the late responders (order Clostridiales within phylum Firmicutes; order Methylococcales within class Gammaproteobacteria; and phylum Tenericutes), which only increased 3 weeks after oil treatment. Furthermore, we identified oil-sensitive bacterial taxa (order Chromatiales within class Gammaproteobacteria; order Syntrophobacterales within class Deltaproteobacteria), which decreased in their population after 2 weeks of oil treatment. Detection of alkane (alkB), catechol (C2,3DO) and biphenyl (bph) biodegradation genes by PCR, particularly in oil-treated sediment metacommunity DNA, delineates proliferation of the hydrocarbon degrading bacterial community. Overall, the indigenous bacterial communities in our salt-marsh sediment in vitro microcosm study responded rapidly and shifted towards members of the taxonomic groups that are capable of surviving in an MC252 oil-contaminated environment.

  7. Bacterial community shift in the coastal Gulf of Mexico salt-marsh sediment microcosm in vitro following exposure to the Mississippi Canyon Block 252 oil (MC252).

    Science.gov (United States)

    Koo, Hyunmin; Mojib, Nazia; Huang, Jonathan P; Donahoe, Rona J; Bej, Asim K

    2015-08-01

    In this study, we examined the responses by the indigenous bacterial communities in salt-marsh sediment microcosms in vitro following treatment with Mississippi Canyon Block 252 oil (MC252). Microcosms were constructed of sediment and seawater collected from Bayou La Batre located in coastal Alabama on the Gulf of Mexico. We used an amplicon pyrosequencing approach on microcosm sediment metagenome targeting the V3-V5 region of the 16S rRNA gene. Overall, we identified a shift in the bacterial community in three distinct groups. The first group was the early responders (orders Pseudomonadales and Oceanospirillales within class Gammaproteobacteria), which increased their relative abundance within 2 weeks and were maintained 3 weeks after oil treatment. The second group was identified as early, but transient responders (order Rhodobacterales within class Alphaproteobacteria; class Epsilonproteobacteria), which increased their population by 2 weeks, but returned to the basal level 3 weeks after oil treatment. The third group was the late responders (order Clostridiales within phylum Firmicutes; order Methylococcales within class Gammaproteobacteria; and phylum Tenericutes), which only increased 3 weeks after oil treatment. Furthermore, we identified oil-sensitive bacterial taxa (order Chromatiales within class Gammaproteobacteria; order Syntrophobacterales within class Deltaproteobacteria), which decreased in their population after 2 weeks of oil treatment. Detection of alkane (alkB), catechol (C2,3DO) and biphenyl (bph) biodegradation genes by PCR, particularly in oil-treated sediment metacommunity DNA, delineates proliferation of  the hydrocarbon degrading bacterial community. Overall, the indigenous bacterial communities in our salt-marsh sediment in vitro microcosm study responded rapidly and shifted towards members of the taxonomic groups that are capable of surviving in an MC252 oil-contaminated environment.

  8. A Phase I/II Protocol Using {sup 252}Cf for the Treatment of Cervical Carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Anita Mahajan; Mark J. Rivard; Evelyn R. Nunez; David E. Wazer

    2000-11-12

    For this clinical study, external photon beam irradiation will be given in a standard fashion with intravenous cisplatinum (CDDP) every week as a radiosensitizing agent. We will incorporate {sup 252}Cf as the brachytherapy source replacing {sup 192}Ir, theoretically improving patient outcomes with its lack of cell cycle and oxygen dependence, and a therapeutic ratio possibly greater than unity. Local tumor control and control of systemic disease are potentially feasible using {sup 252}Cf to initially debulk and destroy local bulky tumor with CDDP and X rays to enhance treatment efficacy and treat minimal microscopic and distant micrometastases. The initial {sup 22}Cf dose will be 1 Gy per weekly fraction with 0.25-Gy increments toward a 2.5-Gy limit. Patients will be stratified according to their stage, toxicities and outcomes will be monitored closely, and the study will be halted if undo morbidities are noted.

  9. Validation of IRDFF in 252Cf Standard and IRDF-2002 Reference Neutron Fields

    Directory of Open Access Journals (Sweden)

    Simakov Stanislav

    2016-01-01

    Full Text Available The results of validation of the latest release of International Reactor Dosimetry and Fusion File, IRDFF-1.03, in the standard 252Cf(s.f. and reference 235U(nth,f neutron benchmark fields are presented. The spectrum-averaged cross sections were shown to confirm IRDFF-1.03 in the 252Cf standard spontaneous fission spectrum; that was not the case for the current recommended spectra for 235U(nth,f. IRDFF was also validated in the spectra of the research reactor facilities ISNF, Sigma-Sigma and YAYOI, which are available in the IRDF-2002 collection. The ISNF facility was re-simulated to remove unphysical oscillations in the spectrum. IRDFF-1.03 was shown to reproduce reasonably well the spectrum-averaged data measured in these fields except for the case of YAYOI.

  10. Performance evaluation of high-pressure MWPC with individual line readout under Cf-252 neutron irradiation

    Science.gov (United States)

    Toh, K.; Nakamura, T.; Sakasai, K.; Soyama, K.; Yamagishi, H.

    2014-07-01

    A multiwire proportional chamber (MWPC) neutron detector system was developed for the Materials and Life Science Experimental Facility at the Japan Proton Accelerator Research Complex. Its basic performance was evaluated by an irradiation experiment using a Cf-252 neutron source. A short response time and high spatial resolution can be obtained using an individual line readout method. The detector system exhibited a one-dimensional uniformity of response of 4.8% and 3.8% in the x- and y-directions, respectively. The uniformity of all pixels in the two-dimensional image was 7.9%. The average intrinsic spatial resolution was 1.55 mm full width at half maximum in the sensitive region calculated by taking into account the track lengths of secondary particles. The signal intensity of the system remained constant during the operation for 500 min under Cf-252 neutron irradiation.

  11. Microbial response to the MC252 Oil and Corexit 9500 in the Gulf of Mexico

    Directory of Open Access Journals (Sweden)

    Romy eChakraborty

    2012-10-01

    Full Text Available The Deepwater Horizon spill released over 4.1 million barrels of crude oil into the Gulf of Mexico. In an effort to mitigate large oil slicks, the dispersant Corexit 9500 was sprayed onto surface slicks and injected directly at the wellhead at water depth of 1,500 meters. Several research groups were involved in investigating the fate of the MC-252 oil using newly advanced molecular tools to elucidate microbial interactions with oil, gases and dispersant. Presented here is a comprehensive overview of the ecogenomics of microbial degradation of MC-252 oil and gases in the water column and shorelines and some insight into the fate of the dispersant Corexit 9500 that was added to aid in oil dispersion process. We also present data that show the dispersant was not toxic to the indigenous microbes at concentrations added, and several bacterial species were able to degrade the various components of Corexit 9500.

  12. Validation of IRDFF in 252Cf standard and IRDF-2002 reference neutron fields

    Energy Technology Data Exchange (ETDEWEB)

    Simakov, Stanislav; Capote Noy, Roberto; Greenwood, Lawrence R.; Griffin, Patrick J.; Kahler, Albert; Pronyaev, Vladimir; Trkov, A.; Zolotarev, K. I.

    2016-05-02

    The results of validation of the latest release of International Reactor Dosimetry and Fusion File, IRDFF-1.03, in the standard 252Cf(s.f.) and reference 235U(nth,f) neutron benchmark fields are presented. The spectrum-averaged cross sections were shown to confirm the recommended spectrum for 252Cf spontaneous fission source; that was not the case for the current recommended spectra for 235U(nth,f). IRDFF was also validated in the spectra of the research reactor facilities ISNF, Sigma-Sigma and YAYOI, which are available in the IRDF- 2002 collection. Before this analysis, the ISFN spectrum was resimulated to remove unphysical oscillations in spectrum. IRDFF-1.03 was shown to reasonably reproduce the spectrum-averaged data measured in these fields except for the case of YAYOI.

  13. Measuring the α/SF Branching Ratio of 252Cf with the NIFFTE TPC

    Science.gov (United States)

    Snyder, L.; Asner, D. M.; Baker, R. G.; Bundgaard, J.; Burgett, E.; Cunningham, M.; Deaven, J.; Duke, D. L.; Greife, U.; Grimes, S.; Heffner, M.; Hill, T.; Isenhower, D.; Klay, J. L.; Kleinrath, V.; Kornilov, N.; Laptev, A. B.; Loveland, W.; Massey, T. N.; Meharchand, R.; Qu, H.; Ruz, J.; Sangiorgio, S.; Seilhan, B.; Stave, S.; Tatishvili, G.; Thornton, R. T.; Tovesson, F.; Towell, D.; Towell, R. S.; Watson, S.; Wendt, B.; Wood, L.

    2014-05-01

    A fission TPC is being developed to measure the energy-dependent neutron induced fission cross sections of the major and minor actinides to an accuracy of better than 1%. Achieving such an accuracy will depend in part, on the ability of the TPC to provide precise tracking and identification of charged particles. A measurement of the α-decay to spontaneous fission branching ratio of 252Cf used to benchmark the performance of the TPC will be discussed.

  14. Advanced conceptual design report. Phase II. Liquid effluent treatment and disposal Project W-252

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-01-31

    This Advanced Conceptual Design Report (ACDR) provides a documented review and analysis of the Conceptual Design Report (CDR), WHC-SD-W252-CDR-001, June 30, 1993. The ACDR provides further design evaluation of the major design approaches and uncertainties identified in the original CDR. The ACDR will provide a firmer basis for the both the design approach and the associated planning for the performance of the Definitive Design phase of the project.

  15. Functional design criteria for Project W-252, Phase II Liquid Effluent Treatment and Disposal: Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    Hatch, C.E.

    1994-11-10

    This document provides the functional design criteria required for the Phase 2 Liquid Effluent Treatment and Disposal Project, Project W-252. Project W-252 shall provide new facilities and existing facility modifications required to implement Best Available Technology/All Known, Available, and Reasonable Methods of Prevention, Control, and Treatment (BAT/AKART) for the 200 East Phase II Liquid Effluent Streams. The project will also provide a 200 East Area Phase II Effluent Collection System (PTECS) for connection to a disposal system for relevant effluent streams to which BAT/AKART has been applied. Liquid wastestreams generated in the 200 East Area are currently discharged to the soil column. Included in these wastestreams are cooling water, steam condensate, raw water, and sanitary wastewaters. It is the policy of the DOE that the use of soil columns to treat and retain radionuclides and nonradioactive contaminants be discontinued at the earliest practical time in favor of wastewater treatment and waste minimization. In 1989, the DOE entered into an interagency agreement with Ecology and EPA. This agreement is referred to as the Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement). Project W-252 is one of the projects required to achieve the milestones set forth in the Tri-Party Agreement. One of the milestones requires BAT/AKART implementation for Phase II streams by October 1997. This Functional Design Criteria (FDC) document provides the technical baseline required to initiate Project W-252 to meet the Tri-Party Agreement milestone for the application of BAT/AKART to the Phase II effluents.

  16. Fermi-LAT Detection of Gamma-ray Emission from the FSRQ PKS 0035-252

    Science.gov (United States)

    Valverde, Janeth; Ojha, Roopesh

    2017-11-01

    The Large Area Telescope (LAT), on board the Fermi Gamma-ray Space Telescope, has observed a gamma-ray flare from a source positionally consistent with the flat spectrum radio quasar PKS 0035-252 with coordinates RA: 00h38m14.7355s, Dec: -24d59m02.234s, J2000, (Fey et al. 2015, AJ, 150, 58) and redshift z=0.498058 (Jones et al. 2009, MNRAS, 399, 683).

  17. State Waste Discharge Permit application for industrial discharge to land: 200 East Area W-252 streams

    Energy Technology Data Exchange (ETDEWEB)

    1993-12-01

    This document constitutes the WAC 173-216 State Waste Discharge Permit application for six W-252 liquid effluent streams at the Hanford Site. Appendices B through H correspond to Section B through H in the permit application form. Within each appendix, sections correspond directly to the respective questions on the application form. The appendices include: Product or service information; Plant operational characteristics; Water consumption and waterloss; Wastewater information; Stormwater; Other information; and Site assessment.

  18. Comparison of fission modes in 252Cf, 257Fm, and 260Md

    Science.gov (United States)

    van Aarle, J.; Siemon, K.; Wild, J. F.; Lougheed, R. W.; Westmeier, W.; Patzelt, P.

    1998-10-01

    Although the spontaneous-fission properties of heavy actinides have been studied for well over 35 years, many interesting and informative details continue to come into light. During the last decade, the spontaneous fission of 252Cf, 257Fm and 260Md has been extensively investigated at the Philipps University of Marburg (1-4), by means of a gadolinium-doped liquid scintillation tank for neutron counting and surface barrier detectors for fission fragment detection. The three nuclides represent the transition from the well-known asymmetric fission yield distribution, as it is characteristic for 252Cf, to a much more symmetrical one, found in the fission of 260Md. Therefore, trends in the dynamical changes of fission properties have been derived from these studies. For the spontaneous fission of 252Cf and 260Md, it was already shown that different fission modes, as proposed by theoretical calculations of Brosa et al. (5), could be separated, using the correlation between the neutrons emitted in a fission event and both the observed fission-fragment mass and the total kinetic energy (1, 2). In the case of 257Fm, no theoretical calculations for fission modes exist. However, from the fission properties of the two surrounding actinides, one can expect at least three different fission modes, namely two "standard" and the "supershort" mode. In this paper, results from the recent 257Fm experiment will be presented and compared to systematics extracted from the fission properties of other heavy actinides.

  19. On the {sup 252}Cf primary and secondary gamma rays and epithermal neutron flux for BNCT

    Energy Technology Data Exchange (ETDEWEB)

    Ghassoun, J. [LPTN, Departement de Physique, Faculte des Sciences Semlalia, BP 2390, 40000 Marrakech (Morocco)], E-mail: ghassoun@ucam.ac.ma; Merzouki, A. [LPTN, Departement de Physique, Faculte des Sciences Semlalia, BP 2390, 40000 Marrakech (Morocco); Remote Sensing and Geomatics of the Environnement Laboratory, Ottawa-Carleton Geoscience Centre, Marion Hall-140Louis Pasteur Ottawa, ON, KIN 6N5 (Canada); El Morabiti, A.; Jehouani, A. [LPTN, Departement de Physique, Faculte des Sciences Semlalia, BP 2390, 40000 Marrakech (Morocco)

    2007-10-15

    Monte Carlo simulation has been used to calculate the different components of neutrons and secondary gamma rays originated by {sup 252}Cf fission and also the primary gamma rays emitted directly by the {sup 252}Cf source at the exit face of a compact system designed for the BNCT. The system consists of a {sup 252}Cf source and a moderator/reflector/filter assembly. To study the material properties and configuration possibilities, the MCNP code has been used. The moderator/reflector/filter arrangement is optimised to moderate neutrons to epithermal energy and, as far as possible, to get rid of fast and thermal neutrons and photons from the therapeutic beam. To reduce the total gamma contamination and to have a sufficiently high epithermal neutron flux we have used different photon filters of different thickness. Our analysis showed that the use of an appropriate filter leads to a gamma ray flux reduction without affecting the epithermal neutron beam quality at the exit face of the system.

  20. Oil in the Gulf of Mexico after the capping of the BP/Deepwater Horizon Mississippi Canyon (MC-252) well.

    Science.gov (United States)

    Kolian, Steve R; Porter, Scott A; Sammarco, Paul W; Birkholz, Detlef; Cake, Edwin W; Subra, Wilma A

    2015-08-01

    Evidence of fresh oil from the BP/Deepwater Horizon Mississippi Canyon-252 (MC-252) well was found in the northern Gulf of Mexico up to 1 year and 10 months after it was capped on 15 July 2010. Offshore and coastal samples collected after capping displayed ratios of biomarkers matching those of MC-252 crude oil. Pre- and post-capping samples were compared. Little weathering had occurred, based on the abundance of low-molecular-weight (LMW) n-alkanes and polycyclic aromatic hydrocarbons (PAHs) in the post-capping samples. The occurrence of fresh oil in offshore waters and coastal areas suggest that the MC-252 well continued to leak hydrocarbons into the Gulf of Mexico at least until 22 May 2012, the end of this study period.

  1. CDC-25.2, a C. elegans ortholog of cdc25, is essential for the progression of intestinal divisions.

    Science.gov (United States)

    Lee, Yong-Uk; Son, Miseol; Kim, Jiyoung; Shim, Yhong-Hee; Kawasaki, Ichiro

    2016-01-01

    Intestinal divisions in Caenorhabditis elegans take place in 3 stages: (1) cell divisions during embryogenesis, (2) binucleations at the L1 stage, and (3) endoreduplications at the end of each larval stage. Here, we report that CDC-25.2, a C. elegans ortholog of Cdc25, is required for these specialized division cycles between the 16E cell stage and the onset of endoreduplication. Results of our genetic analyses suggest that CDC-25.2 regulates intestinal cell divisions and binucleations by counteracting WEE-1.3 and by activating the CDK-1/CYB-1 complex. CDC-25.2 activity is then repressed by LIN-23 E3 ubiquitin ligase before the onset of intestinal endoreduplication, and this repression is maintained by LIN-35, the C. elegans ortholog of Retinoblastoma (Rb). These findings indicate that timely regulation of CDC-25.2 activity is essential for the progression of specialized division cycles and development of the C. elegans intestine.

  2. Comparison of fission modes in {sup 252}Cf, {sup 257}Fm, and {sup 260}Md

    Energy Technology Data Exchange (ETDEWEB)

    van Aarle, J. [Laboratory for Materials Behaviour, Paul Scherrer Institute, CH-5232 Villigen-PSI (Switzerland); Siemon, K.; Patzelt, P. [Philipps University, FB 15---Kernchemie, D-35032 Marburg an der Lahn (Germany); Wild, J.F.; Lougheed, R.W. [University of California, Lawrence Livermore National Lab., Livermore, California 94551 (United States); Westmeier, W. [Dr. Westmeier GmbH, Moellnerweg 32, 35085 Ebsdorfergrund-Moelln (Germany)

    1998-10-01

    Although the spontaneous-fission properties of heavy actinides have been studied for well over 35 years, many interesting and informative details continue to come into light. During the last decade, the spontaneous fission of {sup 252}Cf, {sup 257}Fm and {sup 260}Md has been extensively investigated at the Philipps University of Marburg (1{endash}4), by means of a gadolinium-doped liquid scintillation tank for neutron counting and surface barrier detectors for fission fragment detection. The three nuclides represent the transition from the well-known asymmetric fission yield distribution, as it is characteristic for {sup 252}Cf, to a much more symmetrical one, found in the fission of {sup 260}Md. Therefore, trends in the dynamical changes of fission properties have been derived from these studies. For the spontaneous fission of {sup 252}Cf and {sup 260}Md, it was already shown that different fission modes, as proposed by theoretical calculations of Brosa et al. (5), could be separated, using the correlation between the neutrons emitted in a fission event and both the observed fission-fragment mass and the total kinetic energy (1, 2). In the case of {sup 257}Fm, no theoretical calculations for fission modes exist. However, from the fission properties of the two surrounding actinides, one can expect at least three different fission modes, namely two {open_quotes}standard{close_quotes} and the {open_quotes}supershort{close_quotes} mode. In this paper, results from the recent {sup 257}Fm experiment will be presented and compared to systematics extracted from the fission properties of other heavy actinides. {copyright} {ital 1998 American Institute of Physics.}

  3. 252Cf: neutron multiplicities in correlation with fission-fragment mass and energy

    Science.gov (United States)

    van Aarle, J.; Westmeier, W.; Esterlund, R. A.; Patzelt, P.

    1994-10-01

    The number of neutrons emitted in the spontaneous fission of 252Cf has been measured, using a large Gd-doped liquid scintillator tank. A total of 1.7 × 107252Cf fission events were assayed, and the correlations between the number of neutrons emitted by the fission fragments and the total kinetic energy (TKE) released in a particular fission event were investigated. From these correlations, spontaneous-fission parameters were derived and compared to exit-channel predictions given by the multi-modal random neck-rupture model of Brosa and co-workers.

  4. New Results in Studying of the Collinear Cluster Tripartition of the $^{252}$Cf Nucleus

    CERN Document Server

    Pyatkov, Yu V; Trzaska, W; Yamaletdinov, S R; Sokol, E A; Tjukavkin, A N; Aleksandrov, A A; Aleksandrova, I A; Denisov, S V; Krajnov, V P; Khlebnikov, S Yu; Kuzmina, T E; Kuznetsova, E A; Mitrofanov, S V; Penionzhkevich, Yu E; Ryabov, Yu; Tishchenko, V G; Florko, B V

    2004-01-01

    New experimental results confirming collinear cluster tripartition mode in ^{252}Cf (sf) have been obtained at the modified FOBOS spectrometer. Some events have been detected with the low total mass of fission fragments, which turned out to be by 30-40 % smaller than the initial mass of the fissioning nuclei. The group of these rare events gated by the large neutron multiplicity measured revealed the specific rectangular-shaped structures in the mass distribution of the coincident collinear fragments bounded by the magic mass numbers.

  5. Multi-modal fission in collinear ternary cluster decay of 252Cf(sf, fff

    Directory of Open Access Journals (Sweden)

    W. von Oertzen

    2015-06-01

    Full Text Available We discuss the multiple decay modes of collinear fission in 252Cf(sf, fff, with three fragments as suggested by the potential energy surface (PES. Fission as a statistical decay is governed by the phase space of the different decay channels, which are suggested in the PES-landscape. The population of the fission modes is determined by the minima in the PES at the scission points and on the internal potential barriers. The ternary collinear decay proceeds as a sequential process, in two steps. The originally observed ternary decay of 252Cf(sf into three different masses (e.g. 132–140Sn, 52–48Ca, 68–72Ni, observed by the FOBOS group in the FLNR (Flerov Laboratory for Nuclear Reactions of the JINR (Dubna the collinear cluster tripartition (CCT, is one of the ternary fission modes. This kind of “true ternary fission” of heavy nuclei has often been predicted in theoretical works during the last decades. In the present note we discuss different ternary fission modes in the same system. The PES shows pronounced minima, which correspond to several modes of ternary fragmentations. These decays have very similar dynamical features as the previously observed CCT-decays. The data obtained in the experiments on CCT allow us to extract the yields for different decay modes using specific gates on the measured parameters, and to establish multiple modes of the ternary fission decay.

  6. Interim report on the ORNL absolute measureoffoments of anti. nu. /sub p/ for /sup 252/Cf

    Energy Technology Data Exchange (ETDEWEB)

    Spencer, R.R.; Gwin, R.; Ingle, R.; Weaver, H.

    1979-09-01

    An initial effort was made to measure absolutely the average number of prompt neutrons, anti ..nu../sub p/, emitted in spontaneous fission of /sup 252/Cf to an unprecedented accuracy of +- 0.25%. Fission neutrons were counted with a large, gadolinium poisoned, liquid scintillator. A white source of neutrons from the ORELA was used to calibrate the detector efficiency as a function of neutron energy. Source neutrons were scattered into the large scintillator by a thin NE-213 proton-recoil detector which employed pulse shape discrimination to eliminate unwanted ..gamma..-ray background. The resulting neutron-energy and scattering angle-dependent efficiencies were used to normalize a Monte Carlo calculation of the scintillator efficiency for fission neutrons. Under the assumptions that the effects of parasitic charged particle reactions and multiple neutron scattering in the proton-recoil counter have negligible influence on the efficiency calibration, the value of the average number of prompt neutrons emitted per /sup 252/Cf fission was found to be 3.783 +- 0.010. This report is intended as a documentary and guide for future measurements incorporating improvements suggested by the analysis of this first determination. 31 references.

  7. 47 CFR 51.807 - Arbitration and mediation of agreements by the Commission pursuant to section 252(e)(5) of the Act.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 3 2010-10-01 2010-10-01 false Arbitration and mediation of agreements by the... Implementation of Section 252 of the Act § 51.807 Arbitration and mediation of agreements by the Commission... proceeding or matter. (c) In resolving, by arbitration under section 252(b) of the Act, any open issues and...

  8. Experience with and potential of Cf-252 therapy for other tumors: Lexington clinical trials

    Energy Technology Data Exchange (ETDEWEB)

    Maruyama, Y.

    1986-01-01

    Clinical observations of tumor response in a variety of sites to Cf-252 (Cf) neutron brachytherapy (NT) are described. Many tumors which are accessible and easily implanted are suitable for Cf-NT, but in advanced stages, must be integrated into a more comprehensive program of local, regional and systemic therapy. With local tumor clearance and control, there should be treatment for regional disease using conventional photon radiotherapy; adjuvant therapies for disseminated disease using systemic therapy is also needed. While potential for therapy exists for Cf-NT treatment of many tumors, additional clinical trials carried out in a variety of global settings are needed where different tumors are common and are available for studies. Tumors suitable for study include e.g. cervix, uterus, vagina, tonsil-oropharynx, anterior oral cavity, prostate, female urethra, nasopharynx, anus and rectum, malignant glioma, parotid, perhaps esophagus, bladder, non-oat cell lung, localized sarcoma and melanoma, etc.

  9. Tagging fast neutrons from a 252Cf fission-fragment source.

    Science.gov (United States)

    Scherzinger, J; Al Jebali, R; Annand, J R M; Bala, A; Fissum, K G; Hall-Wilton, R; Hamilton, D; Mauritzson, N; Messi, F; Perrey, H; Rofors, E

    2017-10-01

    Coincidence and time-of-flight measurement techniques are employed to tag fission neutrons emitted from a 252Cf source sealed on one side with a very thin layer of Au. The source is positioned within a gaseous 4He scintillator detector. Together with α particles, both light and heavy fission fragments pass through the thin layer of Au and are detected. The fragments enable the corresponding fission neutrons, which are detected in a NE-213 liquid-scintillator detector, to be tagged. The resulting continuous polychromatic beam of tagged neutrons has an energy dependence that agrees qualitatively with expectations. We anticipate that this technique will provide a cost-effective means for the characterization of neutron-detector efficiency in the energy range 1-6MeV. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.

  10. JCMT Spectral and Continuum Imaging of Comet 252P/LINEAR

    Science.gov (United States)

    Coulson, Iain M.; Cordiner, Martin A.; Kuan, Yi-Jehng; Tseng, Wei-Ling; Chuang, Yo-Ling; Lin, Zhong-Yi; Milam, Stefanie N.; Charnley, Steven B.; Ip, Wing-Huen

    2017-04-01

    Comet 252P/LINEAR passed the Earth at a distance of 0.035 au on 2016 March 21, presenting a rare opportunity to study a comet at high spatial resolution. Even with a single dish facility such as JCMT, the chemical structure of the coma could be observed on scales of 500-1000 km, which are smaller than the scale lengths of known distributed cometary molecules. Our week-long observing campaign at JCMT started on March 27 (UT), 12 days after perihelion, and ended on April 3, during which time the comet's distance from Earth increased from 0.045 to 0.078 au. Our observations of the J = 4 - 3 transition of HCN showed generally uniform levels of activity. Expansion velocities were ˜0.6 km s-1 (±10%), and the derived mean HCN production rate during the week was 6.4 × 1024 mol s-1. Comparison with independent estimates of the water production rate during the same period yields a mixing ratio of 0.12% with respect to water. Methanol emissions appear to arise from an extended source—probably in the form of an ice halo—suggesting that all the gases from 252P may originate in large part from the sublimation of icy grains in the coma. Adopting a mean dust particle size of 1 mm, the mass of dust in the coma at the same time is estimated at 4 × 107 kg, implying a total dust production rate of 4 kg s-1. The dust-to-gas mass ratio of ˜0.025 is one of the lowest values ever observed for a comet.

  11. Interactive effects between Lymphotoxin α +252 polymorphism and habits of substance use on risk of hepatocellular carcinoma

    Directory of Open Access Journals (Sweden)

    Jung-Fa Tsai

    2017-07-01

    Full Text Available This case–control study aimed to assess the interactive effect between polymorphisms of lymphotoxin (LT α +252 and habitual substance use on risk of hepatocellular carcinoma (HCC. We enrolled 150 pairs of sex- and age-matched HCC patients and unrelated healthy controls. LTα genotypes were detected with polymerase-chain reaction and restrictive fragment length polymorphisms. Information about habits of substance use was obtained through personal interview. Multivariate analysis indicated that LTα +252 G/G genotypes [odds ratio (OR = 3.36], Hepatitis B surface antigen (OR = 16.68, antibodies to hepatitis C virus (OR = 34.88 and having at least two habits of substance use (OR = 2.50 were independent risk factors for HCC. There were additive interactions among LTα +252 G/G genotype, chronic viral hepatitis, and habit of each substance use. In conclusion: There are independent and additive interactions between LTα +252 G/G genotype, chronic viral hepatitis, and habits of substance use on risk of HCC.

  12. 48 CFR 252.227-7018 - Rights in noncommercial technical data and computer software-Small Business Innovation Research...

    Science.gov (United States)

    2010-10-01

    ... technical data and computer software-Small Business Innovation Research (SBIR) Program. 252.227-7018 Section... Noncommercial Technical Data and Computer Software—Small Business Innovation Research (SBIR) Program (JUN 1995... the Rights in Noncommercial Technical Data and Computer Software—Small Business Innovative Research...

  13. 8 CFR 252.3 - Great Lakes vessels and tugboats arriving in the United States from Canada; special procedures.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Great Lakes vessels and tugboats arriving... DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS LANDING OF ALIEN CREWMEN § 252.3 Great Lakes vessels... and tugboats. An immigration examination shall not be required of any crewman aboard a Great Lakes...

  14. 48 CFR 252.236-7011 - Overseas architect-engineer services-Restriction to United States firms.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Overseas architect... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions And Clauses 252.236-7011 Overseas architect... provision: Overseas Architect-Engineer Services—Restriction to United States Firms (JAN 1997) (a) Definition...

  15. Comparison of 252Cf time correlated induced fission with AmLi induced fission on fresh MTR reserach reactor fuel

    Energy Technology Data Exchange (ETDEWEB)

    Joshi, Jay Prakash [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-05-01

    The objectives of this project are to calibrate the Advanced Experimental Fuel Counter (AEFC), benchmark MCNP simulations using experimental results, investigate the effects of change in fuel assembly geometry, and finally to show the boost in doubles count rates with 252Cf active soruces due to the time correlated induced fission (TCIF) effect.

  16. 75 FR 51943 - Safety Zone; DEEPWATER HORIZON at Mississippi Canyon 252 Outer Continental Shelf MODU in the Gulf...

    Science.gov (United States)

    2010-08-24

    ... SECURITY Coast Guard 33 CFR Part 147 RIN 1625-AA00 Safety Zone; DEEPWATER HORIZON at Mississippi Canyon 252... temporary safety zone around the riser for the DEEPWATER HORIZON, a Mobile Offshore Drilling Unit (MODU), at... zone around the riser for the DEEPWATER HORIZON, a Mobile Offshore Drilling Unit (MODU), which is...

  17. Viability of neutron brachytherapy technique using Cf{sup 252} for tumors of salivary glands therapy; Viabilidade da tecnica de braquiterapia de neutrons por Cf{sup 252} para tratamento de tumores de glandulas salivares

    Energy Technology Data Exchange (ETDEWEB)

    Andrade, Lidia M.; Campos, Tarcisio P.R. [Minas Gerais Univ., Belo Horizonte, MG (Brazil). Dept. de Engenharia Nuclear]. E-mail: campos@nuclear.ufmg.br; lidia@nuclear.ufmg.br

    2000-07-01

    Gland salivary tumors, although uncommon, present significant characteristics such as distant metastasis, recurrence and average survive of five year for treated patients. Those tumors presents low response to a conventional radiotherapy, photon and electron therapy; thus, this modality is associated with surgery. Fast neutron therapy has been presented better results in controlling the local tumor in comparison with conventional radiotherapy. Brachytherapy with Cf-252 presents an alternative treatment for tumors. Those radiotherapy technique are discussed and analyzed. (author)

  18. Correlations in prompt neutrons and gamma-rays from Cf-252 spontaneous fission

    Directory of Open Access Journals (Sweden)

    Marcath M.J.

    2017-01-01

    Full Text Available New event-by-event fission models have prompt neutrons and gamma-rays that are correlated in time, energy, and multiplicity, however there is limited measurement data available to validate these models. Measurement of high-order fission neutron and gamma-ray coincidences is difficult and there has previously been little motivation to measure properties of both particle types simultaneously. High-order Cf-252 spontaneous fission neutron and gamma-ray coincidences were measured with a cylindrical array of 22 liquid organic and 8 NaI(Tl scintillation detectors, 50 cm from a central axis. Waveforms were acquired and saved for post-processing using four time-synchronized CAEN V1720 digitizers. Liquid organic scintillator waveforms were analyzed with off-line pulse shape discrimination techniques to categorize neutron and gamma-ray detections. Detected multiplicity was compared with MCNPX-PoliMi simulation results, where built-in fission models and event-by-event fission models, CGMF and FREYA, have been implemented. Additionally, measured neutron energy by time-of-flight and gamma-ray energy correlated by detected multiplicity were compared to simulated results.

  19. Correlations in prompt neutrons and gamma-rays from Cf-252 spontaneous fission

    Science.gov (United States)

    Marcath, M. J.; Shin, T. H.; Fulvio, A. Di; Clarke, S. D.; Pozzi, S. A.

    2017-09-01

    New event-by-event fission models have prompt neutrons and gamma-rays that are correlated in time, energy, and multiplicity, however there is limited measurement data available to validate these models. Measurement of high-order fission neutron and gamma-ray coincidences is difficult and there has previously been little motivation to measure properties of both particle types simultaneously. High-order Cf-252 spontaneous fission neutron and gamma-ray coincidences were measured with a cylindrical array of 22 liquid organic and 8 NaI(Tl) scintillation detectors, 50 cm from a central axis. Waveforms were acquired and saved for post-processing using four time-synchronized CAEN V1720 digitizers. Liquid organic scintillator waveforms were analyzed with off-line pulse shape discrimination techniques to categorize neutron and gamma-ray detections. Detected multiplicity was compared with MCNPX-PoliMi simulation results, where built-in fission models and event-by-event fission models, CGMF and FREYA, have been implemented. Additionally, measured neutron energy by time-of-flight and gamma-ray energy correlated by detected multiplicity were compared to simulated results.

  20. Neutron calibration field of bare {sup 252}Cf source in Vietnam

    Energy Technology Data Exchange (ETDEWEB)

    Le, Ngoc Thiem; Tran, Hoai Nam; Nguyen, Khai Tuan [Institute for Nuclear Science and Technology, Hanoi (Viet Nam); Trinh, Glap Van [Institute of Research and Development, Duy Tan University, Da Nang (Viet Nam)

    2017-02-15

    This paper presents the establishment and characterization of a neutron calibration field using a bare {sup 252}Cf source of low neutron source strength in Vietnam. The characterization of the field in terms of neutron flux spectra and neutron ambient dose equivalent rates were performed by Monte Carlo simulations using the MCNP5 code. The anisotropy effect of the source was also investigated. The neutron ambient dose equivalent rates at three reference distances of 75, 125, and 150 cm from the source were calculated and compared with the measurements using the Aloka TPS-451C neutron survey meters. The discrepancy between the calculated and measured values is found to be about 10%. To separate the scattered and the direct components from the total neutron flux spectra, an in-house shadow cone of 10% borated polyethylene was used. The shielding efficiency of the shadow cone was estimated using the MCNP5 code. The results confirmed that the shielding efficiency of the shadow cone is acceptable.

  1. Measurement of the Range Component Directional Signature in a DRIFT-II Detector using 252Cf Neutrons

    CERN Document Server

    Burgos, S; Forbes, J; Ghag, C; Gold, M; Hagemann, C; Kudryavtsev, V A; Lawson, T B; Loomba, D; Majewski, P; Muna, D; Murphy, A St J; Nicklin, G G; Paling, S M; Petkov, A; Plank, S J S; Robinson, M; Sanghi, N; Snowden-Ifft, D P; Spooner, N J C; Turk, J; Tziaferi, E

    2008-01-01

    The DRIFT collaboration utilizes low pressure gaseous detectors to search for WIMP dark matter with directional signatures. A 252Cf neutron source was placed on each of the principal axes of a DRIFT detector in order to test its ability to measure directional signatures from the three components of very low energy (~keV/amu) recoil ranges. A high trigger threshold and the event selection procedure ensured that only sulfur recoils were analyzed. Sulfur recoils produced in the CS2 target gas by the 252Cf source closely match those expected from massive WIMP induced sulfur recoils. For each orientation of the source a directional signal from the range components was observed, indicating that the detector is directional along all 3 axes. An analysis of these results yields an optimal orientation for DRIFT detectors when searching for a directional signature from WIMPs. Additional energy dependent information is provided to aid in understanding this effect.

  2. Pre-scission configuration of the tri-nuclear system at spontaneous ternary fission of {sup 252}Cf

    Energy Technology Data Exchange (ETDEWEB)

    Nasirov, A.K. [Joint Institute for Nuclear Research, BLTP, Dubna (Russian Federation); Institute of Nuclear Physics, Ulugbek, Tashkent (Uzbekistan); Tashkhodjaev, R.B. [Institute of Nuclear Physics, Ulugbek, Tashkent (Uzbekistan); Inha University in Tashkent, Tashkent (Uzbekistan); Oertzen, W. von [Helmholtz-Zentrum Berlin, Berlin (Germany); Freie Universitaet, Fachbereich Physik, Berlin (Germany)

    2016-05-15

    The potential energy surface for the pre-scission configurations of tri-nuclear systems formed in the spontaneous ternary fission of {sup 252}Cf is calculated. The fission channel {sup 70}Ni+{sup 50}Ca+{sup 132}Sn is chosen as one of the more probable channels of true ternary fission of {sup 252}Cf. A study of the collinear arrangement of the reaction products for true ternary fission is the aim of this work. The results are presented as a function of the relative distance R{sub 12} between the centres of mass of {sup 70}Ni and {sup 132}Sn and the distance from the centre of mass of {sup 50}Ca, which is perpendicular to R{sub 12}. The results show that only for a particular range of the R{sub 12} values the collinear tripartion of the fissioning nucleus occurs. (orig.)

  3. Radioactive Beams from 252CF Fission Using a Gas Catcher and an ECR Charge Breeder at ATLAS

    CERN Document Server

    Pardo, Richard C; Hecht, Adam; Moore, Eugene F; Savard, Guy

    2005-01-01

    An upgrade to the radioactive beam capability of the ATLAS facility has been proposed using 252Cf fission fragments thermalized and collected into a low-energy particle beam using a helium gas catcher. In order to reaccelerate these beams an existing ATLAS ECR ion source will be reconfigured as a charge breeder source. A 1Ci 252Cf source is expected to provide sufficient yield to deliver beams of up to ~106 far from stability ions per second on target. A facility description, the expected performance and the expected performance will be presented in this paper. This work is supported by the U.S. Department of Energy, Office of Nuclear Physics, under contract W-31-109-ENG-38.

  4. Absolute measurement of anti. nu. /sub p/ for /sup 252/Cf using the ORNL large liquid scintillator neutron detector

    Energy Technology Data Exchange (ETDEWEB)

    Spencer, R.R.; Gwin, R.; Ingle, R.

    1981-08-01

    The ORNL large liquid scintillator detector was used in a precise determination of anti ..nu../sub p/, the number of neutrons emitted promptly, for spontaneous fission of /sup 252/Cf. Measurements of the detector efficiency over a broad energy region were made by means of a proton-recoil technique employing the ORELA white neutron source. Monte Carlo calculation of the detector efficiency for a spectrum representative of /sup 252/Cf fission neutrons was calibrated with these elaborate measurements. The unusually flat response of the neutron detector resulted in elimination of several known sources of error. Experimental measurement was coupled with calculational methods to correct for other known errors. These measurements lead to an unusually small estimated uncertainty of 0.2% in the value obtained, anti ..nu../sub p/ = 3.773 +- 0.007.

  5. Development of a gas-jet coupled ISOL facility with a /sup 252/Cf spontaneous fission source

    CERN Document Server

    Greenwood, R C; Novick, V J

    1981-01-01

    A mass separator at the INEL has been successfully coupled on-line to a source of /sup 252/Cf fission products via a He-gas jet transport arrangement using solid aerosols of NaCl as activity carriers. Initial tests of the ISOL system on-line to an approximately 7 mu g /sup 252 /Cf source are conducted using gamma-ray spectroscopic measurements of the separated /sup 138,139/Cs, /sup 141,142/Ba and /sup 142/La activities. The measured transport efficiencies through the system of approximately 3% and approximately 0.3% for the Cs and Ba isotopes, respectively, are comparable with the results of earlier tests conducted at INEL with a hollow-cathode ion source alone coupled to the He-gas jet transport arrangement. Following these tests, a general survey of the mass-separated activities is conducted with the ISOL system on-line to an approximately 600 mu g source of /sup 252/Cf. Gross beta - gamma activity is measured for samples collected at 73 mass positions. Gamma-ray spectra are measured with a Ge(Li) detector ...

  6. Studies On Particle-Accompanied Fission Of 252Cf(sf) And 235U(nth,f)

    Science.gov (United States)

    Kopatch, Yu N.; Tishchenko, V.; Speransky, M.; Mutterer, M.; Gönnenwein, F.; Jesinger, P.; Gagarski, A. M.; von Kalben, J.; Kojouharov, I.; Lubkiewics, E.; Mezentseva, Z.; Nezvishevsky, V.; Petrov, G. A.; Schaffner, H.; Scharma, H.; Trzaska, W. H.; Wollersheim, H.-J.

    2005-11-01

    In recent multi-parameter studies of spontaneous and thermal neutron induced fission, 252Cf(sf) and 235U(nth,f) respectively, the energies and emission angles of fission fragments and light charged particles were measured. Fragments were detected by an energy and angle sensitive twin ionization chamber while the light charged particles were identified by a series of ΔE-Erest telescopes. Up to Be the light particle isotopes could be disentangled. In addition, in the 252Cf(sf) experiment, gammas emitted by the fragments were analyzed by a pair of large-volume segmented clover Ge detectors. Here the main interest is to study the γ-decay and the anisotropy of gammas emitted by fragments and light particles. On the other hand, the high count rates achieved in the U-experiment performed at the high flux reactor of the ILL, Grenoble, should allow to explore fragment-particle correlations in very rare events like quaternary fission. At the present stage of data evaluation, yields and energy distributions of light particles are available. For the present contribution in particular the yields of Be-isotopes for the two reactions studied are compared and discussed. For 252Cf(sf) these isotopic yields were hitherto not known.

  7. cdc-25.2, a C. elegans ortholog of cdc25, is required to promote oocyte maturation.

    Science.gov (United States)

    Kim, Jiyoung; Kawasaki, Ichiro; Shim, Yhong-Hee

    2010-03-15

    Cdc25 is an evolutionarily conserved protein phosphatase that promotes progression through the cell cycle. Some metazoans have multiple isoforms of Cdc25, which have distinct functions and different expression patterns during development. C. elegans has four cdc-25 genes. cdc-25.1 is required for germline mitotic proliferation. To determine if the other members of the cdc-25 family also contribute to regulation of cell division in the germ line, we examined phenotypes of loss-of-function mutants of the other cdc-25 family genes. We found that cdc-25.2 is also essential for germline development. cdc-25.2 homozygous mutant hermaphrodites exhibited sterility as a result of defects in oogenesis: mutant oocytes were arrested as endomitotic oocytes that were not fertilized successfully. Spermatogenesis and male germline development were not affected. Through genetic interaction studies, we found that CDC-25.2 functions upstream of maturation-promoting factor containing CDK-1 and CYB-3 to promote oocyte maturation by counteracting function of WEE-1.3. We propose that cdc-25 family members function as distinct but related cell cycle regulators to control diverse cell cycles in C. elegans germline development.

  8. LIN-23, an E3 Ubiquitin Ligase Component, Is Required for the Repression of CDC-25.2 Activity during Intestinal Development in Caenorhabditis elegans.

    Science.gov (United States)

    Son, Miseol; Kawasaki, Ichiro; Oh, Bong-Kyeong; Shim, Yhong-Hee

    2016-11-30

    Caenorhabditis elegans (C. elegans) utilizes two different cell-cycle modes, binucleations during the L1 larval stage and endoreduplications at four larval moltings, for its postembryonic intestinal development. Previous genetic studies indicated that CDC-25.2 is specifically required for binucleations at the L1 larval stage and is repressed before endoreduplications. Furthermore, LIN-23, the C. elegans β-TrCP ortholog, appears to function as a repressor of CDC-25.2 to prevent excess intestinal divisions. We previously reported that intestinal hyperplasia in lin-23(e1883) mutants was effectively suppressed by the RNAi depletion of cdc-25.2. Nevertheless, LIN-23 targeting CDC-25.2 for ubiquitination as a component of E3 ubiquitin ligase has not yet been tested. In this study, LIN-23 is shown to be the major E3 ubiquitin ligase component, recognizing CDC-25.2 to repress their activities for proper transition of cell-cycle modes during the C. elegans postembryonic intestinal development. In addition, for the first time that LIN-23 physically interacts with both CDC-25.1 and CDC-25.2 and facilitates ubiquitination for timely regulation of their activities during the intestinal development.

  9. Biodegradation of MC252 oil in oil:sand aggregates in a coastal headland beach environment

    Directory of Open Access Journals (Sweden)

    Vijaikrishnah eElango

    2014-04-01

    Full Text Available Biodegradation potential of MC252 in oil:sand aggregates, termed surface residue balls (SRBs, was examined using multiple lines of evidence on a heavily-impacted coastal headland beach in Louisiana, USA. SRBs were sampled over a 16-month period on the supratidal beach environment where reasonable control existed on the residence time of the aggregates on the beach surface. PAH and alkane concentration ratios were measured including PAH/C30-hopane, C2/C3 phenanthrenes, C2/C3 dibenzothiophenes and alkane/C30-hopane and demonstrated unequivocally that biodegradation was occurring in SRBs in the supratidal. These biodegradation reactions occurred over time frames relevant to the coastal processes moving SRBs off the beach. In contrast, submerged oil mat (SOM samples did not demonstrate chemical changes consistent with biodegradation. Review and analysis of additional biogeochemical parameters suggested the existence of a moisture and N-limited biodegradation regime on the supratidal beach environment. At this location, SRBs possess moisture contents < 2% and molar C:N ratios from 131-323, well outside of optimal values for biodegradation in the literature. Despite these limitations, biodegradation of PAHs and alkanes proceeded at relevant rates (2-8 year-1 due in part to the presence of degrading populations, i.e., Mycobacterium sp., adapted to these conditions. For SOM samples in the intertidal, an oxygen and salinity-impacted regime is proposed that severely limits biodegradation of alkanes and PAHs in this environment. These results support the hypothesis that SRBs deposited at different locations on the beach have different biogeochemical characteristics (e.g., moisture; salinity; terminal electron acceptors; nutrient; and oil composition due, in part, to their location on the landscape.

  10. The Unusual Apparition of Comet 252P/2000 G1 (LINEAR) and Comparison with Comet P/2016 BA14 (PanSTARRS)

    Science.gov (United States)

    Li, Jian-Yang; Kelley, Michael S. P.; Samarasinha, Nalin H.; Farnocchia, Davide; Mutchler, Max J.; Ren, Yanqiong; Lu, Xiaoping; Tholen, David J.; Lister, Tim; Micheli, Marco

    2017-10-01

    We imaged Comet 252P/2000 G1 (LINEAR; hereafter 252P) with the Hubble Space Telescope and both 252P and P/2016 BA14 (PanSTARRS; hereafter BA14) with the Discovery Channel Telescope in 2016 March and April, surrounding its close encounter to Earth. The r‧-band Afρ of 252P in a 0.″2-radius aperture were 16.8 ± 0.3 and 57 ± 1 cm on March 14 and April 4, respectively, and its gas production rates were Q(OH) = (5.8 ± 0.1) × 1027 s-1, and Q(CN) = (1.25 ± 0.01) × 1025 s-1 on April 17. The r‧-band upper limit Afρ of BA14 was 0.19 ± 0.01 cm in a 19.″2-radius aperture, and Q(CN) = (1.4 ± 0.1) × 1022 s-1 on 2017 April 17. 252P shows a bright and narrow jet of a few hundred kilometers long in the sunward direction, changing its projected position angle in the sky with a periodicity consistent with 7.24 hr. However, its photometric light curve is consistent with a periodicity of 5.41 hr. We suggest that the nucleus of 252P is likely in a non-principal axis rotation. The nucleus radius of 252P is estimated to be about 0.3 ± 0.03 km, indicating an active fraction of 40% to >100% in its 2016 apparition. Evidence implies a possible cloud of slow-moving grains surrounding the nucleus. The activity level of 252P in the 2016 apparition increased by two orders of magnitude from its previous apparitions, making this apparition unusual. On the other hand, the activity level of BA14 appears to be at least three orders of magnitude lower than that of 252P, despite its 10 times or larger surface area.

  11. Multi-modal fission in collinear ternary cluster decay of {sup 252}Cf(sf, fff)

    Energy Technology Data Exchange (ETDEWEB)

    Oertzen, W. von, E-mail: oertzen@helmholtz-berlin.de [Helmholtz-Zentrum Berlin, 14109 Berlin (Germany); Joint Institute for Nuclear Research, FLNR, 141980 Dubna (Russian Federation); Nasirov, A.K. [Joint Institute for Nuclear Research, FLNR, 141980 Dubna (Russian Federation); Institute of Nuclear Physics, 100214, Tashkent (Uzbekistan); Kyungpook National University, 702-701, Daegu (Korea, Republic of); Tashkhodjaev, R.B. [Institute of Nuclear Physics, 100214, Tashkent (Uzbekistan); Inha University in Tashkent, 100170, Tashkent (Uzbekistan)

    2015-06-30

    We discuss the multiple decay modes of collinear fission in {sup 252}Cf(sf, fff), with three fragments as suggested by the potential energy surface (PES). Fission as a statistical decay is governed by the phase space of the different decay channels, which are suggested in the PES-landscape. The population of the fission modes is determined by the minima in the PES at the scission points and on the internal potential barriers. The ternary collinear decay proceeds as a sequential process, in two steps. The originally observed ternary decay of {sup 252}Cf(sf) into three different masses (e.g. {sup 132–140}Sn, {sup 52–48}Ca, {sup 68–72}Ni), observed by the FOBOS group in the FLNR (Flerov Laboratory for Nuclear Reactions) of the JINR (Dubna) the collinear cluster tripartition (CCT), is one of the ternary fission modes. This kind of “true ternary fission” of heavy nuclei has often been predicted in theoretical works during the last decades. In the present note we discuss different ternary fission modes in the same system. The PES shows pronounced minima, which correspond to several modes of ternary fragmentations. These decays have very similar dynamical features as the previously observed CCT-decays. The data obtained in the experiments on CCT allow us to extract the yields for different decay modes using specific gates on the measured parameters, and to establish multiple modes of the ternary fission decay.

  12. Identification of new neutron-rich rare-earth nuclei produced in /sup 252/Cf spontaneous fission

    CERN Document Server

    Greenwood, R C; Gehrke, R J; Meikrantz, D H

    1981-01-01

    A program of systematic study of the decay properties of neutron-rich rare-earth nuclei with 30 s252/Cf spontaneous fission, is currently underway using the Idaho ESOL (Elemental Separation On Line) Facility. The chemistry system used for the rare-earth elemental separations consists of two high-performance chromatography columns connected in series and coupled to the /sup 252 /Cf fission source via a helium gas-jet transport arrangement. The time delay for separation and initiation of gamma -ray counting with results which have been obtained to date with this system include the identification of a number of new neutron-rich rare-earth isotopes including /sup 155/Pm (t/sub 1/2/=48+or-4 s) and /sup 163/Gd (t/sub 1 /2/=68+or-3 s), in addition to 5.51 min /sup 158/Sm which was identified in an earlier series of experiments. (11 refs).

  13. Association between TNF promoter -308 G>A and LTA 252 A>G polymorphisms and systemic lupus erythematosus.

    Science.gov (United States)

    Ahmed, Hanan Hosni; Taha, Fatma Mohamed; Darweesh, Hanan El-Sayed; Morsi, Heba Mohamed Abdelhafiz

    2014-01-01

    Tumor necrosis factor (TNF) and lymphotoxin alpha (LTA) are pivotal cytokines in the pathogenesis of systemic lupus erythematosus (SLE). To investigate the possible association of the polymorphism of the TNF promoter gene -308 and that of the LTA gene 252 with susceptibility to SLE and with phenotypic disease features in Egyptian patients. A case control study involving 100 SLE patients and 100 unrelated healthy controls. Polymerase chain reaction and restriction fragment length polymorphism methods were applied to detect genetic polymorphism. We found that TNF-308 genotype AA was significantly increase by 26 % in SLE patients compared to 10 % in the control group (p = 0.003; OR 3.16; CI 1.43-6.98) and the frequency of the A allele of the TNF promoter -308 was significantly higher in the SLE patients (42 %) than in the control subjects (24 %) (p manifestations as malar rash, arthritis, oral ulcers, serositis and systemic lupus erythematosus disease activity index. Genotype (GG+GA) of LTA was significantly associated with arthritis. These results suggest that TNF and LTA genetic polymorphisms contribute to SLE susceptibility in the Egyptian population and are associated with disease characteristics. TNF-308 and LTA+252 polymorphic markers may be used for early diagnosis of SLE and early prediction of clinical manifestations, like arthritis.

  14. RECONCEPTUALIZAREA INCRIMINĂRII TORTURII, TRATAMENTULUI INUMAN SAU DEGRADANT PRIN LEGEA NR.252 DIN 08.11.2012

    Directory of Open Access Journals (Sweden)

    Ursu Daniela

    2016-11-01

    Full Text Available Prezentul studiu este destinat identificării raţiunilor legiuitorului Republicii Moldova de a incrimina cu titlu de nomen iuris faptele de tortură, tratament inuman sau degradant în Capitolul III al Părţii Speciale a Codului penal – „Infracţiuni contra libertăţii, cinstei şi demnităţii persoanei”. Această preocupare este dictată îndeosebi de diferenţele care se impun, în latura amplasării într-un anumit capitol, între actualul model incriminator în materie şi cel care în vigoare până la in­tervenţia Legii Republicii Moldova pentru modificarea şi completarea unor acte legislative, nr.252 din 08.11.2012, prin aceasta revenindu-se la concepţia anterioară de categorisire a torturii, adică la cea consacrată în legea penală în re­dacţia din 1961. Graţie analizei comparative a reglementărilor penale ale Republicii Moldova şi ale altor state referitoare la răspunderea pentru tortură, tratament inuman sau degradant, pe de o parte, şi sintetizării jurisprudenţei CtEDO în materie, pe de altă parte, a fost ilustrată natura juridică şi socială a acestor fapte prejudiciabile, din care s-au putut desprinde explicaţiile de rigoare ce au stat la baza remanierilor legislative intervenite prin Legea Republicii Moldova pentru modi­ficarea şi completarea unor acte legislative, nr.252 din 08.11.2012.RECONSIDERING THE CRIMINALISATION OF TORTURE, INHUMAN OR DEGRADING TREATMENT BY LAW NR.252 OF 8/11/2012This study is dedicated to identification of the rationalities of the Moldovan legislator to criminalise the title of nomen juris the facts of torture, inhuman or degrading treatment in Chapter III of the Special Part of the Criminal Code - "Crimes against freedom, honor and dignity". This concern is dictated particularly by differences that impose a particular side of location in the Chapter, between the current incriminatory model and the matters which operated until the intervention to the Law of the Republic

  15. Importance of the neutrons kerma coefficient in the planning of Brachytherapy treatments with Cf-252 sources; Importancia del coeficiente de kerma de neutrones en la planeacion de tratamientos de Braquiterapia con fuentes de Cf-252

    Energy Technology Data Exchange (ETDEWEB)

    Paredes G, L.; Balcazar G, M. [ININ, 52045 Ocoyocac, Estado de Mexico (Mexico); Azorin N, J. [Universidad Autonoma Metropolitana, 09000 Mexico D.F. (Mexico); Francois L, J.L. [UNAM, 04500 Mexico D.F. (Mexico)]. e-mail: lpg@nuclear.inin.mx

    2006-07-01

    The Cf-252 is a fast neutrons emitting radioisotope by spontaneous fission that can be used as sealed source in medicine applications, industry and research. Commercially its offer sources of different sizes, compact and with a fast neutrons emission of the order of 10{sup 6} n/s-{mu}g and an energy spectra that presents respectively maxim and average energy in 2.1 MeV and 0.7 MeV. In medicine new applications are being developed for the treatment of patient with hypoxic and voluminous tumors, where the therapy with photons has not given positive results, as well as for the protocols of therapy treatment by boron neutron capture, where very small sources of Cf-252 will be used with the interstitial brachytherapy technique of high and low dose rate. In this work an analysis of how the small differences that exist in the elementary composition of 4 wicked tumors, 4 ICRU healthy tissues and 3 substitute materials of ICRU tissue used in dosimetry are presented, its generate changes in the neutrons kerma coefficient in function of the energy and consequently in the absorbed dose in the interval of 11 eV to 29 MeV. These differences can produce maximum variations of the neutron kerma coefficients ratio for E{sub n} > 1 keV of the one: 15% tumor/ICRU guest healthy tissue, 12% ICRU tumor/muscle, 12% ICRU healthy tissues ICRU/ICRU muscle, 22% substitutes tissue/tumor and 22% ICRU substitutes tissue/muscle. Also, it was found that the average value of the neutrons kerma coefficient for the 4 wicked tumors is from 6% to 7% smaller that the average value for the soft tissue in the interval energy of interest for therapy with fast neutrons with E{sub n} > 1 MeV. These results have a special importance during the planning process of brachytherapy treatments with sources of {sup 252}Cf, to optimize and to individualize the patients treatments. (Author)

  16. Monte Carlo simulation optimisation of zinc sulphide based fast-neutron detector for radiography using a {sup 252}Cf source

    Energy Technology Data Exchange (ETDEWEB)

    Meshkian, Mohsen, E-mail: mohsenm@ethz.ch

    2016-02-01

    Neutron radiography is rapidly extending as one of the methods for non-destructive screening of materials. There are various parameters to be studied for optimising imaging screens and image quality for different fast-neutron radiography systems. Herein, a Geant4 Monte Carlo simulation is employed to evaluate the response of a fast-neutron radiography system using a {sup 252}Cf neutron source. The neutron radiography system is comprised of a moderator as the neutron-to-proton converter with suspended silver-activated zinc sulphide (ZnS(Ag)) as the phosphor material. The neutron-induced protons deposit energy in the phosphor which consequently emits scintillation light. Further, radiographs are obtained by simulating the overall radiography system including source and sample. Two different standard samples are used to evaluate the quality of the radiographs.

  17. Monte Carlo simulation optimisation of zinc sulphide based fast-neutron detector for radiography using a 252Cf source

    Science.gov (United States)

    Meshkian, Mohsen

    2016-02-01

    Neutron radiography is rapidly extending as one of the methods for non-destructive screening of materials. There are various parameters to be studied for optimising imaging screens and image quality for different fast-neutron radiography systems. Herein, a Geant4 Monte Carlo simulation is employed to evaluate the response of a fast-neutron radiography system using a 252Cf neutron source. The neutron radiography system is comprised of a moderator as the neutron-to-proton converter with suspended silver-activated zinc sulphide (ZnS(Ag)) as the phosphor material. The neutron-induced protons deposit energy in the phosphor which consequently emits scintillation light. Further, radiographs are obtained by simulating the overall radiography system including source and sample. Two different standard samples are used to evaluate the quality of the radiographs.

  18. Comparative dosimetry in intracavitary balloon catheter brachytherapy with I-125 and in Cf-252 brachytherapy combined with BNCT for brain tumors

    Energy Technology Data Exchange (ETDEWEB)

    Brandao, Samia de Freitas, E-mail: samiabrandao@gmail.com [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Departamento de Engenharia Nuclear; Campos, Tarcisio Passos Ribeiro de [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil)

    2013-06-15

    Objective: comparative analysis of dosimetry in intracavitary balloon catheter brachytherapy with I-125 and in Cf-252 brachytherapy combined with BNCT for treatment of brain tumors. Materials and methods: simulations of intracavitary balloon catheter brachytherapy with I-125 and in Cf-252 brachytherapy combined with BNCT were performed with the MCNP5 code, modeling the treatment of a brain tumor on a voxel computational phantom representing a human head. Absorbed dose rates were converted into biologically weighted dose rates. Results: intracavitary balloon catheter brachytherapy with I-125 produced biologically weighted mean dose rates of 3.2E-11, 1.3E-10, 1.9E-11 and 6.9E-13 RBE.Gy.h{sup -1}.p{sup -1}.s, respectively, on the healthy tissue, on the balloon periphery and on the /{sub 1} and /{sub 2} tumor infiltration zones. On the other hand, Cf-252 brachytherapy combined with BNCT produced a biologically weighted mean dose rate of 5.2E-09, 2.3E-07, 8.7E-09 and 2.4E-09 RBE.Gy.h{sup -1}.p{sup -1}.s, respectively on the healthy tissue, on the target tumor and on the /{sub 1} and /{sub 2} infiltration zones. Conclusion: Cf-252 brachytherapy combined with BNCT delivered a selective irradiation to the target tumor and to infiltration zones, while intracavitary balloon catheter brachytherapy with I-125 delivered negligible doses on the tumor infiltration zones. (author)

  19. The precise measurements of integral (over spectrum of Cf-252) total neutron cross-sections and transmission coefficients for the testing of differential total cross-section

    Energy Technology Data Exchange (ETDEWEB)

    Guzhovskii, B.Ya.; Grebennikov, A.N.; Gorelov, V.P.; Farafontov, G.G.; Rudnev, V.S. [Russian Federal Nuclear Center, Arzamas (Russian Federation)

    1994-12-31

    The integral total cross-sections of nuclei Be, C, Al, Fe, Ni, Cu, Nb, Mo, Ta, W and U-238 were measured on Cf-252 spontaneous fission neutron spectrum and compared by calculated values from various libraries of evaluated neutron data.

  20. 47 CFR 15.252 - Operation of wideband vehicular radar systems within the bands 16.2-17.7 GHz and 23.12-29.0 GHz.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 1 2010-10-01 2010-10-01 false Operation of wideband vehicular radar systems..., Additional Provisions § 15.252 Operation of wideband vehicular radar systems within the bands 16.2-17.7 GHz and 23.12-29.0 GHz. (a) Operation under this section is limited to field disturbance sensors that are...

  1. Comparative dosimetry in intracavitary balloon catheter brachytherapy with I-125 and in Cf-252 brachytherapy combined with BNCT for brain tumors

    Directory of Open Access Journals (Sweden)

    Samia de Freitas Brandao

    2013-07-01

    Full Text Available Objective Comparative analysis of dosimetry in intracavitary balloon catheter brachytherapy with I-125 and in Cf-252 brachytherapy combined with BNCT for treatment of brain tumors. Materials and Methods Simulations of intracavitary balloon catheter brachytherapy with I-125 and in Cf-252 brachytherapy combined with BNCT were performed with the MCNP5 code, modeling the treatment of a brain tumor on a voxel computational phantom representing a human head. Absorbed dose rates were converted into biologically weighted dose rates. Results Intracavitary balloon catheter brachytherapy with I-125 produced biologically weighted mean dose rates of 3.2E-11, 1.3E-10, 1.9E-11 and 6.9E-13 RBE.Gy.h-1.p-1.s, respectively, on the healthy tissue, on the balloon periphery and on the I 1 and I 2 tumor infiltration zones. On the other hand, Cf-252 brachytherapy combined with BNCT produced a biologically weighted mean dose rate of 5.2E-09, 2.3E-07, 8.7E-09 and 2.4E-09 RBE.Gy.h-1.p-1.s, respectively on the healthy tissue, on the target tumor and on the I 1 and I 2 infiltration zones. Conclusion Cf-252 brachytherapy combined with BNCT delivered a selective irradiation to the target tumor and to infiltration zones, while intracavitary balloon catheter brachytherapy with I-125 delivered negligible doses on the tumor infiltration zones.

  2. Influence of gain-of-function mutation (Ser252Trp in fibroblast growth factor receptor 2 gene on long bone development

    Directory of Open Access Journals (Sweden)

    Peng CHEN

    2013-07-01

    Full Text Available Objective To observe the early postnatal long bone development in Fgfr2+/S252W mutant mice and littermate wild-type (WT mice, and explore the effect of continued function enhancement of fibroblast growth factor receptor 2 (FGFR2 gene on endochondral ossification. Methods A mouse model of Fgfr2+/S252W simulated human Apert syndrome was reproduced by knock-in technique, and then the gain-of-function mutation Fgfr2+/S252W mice and littermate WT mice were obtained after breeding and identification. Three Fgfr2+/S252W and same number of WT mice were sacrificed at 7, 10, 14 and 28 postnatal days respectively, and the morphology of long bone was examined with X-ray and Micro CT, the structure of bone and cartilage was observed by HE staining, and the expression of gene in growth plate was observed by immunohistochemical analysis. Results Fgfr2+/S252W mouse model exhibited typical craniosynostosis and brachycephalium of Apert syndrome, accompanied by short stature, growth retardation of long bone, delayed appearance of secondary ossification center, decrease of bone density and trabecula number. HE staining showed noticeable shortened zones of proliferation and hypertrophic chondrocytes, irregularity of cell arrangement, and small hypertrophic chondrocytes in the growth plates of the mutant mice. Immunohistochemical analysis revealed that the expression of genes related to chondrocytes proliferation and differentiation was decreased in mutant mice. Conclusions Gain-of-function mutation in FGFR2 may lead to abnormal development of long bone in mice. FGFR2 may have the function of regulating the development both of osteoblast and chondrocyte lineages, and play an important role in the process of skeletal development.

  3. Abscesso pulmonar de aspiração: análise de 252 casos consecutivos estudados de 1968 a 2004 Lung abscess: analysis of 252 consecutive cases diagnosed between 1968 and 2004

    Directory of Open Access Journals (Sweden)

    José da Silva Moreira

    2006-04-01

    Full Text Available OBJETIVO: Apresentar a experiência de um serviço especializado em doenças respiratórias no manejo de casos de abscesso pulmonar de aspiração. MÉTODOS: Descrevem-se aspectos diagnósticos e resultados terapêuticos de 252 casos consecutivos de pacientes com abscesso de pulmão, hospitalizados de 1968 a 2004. RESULTADOS: Dos 252 casos, 209 ocorreram em homens e 43 em mulheres, com média de idade de 41,4 anos. Eram alcoolistas 70,2% dos pacientes. Tosse, expectoração, febre e comprometimento do estado geral ocorreram em mais de 97% dos casos, 64% tinham dor torácica, 30,2% hipocratismo digital, 82,5% apresentavam dentes em mau estado de conservação, 78,6% tiveram episódio de perda de consciência e 67,5% apresentavam odor fétido de secreções broncopulmonares. Em 85,3% dos casos as lesões localizavam-se nos segmentos posterior de lobo superior ou superior de lobo inferior, 96,8% delas unilateralmente. Em 24 pacientes houve associação de empiema pleural (9,5%. Flora mista foi identificada em secreções broncopulmonares ou pleurais em 182 pacientes (72,2 %. Todos os doentes foram inicialmente tratados com antibióticos (principalmente penicilina ou clindamicina e 98,4 % deles foram submetidos à drenagem postural. Procedimentos cirúrgicos foram efetuados em 52 (20,6% pacientes (24 drenagens de empiema, 22 ressecções pulmonares e 6 pneumostomias. Cura foi obtida em 242 pacientes (96,0% e 10 faleceram (4,0%. CONCLUSÃO: O abscesso pulmonar de aspiração ocorreu predominantemente em indivíduos adultos masculinos com doença dentária e episódio antecedente de perda de consciência (especialmente por alcoolismo. A maioria dos pacientes foi tratada clinicamente (antibióticos e drenagem postural. Um quinto deles submeteu-se a algum procedimento cirúrgico.OBJECTIVE: To relate the experience of the staff at a health care facility specializing in the management of patients with aspiration lung abscess. METHODS: Diagnostic aspects

  4. Comparison Of 252Cf Time Correlated Induced Fisssion With AmLi Induced Fission On Fresh MTR Research Reactor Fuel

    Energy Technology Data Exchange (ETDEWEB)

    Joshi, Jay Prakash [Los Alamos National Laboratory

    2017-03-30

    The effective application of international safeguards to research reactors requires verification of spent fuel as well as fresh fuel. To accomplish this goal various nondestructive and destructive assay techniques have been developed in the US and around the world. The Advanced Experimental Fuel Counter (AEFC) is a nondestructive assay (NDA) system developed at Los Alamos National Laboratory (LANL) combining both neutron and gamma measurement capabilities. Since spent fuel assemblies are stored in water, the system was designed to be watertight to facilitate underwater measurements by inspectors. The AEFC is comprised of six 3He detectors as well as a shielded and collimated ion chamber. The 3He detectors are used for active and passive neutron coincidence counting while the ion chamber is used for gross gamma counting. Active coincidence measurement data is used to measure residual fissile mass, whereas the passive coincidence measurement data along with passive gamma measurement can provide information about burnup, cooling time, and initial enrichment. In the past, most of the active interrogation systems along with the AEFC used an AmLi neutron interrogation source. Owing to the difficulty in obtaining an AmLi source, a 252Cf spontaneous fission (SF) source was used during a 2014 field trail in Uzbekistan as an alternative. In this study, experiments were performed to calibrate the AEFC instrument and compare use of the 252Cf spontaneous fission source and the AmLi (α,n) neutron emission source. The 252Cf source spontaneously emits bursts of time-correlated prompt fission neutrons that thermalize in the water and induce fission in the fuel assembly. The induced fission (IF) neutrons are also time correlated resulting in more correlated neutron detections inside the 3He detector, which helps reduce the statistical errors in doubles when using the 252Cf interrogation source instead of

  5. Biochemical, kinetic, and in silico characterization of DING protein purified from probiotic lactic acid bacteria Pediococcus acidilactici NCDC 252.

    Science.gov (United States)

    Attri, Pooja; Khaket, Tejinder P; Jodha, Drukshakshi; Singh, Jasbir; Dhanda, Suman

    2015-01-01

    DING proteins are intriguing proteins characterized by conserved N-terminal sequence. In spite of unusually high sequence conservation even between distantly related species, DING proteins exhibit outstanding functional diversity. An extracellular caseinolytic alkaline enzyme was purified to homogeneity from a probiotic lactic acid bacteria Pediococcus acidilactici NCDC 252 using a simple procedure involving ammonium sulphate precipitation and gel filtration chromatography. This was purified 45.72-fold with a yield and specific activity of 43.5 % and 250 U/mg, respectively. The calculated molecular weight was 38.7 and 38.9 kDa by MALDI and SDS-PAGE, respectively, and pI was 7.77. The enzyme exhibited optimal activity at pH 8.0 and 40 °C. It was considerably stable up to pH 12. For casein, the enzyme had K m of 20 μM with V max of 26 U/ml. The enzyme was resistant to organic solvents but sensitive to DTNB and EDTA that confirmed it as thiol protein with involvement of metal ions in catalysis. Its tryptic peptide fragments showed 95 % similarity with eukaryotic DING, i.e., human phosphate binding protein (HPBP). Homology-based structure evaluation using HBPB as template revealed both to be structurally conserved and also possessing conserved phosphate binding motifs.

  6. Experimental Investigation on Propagation Characteristics of PD Radiated UHF Signal in Actual 252 kV GIS

    Directory of Open Access Journals (Sweden)

    Tianhui Li

    2017-07-01

    Full Text Available For partial discharge (PD diagnostics in gas insulated switchgears (GISs based on the ultra-high-frequency (UHF method, it is essential to study the attenuation characteristics of UHF signals so as to improve the application of the UHF technique. Currently, the performance of UHF has not been adequately considered in most experimental research, while the constructive conclusions about the installation and position of UHF sensors are relatively rare. In this research, by using a previously-designed broadband sensor, the output signal is detected and analyzed experimentally in a 252 kV GIS with L-shaped structure and disconnecting switch. Since the relative position of the sensor and the defect is usually fixed by prior research, three circumferential angle positions of the defect in cross section are performed. The results are studied by time, statistics and frequency analyses. This identifies that the discontinuity conductor of DS will lead to a rise of both the peak to peak value (Vpp and the transmission rate of the UHF signal. Then, the frequency analysis indicates that the reason for the distinction of signal amplitude and transmission rate is that the mode components of the PD signal are distinctively affected by the special structure of GIS. Finally, the optimal circumferential angle position of the UHF Sensor is given based on the comparison of transmission rates.

  7. Measurement of the energy spectrum of {sup 252}Cf fission fragments using nuclear track detectors and digital image processing

    Energy Technology Data Exchange (ETDEWEB)

    Espinosa, G.; Golzarri, J. I. [UNAM, Instituto de Fisica, Circuito Exterior, Ciudad Universitaria, 04510 Mexico D. F. (Mexico); Castano, V. M. [UNAM, Centro de Fisica Aplicada y Tecnologia Avanzada, Boulevard Juriquilla 3001, Santiago de Queretaro, 76230 Queretaro (Mexico); Gaso, I. [ININ, Carretera Mexico-Toluca s/n, Ocoyoacac 52750, Estado de Mexico (Mexico); Mena, M.; Segovia, N. [UNAM, Instituto de Geofisica, Circuito de la Investigacion Cientifica, Ciudad Universitaria, 04510 Mexico D. F. (Mexico)

    2010-02-15

    The energy spectrum of {sup 252}Cf fission fragments was measured using nuclear track detectors and digital image analysis system. The detection material was fused silica glass. The detectors were chemically etched in an 8% HF solution. After experimenting with various etching time, it was found that the best resolution of the track diameter distribution was obtained after 30 minutes of etching. Both Gaussian and Lorentzian curves were fit to the track diameter distribution histograms and used to determine the basic parameters of the distribution of the light (N{sub L}) and heavy (N{sub H}) formed peaks and the minimum of the central valley (N{sub V}). Advantages of the method presented here include the fully-automated analysis process, the low cost of the nuclear track detectors and the simplicity of the nuclear track method. The distribution resolution obtained by this method is comparable with the resolution obtained by electronic analysis devices. The descriptive variables calculated were very close to those obtained by other methods based on the use of semiconductor detectors. (Author)

  8. Effects of Exposure of Pink Shrimp, Farfantepenaeus duorarum, Larvae to Macondo Canyon 252 Crude Oil and the Corexit Dispersant

    Directory of Open Access Journals (Sweden)

    Susan Laramore

    2016-03-01

    Full Text Available The release of oil into the Gulf of Mexico (GOM during the Deepwater Horizon event coincided with the white and pink shrimp spawning season. To determine the potential impact on shrimp larvae a series of static acute (24–96 h toxicity studies with water accommodated fractions (WAFs of Macondo Canyon (MC 252 crude oil, the Corexit 9500A dispersant, and chemically enhanced WAFS (CEWAFs were conducted with nauplii, zoea, mysid, and postlarval Farfantepenaeus duorarum. Median lethal concentrations (LC50 were calculated and behavior responses (swimming, molting, light sensitivity evaluated. Impacts were life stage dependent with zoea being the most sensitive. Behavioral responses for all stages, except postlarvae, occurred at below LC50 values. Dispersants had the greatest negative impact while WAFs had the least. No short-term effects (survival, growth were noted for nauplii exposed to sub-lethal CEWAFs 39 days post-exposure. This study points to the importance of evaluating multiple life stages to assess population effects following contaminant exposure and further, that the use of dispersants as a method of oil removal increases oil toxicity.

  9. Gamma-ray multiplicity measurement of the spontaneous fission of {sup 252}Cf in a segmented HPGe/BGO detector array

    Energy Technology Data Exchange (ETDEWEB)

    Bleuel, D.L., E-mail: bleuel1@llnl.go [Lawrence Livermore National Laboratory, Livermore, CA 94551 (United States); Bernstein, L.A.; Burke, J.T. [Lawrence Livermore National Laboratory, Livermore, CA 94551 (United States); Gibelin, J. [Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States); Heffner, M.D. [Lawrence Livermore National Laboratory, Livermore, CA 94551 (United States); Mintz, J. [Nuclear Engineering Department, University of California, Berkeley, CA 94720 (United States); Norman, E.B. [Lawrence Livermore National Laboratory, Livermore, CA 94551 (United States); Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States); Nuclear Engineering Department, University of California, Berkeley, CA 94720 (United States); Phair, L. [Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States); Scielzo, N.D.; Sheets, S.A.; Snyderman, N.J.; Stoyer, M.A. [Lawrence Livermore National Laboratory, Livermore, CA 94551 (United States); Wiedeking, M. [Lawrence Livermore National Laboratory, Livermore, CA 94551 (United States); Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States)

    2010-12-21

    Coincident {gamma} rays from a {sup 252}Cf source were measured using an array of six segmented high-purity germanium (HPGe) Clover detectors each enclosed by 16 bismuth-germanate (BGO) detectors. The detectors were arranged in a cubic pattern around a 1{mu}Ci{sup 252}Cf source to cover a large solid angle for {gamma}-ray measurement with a reasonable reconstruction of the multiplicity. Neutron multiplicity was determined in certain cases by identifying the prompt {gamma} rays from individual fission fragment pairs. Multiplicity distributions from previous experiments and theoretical models were convolved with the response function of the array and compared to the present results. These results suggest a {gamma}-ray multiplicity spectrum broader than previous measurements and models, and provide no evidence of correlation with neutron multiplicity.

  10. Residues 248-252 and 300-304 of the cardiac Na+/Ca2+ exchanger are involved in its regulation by phospholemman.

    Science.gov (United States)

    Zhang, Xue-Qian; Wang, JuFang; Song, Jianliang; Ji, Angi M; Chan, Tung O; Cheung, Joseph Y

    2011-10-01

    Using split cardiac Na(+)/Ca(2+) exchangers (NCX1), we previously demonstrated that phospholemman (PLM) regulates NCX1 by interacting with the proximal linker domain (residues 218-358) of the intracellular loop of NCX1. With the use of overlapping loop deletion mutants, interaction sites are localized to two regions spanning residues 238-270 and residues 300-328 of NCX1. In this study, we used alanine (Ala) linker scanning to pinpoint the residues in the proximal linker domain involved in regulation of NCX1 by PLM. Transfection of human embryonic kidney (HEK)293 cells with wild-type (WT) NCX1 or its Ala mutants but not empty vector resulted in NCX1 current (I(NaCa)). Coexpression of PLM with WT NCX1 inhibited I(NaCa). Mutating residues 248-252 (PASKT) or 300-304 (QKHPD) in WT NCX1 to Ala resulted in loss of inhibition of I(NaCa) by PLM. By contrast, inhibition of I(NaCa) by PLM was preserved when residues 238-242, 243-247, 253-257, 258-262, 263-267, 305-309, 310-314, 315-319, 320-324, or 325-329 were mutated to Ala. While mutating residue 301 to alanine completely abolished PLM inhibition, mutation of any single residue 250-252, 300, or 302-304 resulted in partial reduction in inhibition. Mutating residues 248-252 to Ala resulted in significantly weaker association with PLM. The NCX1-G503P mutant that lacks Ca(2+)-dependent activation retained its sensitivity to PLM. We conclude that residues 248-252 and 300-304 in the proximal linker domain of NCX1 were involved in its inhibition by PLM.

  11. Residues 248–252 and 300–304 of the cardiac Na+/Ca2+ exchanger are involved in its regulation by phospholemman

    Science.gov (United States)

    Zhang, Xue-Qian; Wang, JuFang; Song, Jianliang; Ji, Angi M.; Chan, Tung O.

    2011-01-01

    Using split cardiac Na+/Ca2+ exchangers (NCX1), we previously demonstrated that phospholemman (PLM) regulates NCX1 by interacting with the proximal linker domain (residues 218–358) of the intracellular loop of NCX1. With the use of overlapping loop deletion mutants, interaction sites are localized to two regions spanning residues 238–270 and residues 300–328 of NCX1. In this study, we used alanine (Ala) linker scanning to pinpoint the residues in the proximal linker domain involved in regulation of NCX1 by PLM. Transfection of human embryonic kidney (HEK)293 cells with wild-type (WT) NCX1 or its Ala mutants but not empty vector resulted in NCX1 current (INaCa). Coexpression of PLM with WT NCX1 inhibited INaCa. Mutating residues 248–252 (PASKT) or 300–304 (QKHPD) in WT NCX1 to Ala resulted in loss of inhibition of INaCa by PLM. By contrast, inhibition of INaCa by PLM was preserved when residues 238–242, 243–247, 253–257, 258–262, 263–267, 305–309, 310–314, 315–319, 320–324, or 325–329 were mutated to Ala. While mutating residue 301 to alanine completely abolished PLM inhibition, mutation of any single residue 250–252, 300, or 302–304 resulted in partial reduction in inhibition. Mutating residues 248–252 to Ala resulted in significantly weaker association with PLM. The NCX1-G503P mutant that lacks Ca2+-dependent activation retained its sensitivity to PLM. We conclude that residues 248–252 and 300–304 in the proximal linker domain of NCX1 were involved in its inhibition by PLM. PMID:21734189

  12. Dermal exposure to weathered MC252 crude oil results in echocardiographically identifiable systolic myocardial dysfunction in double-crested cormorants (Phalacrocorax auritus).

    Science.gov (United States)

    Harr, K E; Rishniw, M; Rupp, T L; Cacela, D; Dean, K M; Dorr, B S; Hanson-Dorr, K C; Healy, K; Horak, K; Link, J E; Reavill, D; Bursian, S J; Cunningham, F L

    2017-12-01

    During the Deepwater Horizon Natural Resource Damage Assessment, gross morphologic cardiac abnormalities, including softer, more distensible musculature, were noted upon gross necropsy in hearts from laughing gulls and double-crested cormorants exposed to weathered MC252 crude oil. A species specific, echocardiographic technique was developed for antemortem evaluation of function that was used to evaluate and better characterize cardiac dysfunction. Control (n=12) and treated (n=13) cormorant groups of similar sex-ratio and ages were dermally treated with approximately 13ml of water or weathered MC252 crude oil, respectively, every 3 days for 6 dosages. This resulted in a low to moderate external exposure. Upon visualization and clinical assessment of the hearts of all test subjects, comprehensive diagnostic cardiographic measurements were taken twice, prior to oil application and after a 21day dermal oil exposure. Oil-treated birds showed a decrease in cardiac systolic function, as characterized by an increased left ventricular internal dimension-systole and left ventricular stroke volume as well as concurrent decreased left ventricular ejection fraction and left ventricular fractional shortening when compared to both control birds' and the treated birds' time zero values. These changes are indicative of a possible dilative cardiomyopathy induced by oil exposure, although further elucidation of possible collagen damage is recommended. Arrhythmias including tachycardia in two treated birds and bradycardia in all treated birds were documented, indicating further clinically significant abnormalities induced by MC252 oil that warrant further investigation. A statistically significant increase in free calcium concentration, important to muscular and neurologic function in treated birds was also noted. This study documents that weathered MC252 oil caused clinically significant cardiac dysfunction that could result in mortality and decrease recruitment. Copyright © 2017

  13. New source-moderator geometry to improve performance of {sup 252}Cf and {sup 241}Am-Be source-based PGNAA setups

    Energy Technology Data Exchange (ETDEWEB)

    Naqvi, A.A. [Department of Physics, King Fahd University of Petroleum and Minerals, Dhahran 31261 (Saudi Arabia)]. E-mail: aanaqvi@kfupm.edu.sa; Abdelmonem, M.S. [Department of Physics, King Fahd University of Petroleum and Minerals, Dhahran 31261 (Saudi Arabia); Al-Misned, Ghada [Girls Education College, Riyadh Girls Colleges, Riyadh (Saudi Arabia); Al-Ghamdi, Hanan [Girls Education College, Riyadh Girls Colleges, Riyadh (Saudi Arabia)

    2006-06-15

    The gamma ray yield from a {sup 252}Cf and a {sup 241}Am-Be source-based Prompt Gamma Ray Activation Analysis (PGNAA) setup has been observed to increase with enclosing their neutrons sources in a high-density polyethylene moderator. The prompt gamma rays yield from both setups depends upon the moderator length and the source position in it. For both setups, the optimum moderator length is found to be 7 cm. The optimum position of the neutron source inside moderator of the {sup 252}Cf and the {sup 241}Am-Be source-based PGNAA setups was found to be at a distance of 0.5 and 0.75 cm from the moderator-end facing the sample, respectively. Due to enclosure of the source in the moderator, about three-fold increase has been observed in the yield of prompt gamma rays from a Portland cement sample of a {sup 252}Cf and a {sup 241}Am-Be source-based PGNAA setups.

  14. Generation of the V4.2m5 and AMPX and MPACT 51 and 252-Group Libraries with ENDF/B-VII.0 and VII.1

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Kang Seog [Oak Ridge National Laboratory (ORNL), Oak Ridge, TN (United States). Consortium for Advanced Simulation of LWRs (CASL)

    2016-12-12

    The evaluated nuclear data file (ENDF)/B-7.0 v4.1m3 MPACT 47-group library has been used as a main library for the Consortium for Advanced Simulation of Light Water Reactors (CASL) neutronics simulator in simulating pressurized water reactor (PWR) problems. Recent analysis for the high void boiling water reactor (BWR) fuels and burnt fuels indicates that the 47-group library introduces relatively large reactivity bias. Since the 47- group structure does not match with the SCALE 6.2 252-group boundaries, the CASL Virtual Environment for Reactor Applications Core Simulator (VERA-CS) MPACT library must be maintained independently, which causes quality assurance concerns. In order to address this issue, a new 51-group structure has been proposed based on the MPACT 47- g and SCALE 252-g structures. In addition, the new CASL library will include a 19-group structure for gamma production and interaction cross section data based on the SCALE 19- group structure. New AMPX and MPACT 51-group libraries have been developed with the ENDF/B-7.0 and 7.1 evaluated nuclear data. The 19-group gamma data also have been generated for future use, but they are only available on the AMPX 51-g library. In addition, ENDF/B-7.0 and 7.1 MPACT 252-g libraries have been generated for verification purposes. Various benchmark calculations have been performed to verify and validate the newly developed libraries.

  15. Identifying involvement of Lys251/Asp252 pair in electron transfer and associated proton transfer at the quinone reduction site of Rhodobacter capsulatus cytochrome bc1.

    Science.gov (United States)

    Kuleta, Patryk; Sarewicz, Marcin; Postila, Pekka; Róg, Tomasz; Osyczka, Artur

    2016-10-01

    Describing dynamics of proton transfers in proteins is challenging, but crucial for understanding processes which use them for biological functions. In cytochrome bc1, one of the key enzymes of respiration or photosynthesis, proton transfers engage in oxidation of quinol (QH2) and reduction of quinone (Q) taking place at two distinct catalytic sites. Here we evaluated by site-directed mutagenesis the contribution of Lys251/Asp252 pair (bacterial numbering) in electron transfers and associated with it proton uptake to the quinone reduction site (Qi site). We showed that the absence of protonable group at position 251 or 252 significantly changes the equilibrium levels of electronic reactions including the Qi-site mediated oxidation of heme bH, reverse reduction of heme bH by quinol and heme bH/Qi semiquinone equilibrium. This implicates the role of H-bonding network in binding of quinone/semiquinone and defining thermodynamic properties of Q/SQ/QH2 triad. The Lys251/Asp252 proton path is disabled only when both protonable groups are removed. With just one protonable residue from this pair, the entrance of protons to the catalytic site is sustained, albeit at lower rates, indicating that protons can travel through parallel routes, possibly involving water molecules. This shows that proton paths display engineering tolerance for change as long as all the elements available for functional cooperation secure efficient proton delivery to the catalytic site. Copyright © 2016 The Authors. Published by Elsevier B.V. All rights reserved.

  16. Biological, chemical and other data collected aboard the THOMAS G. THOMPSON during cruise TN252 in the Coastal Waters of SE Alaska and North Pacific Ocean from 2010-07-26 to 2010-08-23 (NODC Accession 0104356)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0104356 includes biological, chemical, optical, physical and underway data collected aboard the THOMAS G. THOMPSON during cruise TN252 in the Coastal...

  17. Deepwater Horizon MC252 incident wellhead location and bathymetry data from the Environmental Resource Management Application (ERMA) collected between 2010-06-01 to 2010-07-31 in the Northern Gulf of Mexico (NCEI Accession 0163804)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This Archival Information Package (AIP) contains three Environmental Resource Management Application (ERMA) GIS layers that depict the Mississippi Canyon 252...

  18. Some characteristics of two azoreductase systems in rat liver. Relevance to the activity of 2-[4'-di(2"-bromopropyl)-aminophenylazo]benzoic acid (CB10-252), a compound possessing latent cytotoxic activity

    DEFF Research Database (Denmark)

    Autrup, Herman; Warwick, Gerald P.

    1975-01-01

    organs particularly in the spleen. DAB-azoreductase as shown previously is present almost entirely in the microsomal fraction and is found in high concentration only in liver. The pH maxima for CB10-252-azoreductase and DAB-azoreductase were 6.2 and 6.9, respectively. Methylred-azoreductase had...... properties in most respects similar to CBlO-252-azoreductase implying the importance of the 2'-car☐yl group in determining substrate specificity. The use of enzyme inhibitors and other additives showed that CB10-252 was not xanthine oxidase or dihydrofolate reductase. Its activity was not affected by carbon...... monoxide, phenobarbitone (PB), or 3-methylcholanthrene (MC) pretreatment. Enhancement of the activity by ferrous ions and FAD indicated that at least part of the reduction system could involve a flavoprotein with FAD as the prosthetic group. The activity of CB10-252-azoreductase and methylred-azoreductase...

  19. Separation of Transplutonium Elements from Neutron Irradiated Americium-241

    National Research Council Canada - National Science Library

    UENO, Kaoru; WATANABE, Kenju; SAGAWA, Chiaki; ISHIMORI, Tomitaro

    1974-01-01

    .... The ratios of the amounts present of these isotopes were determined by mass spectrometry. It was not possible to identify 249Bk in the berkelium fraction owing to the interference from other β-ray emitting nuclides. In the californium fraction, both spontaneous fission and a-activities due to 250, 252 were observed.

  20. Metastable charge-transfer state of californium(iii) compounds.

    Science.gov (United States)

    Liu, Guokui; Cary, Samantha K; Albrecht-Schmitt, Thomas E

    2015-06-28

    Among a series of anomalous physical and chemical properties of Cf(iii) compounds revealed by recent investigations, the present work addresses the characteristics of the optical spectra of An(HDPA)3·H2O (An = Am, Cm, and Cf), especially the broadband photoluminescence from Cf(HDPA)3·H2O induced by ligand-to-metal charge transfer (CT). As a result of strong ion-ligand interactions and the relative ease of reducing Cf(iii) to Cf(ii), a CT transition occurs at low energy (transfer state undergoes radiative and non-radiative relaxations. Broadening of the CT transition arises from strong vibronic coupling and hole-charge interactions in the valence band. The non-radiative relaxation of the metastable CT state results from a competition between phonon-relaxation and thermal tunneling that populates the excited states of Cf(iii).

  1. Microarray analysis of DNA damage repair gene expression profiles in cervical cancer cells radioresistant to 252Cf neutron and X-rays

    Directory of Open Access Journals (Sweden)

    Yang Zhen-Zhou

    2010-02-01

    Full Text Available Abstract Background The aim of the study was to obtain stable radioresistant sub-lines from the human cervical cancer cell line HeLa by prolonged exposure to 252Cf neutron and X-rays. Radioresistance mechanisms were investigated in the resulting cells using microarray analysis of DNA damage repair genes. Methods HeLa cells were treated with fractionated 252Cf neutron and X-rays, with a cumulative dose of 75 Gy each, over 8 months, yielding the sub-lines HeLaNR and HeLaXR. Radioresistant characteristics were detected by clone formation assay, ultrastructural observations, cell doubling time, cell cycle distribution, and apoptosis assay. Gene expression patterns of the radioresistant sub-lines were studied through microarray analysis and verified by Western blotting and real-time PCR. Results The radioresistant sub-lines HeLaNR and HeLaXR were more radioresisitant to 252Cf neutron and X-rays than parental HeLa cells by detecting their radioresistant characteristics, respectively. Compared to HeLa cells, the expression of 24 genes was significantly altered by at least 2-fold in HeLaNR cells. Of these, 19 genes were up-regulated and 5 down-regulated. In HeLaXR cells, 41 genes were significantly altered by at least 2-fold; 38 genes were up-regulated and 3 down-regulated. Conclusions Chronic exposure of cells to ionizing radiation induces adaptive responses that enhance tolerance of ionizing radiation and allow investigations of cellular radioresistance mechanisms. The insights gained into the molecular mechanisms activated by these "radioresistance" genes will lead to new therapeutic targets for cervical cancer.

  2. Some characteristics of two azoreductase systems in rat liver. Relevance to the activity of 2-[4'-di(2"-bromopropyl)-aminophenylazo]benzoic acid (CB10-252), a compound possessing latent cytotoxic activity.

    Science.gov (United States)

    Autrup, H; Warwick, G P

    1975-11-01

    The system involved in the reduction of 2-[4'-di(2''-bromopropyl) aminophenylazolbenzoic acid (CB10-252), an agent designed for treating primary liver cell cancer, has been demonstrated to be localised mainly in the 108 000 X g supernatant fraction of rat liver homogenate. It is also present in other organs particularly in the spleen. DAB-azoreductase as shown previously is present almost entirely in the microsomal fraction and is found in high concentration only in liver. The pH maximum for CB10-252-azoreductase implying the importance of the 2'-carboxyl group in determining substrate specificity. The use of enzyme inhibitors and other additives showed that CB10-252 WAS NOT AXANTHINE OXIDASE OR DIHYDROFOLATE REDUCTASE. Its activity was not affected by carbon monoxide, phenobarbitone (PB), or 3-methylcholanthrene (MC) pretreatment. Enhancement of the activity by ferrous ions and FAD indicated that at least part of the reduction system could involve a flavoprotein with FAD as the prosthetic group. The activity of CB10-252-azoreductase and methylred-azoreductase was reduced by menadione (vitamin K3), cyanide and propylgallate. A diaphorase preparation from pig heart reduced both CB10-252 and methylred with both NADPH- and NADH-generating systems.

  3. Rapid Evolution to Blast Crisis Associated with a Q252H ABL1 Kinase Domain Mutation in e19a2 BCR-ABL1 Chronic Myeloid Leukaemia

    Directory of Open Access Journals (Sweden)

    Sarah L. McCarron

    2013-01-01

    Full Text Available A minority of chronic myeloid leukaemia (CML patients express variant transcripts of which the e19a2 BCR-ABL1 fusion is the most common. Instances of tyrosine kinase inhibitor (TKI resistance in e19a2 BCR-ABL1 CML patients have rarely been reported. A case of e19a2 BCR-ABL1 CML is described in whom imatinib resistance, associated with a Q252H ABL1 kinase domain mutation, became apparent soon after initiation of TKI therapy. The patient rapidly transformed to myeloid blast crisis (BC with considerable bone marrow fibrosis and no significant molecular response to a second generation TKI. The clinical course was complicated by comorbidities with the patient rapidly succumbing to advanced disease. This scenario of Q252H-associated TKI resistance with rapid BC transformation has not been previously documented in e19a2 BCR-ABL1 CML. This case highlights the considerable challenges remaining in the management of TKI-resistant BC CML, particularly in the elderly patient.

  4. Involvement of CD252 (CD134L) and IL-2 in the expression of cytotoxic proteins in bacterial- or viral-activated human T cells.

    Science.gov (United States)

    Walch, Michael; Rampini, Silvana K; Stoeckli, Isabelle; Latinovic-Golic, Sonja; Dumrese, Claudia; Sundstrom, Hanna; Vogetseder, Alexander; Marino, Joseph; Glauser, Daniel L; van den Broek, Maries; Sander, Peter; Groscurth, Peter; Ziegler, Urs

    2009-06-15

    Regulation of cytotoxic effector molecule expression in human CTLs after viral or bacterial activation is poorly understood. By using human autologous dendritic cells (DCs) to prime T lymphocytes, we found perforin only highly up-regulated in virus- (HSV-1, vaccinia virus) but not in intracellular bacteria- (Listeria innocua, Listeria monocytogenes, Mycobacterium tuberculosis, Chlamydophila pneumoniae) activated CTLs. In contrast, larger quantities of IFN-gamma and TNF-alpha were produced in Listeria-stimulated cultures. Granzyme B and granulysin were similarly up-regulated by all tested viruses and intracellular bacteria. DCs infected with HSV-1 showed enhanced surface expression of the costimulatory molecule CD252 (CD134L) compared with Listeria-infected DC and induced enhanced secretion of IL-2. Adding blocking CD134 or neutralizing IL-2 Abs during T cell activation reduced the HSV-dependent up-regulation of perforin. These data indicate a distinct CTL effector function in response to intracellular pathogens triggered via differing endogenous IL-2 production upon costimulation through CD252.

  5. Equilibration in the reaction of 175 and 252 MeV /sup 20/Ne with /sup 197/Au. [Energy, element, and angular distributions

    Energy Technology Data Exchange (ETDEWEB)

    Moulton, J.B.

    1978-06-01

    The highly inelastic nuclear reaction of /sup 197/Au with /sup 20/Ne at 175 and 252 MeV laboratory energies is studied. Energy-, elemental-, and angular- distributions for atomic numbers 5 to 30 (175 MeV) or 34 (252 MeV) are presented. The means and widths of the kinetic energy spectra for detected elements are compared with a theoretical calculation. The calculation postulates thermalization of the incident projectile kinetic energy, and includes one sha(e-vibrational degree of freedom and rigid rotation of the reaction complex. The effect of particle evaporation is considered. Good agreement of the expurimental mean energies with the theory is obtained. Poorer agreement of the kinetic energy widths with the theory may be due to a low-temperature quantal effect. The relative elemental yields are analyzed for their degree of equilibration, based on a model of diffusive nucleon exchange as described by the master equation. A similar degree of equilibration is observed for both reaction energies. The absolute elemental yields are reproduced qualitatively by employing an advanced diffusion code, coupled with calculation of the subsequent fission of heavy reaction products, including the compound nucleus. The angular distributions are analyzed with a simple model, to estimate the reaction lifetime of selected elements.

  6. High sensitivity isotope analysis with a /sup 252/Cf--/sup 235/U fueled subcritical multiplier and low background photon detector systems

    Energy Technology Data Exchange (ETDEWEB)

    Wogman, N.A.; Rieck, H.G. Jr.; Laul, J.C.; MacMurdo, K.W.

    1976-09-01

    A /sup 252/Cf activation analysis facility has been developed for routine multielement analysis of a wide variety of solid and liquid samples. The facility contains six sources of /sup 252/Cf totaling slightly over 100 mg. These sources are placed in a 93 percent /sup 235/U-enriched uranium core which is subcritical with a K effective of 0.985 (multiplication factor of 66). The system produces a thermal flux on the order of 10/sup +1/ neutrons per square centimeter per second. A pneumatic rabbit system permits automatic irradiation, decay, and counting regimes to be performed unattended on the samples. The activated isotopes are analyzed through their photon emissions with state-of-the-art intrinsic Ge detectors, Ge(Li) detectors, and NaI(Tl) multidimensional gamma ray spectrometers. High efficiency (25 percent), low background, anticoincidence shielded Ge(Li) gamma ray detector systems have been constructed to provide the lowest possible background, yet maintain a peak to Compton ratio of greater than 1000 to 1. The multidimensional gamma ray spectrometer systems are composed of 23 cm diameter x 20 cm thick NaI(Tl) crystals surrounded by NaI(Tl) anticoincidence shields. The detection limits for over 65 elements have been determined for this system. Over 40 elements are detectable at the 1 part per million level at a precision of +-10 percent.

  7. Bis(2-{5-[(2-carboxyphenylsulfanylmethyl]-2,4-dimethylbenzylsulfanyl}benzoato-κ2O,O′bis(pyridine-κNiron(II

    Directory of Open Access Journals (Sweden)

    Yu-Min Xu

    2011-02-01

    Full Text Available The title compound, [Fe(C24H21O4S22(C5H5N2], has 2 symmetry. The FeII cation is located on a twofold rotation axis and is O,O′-chelated by two 2-{5-[(2-carboxyphenylsulfanylmethyl]-2,4-dimethylbenzylsulfanyl}benzoate anions and further coordinated by two pyridine ligands in a distorted octahedral geometry. In the anion, the terminal benzene rings are oriented at dihedral angles of 63.81 (14 and 84.50 (14° with respect to the central benzene ring. Intermolecular O—H...O and C—H...O hydrogen bonding is present in the crystal structure.

  8. Scission-point model predictions of fission-fragment mass and total kinetic energy distributions for 236U and 252Cf

    Directory of Open Access Journals (Sweden)

    Ivanyuk Fedor

    2017-01-01

    Full Text Available The total deformation energy at the moment of the neck rupture for 236U and 252Cf is calculated using the Strutinsky's prescription and nuclear shapes described in terms of Cassinian ovals generalized by the inclusion of four additional shape parameters: α1, α2, α3, and α4. The corresponding fragment-mass distributions are estimated supposing that each point in the deformation space is occupied according to a canonical distribution. The energy distributions of fission fragments are calculated assuming the point-charge approximation for the Coulomb interaction of fission fragments. Finally, an alternative definition of the nuclear scission point configuration relying on the minimization of liquid drop energy (optimal shape method is used. Both definitions lead, for these two nuclei, to a reasonably good agreement with the experimental data.

  9. Antidepressant use and risk for mortality in 121,252 heart failure patients with or without a diagnosis of clinical depression

    DEFF Research Database (Denmark)

    Brouwers, Corline; Christensen, Stefan B; Damen, Nikki L

    2016-01-01

    antidepressants at baseline, of which 86.7% (16,780) had no diagnosis of clinical depression. Female gender, older age, higher socio-economic status, more comorbidities, increased use of statins, spironolactone and aspirin, lower use of beta-blockers and ACE-inhibitors, greater HF severity and a diagnosis......BACKGROUND: Depression is a risk factor for mortality in patients with heart failure (HF), however, treating depression with antidepressant therapy does not seem to improve survival. We examined the prevalence of antidepressant use in HF patients, the correlates of antidepressant use subsequent...... to hospital discharge and the relation between antidepressant use, clinical depression and mortality in patients with HF. METHODS: 121,252 HF patients surviving first hospitalization were stratified by antidepressant use and a diagnosis of clinical depression. RESULTS: In total, 15.6% (19,348) received...

  10. Analysis of linear energy transfers and quality factors of charged particles produced by spontaneous fission neutrons from 252Cf and 244Pu in the human body.

    Science.gov (United States)

    Endo, Akira; Sato, Tatsuhiko

    2013-04-01

    Absorbed doses, linear energy transfers (LETs) and quality factors of secondary charged particles in organs and tissues, generated via the interactions of the spontaneous fission neutrons from (252)Cf and (244)Pu within the human body, were studied using the Particle and Heavy Ion Transport Code System (PHITS) coupled with the ICRP Reference Phantom. Both the absorbed doses and the quality factors in target organs generally decrease with increasing distance from the source organ. The analysis of LET distributions of secondary charged particles led to the identification of the relationship between LET spectra and target-source organ locations. A comparison between human body-averaged mean quality factors and fluence-averaged radiation weighting factors showed that the current numerical conventions for the radiation weighting factors of neutrons, updated in ICRP103, and the quality factors for internal exposure are valid.

  11. Lawrence Livermore National Laboratory and Sandia National Laboratory Nuclear Accident Dosimetry Support of IER 252 and the Dose Characterization of the Flattop Reactor at the DAF

    Energy Technology Data Exchange (ETDEWEB)

    Hickman, D. P. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Jeffers, K. L. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Radev, R. P. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Tai, L. I. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Ward, D. C. [Sandia National Lab. (SNL-CA), Livermore, CA (United States); Leonard, E. I. [Sandia National Lab. (SNL-CA), Livermore, CA (United States)

    2017-10-06

    In support of IER 252 “Characterization of the Flattop Reactor at the NCERC”, LLNL performed ROSPEC measurements of the neutron spectrum and deployed 129 Personnel Nuclear Accident Dosimeters (PNAD) to establish the need for height corrections and verification of neutron spectrum evaluation of the fluences and dose. A very limited number of heights (typically only one or two heights) can be measured using neutron spectrometers, therefore it was important to determine if any height correction would be needed in future intercomparisons and studies. Specific measurement positions around the Flatttop reactor are provided in Figure 1. Table 1 provides run and position information for LLNL measurements. The LLNL ROSPEC (R2) was used for run numbers 1 – 7, and vi. PNADs were positioned on trees during run numbers 9, 11, and 13.

  12. Comparative analysis of bacterial community-metagenomics in coastal Gulf of Mexico sediment microcosms following exposure to Macondo oil (MC252)

    KAUST Repository

    Koo, Hyunmin

    2014-09-10

    The indigenous bacterial communities in sediment microcosms from Dauphin Island (DI), Petit Bois Island (PB) and Perdido Pass (PP) of the coastal Gulf of Mexico were compared following treatment with Macondo oil (MC252) using pyrosequencing and culture-based approaches. After quality-based trimming, 28,991 partial 16S rRNA sequence reads were analyzed by rarefaction, confirming that analyses of bacterial communities were saturated with respect to species diversity. Changes in the relative abundances of Proteobacteria, Bacteroidetes and Firmicutes played an important role in structuring bacterial communities in oil-treated sediments. Proteobacteria were dominant in oil-treated samples, whereas Firmicutes and Bacteroidetes were either the second or the third most abundant taxa. Tenericutes, members of which are known for oil biodegradation, were detected shortly after treatment, and continued to increase in DI and PP sediments. Multivariate statistical analyses (ADONIS) revealed significant dissimilarity of bacterial communities between oil-treated and untreated samples and among locations. In addition, a similarity percentage analysis showed the contribution of each species to the contrast between untreated and oil-treated samples. PCR amplification using DNA from pure cultures of Exiguobacterium,  Pseudoalteromonas,  Halomonas and Dyadobacter, isolated from oil-treated microcosm sediments, produced amplicons similar to polycyclic aromatic hydrocarbon-degrading genes. In the context of the 2010 Macondo blowout, the results from our study demonstrated that the indigenous bacterial communities in coastal Gulf of Mexico sediment microcosms responded to the MC252 oil with altered community structure and species composition. The rapid proliferation of hydrocarbonoclastic bacteria suggests their involvement in the degradation of the spilt oil in the Gulf of Mexico ecosystem.

  13. Sentinel node necrosis is a negative prognostic factor in patients with nasopharyngeal carcinoma: a magnetic resonance imaging study of 252 patients

    Science.gov (United States)

    Lu, L.; Wei, X.; Li, Y.H.; Li, W.B.

    2017-01-01

    Purpose We explored the patterns of sentinel node metastasis and investigated the prognostic value of sentinel node necrosis (snn) in patients with nasopharyngeal carcinoma (npc), based on magnetic resonance imaging (mri). Methods This retrospective study enrolled 252 patients at our institution who had metastatic lymph nodes from biopsy-confirmed npc and who were treated with definitive radiation therapy, with or without chemotherapy. All participants underwent mri before treatment, and the resulting images were reviewed to evaluate lymph node status. The patients were divided into snn and non-snn groups. Overall survival (os), tumour-free survival (tfs), regional relapse–free survival (rrfs), and distant metastasis–free survival (dmfs) were calculated by the Kaplan–Meier method, and differences were compared using the log-rank test. Factors predictive of outcome were determined by univariate and multivariate analysis. Results Of the 252 patients, 189 (75%) had retropharyngeal lymph node metastasis, and 189 (75%) had level iia or iib lymph node necrosis. The incidence of snn was 43.4% (91 of 210 patients with lymph node metastasis or necrosis, or both). After a median follow-up of 54 months, the 5-year rates of os, tfs, rrfs, and dmfs in the snn and non-snn groups were, respectively, 79.4% and 95.3%, 73.5% and 93.3%, 80.4% and 96.6%, and 75.5% and 95.3% (all p < 0.01). Age greater than 40 years, snn, T stage, and N stage were significant independent negative prognostic factors for os, tfs, rrfs, and dmfs. Conclusions Metastatic retropharyngeal lymph nodes and necrotic level ii nodes both seem to act as sentinels. Sentinel node necrosis is an negative prognostic factor in patients with npc. Patients with snn have a worse prognosis. PMID:28680290

  14. A complement C5 gene mutation, c.754G>A:p.A252T, is common in the Western Cape, South Africa and found to be homozygous in seven percent of Black African meningococcal disease cases.

    Science.gov (United States)

    Owen, E Patricia; Würzner, Reinhard; Leisegang, Felicity; Rizkallah, Pierre; Whitelaw, Andrew; Simpson, John; Thomas, Andrew D; Harris, Claire L; Giles, Joanna L; Hellerud, Bernt C; Mollnes, Tom E; Morgan, B Paul; Potter, Paul C; Orren, Ann

    2015-03-01

    Patients with genetically determined deficiency of complement component 5 are usually diagnosed because of recurrent invasive Neisseria meningitidis infections. Approximately 40 individual cases have been diagnosed worldwide. Nevertheless, reports of the responsible genetic defects have been sporadic, and we know of no previous reports of C5 deficiency being associated with a number of independent meningococcal disease cases in particular communities. Here we describe C5 deficiency in seven unrelated Western Cape, South African families. Three different C5 mutations c.55C>T:p.Q19X, c.754G>A:p.A252T and c.4426C>T:p.R1476X were diagnosed in index cases from two families who had both presented with recurrent meningococcal disease. p.Q19X and p.R1476X have already been described in North American Black families and more recently p.Q19X in a Saudi family. However, p.A252T was only reported in SNP databases and was not associated with disease until the present study was undertaken in the Western Cape, South Africa. We tested for p.A252T in 140 patients presenting with meningococcal disease in the Cape Town area, and found seven individuals in five families who were homozygous for the mutation p.A252T. Very low serum C5 protein levels (0.1-4%) and correspondingly low in vitro functional activity were found in all homozygous individuals. Allele frequencies of p.A252T in the Black African and Cape Coloured communities were 3% and 0.66% and estimated homozygosities are 1/1100 and 1/22,500 respectively. In 2012 we reported association between p.A252T and meningococcal disease. Molecular modelling of p.A252T has indicated an area of molecular stress in the C5 molecule which may provide a mechanism for the very low level in the circulation. This report includes seven affected families indicating that C5D is not rare in South Africa. Copyright © 2014 The Authors. Published by Elsevier Ltd.. All rights reserved.

  15. Complement factor 5 (C5) p.A252T mutation is prevalent in, but not restricted to, sub-Saharan Africa: implications for the susceptibility to meningococcal disease.

    Science.gov (United States)

    Franco-Jarava, C; Comas, D; Orren, A; Hernández-González, M; Colobran, R

    2017-08-01

    Complement C5 deficiency (C5D) is a rare primary immunodeficiency associated with recurrent infections, particularly meningitis, by Neisseria species. To date, studies to elucidate the molecular basis of hereditary C5D have included fewer than 40 families, and most C5 mutations (13 of 17) have been found in single families. However, the recently described C5 p.A252T mutation is reported to be associated with approximately 7% of meningococcal disease cases in South Africa. This finding raises the question of whether the mutation may be prevalent in other parts of Africa or other continental regions. The aim of this study was to investigate the prevalence of C5 p.A252T in Africa and other regions and discuss the implications for prophylaxis against meningococcal disease. In total, 2710 samples from healthy donors within various populations worldwide were analysed by quantitative polymerase chain reaction (qPCR) assay to detect the C5 p.A252T mutation. Eleven samples were found to be heterozygous for p.A252T, and nine of these samples were from sub-Saharan African populations (allele frequency 0·94%). Interestingly, two other heterozygous samples were from individuals in populations outside Africa (Israel and Pakistan). These findings, together with data from genomic variation databases, indicate a 0·5-2% prevalence of the C5 p.A252T mutation in heterozygosity in sub-Saharan Africa. Therefore, this mutation may have a relevant role in meningococcal disease susceptibility in this geographical area. © 2017 British Society for Immunology.

  16. Mean fission neutron spectrum energies for /sup 252/Cf and fissile nuclides, /sup 233/U, /sup 235/U, /sup 239/Pu and /sup 241/Pu

    Energy Technology Data Exchange (ETDEWEB)

    Holden, N.E.

    1985-01-01

    The international standard for a neutron spectrum is that produced from the spontaneous fission of /sup 252/Cf, while the thermal neutron induced fission neutron spectra for the four fissile nuclides, /sup 233/U, /sup 235/U, /sup 239/Pu and /sup 241/Pu, are of interest from the standpoint of nuclear reactors. There have been many data sets produced in recent years which deal with the shape of these spectra, particularly at both the low energy and the high energy portions of the curve. However, our interest here is in the average neutron energies of these spectra. We have tabulated all measurements for the five nuclides of interest. The individual measurements are recorded with the neutron energy range measured, the method of detection as well as the average neutron energy for each author. Fortunately, the measurements have been performed with a number of techniques, which allows one to estimate the systematic error from the spread in the results for the different techniques. An attempt has been made to renormalize results when the neutron spectrum used for normalization purposes has been given. In addition to the tables of mean energy measurements, we have also tabulated the measurements of the ratio of mean energies for pairs of fission neutron spectra. The following items were considered, where possible, in the analysis of the mean energies of the neutron spectra: the energy scale of the measurement, the determination of the detector efficiency, the sample size and the sample thickness and the scattering corrections made. The recommended mean energies for the spectra considered are shown. The uncertainty listed attempts to estimate the systematic error as well as merely the precision in each of the experiments. The recommended values for /sup 233,235/U, /sup 239,241/Pu, and /sup 252/Cf are 2.02 +- 0.03 MeV, 1.98 +- 0.03 MeV, 2.06 +- 0.04 MeV, 2.05 +- 0.05 MeV, and 2.14 +- 0.03 MeV, respectively. 73 refs.

  17. Reprint of: CYP1A protein expression and catalytic activity in double-crested cormorants experimentally exposed to Deepwater Horizon Mississippi Canyon 252 oil.

    Science.gov (United States)

    Alexander, Courtney R; Hooper, Michael J; Cacela, Dave; Smelker, Kim D; Calvin, Caleshia S; Dean, Karen M; Bursian, Steve J; Cunningham, Fred L; Hanson-Dorr, Katie C; Horak, Katherine E; Isanhart, John P; Link, Jane; Shriner, Susan A; Godard-Codding, Céline A J

    2017-12-01

    Double-crested cormorants (Phalacrocorax auritus, DCCO) were orally exposed to Deepwater Horizon Mississippi Canyon 252 (DWH) oil to investigate oil-induced toxicological impacts. Livers were collected for multiple analyses including cytochrome P4501A (CYP1A) enzymatic activity and protein expression. CYP1A enzymatic activity was measured by alkoxyresorufin O-dealkylase (AROD) assays. Activities specific to the O-dealkylation of four resorufin ethers are reported: benzyloxyresorufin O-debenzylase (BROD), ethoxyresorufin O-deethylase (EROD), methoxyresorufin O-demethylase (MROD), and pentoxyresorufin O-depentylase (PROD). CYP1A protein expression was measured by western blot analysis with a CYP1A1 mouse monoclonal antibody. In study 1, hepatic BROD, EROD, and PROD activities were significantly induced in DCCO orally exposed to 20ml/kg body weight (bw) oil as a single dose or daily for 5 days. Western blot analysis revealed hepatic CYP1A protein induction in both treatment groups. In study 2 (5ml/kg bw oil or 10ml/kg bw oil, 21day exposure), all four hepatic ARODs were significantly induced. Western blots showed an increase in hepatic CYP1A expression in both treatment groups with a significant induction in birds exposed to 10ml/kg oil. Significant correlations were detected among all 4 AROD activities in both studies and between CYP1A protein expression and both MROD and PROD activities in study 2. EROD activity was highest for both treatment groups in both studies while BROD activity had the greatest fold-induction. While PROD activity values were consistently low, the fold-induction was high, usually 2nd highest to BROD activity. The observed induced AROD profiles detected in the present studies suggest both CYP1A4/1A5 DCCO isoforms are being induced after MC252 oil ingestion. A review of the literature on avian CYP1A AROD activity levels and protein expression after exposure to CYP1A inducers highlights the need for species-specific studies to accurately evaluate

  18. Weathered MC252 crude oil-induced anemia and abnormal erythroid morphology in double-crested cormorants (Phalacrocorax auritus) with light microscopic and ultrastructural description of Heinz bodies.

    Science.gov (United States)

    Harr, Kendal E; Cunningham, Fred L; Pritsos, Chris A; Pritsos, Karen L; Muthumalage, Thivanka; Dorr, Brian S; Horak, Katherine E; Hanson-Dorr, Katie C; Dean, Karen M; Cacela, Dave; McFadden, Andrew K; Link, Jane E; Healy, Katherine A; Tuttle, Pete; Bursian, Steven J

    2017-12-01

    Injury assessment of birds following the Deepwater Horizon (DWH) oil spill in 2010 was part of the Natural Resource Damage Assessment. One reported effect was hemolytic anemia with the presence of Heinz bodies (HB) in birds, however, the role of route and magnitude of exposure to oil is unknown. The purpose of the present study was to determine if double-crested cormorants (Phalacocorax auritis; DCCO) exposed orally and dermally to artificially weathered crude oil would develop hemolytic anemia including HB and reticulocytosis. In the oral experiment, sub-adult, mixed-sex DCCOs were fed control (n = 8) or oil-injected fish with a daily target dose of 5 (n = 9) or 10 (n = 9) ml oil/kg for 21 days. Then, subadult control (n = 12) and treated (n = 13) cormorant groups of similar sex-ratio were dermally treated with approximately 13ml of water or weathered MC252 crude oil, respectively, every 3 days for 6 dosages approximating 20% surface coverage. Collected whole blood samples were analyzed by light (new methylene blue) and transmission electron microscopy. Both oral and dermal treatment with weathered DWH MC252 crude oil induced regenerative, but inadequately compensated, anemia due to hemolysis and hematochezia as indicated by decreased packed cell volume, relative increase in reticulocytes with lack of difference in corrected reticulocyte count, and morphologic evidence of oxidant damage at the ultrastructural level. Hemoglobin precipitation, HB formation, degenerate organelles, and systemic oxidant damage were documented. Heinz bodies were typically <2µm in length and smaller than in mammals. These oblong cytoplasmic inclusions were difficult to see upon routine blood smear evaluation and lacked the classic button appearance found in mammalian red blood cells. They could be found as light, homogeneous blue inclusions upon new methylene blue staining. Ultrastructurally, HB appeared as homogeneous, electron-dense structures within the cytosol and lacked membranous

  19. CYP1A protein expression and catalytic activity in double-crested cormorants experimentally exposed to deepwater Horizon Mississippi Canyon 252 oil.

    Science.gov (United States)

    Alexander, Courtney R; Hooper, Michael J; Cacela, Dave; Smelker, Kim D; Calvin, Caleshia S; Dean, Karen M; Bursian, Steve J; Cunningham, Fred L; Hanson-Dorr, Katie C; Horak, Katherine E; Isanhart, John P; Link, Jane; Shriner, Susan A; Godard-Codding, Céline A J

    2017-04-05

    Double-crested cormorants (Phalacrocorax auritus, DCCO) were orally exposed to Deepwater Horizon Mississippi Canyon 252 (DWH) oil to investigate oil-induced toxicological impacts. Livers were collected for multiple analyses including cytochrome P4501A (CYP1A) enzymatic activity and protein expression. CYP1A enzymatic activity was measured by alkoxyresorufin O-dealkylase (AROD) assays. Activities specific to the O-dealkylation of four resorufin ethers are reported: benzyloxyresorufin O-debenzylase (BROD), ethoxyresorufin O-deethylase (EROD), methoxyresorufin O-demethylase (MROD), and pentoxyresorufin O-depentylase (PROD). CYP1A protein expression was measured by western blot analysis with a CYP1A1 mouse monoclonal antibody. In study 1, hepatic BROD, EROD, and PROD activities were significantly induced in DCCO orally exposed to 20ml/kg body weight (bw) oil as a single dose or daily for 5 days. Western blot analysis revealed hepatic CYP1A protein induction in both treatment groups. In study 2 (5ml/kg bw oil or 10ml/kg bw oil, 21day exposure), all four hepatic ARODs were significantly induced. Western blots showed an increase in hepatic CYP1A expression in both treatment groups with a significant induction in birds exposed to 10ml/kg oil. Significant correlations were detected among all 4 AROD activities in both studies and between CYP1A protein expression and both MROD and PROD activities in study 2. EROD activity was highest for both treatment groups in both studies while BROD activity had the greatest fold-induction. While PROD activity values were consistently low, the fold-induction was high, usually 2nd highest to BROD activity. The observed induced AROD profiles detected in the present studies suggest both CYP1A4/1A5 DCCO isoforms are being induced after MC252 oil ingestion. A review of the literature on avian CYP1A AROD activity levels and protein expression after exposure to CYP1A inducers highlights the need for species-specific studies to accurately evaluate

  20. Standard test method for nondestructive assay of nuclear material in scrap and waste by passive-Active neutron counting using 252Cf shuffler

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2008-01-01

    1.1 This test method covers the nondestructive assay of scrap and waste items for U, Pu, or both, using a 252Cf shuffler. Shuffler measurements have been applied to a variety of matrix materials in containers of up to several 100 L. Corrections are made for the effects of matrix material. Applications of this test method include measurements for safeguards, accountability, TRU, and U waste segregation, disposal, and process control purposes (1, 2, 3). 1.1.1 This test method uses passive neutron coincidence counting (4) to measure the 240Pu-effective mass. It has been used to assay items with total Pu contents between 0.03 g and 1000 g. It could be used to measure other spontaneously fissioning isotopes such as Cm and Cf. It specifically describes the approach used with shift register electronics; however, it can be adapted to other electronics. 1.1.2 This test method uses neutron irradiation with a moveable Cf source and counting of the delayed neutrons from the induced fissions to measure the 235U equiva...

  1. A new case of de novo 6q24.2-q25.2 deletion on paternal chromosome 6 with growth hormone deficiency: a twelve-year follow-up and literature review.

    Science.gov (United States)

    Stagi, Stefano; Lapi, Elisabetta; Pantaleo, Marilena; Carella, Massimo; Petracca, Antonio; De Crescenzo, Agostina; Zelante, Leopoldo; Riccio, Andrea; de Martino, Maurizio

    2015-08-23

    Deletions on the distal portion of the long arm of chromosome 6 are relatively uncommon, and only a small number occurs in the paternal copy, causing growth abnormalities. As a result, extensive clinical descriptions are lacking. We describe a male of Italian descent born at 35 weeks by elective caesarean delivery presenting hypoplastic left colon, bilateral inguinal hernia, dysplastic tricuspid and pulmonary valves, premature ventricular contractions, recurrent otitis media, poor feeding, gastro-oesophageal reflux, bilateral pseudopapilledema, and astigmatism. He also showed particular facial dysmorphisms and postnatal growth failure. Early psychomotor development was mildly delayed. At 3.75 years, he was evaluated for severe short stature (-2.98 SD) and delayed bone age. He showed an insulin-like growth factor 1 concentration (IGF-1) in the low-normal range. Growth hormone stimulation tests showed a low response to clonidine and insulin. Magnetic resonance imaging showed hypophyseal hypoplasia. Genetic evaluation by Single Nucleotide Polymorphism arrays showed a de novo 6q24.2-q25.2 deletion on paternal chromosome 6. We confirm that this is a new congenital malformation syndrome associated with a deletion of 6q24.2-q25.2 on paternal chromosome 6. We suggest evaluating the growth hormone axis in children with 6q24.2-q25.2 deletions and growth failure.

  2. The incidence of all-cause, cardiovascular and respiratory disease admission among 20,252 users of lisinopril vs. perindopril: A cohort study.

    Science.gov (United States)

    Wong, Martin C S; Chan, David K L; Wang, Harry H X; Tam, Wilson W S; Cheung, Clement S K; Yan, Bryan P; Coats, Andrew J S

    2016-09-15

    Major international guidelines do not offer explicit recommendations on any specific angiotensin-converting enzyme inhibitor (ACEI) agent over another within the same drug group. This study compared the effectiveness of lisinopril vs. perindopril in reducing the incidence of hospital admission due to all-cause, cardiovascular disease and respiratory disease. Adult patients who received new prescriptions of lisinopril or perindopril from 2001 to 2005 in all public hospitals and clinics in Hong Kong were included, and followed up for ≥2years. The incidence of admissions due to all-cause, cardiovascular disease and respiratory disease were evaluated, respectively, by using Cox proportional hazard regression models. The regression models were constructed with propensity score matching to minimize indication biases. A total of 20,252 eligible patients with an average age of 64.5years (standard deviation 15.0) were included. The admission rate at 24months within the date of index prescription due to any cause, cardiovascular disease and respiratory disease among lisinopril vs. perindopril users was 24.8% vs. 24.8%, 13.7% vs. 14.0% and 6.9% vs. 6.3%, respectively. Lisinopril users were significantly more likely to be admitted due to respiratory diseases (adjusted hazard ratios [AHR]=1.25, 95% CI 1.08 to 1.43, p=0.002 at 12months; AHR=1.17, 95% CI 1.04 to 1.31, p=0.009 at 24months) and all causes (AHR=1.12, 95% CI 1.05 to 1.19, p<0.001 at 24months) than perindopril users. These findings support intra-class differences in the effectiveness of ACEIs, which could be considered by clinical guidelines when the preferred first-line antihypertensive drugs are recommended. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  3. New fit of thermal neutron constants (TNC for 233,235U, 239,241Pu and 252Cf(sf: Microscopic vs. maxwellian data

    Directory of Open Access Journals (Sweden)

    Pronyaev Vladimir G.

    2017-01-01

    Full Text Available An IAEA project to update the Neutron Standards is near completion. Traditionally, the Thermal Neutron Constants (TNC evaluated data by Axton for thermal-neutron scattering, capture and fission on four fissile nuclei and the total nu-bar of 252Cf(sf are used as input in the combined least-square fit with neutron cross section standards. The evaluation by Axton (1986 was based on a least-square fit of both thermal-spectrum averaged cross sections (Maxwellian data and microscopic cross sections at 2200 m/s. There is a second Axton evaluation based exclusively on measured microscopic cross sections at 2200 m/s (excluding Maxwellian data. Both evaluations disagree within quoted uncertainties for fission and capture cross sections and total multiplicities of uranium isotopes. There are two factors, which may lead to such difference: Westcott g-factors with estimated 0.2% uncertainties used in the Axton's fit, and deviation of the thermal spectra from Maxwellian shape. To exclude or mitigate the impact of these factors, a new combined GMA fit of standards was undertaken with Axton's TNC evaluation based on 2200 m/s data used as a prior. New microscopic data at the thermal point, available since 1986, were added to the combined fit. Additionally, an independent evaluation of TNC was undertaken using CONRAD code. Both GMA and CONRAD results are consistent within quoted uncertainties. New evaluation shows a small increase of fission and capture thermal cross sections, and a corresponding decrease in evaluated thermal nubar for uranium isotopes and 239Pu.

  4. Genome-wide association analysis of self-reported events in 6135 individuals and 252 827 controls identifies 8 loci associated with thrombosis.

    Science.gov (United States)

    Hinds, David A; Buil, Alfonso; Ziemek, Daniel; Martinez-Perez, Angel; Malik, Rainer; Folkersen, Lasse; Germain, Marine; Mälarstig, Anders; Brown, Andrew; Soria, Jose Manuel; Dichgans, Martin; Bing, Nan; Franco-Cereceda, Anders; Souto, Juan Carlos; Dermitzakis, Emmanouil T; Hamsten, Anders; Worrall, Bradford B; Tung, Joyce Y; Sabater-Lleal, Maria

    2016-05-01

    Thrombotic diseases are among the leading causes of morbidity and mortality in the world. To add insights into the genetic regulation of thrombotic disease, we conducted a genome-wide association study (GWAS) of 6135 self-reported blood clots events and 252 827 controls of European ancestry belonging to the 23andMe cohort of research participants. Eight loci exceeded genome-wide significance. Among the genome-wide significant results, our study replicated previously known venous thromboembolism (VTE) loci near the F5, FGA-FGG, F11, F2, PROCR and ABO genes, and the more recently discovered locus near SLC44A2 In addition, our study reports for the first time a genome-wide significant association between rs114209171, located upstream of the F8 structural gene, and thrombosis risk. Analyses of expression profiles and expression quantitative trait loci across different tissues suggested SLC44A2, ILF3 and AP1M2 as the three most plausible candidate genes for the chromosome 19 locus, our only genome-wide significant thrombosis-related locus that does not harbor likely coagulation-related genes. In addition, we present data showing that this locus also acts as a novel risk factor for stroke and coronary artery disease (CAD). In conclusion, our study reveals novel common genetic risk factors for VTE, stroke and CAD and provides evidence that self-reported data on blood clots used in a GWAS yield results that are comparable with those obtained using clinically diagnosed VTE. This observation opens up the potential for larger meta-analyses, which will enable elucidation of the genetics of thrombotic diseases, and serves as an example for the genetic study of other diseases. © The Author 2016. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  5. Subtyping of Non-Small Cell Lung Carcinoma in Fine Needle Aspiration Specimens: A Study of 252 Patients with Surgical Correlations

    Directory of Open Access Journals (Sweden)

    Beyhan Varol Mollamehmetoğlu

    2016-12-01

    Full Text Available Objective: Fine-needle aspiration (FNA cytology performed by either transthoracic or transbronchial procedures is an important approach to obtain tumor tissue for histological diagnosis. We investigated the accuracy of FNA in differentiating NSCLCs of adenocarcinoma from squamous cell carcinoma histological types to correlate cytological findings with histological features and immunohistochemistry confirmation in some cases. Methods: From 2010 to 2015, a total of 635 transbronchial needle aspirations or transthoracic needle aspirations were performed. 332 cases were diagnosed as NSCLC, with or without an indication of a specific subtype, while 303 cases were not diagnosed as NSCLC. Out of 332 cases diagnosed as NSCLC, 252 had a histological follow-up. Subsequently, histological samples included 161 surgical resections and 91 biopsies. In cases with histopathological diagnosis accompanied by FNA cytology, an immunohistochemical study was carried out and the diagnostic results of the two methods were compared to each other. Results: The specific subtype of NSCLC was provided in 217 cases (86% based on cytomorphology which included 115 adenocarcinomas (46% and 102 squamous cell carcinomas (40%. The diagnosis NSCLC-NOS by FNA was set in 35 cases. At histology, 251 cases (99.6% were sub-classified: 122 adenocarcinomas (48%, 104 squamous cell carcinomas (41%, 11 large cell carcinomas (4% , and 14 adenosquamous carcinomas (6%. Agreement between cytological and histological typing was found in 181 of 197 cases (92% (K=0.837; p<0.001. Conclusion: Our study proved that most NSCLC can be sub-classified as adenocarcinoma or squamous cell carcinoma by FNA through cytomorphology and the application of immunocytochemistry.

  6. Solid-State Neutron Multiplicity Counting System Using Commercial Off-the-Shelf Semiconductor Detectors

    Energy Technology Data Exchange (ETDEWEB)

    Rozhdestvenskyy, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-08-09

    This work iterates on the first demonstration of a solid-state neutron multiplicity counting system developed at Lawrence Livermore National Laboratory by using commercial off-the-shelf detectors. The system was demonstrated to determine the mass of a californium-252 neutron source within 20% error requiring only one-hour measurement time with 20 cm2 of active detector area.

  7. Open Source: Potential in Latin America for Radiological Weapons

    Science.gov (United States)

    2010-03-01

    terrorist group would need to acquire a radioactive isotope with a relatively short half-life. 36,37 As an aside, the IAEA verified that depleted...cns.miis.edu/npr/pdfs/123salama.pdf (accessed March 3, 2010), Useful RDD isotopes include cobalt-60, strontium-90, yttrium-90, iridium-192, cesium-137...plutonium-238, radium -226, americium-241, and californium-252. 37 Hansell and Salama, “Does intent equal capability?,” 640-641. 38 Internation Atomic

  8. SAJP 25(2).vp

    African Journals Online (AJOL)

    Danie Strauss

    Grenoble & Paris: B. Arthaud. Levinas, E. 1991. Otherwise than being or beyond essence, trans. Alphonso Lingis. Dordrecht/Boston/London: Kluwer Academic Publishers. In French: Autrement qu'être ou au-delà de l'essence, 1974. The Hague: Martinus Nijhoff. Levinas, E. 2003. On escape, trans. Bettina Bergo. Stanford: ...

  9. 1987 Neutron and gamma personnel dosimeter intercomparison study using a D/sub 2/O-moderated /sup 252/Cf source

    Energy Technology Data Exchange (ETDEWEB)

    Swaja, R.E.; West, L.E.; Sims, C.S.; Welty, T.J.

    1989-05-01

    The thirteenth Personnel Dosimetry Intercomparison Study (i.e., PDIS 13) was conducted during April 1987 as a joint effort by Oak Ridge National Laboratory's (ORNL) Dosimetry Applications Research Group and the Southwest Radiation Calibration Center at the University of Arkansas. A total of 48 organizations (34 from the US and 14 from abroad) participated in PDIS 13. Participants submitted a total of 1,113 neutron and gamma dosimeters for this mixed field study. The dosimeters were transferred by mail and were handled by experimental personnel at ORNL and the University of Arkansas. The type of neutron dosimeter and the percentage of participants submitting that type are as follows: TLD-albedo (49%), direct interaction TLD (31%), CR-39 (17%), film (3%). The type of gamma dosimeter and the percentage of participants submitting that type are as follows: Li/sub 2/B/sub 4/O/sub 7/, alone or in combination with CaSO/sub 4/, (69%), /sup 7/LiF (28%), natural LiF (3%). Radiation exposures in PDIS 13 were limited to 0.5 and 1.5 mSv from /sup 252/Cf moderated by 15-cm of D/sub 2/O. Traditional exposures using the Health Physics Research Reactor (HPRR) were not possible due to the fact that all reactors at ORNL, including the HPRR, were shutdown by order of the Department of Energy at the time the intercomparison was performed. Planned exposures using a /sup 238/PuBe source were negated by a faulty timing mechanism. Based on accuracy and precision, direct interaction TLD dosimeters exhibited the best performance in PDIS 13 neutron measurements. They were followed, in order of best performance, by CR-39, TLD albedo, and film. The Li/sub 2/B/sub 4/O/sub 7/ type TLD dosimeters exhibited the best performance in PDIS 13 gamma measurements. They were followed by natural LiF, /sup 7/LiF, and film. 12 refs., 1 fig., 5 tabs.

  10. Molecular typing for the Indian blood group associated 252G>C single nucleotide polymorphism in a selected cohort of Australian blood donors

    Science.gov (United States)

    Lopez, Genghis H.; McBean, Rhiannon S.; Wilson, Brett; Irwin, Darryl L.; Liew, Yew-Wah; Hyland, Catherine A.; Flower, Robert L.

    2015-01-01

    Background The Indian blood group antigens, Ina and Inb, are clinically significant in transfusion medicine. However, antisera to type these antigens are difficult to obtain. The Inb antigen is a high frequency antigen present in all populations, while the frequency of the antithetical Ina ranges from 0.1% in Caucasians up to 11% in Middle Eastern groups. This antigen polymorphism is encoded by the single nucleotide polymorphism (SNP) 252G>C in CD44. The aim of this study was to establish and compare two genotyping methods to measure the frequency of the IN*A and IN*B alleles in a blood donor cohort. Materials and methods Donor blood samples (n=151) were genotyped by a novel real-time polymerase chain reaction (PCR) high-resolution meltcurve (HRM) analysis and a custom matrix-assisted laser desorption/ionisation time-of-flight mass spectrometry (MALDI-TOF MS) assay. Samples with the rare IN*A allele were further investigated by nucleotide sequencing, red cell agglutination, and flow cytometry techniques. Results In this study group, 149 IN*B homozygous and 2 IN*A/B heterozygous samples were detected with 100% concordance between HRM and MALDI-TOF MS methods. For PCR HRM, amplicon melting alone did not differentiate IN*A and IN*B alleles (class 3 SNP), however, the introduction of an unlabelled probe (UP) increased the resolution of the assay. Sequencing confirmed that the two non-homozygous samples were IN*A/B heterozygous and phenotyping by red cell agglutination, and flow cytometry confirmed both Ina and Inb antigens were present as predicted. Discussion Genotyping permits conservation of rare antisera to predict blood group antigen phenotype. In PCR UP-HRM the IN*A and IN*B alleles were discriminated on the basis of their melting properties. The Ina frequency in this selected donor population was 1.3%. Application of genotyping methods such as these assists in identifying donors with rare blood group phenotypes of potential clinical significance. PMID:24960658

  11. Outcomes in Adenomyosis Treated with Uterine Artery Embolization Are Associated with Lesion Vascularity: A Long-Term Follow-Up Study of 252 Cases.

    Directory of Open Access Journals (Sweden)

    Jing Zhou

    Full Text Available To study the therapeutic effects of uterine artery embolization (UAE on adenomyosis and to investigate the association between uterine blood supply and artery embolization treatment outcomes.Using digital subtraction angiography (DSA imaging data, we retrospectively evaluated the vascular features of 252 adenomyosis patients treated with UAE. The cases were classified based on the equality of uterine blood supply (equal and unequal subgroups and the degree of vascularity at the adenomyosis lesion site (hypervascular, isovascular and hypovascular subgroups. Patients were followed-up for 5 years after UAE. Improvements in dysmenorrhea and menorrhagia were evaluated based on the relief of the patients' symptoms. The improvement rates among the different subgroups were analyzed and compared.The improvement rates of dysmenorrhea and menorrhagia were 74.0% and 70.9%, respectively, at the short-term (12-month follow-up and 70.4% and 68.8%, respectively, at the long-term (5-year follow-up. No statistically significant differences were observed in the improvement rates for dysmenorrhea or menorrhagia between the equal and unequal blood supply subgroups at either the short- or long-term follow-up. The improvement rates for dysmenorrhea among the hypervascular, isovascular and hypovascular subgroups were 86.5%, 71.8% and 58.8%, respectively, at the short-term follow-up (p = 0.002 and 83.6%, 67.3% and 52.8%, respectively, at the long-term follow-up (p = 0.005. The improvement rates for menorrhagia in the hypervascular, isovascular and hypovascular subgroups were 81.0%, 68.3% and 60.7%, respectively, at the short-term follow-up (p = 0.024 and 79.4%, 61.4% and 62.2%, respectively, at the long-term follow-up (p = 0.052.UAE is effective in treating patients with adenomyosis in both the short and long term. The outcomes of patients with adenomyosis were significantly correlated with lesion vascularity.

  12. Advanced development of the spectrum sciences Model 5005-TF, single-event test fixture

    Energy Technology Data Exchange (ETDEWEB)

    Ackermann, M.R.; Browning, J.S. (Sandia National Labs., Albuquerque, NM (USA)); Hughlock, B.W. (Boeing Aerospace and Electronics Co., Seattle, WA (USA)); Lum, G.K. (Lockheed Missiles and Space Co., Sunnyvale, CA (USA)); Tsacoyeanes, W.C. (Draper (Charles Stark) Lab., Inc., Cambridge, MA (USA)); Weeks, M.D. (Spectrum Sciences, Inc., Santa Clara, CA (USA))

    1990-09-01

    This report summarizes the advanced development of the Spectrum Sciences Model 5005-TF, Single-Event Test Fixture. The Model 5005-TF uses a Californium-252 (Cf-252) fission-fragment source to test integrated circuits and other devices for the effects of single-event phenomena. Particle identification methods commonly used in high-energy physics research and nuclear engineering have been incorporated into the Model 5005-TF for estimating the particle charge, mass, and energy parameters. All single-event phenomena observed in a device under test (DUT) are correlated with an identified fission fragment, and its linear energy transfer (LET) and range in the semiconductor material of the DUT.

  13. Oxidation of M252 but not M428 in hu-IgG1 is responsible for decreased binding to and activation of hu-FcγRIIa (His131).

    Science.gov (United States)

    Cymer, Florian; Thomann, Marco; Wegele, Harald; Avenal, Cecile; Schlothauer, Tilman; Gygax, Daniel; Beck, Hermann

    2017-11-01

    Oxidation of monoclonal therapeutic antibodies (mAbs) can affect binding to Fc-receptors and potentially influence pharmacokinetics or effector functions like e.g. antibody dependent cellular phagocytosis (ADCP). Recently, it has been demonstrated that binding to FcγRIIa (H131) is affected by methionine oxidation of the Fc-portion but it is currently unknown which methionine is responsible for decreased binding. We separated an oxidized IgG1 monoclonal antibody based on the oxidation state of methionine 252 and analyzed fractionated material in receptor binding experiments as well as in functional (cell-based) assays. Although the unfractionated mixture demonstrated weaker interaction/activation of the receptor, differently oxidized isolated subspecies can lead both to stronger as well as weaker binding and activation of the histidine variant of FcγRIIa. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.

  14. Neutron Protection Factor Determination and Validation for a Vehicle Surrogate Using a Californium Fission Source

    Science.gov (United States)

    2017-06-01

    a 4 mm x 4 mm (0.157" x 0.157") LiI(Eu) crystal with 96% enrichment of lithium -6. The crystal is connected to a photomultiplier tube (PMT) which...32 Figure 17. Lithium -6 Iodide, Europium Doped Scintillation Detector. Source: [27...Alamos National Laboratory LiI(Eu) Lithium Iodide Europium Doped LLD Low Level Discriminator LLNL Lawrence Livermore National Laboratory MASH Monte

  15. Measurement of inclusive ep cross sections at high Q{sup 2} at √(s) = 225 and 252 GeV and of the longitudinal proton structure function F{sub L} at HERA

    Energy Technology Data Exchange (ETDEWEB)

    Andreev, V.; Belousov, A.; Fomenko, A.; Gogitidze, N.; Lebedev, A.; Malinovski, E.; Rusakov, S.; Vazdik, Y. [Lebedev Physical Institute, Moscow (Russian Federation); Baghdasaryan, A.; Baghdasaryan, S.; Zohrabyan, H. [Yerevan Physics Institute, Yerevan (Armenia); Begzsuren, K.; Ravdandorj, T.; Tseepeldorj, B. [Institute of Physics and Technology of the Mongolian Academy of Sciences, Ulaanbaatar (Mongolia); Belov, P.; Brinkmann, M.; Britzger, D.; Campbell, A.J.; Dodonov, V.; Eckerlin, G.; Elsen, E.; Fleischer, M.; Gayler, J.; Ghazaryan, S.; Glazov, A.; Gouzevitch, M.; Grebenyuk, A.; Habib, S.; Haidt, D.; Kleinwort, C.; Krueger, K.; Levonian, S.; Lipka, K.; List, B.; List, J.; Lobodzinski, B.; Meyer, A.B.; Meyer, J.; Niebuhr, C.; Olsson, J.E.; Ozerov, D.; Pahl, P.; Petrukhin, A.; Pirumov, H.; Pitzl, D.; Placakyte, R.; Radescu, V.; Raspereza, A.; Schmitt, S.; Sefkow, F.; Shushkevich, S.; South, D.; Steder, M.; Wuensch, E. [DESY, Hamburg (Germany); Boudry, V.; Specka, A. [LLR, Ecole Polytechnique, CNRS/IN2P3, Palaiseau (France); Bradt, G. [Oxford University, Department of Physics, Oxford (United Kingdom); Brisson, V.; Jacquet, M.; Pascaud, C.; Zhang, Z.; Zomer, F. [LAL, Universite Paris-Sud, CNRS/IN2P3, Orsay (France); Buniatyan, A.; Huber, F.; Sauter, M.; Schoening, A. [Universitaet Heidelberg, Physikalisches Institut, Heidelberg (Germany); Bylinkin, A.; Bystritskaya, L.; Fedotov, A.; Rostovtsev, A. [Institute for Theoretical and Experimental Physics, Moscow (Russian Federation); Cantun Avila, K.B.; Contreras, J.G. [CINVESTAV, Departamento de Fisica Aplicada, Merida, Yucatan (Mexico); Ceccopieri, F.; Wolf, E.A. de; Favart, L.; Hreus, T.; Janssen, X.; Roosen, R.; Mechelen, P. van [Brussels and Universiteit Antwerpen, Inter-University Institute for High Energies ULB-VUB, Antwerp (Belgium); Cerny, K.; Pokorny, B.; Polifka, R.; Salek, D.; Valkarova, A.; Zacek, J.; Zlebcik, R. [Charles University, Faculty of Mathematics and Physics, Prague (Czech Republic); Chekelian, V.; Grindhammer, G.; Kiesling, C.; Olivier, B. [Max-Planck-Institut fuer Physik, Munich (Germany); Dainton, J.B.; Gabathuler, E.; Greenshaw, T.; Klein, M.; Kretzschmar, J.; Laycock, P.; Maxfield, S.J.; Mehta, A.; Patel, G.D. [University of Liverpool, Department of Physics, Liverpool (United Kingdom); Daum, K.; Meyer, H. [Universitaet Wuppertal, Fachbereich C, Wuppertal (Germany); Diaconu, C.; Hoffmann, D.; Sauvan, E.; Vallee, C. [CPPM, Aix-Marseille Univ, CNRS/IN2P3, Marseille (France); Dobre, M.; Rotaru, M. [National Institute for Physics and Nuclear Engineering (NIPNE), Bucharest (Romania); Dossanov, A. [Universitaet Hamburg, Institut fuer Experimentalphysik, Hamburg (Germany); Max-Planck-Institut fuer Physik, Munich (Germany); Dubak, A. [Max-Planck-Institut fuer Physik, Munich (Germany); University of Montenegro, Faculty of Science, Podgorica (Montenegro); Egli, S.; Hildebrandt, M.; Horisberger, R. [Paul Scherrer Institut, Villigen (Switzerland); Feltesse, J.; Perez, E.; Schoeffel, L. [CEA, DSM/Irfu, CE-Saclay, Gif-sur-Yvette (France); Ferencei, J. [Slovak Academy of Sciences, Institute of Experimental Physics, Kosice (Slovakia); Goerlich, L.; Mikocki, S.; Nowak, G.; Sopicki, P.; Turnau, J. [Institute for Nuclear Physics, Cracow (Poland); Grab, C. [ETH, Institut fuer Teilchenphysik, Zurich (Switzerland); Henderson, R.C.W. [University of Lancaster, Department of Physics, Lancaster (United Kingdom); Herbst, M.; Jung, A.W.; Schultz-Coulon, H.C. [Universitaet Heidelberg, Kirchhoff-Institut fuer Physik, Heidelberg (Germany); Hladka, J.; Reimer, P. [Academy of Sciences of the Czech Republic, Institute of Physics, Prague (Czech Republic); Jung, H. [Brussels and Universiteit Antwerpen, Inter-University Institute for High Energies ULB-VUB, Antwerp (Belgium); DESY, Hamburg (Germany); Kapichine, M.; Morozov, A.; Spaskov, V. [Joint Institute for Nuclear Research, Dubna (RU); Kogler, R.; Nowak, K. [Universitaet Hamburg, Institut fuer Experimentalphysik, Hamburg (DE); Kostka, P.; Lange, W.; Naumann, T. [DESY, Zeuthen (DE); Landon, M.P.J.; Rizvi, E.; Traynor, D. [University of London, School of Physics and Astronomy, Queen Mary, London (GB); Lubimov, V. [Institute for Theoretical and Experimental Physics, Moscow (RU); Martyn, H.U. [I. Physikalisches Institut der RWTH, Aachen (DE); Mueller, K.; Robmann, P.; Straumann, U.; Truoel, P. [Physik-Institut der Universitaet Zuerich, Zurich (CH); Newman, P.R.; Thompson, P.D. [School of Physics and Astronomy, University of Birmingham, Birmingham (GB); Picuric, I.; Raicevic, N. [University of Montenegro, Faculty of Science, Podgorica (ME); Sankey, D.P.C. [STFC, Rutherford Appleton Laboratory, Oxfordshire (GB); Soloviev, Y. [DESY, Hamburg (DE); Lebedev Physical Institute, Moscow (RU); Stella, B. [Universita di Roma Tre (IT); INFN Roma 3, Dipartimento di Fisica, Rome (IT); Sykora, T. [Brussels and Universiteit Antwerpen, Inter-University Institute for High Energies ULB-VUB, Antwerp (BE); Charles University, Faculty of Mathematics and Physics, Prague (CZ); Tsakov, I. [Institute for Nuclear Research and Nuclear Energy, Sofia (BG); Wegener, D. [Institut fuer Physik, TU Dortmund, Dortmund (DE); Collaboration: H1 Collaboration

    2014-04-15

    Inclusive ep double differential cross sections for neutral current deep inelastic scattering are measured with the H1 detector at HERA.The data were taken with a lepton beam energy of 27.6 GeV and two proton beam energies of E{sub p} = 460 and 575 GeV corresponding to centre-of-mass energies of 225 and 252 GeV, respectively. The measurements cover the region of 6.5 x 10{sup -4} ≤ x ≤ 0.65 for 35 ≤ Q{sup 2} ≤ 800 GeV{sup 2} up to y = 0.85. The measurements are used together with previously published H1 data at E{sub p} = 920 GeV and lower Q{sup 2} data at E{sub p} = 460, 575 and 920 GeV to extract the longitudinal proton structure function F{sub L} in the region 1.5 ≤ Q{sup 2} ≤ 800 GeV{sup 2}. (orig.)

  16. 36 CFR 25.2 - License.

    Science.gov (United States)

    2010-07-01

    ... to test their knowledge of the history of the battle, or features of historical interest, the.... 2. In case of difference of opinion as to the interpretation of any law, rule, or regulation, to... without delay, and to furnish him with all information in my possession tending to identify the offenders...

  17. Publications | Page 252 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... and Communication Technologies in Asia. Strengthening Rural Livelihoods provides a useful and balanced review of the influence that mobile phones and the Internet can have on supporting the livelihoods of rural people, and particularly farmers in Asia. Tim Unwin, UNESCO Chair in ICT4D and Professor of Geography ...

  18. Reference: 252 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available -Hui et al. 2005 Aug. Plant Physiol. 138(4):2048-60. Cation levels within the cytosol are coordinated by a n...etwork of transporters. Here, we examine the functional roles of calcium exchanger 1 (CAX1), a vacuolar H+/C...a2+ transporter, and the closely related transporter CAX3. We demonstrate that li...ke CAX1, CAX3 is also localized to the tonoplast. We show that CAX1 is predominately expressed in leaves, while CAX3 is highly expre...ssed in roots. Previously, using a yeast assay, we demonstrated that an N-terminal t

  19. 28 CFR 2.52 - Revocation decisions.

    Science.gov (United States)

    2010-07-01

    ... imprisonment, detention, or incarceration in any penal facility, forfeiture of time from the date of such... convicted permits the trial court to impose any term of confinement or imprisonment in any penal facility... convicted of the same offense. (e) In determining whether to revoke parole for non-compliance with a...

  20. 17 CFR 230.252 - Offering statement.

    Science.gov (United States)

    2010-04-01

    ..., language and pagination. The requirements for offering statements are the same as those specified in § 230... Officer, a majority of the members of its board of directors or other governing body, and each selling... that contains the following language: This offering statement shall become qualified on the 20th...

  1. 252-IJBCS-Article-Dr Chuma Okoro

    African Journals Online (AJOL)

    Dr Gatsing

    Plasmids of phenanthrene and dibenzothiophene-degrading bacteria isolated from produced ... Acinetobacter lwoffi, Enterobacter sp. and Pseudomonas sp. harbored some plasmids with molecular weights ... indicates that the genes for the degradation of phenanthrene and DBT in these organisms probably reside in the.

  2. Publications | Page 252 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    restricted access). Cutting down consumption of non-food items, borrowing ... to develop ways in which they deliver services to citizens. E-governance has the potential to enable local governments to engage citizens in greater participation, leading.

  3. BDML Metadata: 252 [SSBD[Archive

    Lifescience Database Archive (English)

    Full Text Available b0-5fef-4e7a-ae16-30a1dc42b18a 0.105 x 0.105 x 0.5 (micrometer), 40 (second) http://ssbd.qbic.riken.jp/data/...source/Ce_KK_P002/RNAi_Y43F4B.6_061214_03/ http://ssbd.qbic.riken.jp/data/bdml/Ce..._KK_P002/RNAi_Y43F4B.6_061214_03.bdml0.15.xml http://ssbd.qbic.riken.jp/data/pdpml/Ce_KK_P002.pdpml0.05.xml ...http://ssbd.qbic.riken.jp/search/f9cae7b0-5fef-4e7a-ae16-30a1dc42b18a/ http://ssbd.qbic.riken.jp/omero/webclient/?show=dataset-206 ...

  4. 252-IJBCS-Article-Dr Chuma Okoro

    African Journals Online (AJOL)

    Dr Gatsing

    Acinetobacter lwoffi, Enterobacter sp. and Pseudomonas sp. harbored some plasmids with molecular weights ... MATERIALS AND METHODS. Enumeration of hydrocarbon utilizing bacteria. Hydrocarbon utilizing bacterial counts in produced water samples were obtained by .... case may be, to identify colonies that have lost.

  5. 30 CFR 252.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... designated by the Director as a State in which there is a substantial probability of significant impact on or..., seismic, or other systems are used to detect or imply the presence of such oil or natural gas, and (2) any...

  6. 7 CFR 1209.252 - Exemption procedures.

    Science.gov (United States)

    2010-01-01

    ... or organic handling operation certificate provided by a USDA-accredited certifying agent as defined... year shall apply to the Council, on a form provided by the Council, for a Certificate of Exemption. The.... (2) To apply for an exemption for organic mushrooms: (i) An eligible mushroom producer shall submit a...

  7. Publications | Page 252 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    This thesis is an assessment of the post drought recovery strategies among pastoralists in Turkana Central district. The main objective of this study was to assess how the pastoralists'' community in drought prone areas of Turkana Central district recovers their livelihoods in the post drought... Impacts of the global economic ...

  8. 48 CFR 252.217-7009 - Default.

    Science.gov (United States)

    2010-10-01

    ... arises from causes beyond the control and without the fault or negligence of the Contractor. Examples of such causes include acts of God or of the public enemy, acts of the Government in either its sovereign or contractual capacity, fires, floods, epidemics, quarantine restrictions, strikes, freight...

  9. 6 CFR 25.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... information and projections, actuarial calculations, liability estimates, insurance quotations, and business... studies, and other analyses relevant to homeland security may be deemed a Technology under this part...

  10. 42 CFR 422.252 - Terminology.

    Science.gov (United States)

    2010-10-01

    ... or regional plan that provides prescription drug coverage under Part D of Title XVIII of the Social... eligible beneficiary with a nationally average risk profile for the factors described in § 422.308(c), and... Medicare benefits to an MA eligible beneficiary with a nationally average risk profile for the risk factors...

  11. 7 CFR 1944.252 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... services described in section 802(k)(16). Under this Program, health-related services mean non-medical supervision, wellness programs, preventive health screening, monitoring of medication consistent with state... such person is determined under regulations issued by the Secretary to have a physical, mental, or...

  12. 15 CFR 25.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    .... Statement means any representation, certification, affirmation, document, record, or accounting or..., the authority, or any State, political subdivision of a State, or other party, if the United States... benefit, or if the Government will reimburse such State, political subdivision, or party for any portion...

  13. H:\\PMKER 25(2)\\PDF 25(2)\\MBETID BESSANE.xps

    African Journals Online (AJOL)

    AISA

    E. MBETID-BESSANE1 et M. HAVARD2. 1Université de Bangui, Faculté des Sciences Economiques et de Gestion (FASEG), Laboratoire d'Economie Rurale ..... si rien n'est fait cette filière cotonnière risque de disparaître. (Mbétid-Bessane, 2009). ..... partenaires financiers demeurent nécessaires pour le renforcement des ...

  14. H:\\PMKER 25(2)\\PDF 25(2)\\HOUNGBO.xps

    African Journals Online (AJOL)

    AISA

    Malgré l'importance reconnue à la filière, la production cotonnière du Bénin chute régulièrement. Elle est passée d'une période de gloire de 1996 à 2004, où elle a largement dépassé les 350 000 t jusqu'à atteindre. 426 251 t, pour chuter brusquement à moins de 200 000 t en 2005 et pour ne plus quasiment jamais ...

  15. H:\\PMKER 25(2)\\PDF 25(2)\\HOUNGBO.xps

    African Journals Online (AJOL)

    AISA

    Ecole Nationale Supérieure des Sciences et Techniques Agronomiques de Kétou, Université d'Abomey-Calavi,. 05 BP 774 Cotonou (République du ... producteurs et l'approche inappropriée de gestion de la caution solidaire. Face cette réalité, il est ..... Projet d'analyse d'une spéculation agricole par pays, Cotonou et ...

  16. H:\\PMKER 25(2)\\PDF 25(2)\\TCHIO.xps

    African Journals Online (AJOL)

    AISA

    Bron H. U. and A. P. Jacomino. 2006. Ripening and quality of «Golden» papaya fruit harvested at different maturity stages.Braz. J. Plant Physiol. 18(3) : 389 - 396. Calegario F. F. and R. Puschmann. 1997. Relationships between peel color and fruit quality of papaya (Carica papaya l.) harvested at different maturity stages.

  17. H:\\PMKER 25(2)\\PDF 25(2)\\TCHIO.xps

    African Journals Online (AJOL)

    AISA

    2Laboratoire de Biotechnologie et Environnement, Unité de Physiologie et Amélioration des Plantes. Faculté des. Sciences, Université de Yaoundé I. Département de Biologie et Physiologie Végétale. B P 812 Yaoundé, Cameroun. RESUME. La graine est l'organe principal de propagation du papayer (Carica papaya), ...

  18. H:\\PMKER 25(2)\\PDF 25(2)\\DIOMANDE.xps

    African Journals Online (AJOL)

    AISA

    seconde saison sèche dans ce département, offre les perspectives plus intéressantes de développer l'élevage. Cependant, la précarité des ressources hydriques liée à la quasi-disparition de la seconde saison des pluies, peut engendrer des contraintes dommageables pour la production des pâturages naturels destinés à.

  19. H:\\PMKER 25(2)\\PDF 25(2)\\LOKONON.xps

    African Journals Online (AJOL)

    AISA

    The velvet tamarind (Dialium guineense Willd) is one of the key species for domestication in Sub-Saharan. Africa. In order to help the sustainable management and conservation of this species, its structural characteristics and ethnobotanical traits were studied in the 4 vegetation types (typical dense forest, degraded dense ...

  20. H:\\PMKER 25(2)\\PDF 25(2)\\BAN KOFFI.xps

    African Journals Online (AJOL)

    AISA

    Les milieux de culture ont été mis à incuber à 30 °C pendant 24 à. 72 h. Les genres microbiens constituant la microflore majeure de la fermentation du cacao ont été recherchés, notamment les levures, les bactéries lactiques, les bactéries acétiques, les bacillus et les moisissures. Le dénombrement des levures s'est faite à ...

  1. H:\\PMKER 25(2)\\PDF 25(2)\\MBETID BESSANE.xps

    African Journals Online (AJOL)

    AISA

    des logiques de survie. En cette période d'incertitude, des mesures politiques et économiques pour accompagner les populations agricoles vulnérables des zones cotonnières sont indispensables pour éviter leur marginalisation. Mots clés : Exploitation agricole familiale, performances économiques, stratégie, crise, coton.

  2. H:\\PMKER 25(2)\\PDF 25(2)\\YONGO.xps

    African Journals Online (AJOL)

    AISA

    Il en ressort que la régénération est en général pauvre le long des récentes pistes d'exploitation, dans les ... financé par la Communauté européenne. Pour ... SITE D'ETUDE. Cette étude a été réalisée dans la forêt de Ngotto située dans le sud-ouest de la République. Centrafricaine entre 3°30' - 4°25' N et 16°20' -.

  3. H:\\PMKER 25(2)\\PDF 25(2)\\MBETID BESSANE.xps

    African Journals Online (AJOL)

    AISA

    leur marginalisation. Mots clés : Exploitation agricole familiale, performances économiques, stratégie, crise, coton. ABSTRACT ... zones to avoid their marginalization. Keywords : Family farm, economic performance, strategy, crisis, cotton. ... agricoles stagne, plusieurs crises financières graves ont eu lieu, et des baisses ...

  4. Alternative synthetic route for the heterometallic CO-releasing [Sb@Rh12(CO27]3− icosahedral carbonyl cluster and synthesis of its new unsaturated [Sb@Rh12(CO24]4− and dimeric [{Sb@Rh12Sb(CO25}2Rh(CO2PPh3]7− derivatives

    Directory of Open Access Journals (Sweden)

    Cristina Femoni

    2016-10-01

    Full Text Available The hetero-metallic [Sb@Rh12(CO27]3− cluster has been known as for over three decades thanks to Vidal and co-workers, and represents the first example of an E-centered (E=heteroatom icosahedral rhodium carbonyl cluster. However, its synthesis required high temperature (140–160 °C and elevated CO pressure (400 atm. Applying the redox condensation method for cluster preparation, we herein report a new synthetic, high-yield route for preparing [Sb@Rh12(CO27]3− under much milder conditions of temperature and pressure. Notably, when the same synthesis was carried out under N2 instead of CO atmosphere, the new isostructural but unsaturated derivative [Sb@Rh12(CO24]4− was obtained, for which we report the full X-ray structural characterization. This species represents one of the few examples of an icosahedral cluster disobeying the electron-counting Wade-Mingos rules, possessing less than the expected 170 cluster valence electrons (CVEs. Judging from IR monitoring, the two species can be obtained one from the other by switching between N2 and CO atmosphere, making [Sb@Rh12(CO27]3− a spontaneous CO-releasing molecule. Finally, the study of the chemical reactivity of [Sb@Rh12(CO27]3− with PPh3 allowed us to obtain the new [{Sb@Rh12Sb(CO25}2Rh(CO2PPh3]7− dimeric compound, for which we herein report the full X-ray structural and 31P NMR analyses.

  5. Environmental assessment of the thermal neutron activation explosive detection system for concourse use at US airports

    Energy Technology Data Exchange (ETDEWEB)

    Jones, C.G.

    1990-08-01

    This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs.

  6. Reliability of semiconductor and gas-filled diodes for over-voltage protection exposed to ionizing radiation

    Directory of Open Access Journals (Sweden)

    Stanković Koviljka

    2009-01-01

    Full Text Available The wide-spread use of semiconductor and gas-filled diodes for non-linear over-voltage protection results in a variety of possible working conditions. It is therefore essential to have a thorough insight into their reliability in exploitation environments which imply exposure to ionizing radiation. The aim of this paper is to investigate the influence of irradiation on over-voltage diode characteristics by exposing the diodes to californium-252 combined neutron/gamma radiation field. The irradiation of semiconductor over-voltage diodes causes severe degradation of their protection characteristics. On the other hand, gas-filled over-voltage diodes exhibit a temporal improvement of performance. The results are presented with the accompanying theoretical interpretations of the observed changes in over-voltage diode behaviour, based on the interaction of radiation with materials constituting the diodes.

  7. 48 CFR 252.237-7017 - Individual laundry.

    Science.gov (United States)

    2010-10-01

    ... contract on both a unit bundle and on a piece-rate bundle basis for individual personnel. (b) The total... services. (c) Charges for individual laundry will be on a per unit bundle or a piece-rate basis. The... whether the laundry is a unit bundle or a piece-rate bundle. An individual laundry bundle will be...

  8. 7 CFR 25.2 - Objective and purpose.

    Science.gov (United States)

    2010-01-01

    ... departments, including Empowerment Zone and Enterprise Community Social Services Block Grant (EZ/EC SSBG... Office of the Secretary of Agriculture RURAL EMPOWERMENT ZONES AND ENTERPRISE COMMUNITIES General... Empowerment Zones and Enterprise Communities in rural areas in order to facilitate the empowerment of the...

  9. Dicty_cDB: VSG252 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available iqnsy*nvwfyi*rpfsstsr*n*rwfkrpkntrwwwwwwwwyfskwwcspww*RILNV VLTLFCYNSIIIIKSNKIIIFGSSSILKKK--- ---IIQIHIKMFGF...nnsnsy*nvwfyi*rpfsstsr*n*rwfkrpkntrwwwwwwwwyfskwwcspww*ri lnvvltlfcynsiiiiksnk Fr...ame C: iiqnsy*nvwfyi*rpfsstsr*n*rwfkrpkntrwwwwwwwwyfskwwcspww*RILNV VLTLFCYNSIIIIKSNKIIIFGSSSILKKK--- ---IIQ

  10. 48 CFR 252.223-7001 - Hazard warning labels.

    Science.gov (United States)

    2010-10-01

    ... and Rodenticide Act; (2) Federal Food, Drug and Cosmetics Act; (3) Consumer Product Safety Act; (4... accordance with the Hazard Communication Standard (29 CFR 1910.1200 et seq). The Standard requires that the hazard warning label conform to the requirements of the standard unless the material is otherwise subject...

  11. 252 Evaluating Managerial Skills for Business Education in a ...

    African Journals Online (AJOL)

    First Lady

    2013-01-28

    Jan 28, 2013 ... Managerial skills according to International Labour. Organization (2002) are skills essential for ... business environment and make it successful in the market, different skills in the managers are required. .... computer the concepts of managerial skills can be taught to the students at every corner of the globe.

  12. 40 CFR 98.252 - GHGs to report.

    Science.gov (United States)

    2010-07-01

    ... units. (b) CO2, CH4, and N2O coke burn-off emissions from each catalytic cracking unit, fluid coking unit, and catalytic reforming unit under this subpart. (c) CO2 emissions from sour gas sent off site...

  13. 48 CFR 252.215-7000 - Pricing adjustments.

    Science.gov (United States)

    2010-10-01

    ... clauses entitled “Price Reduction for Defective Cost or Pricing Data—Modifications,” “Subcontractor Cost or Pricing Data,” and “Subcontractor Cost or Pricing Data—Modifications,” means the aggregate increases and/or decreases in cost plus applicable profits. (End of clause) ...

  14. 48 CFR 252.211-7003 - Item identification and valuation.

    Science.gov (United States)

    2010-10-01

    ... to a class of items with the same form, fit, function, and interface. Parent item means the item..., and parts embedded within delivered items as specified in Attachment Number __. (2) The unique item... item identifier is used). (10) Government's unit acquisition cost. (11) Unit of measure. (e) For...

  15. Dicty_cDB: SHG252 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available xls*iixt*r*nqxky*s*tigc*klgnxmx ilrvnhywvxnqxgkrlanvftxinvisafrnqprlkrtkssfatxssdsnarxhrnlkv qv Translated A... ilrvnhywvxnqxgkrlanvftxinvisafrnqprlkrtkssfatxssdsnarxhrnlkv qv Homology vs CSM-

  16. 48 CFR 252.246-7001 - Warranty of data.

    Science.gov (United States)

    2010-10-01

    ... contract entitled, Rights in Technical Data and Computer Software. (b) Warranty. Notwithstanding inspection... after completion of the delivery of the line item of data (as identified in DD Form 1423, Contract Data... paragraph (d)(3) of this clause shall not apply— (A) With respect to the requirements for product drawings...

  17. Dicty_cDB: VSJ252 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Existence: 5, Extension: 2 Number of Hits to DB: 0 Number of Sequences: 97611 Number of extensions: 0 Numb...er of successful extensions: 0 Number of sequences better than 10.0: 0 Number of HS...P's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 0 Number of HSP'...s that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 0 length of query: 68 length...bda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3019103 Number

  18. Dicty_cDB: CHS252 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FNXFNLTIKKGTTVALVGDSGGGKSSV IGLLERFYDPDEGEVYLDGTNIKEINIHSLRGNIGLVSQEPVLFANSIAENIRYGNENAT MDQIIEACKTA...FNXFNLTIKKGTTVALVGDSGGGKSSV IGLLERFYDPDEGEVYLDGTNIKEINIHSLRGNIGLVSQEPVLFANSIAENIRYGNENAT MDQIIEACKTA

  19. 7 CFR 252.1 - Purpose and scope.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE... and scope. (a) Purpose. This part provides a program whereby the Food and Nutrition Service (FNS) and... industry, acting in cooperation with the States and FNS, to develop new markets in which donated food may...

  20. 252 Evaluating Managerial Skills for Business Education in a ...

    African Journals Online (AJOL)

    First Lady

    2013-01-28

    Jan 28, 2013 ... Skills needed for initiating and successfully running business enterprises or simply the capacity to manage .... As the enterprise grows, there are different specific needs for managerial skills and knowledge. ... business management skills which include, planning, and goal setting, decision making, human ...

  1. 48 CFR 252.211-7006 - Radio Frequency Identification.

    Science.gov (United States)

    2010-10-01

    ... of goods as well as additional information relating to the shipment, such as order information... configuration of goods within the transportation equipment. Bulk commodities means the following commodities... products such as seeds, grains, or animal feed. Case means either a MIL-STD-129 defined exterior container...

  2. 48 CFR 252.225-7021 - Trade agreements.

    Science.gov (United States)

    2010-10-01

    ... (Australia, Bahrain, Canada, Chile, Costa Rica, Dominican Republic, El Salvador, Guatemala, Honduras, Mexico..., Mozambique, Nepal, Niger, Rwanda, Samoa, Sao Tome and Principe, Senegal, Sierra Leone, Solomon Islands...

  3. 7 CFR 868.252 - Definition of other terms.

    Science.gov (United States)

    2010-01-01

    ... of brown rice for processing to a well-milled degree. (h) Objectionable seeds. Whole or broken seeds other than rice, except seeds of Echinochloa crusgalli (commonly known as barnyard grass, watergrass... rice, related material, and seeds. (r) Well-milled kernels. Whole or broken kernels of rice from which...

  4. Dicty_cDB: VSI252 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AGCTAATCTTTAATAGNATTAACAAACCC sequence update 2001. 3.22 Translated Amino Acid sequence ltk**milkkrlttlvll*l...VSSMEAKSMTW*rfryrtwfiifs kknktlklkyenkik*s*slixltn Frame B: ltk**milkkrlttlvll*lhflfqnln*rnsqsnkklylpntlqklv...yri*qrslsqkn *ilp*kklkii*kiltdlaeqii*kllvffkkrfhlwrlnl*lgkdlgielgslfflkki kh*n*nmkik*NKANHLIVINKPSLYVKLKKK--- ---ltk**milk

  5. 48 CFR 252.228-7001 - Ground and flight risk.

    Science.gov (United States)

    2010-10-01

    ... airships, unmanned aerial vehicles, or other nonconventional aircraft specified in this contract. (2... includes any pilot or operator of an unmanned aerial vehicle. If required, a defense systems operator may... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Ground and flight risk...

  6. Dicty_cDB: CHL252 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TNCLSHQHRIFKSGKEIYGCGYWSLKDPYEDPWNESIDSNSSTPSSSPLNPLICGAITNR GNICKKPLNKCSFHSNKPGIKNIXSITTITNNNTNSFYLIQKQQQQQLQHQQQQQQQQQN...TNCLSHQHRIFKSGKEIYGCGYWSLKDPYEDPWNESIDSNSSTPSSSPLNPLICGAITNR GNICKKPLNKCSFHSNKPGIKNIXSITTITNNNTNSFYLIQKQQQQQLQHQQQQQQQQQN

  7. 48 CFR 252.227-7020 - Rights in special works.

    Science.gov (United States)

    2010-10-01

    ..., algorithms, processes, flow charts, formulae and related material that would enable the software to be... capable of causing a computer to perform a specific operation or series of operations. (3) “Computer...

  8. Dicty_cDB: AFH252 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available i*kilaiilkkllfnhqkkqlql*ynkilmilkq*hhh* sqnplvavlvkinhhhhhhvvvvviklkknknqvvvvvvkvnhhhhvvvviiinlkknkn qvvveem...ikrvlk le*kllkiryw*chqrvvlvnqqfhpcyhmvfqreiitppkyly*mlifavrqfqs*wvl inckl*iqsmvgfhqrcnkqimilk...CSSCPGQNACKSQADNPDKKSIEI RMKVIKNKILVMSSKGGVGKSTVSSLLSYGFSKRNNNTTKVSVLDVDICGPSIPKLMGVD KLQIINSEYGWIPPKVQQANHDIKVMSV--- ---rcnkqimilk

  9. Dicty_cDB: VHN252 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NDPKKLETYQNLFYLLQTEPKYLAGLVYLIQPEQMESFLGTVILTLFGDAFTPREEFLLL SLYRLSIQKXMANIATVGDFLKADTVVPKMIITYNKRKQGTD---...NDPKKLETYQNLFYLLQTEPKYLAGLVYLIQPEQMESFLGTVILTLFGDAFTPREEFLLL SLYRLSIQKXMANIATVGDFLKADTVVPKMIITYNKRKQGTD---

  10. 252 Relation entre fracturation et morphologie et leurs implications ...

    African Journals Online (AJOL)

    pc

    Les zones où préexistaient des réseaux de fracture d'origine tectonique permettent la circulation de l'eau. En effet l'addition de la fracturation tectonique et de ... éocène [3]. 3-1-2. La famille 2 N100-110 (ESE-WNW). Cette famille peut correspondre aux accidents (faille) normaux liés à la phase atlasique d'âge éocène.

  11. Dicty_cDB: VSA252 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available genomic DNA, chromosome 9, PAC clone:P0705B06, WORKING DRAFT SEQUENCE, 1 ordered pieces. 52 5e-04 3 AP005577...genomic DNA, chromosome 9, BAC clone:OJ1655_B12, WORKING DRAFT SEQUENCE, 1 ordered pieces. 52 0.005 1 AP004777...genomic DNA, chromosome 2, PAC clone:P0458B05, WORKING DRAFT SEQUENCE, 1 ordered pieces. 44 0.025 6 BZ921801...AC007698 |AC007698.1 Homo sapiens chromosome 4, WORKING DRAFT SEQUENCE, 32 unordered pieces. 46 0.34 1...AC116804 |AC116804.4 Mus musculus clone RP24-343C24, WORKING DRAFT SEQUENCE, 9 unordered pieces. 46 0.34 1 AC055861

  12. Table of radionuclides (Vol. 4 - A = 133 to 252)

    Energy Technology Data Exchange (ETDEWEB)

    Be, M.M.; Chiste, V.; Dulieu, Ch. [CEA Saclay, Laboratoire National Henri Becquerel (LNHB), 91 - Gif-sur-Yvette (France); Browne, E. [Lawrence Berkeley National Lab., CA (United States); Chechev, V.; Kuzmenko, N. [Khlopin Radium Institute (KRI) (Russian Federation); Kondev, F.G. [Argonne National Lab., IL (United States); Luca, A. [Horia Hulubei National Institute of Physics and Nuclear Engineering (IFIN-HH) (Romania); Galan, M. [Ciemat, Lab. de Metrologia de Radiaciones Ionizantes (Spain); Pearce, A. [National Physical Laboratory (NPL) (United Kingdom); Huang, X. [China Institute of Atomic Energy (CIAE) (China)

    2008-07-01

    This monograph is one of several published in a series by the Bureau International des Poids et Mesures (BIPM) on behalf of the Comite Consultatif des Rayonnements Ionisants (CCRI), previously known as the Comite Consultatif pour les Etalons de Mesure des Rayonnements Ionisants (CCEMRI). The aim of this series of publications is to review topics that are of importance for the measurement of ionizing radiation and especially of radioactivity, in particular those techniques normally used by participants in international comparisons. It is hoped that these publications will prove to be useful reference volumes both for those who are already engaged in this field and for those who are approaching such measurements for the first time. The purpose of this monograph, number 4 in the series, is to present the recommended values of nuclear and decay data for a wide range of radionuclides. Activity measurements for more than fifty-five of these radionuclides have already been the subject of comparisons under the auspices of Section II (dedicated to the Measurement of radionuclides) of the CCRI. The material for this monograph is now covered in four volumes. The first two volumes contain the primary recommended data relating to half-lives, decay modes, x-rays, gamma-rays, electron emissions; alpha- and beta-particle transitions and emissions, and their uncertainties for a set of sixty-eight radionuclides, Volume I for those radionuclides with mass number up to and including 150 and Volume 2 for those radionuclides with mass number over 150. Volume 3 contains the equivalent data for twenty-six additional radionuclides as listed and reevaluations for {sup 125}Sb and {sup 153}Sm while Volume 4 contains the data for a further thirty-one radionuclides with re-evaluation for {sup 226}Ra. The data have been collated and evaluated by an international working group (Decay Data Evaluation Project) led by the LNE-LNHB. The evaluators have agreed on the methodologies to be used and the CD-ROM included with this monograph contains the evaluators' comments for each radionuclide in addition to the data tables included in the monograph. The work involved in evaluating nuclear data is on-going and the recommended values are updated on the LNHB web site at http://www.nucleide.org/DDEP{sub W}G/DDEPdata.htm. The publication of further volumes of Monograph 5 is envisaged as and when necessary to add new radionuclide data or re-evaluations in a more permanent format that can be referenced easily. Although other data sets may still be used when evaluating radionuclide activity, use of this common, recommended data set should help to reduce the uncertainties in activity evaluations and lead to more coherent results for comparisons. In order to update the data of the nuclides already present and to add new evaluations, the Laboratoire National Henri Becquerel (LNHB, France) and the Physikalisch-Technische Bundesanstalt (PTB, Germany) established a cooperative agreement; they were then joined by the Idaho National Engineering and Environmental Laboratory (INEEL, USA), the Lawrence Berkeley National Laboratory (LBNL, USA) and the Khlopin Radium Institute (KRI, Russia). This international collaboration is base d on an informal agreement, the initial work of this group was to discuss and to agree on a methodology t o be used in these evaluations. The data and associated uncertainties were evaluated from all available experiments and taking into account theoretical considerations. The main steps for the evaluation of the data and their uncertainties are: - a critical analysis of all available original publications in order to accept or not each value and it s uncertainty reduced to the combined standard uncertainty; - the determination of the best value which is either the weighted or the unweighted average of the retained values, this is decided after examination of the reduced {chi}{sup 2} value. For a weighted average of discrepant data, each weight is limited to 50 %, and the uncertainty, designated u,, is the larger of the internal or external uncertainty values, which may be expanded to cover the most precise input value. A value given without an uncertainty is considered questionable. It is provided for information and often its order of magnitude is estimated from the decay scheme.

  13. Dicty_cDB: SFC252 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available racterized by their enhanced expression in good prognostic human neuroblastoma upon comparison between goo... BD083792 |BD083792.1 Nucleic acid sequence characterized in that expression is potentiated in human neuroblastoma with good... prognosis, in comparion between human neuroblastoma with good prognosis and human neuroblas

  14. All projects related to | Page 252 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: ACCESS TO MARKETS, LABOUR MARKET, Capacity building, Competition policy, STRATEGIC PLANNING, COMPETITION LAW, AFRICA. Region: South Africa, North of Sahara, South of Sahara. Program: Employment and Growth. Total Funding: CA$ 751,100.00. African Competition Forum: Promoting Open and ...

  15. Deepwater Horizon MC252 - Oil Spill: Oil Trajectories Maps

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Trajectory maps are produced using GNOME (General NOAA Operational Modeling Environment), which is an oil spill trajectory model developed by OR and academic...

  16. 24 CFR 207.252 - First, second and third premiums.

    Science.gov (United States)

    2010-04-01

    ... one percent nor more than one percent as the Secretary shall determine of the original face amount of... premium equal to not less than one-fourth of one percent nor more than one percent as the Secretary shall... mortgagee shall pay a third premium equal to not less than one-fourth of one percent nor more than one...

  17. PDF 25(2)\\ZINGA-KOUMBA.xps

    African Journals Online (AJOL)

    AISA

    Dans un souci de valorisation écotouristique du baï de Momba, la dynamique saisonnière des glossines, tabanidés et stomoxes a été évaluée. Dix pièges Vavoua ont été utilisés durant 7 j consécutifs soit un effort de piégeage de 70 pièges-j. Un total de 2 641 stomoxes (57 %), 1 680 glossines (36 %) et 325 tabanidés.

  18. PDF 25(2)\\ZINGA-KOUMBA.xps

    African Journals Online (AJOL)

    AISA

    Louis. 2009. La maladie du sommeil au. Gabon. Cent cinquante ans d'une histoire contrastée. 1861 - 2008. Sciences et. Médecine d'Afrique. 2 : 119 - 132. Nganongo J. B. 1999. Suivi des salines ; Parc national d'Odzala, Congo. Rapports mensuels : Août, septembre, octobre, novembre, décembre. Nganongo J. B. 2000.

  19. 7 CFR 252.4 - Application to participate and agreement.

    Science.gov (United States)

    2010-01-01

    ... integrity, business ethics and performance. In addition, the processors must demonstrate their ability to... which reflects the Department's current acquisition price, transportation and, if applicable, processing... to correct problems identified in the verification effort. The processor shall adjust performance...

  20. 24 CFR 983.252 - PHA information for accepted family.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false PHA information for accepted family... family. (a) Oral briefing. When a family accepts an offer of PBV assistance, the PHA must give the family... of how the program works; and (2) Family and owner responsibilities. (b) Information packet. The PHA...

  1. 46 CFR 252.32 - Maintenance (upkeep) and repairs.

    Science.gov (United States)

    2010-10-01

    ... OPERATORS OPERATING-DIFFERENTIAL SUBSIDY FOR BULK CARGO VESSELS ENGAGED IN WORLDWIDE SERVICES Calculation of... subsidy rate for maintenance and repair shall be the U.S.-foreign cost differential determined from price... foreign-flag competition. See paragraph (b)(4) of this section for an example calculation. (1) Cost survey...

  2. 46 CFR 252.31 - Wages of officers and crews.

    Science.gov (United States)

    2010-10-01

    ... OPERATORS OPERATING-DIFFERENTIAL SUBSIDY FOR BULK CARGO VESSELS ENGAGED IN WORLDWIDE SERVICES Calculation of... calculations of WC are necessary—a per diem amount for every ship type on the service and a per month amount for the predominant ship type (most voyages) on the service. The purpose of the per month calculation...

  3. 46 CFR 252.33 - Hull and machinery insurance.

    Science.gov (United States)

    2010-10-01

    ... OPERATORS OPERATING-DIFFERENTIAL SUBSIDY FOR BULK CARGO VESSELS ENGAGED IN WORLDWIDE SERVICES Calculation of... subsidy and used for determining the U.S.-foreign cost differential. Port risk premiums are eligible for subsidy but not for determining the U.S.-foreign cost differential. (b) U.S.-foreign cost differential. A...

  4. 46 CFR 252.34 - Protection and indemnity insurance.

    Science.gov (United States)

    2010-10-01

    ...), as determined in the calculation of the wage differential. (6) U.S.-Foreign cost differential. The U... differential, and determined in the calculation of wage subsidy for the appropriate fiscal period. The... adjusted by substituting a zero cost for such foreign competitor in the calculation of the differential...

  5. Dicty_cDB: CHP252 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ed Amino Acid sequence cwptgnycpxktllvvftlysivvevlllvknvvsvphyslskliyqy*npsvspliyvp tlpvklshnvssiiglqlvlstki...h*srfshqkekrfsprnprfltnxhekl*ti*vale fsnivxxlkkx*kk Frame B: cwptgnycpxktllvvftlysivvevlllvknvvsvphyslskliyq

  6. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in 248Cm samples for transmutation studies

    Energy Technology Data Exchange (ETDEWEB)

    Gourgiotis, A.; Isnard, H.; Aubert, M.; Dupont, E.; AlMahamid, I.; Cassette, P.; Panebianco, S.; Letourneau, A.; Chartier, F.; Tian, G.; Rao, L.; Lukens, W.

    2011-02-01

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (INcineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in {sup 248}Cm ({approx}97 %) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides formations ranged from 0.3% to 1.3%. This uncertainties range is quite acceptable for the nuclear data to be used in transmutation studies.

  7. Moderator design studies for a new neutron reference source based on the D-T fusion reaction

    Science.gov (United States)

    Mozhayev, Andrey V.; Piper, Roman K.; Rathbone, Bruce A.; McDonald, Joseph C.

    2016-06-01

    The radioactive isotope Californium-252 (252Cf) is relied upon internationally as a neutron calibration source for ionizing radiation dosimetry because of its high specific activity. The source may be placed within a heavy-water (D2O) moderating sphere to produce a softened spectrum representative of neutron fields common to commercial nuclear power plant environments, among others. Due to termination of the U.S. Department of Energy loan/lease program in 2012, the expense of obtaining 252Cf sources has undergone a significant increase, rendering high output sources largely unattainable. On the other hand, the use of neutron generators in research and industry applications has increased dramatically in recent years. Neutron generators based on deuteriumtritium (D-T) fusion reaction provide high neutron fluence rates and, therefore, could possibly be used as a replacement for 252Cf. To be viable, the 14 MeV D-T output spectrum must be significantly moderated to approximate common workplace environments. This paper presents the results of an effort to select appropriate moderating materials and design a configuration to reshape the primary neutron field toward a spectrum approaching that from a nuclear power plant workplace. A series of Monte-Carlo (MCNP) simulations of single layer high- and low-Z materials are used to identify initial candidate moderators. Candidates are refined through a similar series of simulations involving combinations of 2-5 different materials. The simulated energy distribution using these candidate moderators are rated in comparison to a target spectrum. Other properties, such as fluence preservation and/or enhancement, prompt gamma production and other characteristics are also considered.

  8. Moderator design studies for a new neutron reference source based on the D–T fusion reaction

    Energy Technology Data Exchange (ETDEWEB)

    Mozhayev, Andrey V.; Piper, Roman K.; Rathbone, Bruce A.; McDonald, Joseph C.

    2016-06-01

    The radioactive isotope Californium-252 (252Cf) is relied upon internationally as a neutron calibration source for ionizing radiation dosimetry because of its high specific activity. The source may be placed within a heavy-water (D2O) moderating sphere to produce a softened spectrum representative of neutron fields common to commercial nuclear power plant environments, among others. Due to termination of the U.S. Department of Energy loan/lease program in 2012, the expense of obtaining 252Cf sources has undergone a significant increase, rendering high output sources largely unattainable. On the other hand, the use of neutron generators in research and industry applications has increased dramatically in recent years. Neutron generators based on deuterium-tritium (D-T) fusion reaction provide high neutron fluence rates and, therefore, could possibly be used as a replacement for 252Cf. To be viable, the 14.6 MeV D-T output spectrum must be significantly moderated to approximate common workplace environments. This paper presents the results of an effort to select appropriate moderating materials and design a configuration to reshape the primary neutron field toward a spectrum approaching that from a nuclear power plant workplace. A series of Monte-Carlo (MCNP) simulations of single layer high- and low-Z materials are used to identify initial candidate moderators. Candidates are refined through a similar series of simulations involving combinations of 2 to 5 different materials. The simulated energy distribution using these candidate moderators are rated in comparison to a target spectrum. Other properties, such as fluence preservation and/or enhancement, prompt gamma production and other characteristics are also considered.

  9. Toward achieving flexible and high sensitivity hexagonal boron nitride neutron detectors

    Science.gov (United States)

    Maity, A.; Grenadier, S. J.; Li, J.; Lin, J. Y.; Jiang, H. X.

    2017-07-01

    Hexagonal boron nitride (h-BN) detectors have demonstrated the highest thermal neutron detection efficiency to date among solid-state neutron detectors at about 51%. We report here the realization of h-BN neutron detectors possessing one order of magnitude enhancement in the detection area but maintaining an equal level of detection efficiency of previous achievement. These 3 mm × 3 mm detectors were fabricated from 50 μm thick freestanding and flexible 10B enriched h-BN (h-10BN) films, grown by metal organic chemical vapor deposition followed by mechanical separation from sapphire substrates. Mobility-lifetime results suggested that holes are the majority carriers in unintentionally doped h-BN. The detectors were tested under thermal neutron irradiation from californium-252 (252Cf) moderated by a high density polyethylene moderator. A thermal neutron detection efficiency of ˜53% was achieved at a bias voltage of 200 V. Conforming to traditional solid-state detectors, the realization of h-BN epilayers with enhanced electrical transport properties is the key to enable scaling up the device sizes. More specifically, the present results revealed that achieving an electrical resistivity of greater than 1014 Ωṡcm and a leakage current density of below 3 × 10-10 A/cm2 is needed to fabricate large area h-BN detectors and provided guidance for achieving high sensitivity solid state neutron detectors based on h-BN.

  10. Study of reproducibility of measurements with the spectrometer of Bonner multispheres

    Energy Technology Data Exchange (ETDEWEB)

    Azevedo, G.A.; Pereira, W.W.; Patrao, K.C.S.; Fonseca, E.S., E-mail: geisadeazevedo@gmail.com, E-mail: walsan@ird.gov.br, E-mail: karla@ird.gov.br, E-mail: evaldo@ird.gov.br [Instituto de Radionprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2013-07-01

    This work aims to study the metrological behavior of the Bonner Multisphere Spectrometer (BMS) of the LN / LNMRI / IRD - Laboratorio Metrologia de Neutrons / Laboratorio Nacional de Metrologia e Radiacao Ionizante / Instituto de Radioprotecao e Dosimetria, for measurements in repeatability and reproducibility conditions. Initially, a simulation was done by applying the Monte Carlo method, using the MCNP code and respecting the ISO 8529-1 (2001), using the sources of Californium ({sup 252} Cf), Americium-Beryllium ({sup 241} AmBe) and californium in heavy water (Cf + D{sub 2}O), all located at a distance of 100 cm from the neutron detector ({sup 6}Li (Eu) - crystal scintillator). In this program, the counting of neutrons that are captured by the detector was made. The source is located in the center of a sphere of radius 300 cm. Analyzes the impact of these neutrons in a point of the sphere wall, which in this case acted as a neutron detector and from there, it is estimated the number of neutrons that collide in the whole sphere. The purpose is to obtain the neutron count for different energy bands in a solid field of neutrons, since they have a spectrum ranging from a low to a high energy that can also vary within a particular environment. Wishes to obtain new fields with different sources and moderators materials to be used as new reference fields. Measurements are being conducted for these fields, with the aim of analyzing the variability conditions of the measurement (repeatability and reproducibility) in LEN - Laboratorio de Espectrometria de Neutrons of the LN/LMNRI/IRD. Thus, the spectrometer will be used to improve both the knowledge of the spectrum as the standard of neutrons of the lab, proving that a spectrometry is essential for correct measurement.

  11. Project Plan 7930 Cell G PaR Remote Handling System Replacement

    Energy Technology Data Exchange (ETDEWEB)

    Kinney, Kathryn A [ORNL

    2009-10-01

    For over 40 years the US Department of Energy (DOE) and its predecessors have made Californium-252 ({sup 252}Cf) available for a wide range of industries including medical, nuclear fuels, mining, military and national security. The Radiochemical Engineering Development Center (REDC) located within the Oak Ridge National Laboratory (ORNL) processes irradiated production targets from the High Flux Isotope Reactor (HFIR). Operations in Building 7930, Cell G provide over 70% of the world's demand for {sup 252}Cf. Building 7930 was constructed and equipped in the mid-1960s. Current operations for {sup 252}Cf processing in Building 7930, Cell G require use of through-the-wall manipulators and the PaR Remote Handling System. Maintenance and repairs for the manipulators is readily accomplished by removal of the manipulator and relocation to a repair shop where hands-on work can be performed in glove boxes. Contamination inside cell G does not currently allow manned entry and no provisions were created for a maintenance area inside the cell. There has been no maintenance of the PaR system or upgrades, leaving operations vulnerable should the system have a catastrophic failure. The Cell G PaR system is currently being operated in a run to failure mode. As the manipulator is now 40+ years old there is significant risk in this method of operation. In 2006 an assessment was completed that resulted in recommendations for replacing the manipulator operator control and power centers which are used to control and power the PaR manipulator in Cell G. In mid-2008 the chain for the bridge drive failed and subsequent examinations indicated several damaged links (see Figure 1). To continue operations the PaR manipulator arm is being used to push and pull the bridge as a workaround. A retrieval tool was fabricated, tested and staged inside Cell G that will allow positioning of the bridge and manipulator arm for removal from the cell should the PaR system completely fail. A fully

  12. Compensated bismuth-loaded plastic scintillators for neutron detection using low-energy pseudo-spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Dumazert, Jonathan, E-mail: jonathan.dumazert@cea.fr [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France); Coulon, Romain; Bertrand, Guillaume H.V.; Normand, Stéphane [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France); Méchin, Laurence [CNRS, UCBN, Groupe de Recherche en Informatique, Image, Automatique et Instrumentation de Caen, 14050 Caen (France); Hamel, Matthieu [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France)

    2016-05-21

    Gadolinium-covered modified plastic scintillators show a high potential for the deployment of cost-effective neutron detectors. Taking advantage of the low-energy photon and electron signature of thermal neutron captures in gadolinium-155 and gadolinium-157 however requires a background correction. In order to display a trustable rate, dual compensation schemes appear as an alternative to Pulse Shape Discrimination. This paper presents the application of such a compensation scheme to a two-bismuth loaded plastic scintillator system. A detection scintillator interacts with incident photon and fast neutron radiations and is covered with a gadolinium converter to become thermal neutron-sensitive as well. In the meantime, an identical compensation scintillator, covered with terbium, solely interacts with the photon and fast neutron part of incident radiations. After the acquisition and the treatment of the counting signals from both sensors, a hypothesis test determines whether the resulting count rate after subtraction falls into statistical fluctuations or provides a robust image of neutron activity. A laboratory prototype is tested under both photon and neutron radiations, allowing us to investigate the performance of the overall compensation system. The study reveals satisfactory results in terms of robustness to a cesium-137 background and in terms of sensitivity in presence of a californium-252 source.

  13. Analysis of patents on mining technology

    Energy Technology Data Exchange (ETDEWEB)

    Menyailo, N.I.; Grishchenko, A.N.; Ratner, M.V.; Kobylyanskii, A.Ya.; Tyshlek, E.G.

    1987-09-01

    Analyses the current work being carried out with the aim of developing and perfecting coal mining technology with regard to improving safety and working conditions (equipment is currently responsible for 6.3% of all hazards in coal mines) by examining patents of class ES 21 S produced in the USSR, USA, UK, FRG, Japan and France between 1970-1984. By far the majority of patents is concerned with improving technology and productivity and a disappointing number deals with safety matters (only 7.2% of the patents for new cutter loader designs deal with dust suppression systems and most of these come from the FRG; no patents for powered mining complexes deal with the problem of noise and vibration reduction). The patents with the most direct relevance to health and safety concern remote control devices for mining equipment, in particular, devices based on radioactive isotopes (e.g. cesium-137, americum-241, selenium-75, californium-252) but measures for monitoring them and protecting against them are not found.

  14. Fast neutron tomography with real-time pulse-shape discrimination in organic scintillation detectors

    Energy Technology Data Exchange (ETDEWEB)

    Joyce, Malcolm J., E-mail: m.joyce@lancaster.ac.uk [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Agar, Stewart [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Aspinall, Michael D. [Hybrid Instruments Ltd., Gordon Manley Building, Lancaster Environment Centre, Lancaster University, Lancaster LA1 4YW (United Kingdom); Beaumont, Jonathan S.; Colley, Edmund; Colling, Miriam; Dykes, Joseph; Kardasopoulos, Phoevos; Mitton, Katie [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom)

    2016-10-21

    A fast neutron tomography system based on the use of real-time pulse-shape discrimination in 7 organic liquid scintillation detectors is described. The system has been tested with a californium-252 source of dose rate 163 μSv/h at 1 m and neutron emission rate of 1.5×10{sup 7} per second into 4π and a maximum acquisition time of 2 h, to characterize two 100×100×100 mm{sup 3} concrete samples. The first of these was a solid sample and the second has a vertical, cylindrical void. The experimental data, supported by simulations with both Monte Carlo methods and MATLAB®, indicate that the presence of the internal cylindrical void, corners and inhomogeneities in the samples can be discerned. The potential for fast neutron assay of this type with the capability to probe hydrogenous features in large low-Z samples is discussed. Neutron tomography of bulk porous samples is achieved that combines effective penetration not possible with thermal neutrons in the absence of beam hardening.

  15. Investigation of Workplace-like Calibration Fields via a Deuterium-Tritium (D-T) Neutron Generator.

    Science.gov (United States)

    Mozhayev, Andrey V; Piper, Roman K; Rathbone, Bruce A; McDonald, Joseph C

    2017-04-01

    Radiation survey meters and personal dosimeters are typically calibrated in reference neutron fields based on conventional radionuclide sources, such as americium-beryllium (Am-Be) or californium-252 (Cf), either unmodified or heavy-water moderated. However, these calibration neutron fields differ significantly from the workplace fields in which most of these survey meters and dosimeters are being used. Although some detectors are designed to yield an approximately dose-equivalent response over a particular neutron energy range, the response of other detectors is highly dependent upon neutron energy. This, in turn, can result in significant over- or underestimation of the intensity of neutron radiation and/or personal dose equivalent determined in the work environment. The use of simulated workplace neutron calibration fields that more closely match those present at the workplace could improve the accuracy of worker, and workplace, neutron dose assessment. This work provides an overview of the neutron fields found around nuclear power reactors and interim spent fuel storage installations based on available data. The feasibility of producing workplace-like calibration fields in an existing calibration facility has been investigated via Monte Carlo simulations. Several moderating assembly configurations, paired with a neutron generator using the deuterium tritium (D-T) fusion reaction, were explored.

  16. Production of medical radioisotopes in the ORNL High Flux Isotope Reactor (HFIR) for cancer treatment and arterial restenosis therapy after PTCA

    Energy Technology Data Exchange (ETDEWEB)

    Knapp, F.F. Jr.; Beets, A.L.; Mirzadeh, S.; Alexander, C.W.; Hobbs, R.L.

    1998-06-01

    The High Flux Isotope Reactor (HFIR) at the Oak Ridge National Laboratory (ORNL) represents an important resource for the production of a wide variety of medical radioisotopes. In addition to serving as a key production site for californium-252 and other transuranic elements, important examples of therapeutic radioisotopes which are currently routinely produced in the HFIR for distribution include dysprosium-166 (parent of holmium-166), rhenium-186, tin-117m and tungsten-188 (parent of rhenium-188). The nine hydraulic tube (HT) positions in the central high flux region permit the insertion and removal of targets at any time during the operating cycle and have traditionally represented a major site for production of medical radioisotopes. To increase the irradiation capabilities of the HFIR, special target holders have recently been designed and fabricated which will be installed in the six Peripheral Target Positions (PTP), which are also located in the high flux region. These positions are only accessible during reactor refueling and will be used for long-term irradiations, such as required for the production of tin-117m and tungsten-188. Each of the PTP tubes will be capable of housing a maximum of eight HT targets, thus increasing the total maximum number of HT targets from the current nine, to a total of 57. In this paper the therapeutic use of reactor-produced radioisotopes for bone pain palliation and vascular brachytherapy and the therapeutic medical radioisotope production capabilities of the ORNL HFIR are briefly discussed.

  17. Page 1 252 A W Patki subsystem packages, has also to meet ...

    Indian Academy of Sciences (India)

    control; the solar panels need to be fixed to the outer surface of the Aryabhata structure, and the passive thermal control system required some free exposed area for thermal treatment. To keep power fluctuations to a minimum, irrespective of the orientation of the Satellite in inertial space, a quasi-spherical shape for a ...

  18. 48 CFR 252.225-7012 - Preference for certain domestic commodities.

    Science.gov (United States)

    2010-10-01

    ... para-aramid fibers and continuous filament para-aramid yarns manufactured in a qualifying country. (d..., handwear, belts, badges, and insignia. (3) Tents, tarpaulins, or covers. (4) Cotton and other natural fiber..., and coated synthetic fabric, including all textile fibers and yarns that are for use in such fabrics...

  19. 25+2 poles, 4.3 T wiggler at BMIT – 7 years operational experience

    Energy Technology Data Exchange (ETDEWEB)

    Wysokinski, Tomasz W., E-mail: bmit@lightsource.ca; Chapman, L. Dean; Miller, Denise; Belev, George; Lin, Linda; Adam, Madison; Wurtz, Ward; Dallin, Les [Canadian Light Source, Saskatoon, SK (Canada)

    2016-07-27

    The research program at the Biomedical Imaging and Therapy (BMIT) Facility at the Canadian Light Source (CLS) required a unique radiation source that would provide a wide beam fan with high critical energy and high dose rates. A superconductive wiggler was the only practical solution that could be installed inside the CLS ring. Design requirements were defined in 2005 [1-2]. The wiggler, optimized for a 3 GeV ring, was to match operating parameters of an equivalent hard X-ray source on a 6 GeV ring. Manufacturing started in 2006 and the wiggler was installed in November of 2007 [3-5]. Several modifications to external hardware and to the power supplies’ controls were implemented to address the air leaks into the He space and to provide the ability to change the field of the wiggler during normal operation without affecting other research groups. The original burst disk and pressure relief valves were replaced with commercial units. Most of the buna O-rings were replaced with metal O-rings, helping to provide air-tightness of external connections. Over the years, the nominal, no-load temperatures went up by 0.3 K at the LHe space and up by 4 K at the 50 K shield space due to deterioration of thermal links and insulation, resulting from thermal cycling and vibrations generated by cryo-coolers. In October of 2014 the wiggler went through major maintenance to improve the thermal links operation, to improve the LHe transfer line connection, to install additional heaters to mitigate potential ice growth, and to provide a separate exhaust path for the rupture disk port.

  20. 48 CFR 252.239-7007 - Cancellation or termination of orders.

    Science.gov (United States)

    2010-10-01

    ... Cancellation or Termination Liability established by the CSA or other contractual document is based on... payments if in the opinion of the Contracting Officer the total of the payments is within the amount the...) Failure to agree shall be a dispute concerning a question of fact within the meaning of the Disputes...

  1. 40 CFR 81.252 - Northwest Kansas Intrastate Air Quality Control Region.

    Science.gov (United States)

    2010-07-01

    ..., Cheyenne County, Decatur County, Ellis County, Gove County, Graham County, Logan County, Ness County..., Sheridan County, Sherman County, Smith County, Thomas County, Trego County, Wallace County. ...

  2. 48 CFR 252.211-7005 - Substitutions for military or Federal specifications and standards.

    Science.gov (United States)

    2010-10-01

    ...: Substitutions For Military or Federal Specifications and Standards (NOV 2005) (a) Definition. “SPI process,” as... via the Internet at http://guidebook.dcma.mil/20/guidebook_process.htm (paragraph 4.2). (c) An offeror..., but is not yet listed at the Internet site specified in paragraph (b) of this clause, submit...

  3. 48 CFR 252.225-7006 - Quarterly reporting of actual contract performance outside the United States.

    Science.gov (United States)

    2010-10-01

    ...) Definition. United States, as used in this clause, means the 50 States, the District of Columbia, and... of DD Form 2139 from the Contracting Officer or via the Internet at http://www.dtic.mil/whs...

  4. 7 CFR 1710.252 - Construction work plans-power supply borrowers.

    Science.gov (United States)

    2010-01-01

    ... UTILITIES SERVICE, DEPARTMENT OF AGRICULTURE GENERAL AND PRE-LOAN POLICIES AND PROCEDURES COMMON TO ELECTRIC..., new substations and substation improvements and replacements, and Systems Control and Data Acquisition...

  5. Cyanobacterial fossils from 252 Ma old microbialites and their environmental significance

    Science.gov (United States)

    Wu, Ya Sheng; Yu, Gong Liang; Li, Ren Hui; Song, Li Rong; Jiang, Hong Xia; Riding, Robert; Liu, Li Jing; Liu, Dong Yan; Zhao, Rui

    2014-01-01

    The end-Permian mass extinction was followed by the formation of an enigmatic rock layer with a distinctive macroscopic spotted or dendroid fabric. This deposit has been interpreted as microbial reef rock, digitate dendrolite, digital thrombolite, dendritic thrombolite, or bacterial deposits. Agreement has been reached in considering them as microbialites, but not in their formation. This study has revealed that the spotted and dendroid microbialites were composed of numerous fossil casts formed by the planktic cyanobacterium, Microcystis, a coccoid genus that at the present-day commonly forms blooms in modern lakes, rivers, and reservoirs. The abundance of the fossils and the diagenesis they experienced has determined the macroscopic fabric: where they abundant, the rock appears as dendroid, otherwise, it appears as spotted. The ancient Microcystis bloom might produce toxin to kill other metazoans, and be responsible for the oceanic anoxia that has puzzled so many researchers for so many years. PMID:24448025

  6. 48 CFR 252.217-7005 - Inspection and manner of doing work.

    Science.gov (United States)

    2010-10-01

    ... with the best commercial marine practices and the rules and requirements of the American Bureau of... provided in the job order, all operational practices of the Contractor and all workmanship, material... workmanship. The solicitation shall prescribe the Navy standard whenever applicable. (c) The Government may...

  7. Role of energy cost in the yield of cold ternary fission of 252 Cf

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics; Volume 80; Issue 1. Role of energy cost in the yield of cold ... P V Kunhikrishnan1 K P Santhosh2. P.G. Department of Physics, Sree Narayana College, Kannur 670 007, India; School of Pure & Applied Physics, Kannur University, Payyanur Campus, Payyanur 670 327, India ...

  8. 50 CFR 14.252 - What definitions do I need to know?

    Science.gov (United States)

    2010-10-01

    ... wildlife species means a specimen of any of the following eight species: Lion (Panthera leo), tiger (Panthera tigris), leopard (Panthera pardus), snow leopard (Uncia uncia), clouded leopard (Neofelis nebulosa), jaguar (Panthera onca), cheetah (Acinonyx jubatus), and cougar (Puma concolor) or any hybrids resulting...

  9. Yeast Interacting Proteins Database: YBR135W, YBR252W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available tes proteolysis of M-phase targets through interactions with the proteasome; role in transcriptional regulat...yclin-dependent protein kinase regulatory subunit and adaptor; modulates proteolysis of M-phase targets through interactions

  10. 48 CFR 252.225-7009 - Restriction on Acquisition of Certain Articles Containing Specialty Metals.

    Science.gov (United States)

    2010-10-01

    ... of the following elements: Aluminum, chromium, cobalt, molybdenum, nickel, niobium (columbium... alloys that contain a total of alloying metals other than cobalt and iron in excess of 10 percent; (iii...) Definitions. As used in this clause— (1) Alloy means a metal consisting of a mixture of a basic metallic...

  11. 48 CFR 252.225-7008 - Restriction on Acquisition of Specialty Metals.

    Science.gov (United States)

    2010-10-01

    ...; or (B) Containing more than 0.25 percent of any of the following elements: Aluminum, chromium, cobalt... of 10 percent; or (B) Cobalt alloys that contain a total of alloying metals other than cobalt and... 2009) (a) Definitions. As used in this clause— (1) Alloy means a metal consisting of a mixture of a...

  12. 48 CFR 252.225-7045 - Balance of Payments Program-Construction Material Under Trade Agreements.

    Science.gov (United States)

    2010-10-01

    ..., El Salvador, Guatemala, Honduras, Mexico, Morocco, Nicaragua, Peru, or Singapore); (3) A least..., Malawi, Maldives, Mali, Mauritania, Mozambique, Nepal, Niger, Rwanda, Samoa, Sao Tome and Principe...

  13. 48 CFR 252.205-7000 - Provision of information to cooperative agreement holders.

    Science.gov (United States)

    2010-10-01

    ... government; a private, nonprofit organization; a tribal organization (as defined in section 4(c) of the... economic enterprise (as defined in section 3(e) of the Indian Financing Act of 1974 (Pub. L. 93-362; 25 U.S... has an agreement with the Defense Logistics Agency to furnish procurement technical assistance to...

  14. 48 CFR 252.209-7007 - Prohibited Financial Interests for Lead System Integrators.

    Science.gov (United States)

    2010-10-01

    ... contractor for the development or production of a major system, if the prime contractor is not expected at the time of award to perform a substantial portion of the work on the system and the major subsystems... while performing lead system integrator functions in the acquisition of a major system by the Department...

  15. 48 CFR 252.229-7011 - Reporting of Foreign Taxes-U.S. Assistance Programs.

    Science.gov (United States)

    2010-10-01

    ... all value added taxes and customs duties imposed by the recipient country. This exemption is in... shall inform the foreign government of the tax exemption, as documented in the Letter of Offer and... nevertheless imposes taxes, the Contractor shall promptly notify the Contracting Officer and shall provide...

  16. 252 canopy (Obatolu and Agboola, 1993; Ilori et al., 2011). It is ...

    African Journals Online (AJOL)

    Osondu

    2012-02-22

    Feb 22, 2012 ... classified as moist semi-deciduous forest under which the soil of the study area is formed (Aweto,. 1981). The soils contain very high reserves of weatherable weathered materials characterized with very high base saturation. The chemical characteristics of the soil however vary considerably, depending on ...

  17. 48 CFR 252.204-7005 - Oral attestation of security responsibilities.

    Science.gov (United States)

    2010-10-01

    ... responsibilities imposed by law or regulation on those granted access. Reading aloud the first paragraph of... responsibilities when being briefed into a new program or during their annual refresher briefing. There is no... and shall submit a report to the Contractor's security activity. (End of clause) ...

  18. 48 CFR 252.227-7038 - Patent Rights-Ownership by the Contractor (Large Business).

    Science.gov (United States)

    2010-10-01

    ...— (1) A university or other institution of higher education; (2) An organization of the type described... paragraph (c) of this clause and the agency requests title within 60 days after learning of the Contractor's...) Serial number and title. (iii) A copy of any patent application (including an English-language version if...

  19. 20 CFR 25.2 - In general, what is the Director's policy regarding such claims?

    Science.gov (United States)

    2010-04-01

    ...' compensation laws, or provisions in the nature of workers' compensation, in effect in areas outside the United... residents of the United States, any territory or Canada, unless a special schedule of compensation for injury or death has been established under this part for the particular locality, or for a class of...

  20. Deepwater Horizon MC252 - Oil Spill: Ocean Imaging Corp.'s Aerial Multispectral Oil Mapping System

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Ocean Imaging Corp.'s Aerial Multispectral Oil Mapping System employs a customizable 4-spectral channel system and IR imager integrated to allow simultaneous data...

  1. 48 CFR 252.237-7023 - Continuation of Essential Contractor Services.

    Science.gov (United States)

    2010-10-01

    ... paragraph (a) of this section during a crisis situation, the Contractor shall notify the Contracting Officer... ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT... Government has identified all or a portion of the services performed under this contract as essential...

  2. : tous les projets | Page 252 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Date de début : 1 mars 2011. End Date: 1 août 2014. Région: Peru, West Indies. Financement total : CA$ 3,400,000.00. Agriculture biologique dans les Andes péruviennes. Projet. Au Pérou, la pauvreté est presque trois fois plus prononcée en milieu rural qu'en milieu urbain, et la situation est encore pire dans les Andes.

  3. 29 CFR 779.252 - Not in deliveries from the reselling establishment.

    Science.gov (United States)

    2010-07-01

    ... “deliveries from the reselling establishment” is to limit the test to goods which flow into the enterprise and to exclude those goods which only cross State lines when they flow out of the enterprise as an... STANDARDS ACT AS APPLIED TO RETAILERS OF GOODS OR SERVICES Employment to Which the Act May Apply; Enterprise...

  4. 48 CFR 252.204-7004 - Alternate A, Central Contractor Registration.

    Science.gov (United States)

    2010-10-01

    ... information required for the conduct of business with the Government. “Commercial and Government Entity (CAGE) code” means— (1) A code assigned by the Defense Logistics Information Service (DLIS) to identify a..., Inc. (D&B) to identify unique business entities. “Data Universal Numbering System +4 (DUNS+4) number...

  5. A Randomized Experiment Using Absenteeism Information to "Nudge" Attendance. REL 2017-252

    Science.gov (United States)

    Rogers, Todd; Duncan, Teresa; Wolford, Tonya; Ternovski, John; Subramanyam, Shruthi; Reitano, Adrienne

    2017-01-01

    Reducing student absenteeism is a key part of the School District of Philadelphia's plan to boost graduation rates. One of the district's goals is to increase guardians' awareness of absenteeism, with the hope that greater awareness will lead to guardians' taking a more active role in improving their student's attendance and academic performance.…

  6. 48 CFR 252.225-7016 - Restriction on acquisition of ball and roller bearings.

    Science.gov (United States)

    2010-10-01

    ... components means the bearing element, retainer, inner race, or outer race. (2) Component, other than bearing..., such as preformed bar, tube, or rod stock and lubricants, need not be mined or produced in the United...

  7. 48 CFR 252.227-7013 - Rights in technical data-Noncommercial items.

    Science.gov (United States)

    2010-10-01

    ... instructions, operating instructions, and other similar items, regardless of storage medium, that explain the..., handling, or mailing the documents or other media in which the technical data will be delivered. (k... contracts as economic leverage to obtain rights in technical data from their subcontractors or suppliers. (5...

  8. Fungal diversity notes 111-252-taxonomic and phylogenetic contributions to fungal taxa

    Czech Academy of Sciences Publication Activity Database

    Ariyawansa, H. A.; Hyde, K. D.; Jayasiri, C.; Buyck, B.; Thilini Chethana, K. W.; Dai, D. Q.; Dai, Y. C.; Daranagama, D. A.; Jayawardena, R. S.; Lücking, R.; Ghobad-Nejhad, M.; Niskanen, T.; Thambugala, K. M.; Voigt, K.; Zhao, R. L.; Li, G. J.; Doilom, M.; Boonmee, S.; Yang, Z. L.; Cai, Q.; Cui, Y. Y.; Bahkali, A. H.; Chen, J.; Cui, B.K.; Chen, J.; Dayarathne, M. C.; Dissanayake, A. J.; Ekanayaka, A. H.; Hashimoto, A.; Hongsanan, S.; Gareth Jones, E. B.; Larsson, E.; Li, W. J.; Li, Q. R.; Liu, J. K.; Luo, Z. L.; Maharachchikumbura, S.S.; Mapook, A.; McKenzie, E.; Norphanphoun, C.; Konta, S.; Pang, K. L.; Perera, R. H.; Phookamsak, R.; Phukhamsakda, C.; Pinruan, U.; Randrianjohany, E.; Singtripop, C.; Tanaka, K.; Tian, C. M.; Tibpromma, S.; Abdel-Wahab, M. A.; Wanasinghe, N. N.; Zhang, J. F.; Zhang, H.; Abdel-Aziz, F. A.; Wedin, M.; Westberg, M.; Ammirati, J. F.; Bulgakov, T. S.; Lima, D. X.; Callaghan, T. M.; Callac, P.; Chang, C. H.; Coca, L. F.; Dal-Forno, M.; Dollhofer, V.; Fliegerová, Kateřina; Greiner, K.; Griffith, G. W.; Ho, H.M.; Hofstetter, V.; Jeewon, R.; Kang, J. C.; Wen, T. C.; Kirk, P.M.; Kytövuori, I.; Lawrey, J. D.; Xing, J. P.; Li, H.; Liu, X.; Liimatainen, K.; Thorsten Lumbsch, H.; Matsumura, M.; Moncada, B.; Nuankaew, S.; Parnmen, S.; de Azevedo Santiago, A. L. C. M.; Sommai, S.; Song, Y.; de Souza, C. A. F.; de Souza-Motta, C. M.; Su, H. Y.; Suetrong, S.; Wang, Y.; Wei, S. F.; Wen, T. Ch.; Yuan, H. S.; Zhou, L. W.; Réblová, Martina; Fournier, J.; Camporesi, E.; Luangsa-ard, J. J.; Tasanathai, K.; Khonsanit, A.; Thanakitpipattana, D.; Somrithipol, S.; Diederich, P.; Millanes, A. M.; Common, R. S.; Stadler, M.; Yan, J. Y.; Li, X. H.; Lee, H. W.; Nguyen, T. T. T.; Lee, H. B.; Battistin, E.; Marsico, O.; Vizzini, A.; Vila, J.; Ercole, E.; Eberhardt, U.; Simonini, G.; Wen, H. A.; Chen, X. H.; Miettinen, O.; Spirin, V.; Hernawati, Dr.

    2015-01-01

    Roč. 75, č. 1 (2015), s. 27-274 ISSN 1560-2745 R&D Projects: GA ČR GAP506/12/0038 Institutional support: RVO:67985904 ; RVO:67985939 Keywords : fungi * taxonomy * new genus Subject RIV: EE - Microbiology, Virology; EF - Botanics (BU-J) Impact factor: 6.991, year: 2015

  9. Clinicopathological Study of 252 Jaw Bone Periapical Lesions From a Private Pathology Laboratory

    Directory of Open Access Journals (Sweden)

    Hung-Pin Lin

    2010-11-01

    Conclusion: Granulomas and cysts were the two most common periapical lesions. Periapical lesions occurred more frequently in female patients and in those in their fourth to fifth decades. The most commonly affected site for periapical lesions was the maxillary anterior region, and the most frequently involved tooth was the maxillary lateral incisor.

  10. 48 CFR 252.227-7021 - Rights in data-existing works.

    Science.gov (United States)

    2010-10-01

    ... includes literary, musical, and dramatic works; pantomimes and choreographic works; pictorial, graphic and sculptural works; motion pictures and other audiovisual works; sound recordings; and works of a similar...

  11. Calculated neutron air kerma strength conversion factors for a generically encapsulated Cf-252 brachytherapy source

    CERN Document Server

    Rivard, M J; D'Errico, F; Tsai, J S; Ulin, K; Engler, M J

    2002-01-01

    The sup 2 sup 5 sup 2 Cf neutron air kerma strength conversion factor (S sub K sub N /m sub C sub f) is a parameter needed to convert the radionuclide mass (mu g) provided by Oak Ridge National Laboratory into neutron air kerma strength required by modern clinical brachytherapy dosimetry formalisms indicated by Task Group No. 43 of the American Association of Physicists in Medicine (AAPM). The impact of currently used or proposed encapsulating materials for sup 2 sup 5 sup 2 Cf brachytherapy sources (Pt/Ir-10%, 316L stainless steel, nitinol, and Zircaloy-2) on S sub K sub N /m sub C sub f was calculated and results were fit to linear equations. Only for substantial encapsulation thicknesses, did S sub K sub N /m sub C sub f decrease, while the impact of source encapsulation composition is increasingly negligible as Z increases. These findings are explained on the basis of the non-relativistic kinematics governing the majority of sup 2 sup 5 sup 2 Cf neutron interactions. Neutron kerma and energy spectra resul...

  12. 48 CFR 252.247-7023 - Transportation of supplies by sea.

    Science.gov (United States)

    2010-10-01

    ... contingency operations, exercises, or forces deployed in humanitarian or peacekeeping operations; or (3) Are..., or forces deployed in humanitarian or peacekeeping operations (Note: This contract requires shipment... deployed in humanitarian or peacekeeping operations); or (C) Are commissary or exchange cargoes transported...

  13. Theatralität in Literatur und Kultur, Germanoslavica 25/2, 2014

    Directory of Open Access Journals (Sweden)

    Elke Mehnert

    2016-12-01

    Full Text Available In einer ausführlichen Einleitung annoncieren die Herausgeber nicht nur jeden der zehn Aufsätze, indem sie eine knappe Zusammenfassung des Inhalts geben, sondern sie bestimmen auch das Anliegen der gesamten, 214 Textseiten umfassenden Publikation: Mit der Zusammenstellung so multipler, auch transnationaler und transdisziplinärer Perspektiven kommt diese Themennummer der Germanoslavica […] dem jüngeren Credo einer kulturwissenschaftlichen und kulturenübergreifenden Öffnung der Zeitschrift nach. Insgesamt sollen die in diesem Heft zusammengestellten Beiträge einen Blick auf die Möglichkeiten der Erforschung eines gattungs- und kulturenüberschreitenden Paradigmas aus einer Perspektive jenseits der Nationalitäten liefern.

  14. Nigerian Veterinary Journal Vol. 25(2), 13-18 (2004)

    African Journals Online (AJOL)

    Antigen-detection enzyme-linked immunosorbent assay (Ag-ELISA) and buffy coat parasitological technique (BCT) were employed for the diagnosis of bovine trypanosomiosis in trade cattle slaughtered at the Bodija Municipal abattoir in Ibadan, Oyo State, between March and November, 2002 and in some sedentary herds ...

  15. External beam radiation and high-dose-rate brachytherapy for elderly patients with gastroesophageal junction adenocarcinoma

    Directory of Open Access Journals (Sweden)

    Wei Zhang

    2017-07-01

    Full Text Available Purpose: The aim of this study was to retrospectively observe and analyze the long-term treatment outcomes of 96 elderly patients with gastroesophageal junction adenocarcinoma (GEJAC who were treated with californium-252 (252Cf neutron brachytherapy (NBT in combination with external beam radiotherapy (EBRT with or without chemotherapy. Material and methods: From January 2002 to November 2012, 96 patients with GEJAC underwent treatment. The total radiation dose to the reference point via NBT was 8-25 Gy-eq in 2 to 5 fractions, with 1 fraction per week. The total dose via EBRT was 40-54 Gy, which was delivered over a period of 4 to 5.5 weeks with normal fraction. Results: The median survival time for the 96 patients was 15.3 months, and the 1-, 2-, 3-, and 5-year rates of overall survival (OS were 62.5%, 33.7%, 20.1%, and 7.9%, respectively. The 1-, 2-, 3-, and 5-year rates for local-regional control (LRC were 78.7%, 57.9%, 41.8%, and 26.4%, respectively. The patients’ age was an independent factor that was significantly associated with OS (p = 0.006 and LRC (p = 0.0005, according to univariate analysis. The 3-year OS (LRC was 31.9% (62.9% for patients aged 70-74 years and 16.1% (19.5% for patients aged ≥ 75 years. From the time of treatment completion to the development of local-regional recurrence or death, 5 (5.2% patients experienced fistula and 7 (7.3% experienced massive bleeding. Conclusions: The clinical data indicated that NBT in combination with EBRT produced favorable local control and long-term survival rates for elderly patients with GEJAC, and that the side effects were tolerable. The patient’s age could be used to select the appropriate treatment in an elderly patient.

  16. Blend Down Monitoring System Fissile Mass Flow Monitor Implementation at the ElectroChemical Plant, Zelenogorsk, Russia

    Energy Technology Data Exchange (ETDEWEB)

    Uckan, T.

    2005-11-11

    The implementation plans and preparations for installation of the Fissile Mass Flow Monitor (FMFM) equipment at the ElectroChemical Plant (ECP), Zelenogorsk, Russia, are presented in this report. The FMFM, developed at Oak Ridge National Laboratory, is part of the Blend Down Monitoring System (BDMS), developed for the U.S. Department of Energy Highly Enriched Uranium (HEU) Transparency Implementation Program. The BDMS provides confidence to the United States that the Russian nuclear facilities supplying the lower-assay ({approx}4%) product low enriched uranium (P-LEU) to the United States from down-blended weapons-grade HEU are meeting the nonproliferation goals of the government-to-government HEU Purchase Agreement, signed between the Russian Federation and the United States in 1993. The first BDMS has been operational at Ural Electrochemical Integrated Plant, Novouralsk, since February 1999 and is successfully providing HEU transparency data to the United States. The second BDMS was installed at ECP in February 2003. The FMFM makes use of a set of thermalized californium-252 ({sup 252}Cf) spontaneous neutron sources for a modulated fission activation of the UF{sub 6} gas stream for measuring the {sup 235}U fissile mass flow rate. To do this, the FMFM measures the transport time of the fission fragments created from the fission activation process under the modulated source to the downstream detectors by detecting the delayed gamma rays from the fission fragments. The FMFM provides unattended, nonintrusive measurements of the {sup 235}U mass flow in the HEU, LEU blend stock, and P-LEU process legs. The FMFM also provides the traceability of the HEU flow to the product process leg. This report documents the technical installation requirements and the expected operational characteristics of the ECP FMFM.

  17. Analytical development of the sup 252 Cf-plasma desorption mass spectroscopy for the structure analysis of biopolymers and synthetic polymers. Analytische Entwicklung der sup 252 Cf-Plasmadesorptions-Massenspektrometrie zur Strukturanalyse von Biopolymeren und synthetischen Polymeren

    Energy Technology Data Exchange (ETDEWEB)

    Schneider, K.

    1991-01-01

    The dissertation had the following aims: A systematic, analytical development of the plasma desorption method, and applications of the plasma desorption mass spectroscopy (PDMS) in primary structure investigations of polypeptides and proteins, and for the determination of the molecular weight of synthetic polymers. For the analytical development of the PDMS, aspects of main interest were the preparation and characterization techniques, and systematic model investigations of the analytical sensitivity, reproducibility and accuray of the molecular weight determination, as well as of the mixture analysis. The objective in the second part of the dissertation was to show application potentials and limits of the PDMS within the framework of analytical tasks of a primary structure characterization of polypeptides and proteins, as well as with regard to the determination of molecular weight and molecular weight distribution of synthetic polymers. (orig.).

  18. Monte Carlo modeling and analyses of YALINA-booster subcritical assembly part 1: analytical models and main neutronics parameters.

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, A.; Gohar, M. Y. A.; Nuclear Engineering Division

    2008-09-11

    This study was carried out to model and analyze the YALINA-Booster facility, of the Joint Institute for Power and Nuclear Research of Belarus, with the long term objective of advancing the utilization of accelerator driven systems for the incineration of nuclear waste. The YALINA-Booster facility is a subcritical assembly, driven by an external neutron source, which has been constructed to study the neutron physics and to develop and refine methodologies to control the operation of accelerator driven systems. The external neutron source consists of Californium-252 spontaneous fission neutrons, 2.45 MeV neutrons from Deuterium-Deuterium reactions, or 14.1 MeV neutrons from Deuterium-Tritium reactions. In the latter two cases a deuteron beam is used to generate the neutrons. This study is a part of the collaborative activity between Argonne National Laboratory (ANL) of USA and the Joint Institute for Power and Nuclear Research of Belarus. In addition, the International Atomic Energy Agency (IAEA) has a coordinated research project benchmarking and comparing the results of different numerical codes with the experimental data available from the YALINA-Booster facility and ANL has a leading role coordinating the IAEA activity. The YALINA-Booster facility has been modeled according to the benchmark specifications defined for the IAEA activity without any geometrical homogenization using the Monte Carlo codes MONK and MCNP/MCNPX/MCB. The MONK model perfectly matches the MCNP one. The computational analyses have been extended through the MCB code, which is an extension of the MCNP code with burnup capability because of its additional feature for analyzing source driven multiplying assemblies. The main neutronics parameters of the YALINA-Booster facility were calculated using these computer codes with different nuclear data libraries based on ENDF/B-VI-0, -6, JEF-2.2, and JEF-3.1.

  19. Questions to the radiological protection in the Universidad Nacional Autonoma de Mexico; Cuestionamientos a la proteccion radiologica en la Universidad Nacional Autonoma de Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Salas M, B., E-mail: salasmarb@yahoo.com.mx [UNAM, Facultad de Ciencias, Departamento de Fisica, Circuito exterior s/n, Ciudad Universitaria, 04510 Mexico D. F. (Mexico)

    2014-08-15

    In the Physics Department of the Sciences Faculty of the Universidad Nacional Autonoma de Mexico (UNAM) exist at least 3 sites where radioactive sources and generating equipment s of ionizing radiation are managed: The Modern Physics Laboratory, the Radiological Analysis of Environmental Samples Workshop and the Collisions Workshop; the first of them has two neutron sources, in addition to other emitted sources of gamma and beta radiation. The neutron sources are of Americium 241-Beryllium and other of Californium-252 which have been operated outside of the control of the Comision Nacional de Seguridad Nuclear y Salvaguardias (CNSNS) that is the regulator organ in Mexico in nuclear matter, because the Operation License No. 183/85, with file number 657 that protected them, lost their validity from August 13, 1987 (25 years behind), what motivated to that the CNSNS assured them. Later to the closing of the Radiological Analysis of Environmental Samples Workshop was believed that a Barium-133 source had been extracted in an illegal way; an investigation realized by the CNSNS determined that the radioactive source was always inside of the detection systems and radiation measurement, for what this source was never lost. In the Collisions Workshop operated an Experimental Accelerator of Particles that the CNSNS prohibited its operation for not having the corresponding license. These examples can be considered as bad practices of radiological protection that should be pointed out to eradicate their promotion and to avoid this way the exposure to the radiation of the occupational exposed personnel and people in general, being also avoided dose of unnecessary radiation. The Instituto Federal de Acceso a la Informacion Publica y Proteccion de Datos (IFAI) in Mexico was a key factor to obtain the information that allowed the realization of this work that was carried out in the Sciences Faculty of the UNAM. (Author)

  20. Production of medical radioisotopes in the ORNL high flux isotope reactor (HFIR) for cancer treatment and arterial restenosis therapy after PICA

    Science.gov (United States)

    Knapp, F. F.; Beets, A. L.; Mirzadeh, S.; Alexander, C. W.; Hobbs, R. L.

    1999-01-01

    The High Flux Isotope Reactor ( HFIR) at the Oak Ridge National Laboratory ( ORNL) represents an important resource for the production of a wide variety of medical radioisotopes. First beginning operation in 1965, the high thermal neutron flux (2.5×1015 neutrons/cm2/sec at 85 MW) and versatile target irradiation and handling facilities provide the opportunity for production of a wide variety of neutron-rich medical radioisotopes of current interest for therapy. In addition to serving as a key production site for californium-252 and other transuranic elements, important examples of therapeutic radioisotopes which are currently routinely produced in the HFIR for distribution include dysprosium-166 (parent of holmium-166), rhenium-186, tin-117 m and tungsten-188 (parent of rhenium-188). The nine hydraulic tube ( HT) positions in the central high flux region permit the insertion and removal of targets at any time during the operating cycle (22-24 days) and have traditionally represented a major site for production of medical radioisotopes. To increase the irradiation capabilities of the HFIR, special target holders have recently been designed and fabricated which will be installed in the six Peripheral Target Positions ( PTP), which are also located in the high flux region. These positions are only accessible during reactor refueling and will be used for long-term irradiations, such as required for the production of tin-117 m and tungsten-188. Each of the PTP tubes will be capable of housing a maximum of eight HT targets, thus increasing the total maximum number of HT targets from the current nine, to a total of 57. In this paper the therapeutic use of reactor-produced radioisotopes for bone pain palliation and vascular brachytherapy and the therapeutic medical radioisotope production capabilities of the ORNL HFIR are briefly discussed.

  1. Structure of a streptococcal adhesion carbohydrate receptor

    Energy Technology Data Exchange (ETDEWEB)

    Cassels, F.J.; Fales, H.M.; London, J.; Carlson, R.W.; van Halbeek, H. (National Institute of Dental Research, Bethesda, MD (USA))

    1990-08-25

    Interactions between complementary protein and carbohydrate structures on different genera of human oral bacteria have been implicated in the formation of dental plaque. The carbohydrate receptor on Streptococcus sanguis H1 that is specific for the adhesion on Capnocytophaga ochracea ATCC 33596 has been isolated from the streptococcal cell wall, purified, and structurally characterized. The hexasaccharide repeating unit of the polysaccharide was purified by reverse-phase, amino-bonded silica, and gel permeation high performance liquid chromatography. Earlier studies established that the repeating unit was a hexasaccharide composed of rhamnose, galactose, and glucose in the ration of 2:3:1, respectively. In the present study, determination of absolute configuration by gas chromatography of the trimethylsilyl (+)-2-butyl glycosides revealed that the rhamnose residues were of the L configuration while the hexoses were all D. 252Californium plasma desorption mass spectrometry of the native, the acetylated and the reduced and acetylated hexasaccharide determined that the molecular mass of the native hexasaccharide was 959, and that the 2 rhamnose residues were linked to each other at the nonreducing terminus of the linear molecule. Methylation analysis revealed the positions of the glycosidic linkages in the hexasaccharide and showed that a galactose residue was present at the reducing end. The structural characterization of the hexasaccharide was completed by one and two dimensional 1H and 13C NMR spectroscopy. Complete 1H and 13C assignments for each glycosyl residue were established by two-dimensional (1H,1H) correlation spectroscopy, homonuclear Hartmann-Hahn, and (13C,1H) correlation experiments. The configurations of the glycosidic linkages were inferred from the chemical shifts and coupling constants of the anomeric 1H and 13C resonances.

  2. Vol. 4(1), S/No 13, January, 2015:252-262 ISSN: 2225-8590 (Print ...

    African Journals Online (AJOL)

    DR Nneka

    argent. (a) Un traducteur mal formé : Quand un traducteur est incompétent, il réalise évidemment un travail médiocre et cela peut conduire à la désinformation et pire encore mettre en danger la vie des peuples qui consomment le ...

  3. 48 CFR 252.225-7036 - Buy American Act-Free Trade Agreements-Balance of Payments Program.

    Science.gov (United States)

    2010-10-01

    ... for purposes of calculating the value of the end product includes services (except transportation... percent of the cost of all its components. The cost of components includes transportation costs to the... Agreement country means Australia, Bahrain, Canada, Chile, Costa Rica, Dominican Republic, El Salvador...

  4. Intake assessment of the food additives nitrite (E 249 and E 250) and nitrate (E 251 and E 252)

    NARCIS (Netherlands)

    Sprong RC; Niekerk EM; Beukers MH; VVH; V&Z

    2017-01-01

    Nitrate and nitrite are authorised as preservatives in certain food products, such as salami, ham (nitrite) and cheese (nitrate). They prevent food spoilage and protect the consumer against food-borne pathogens. Next to that, nitrate and nitrite play a role in food colour retention and contribute to

  5. Topographic Map of the Northwest Ascraeus Mons Region of Mars - MTM 500k 15/252E OMKT

    Science.gov (United States)

    ,

    2004-01-01

    This map is part of a series of topographic maps of areas of special scientific interest on Mars. The topography was compiled photogrammetically using Viking Orbiter stereo image pairs. The contour interval is 250 meters. Horizontal and vertical control was established using the USGS Mars Digital Image Model 2.0 (MDIM 2.0) and data from the Mars Orbiter Laser Altimeter (MOLA).

  6. Topographic Map of the Southwest Ascraeus Mons Region of Mars - MTM 500k 10/252E OMKT

    Science.gov (United States)

    ,

    2004-01-01

    This map is part of a series of topographic maps of areas of special scientific interest on Mars. The topography was compiled photogrammetically using Viking Orbiter stereo image pairs. The contour interval is 250 meters. Horizontal and vertical control was established using the USGS Mars Digital Image Model 2.0 (MDIM 2.0) and data from the Mars Orbiter Laser Altimeter (MOLA).

  7. Polycyclic aromatic hydrocarbon concentrations across the Florida Panhandle continental shelf and slope after the BP MC 252 well failure.

    Science.gov (United States)

    Snyder, Richard A; Ederington-Hagy, Melissa; Hileman, Fredrick; Moss, Joseph A; Amick, Lauren; Carruth, Rebecca; Head, Marie; Marks, Joel; Tominack, Sarah; Jeffrey, Wade H

    2014-12-15

    The Florida Panhandle continental shelf environment was exposed to oil from the BP oil well failure in the Gulf of Mexico during 2010. Floating mats of oil were documented by satellite, but the distribution of dissolved components of the oil in this region was unknown. Shipek® grab samples of sediments were taken during repeated cruises between June 2010 and June 2012 to test for selected polycyclic aromatic hydrocarbons (PAHs) as indicators of this contamination. Sediments were collected as composite samples, extracted using standard techniques, and PAHs were quantified by GC/MS-SIM. PAHs in samples from the continental slope in May 2011 were highest near to the failed well site and were reduced in samples taken one year later. PAHs from continental shelf sediments during the spill (June 2010) ranged from 10 to 165 ng g(-1). Subsequent cruises yielded variable and reduced amounts of PAHs across the shelf. The data suggest that PAHs were distributed widely across the shelf, and their subsequent loss to background levels suggests these compounds were of oil spill origin. PAH half-life estimates by regression were 70-122 days for slope and 201 days for shelf stations. Copyright © 2014 Elsevier Ltd. All rights reserved.

  8. Cytomorphological features of H&#252rthle cell carcinoma: A report of two cases with review of literature

    Directory of Open Access Journals (Sweden)

    Mardi Kavita

    2010-01-01

    Full Text Available The use of the term "Hürthle cell neoplasm" as the gold standard should be discouraged as it makes evaluating these lesions more confusing. Recently, a number of studies have been conducted to define criteria that are more specific for Hürthle cell carcinoma (HCC. We herein report two cases of HCC of thyroid which were accurately diagnosed preoperatively using various cytological features described in the recent studies. A review of the literature is also presented.

  9. GPU-accelerated atmospheric chemical kinetics in the ECHAM/MESSy (EMAC) Earth system model (version 2.52)

    Science.gov (United States)

    Alvanos, Michail; Christoudias, Theodoros

    2017-10-01

    This paper presents an application of GPU accelerators in Earth system modeling. We focus on atmospheric chemical kinetics, one of the most computationally intensive tasks in climate-chemistry model simulations. We developed a software package that automatically generates CUDA kernels to numerically integrate atmospheric chemical kinetics in the global climate model ECHAM/MESSy Atmospheric Chemistry (EMAC), used to study climate change and air quality scenarios. A source-to-source compiler outputs a CUDA-compatible kernel by parsing the FORTRAN code generated by the Kinetic PreProcessor (KPP) general analysis tool. All Rosenbrock methods that are available in the KPP numerical library are supported.Performance evaluation, using Fermi and Pascal CUDA-enabled GPU accelerators, shows achieved speed-ups of 4. 5 × and 20. 4 × , respectively, of the kernel execution time. A node-to-node real-world production performance comparison shows a 1. 75 × speed-up over the non-accelerated application using the KPP three-stage Rosenbrock solver. We provide a detailed description of the code optimizations used to improve the performance including memory optimizations, control code simplification, and reduction of idle time. The accuracy and correctness of the accelerated implementation are evaluated by comparing to the CPU-only code of the application. The median relative difference is found to be less than 0.000000001 % when comparing the output of the accelerated kernel the CPU-only code.The approach followed, including the computational workload division, and the developed GPU solver code can potentially be used as the basis for hardware acceleration of numerous geoscientific models that rely on KPP for atmospheric chemical kinetics applications.

  10. SU-E-J-252: Reproducibility of Radiogenomic Image Features: Comparison of Two Semi-Automated Segmentation Methods

    Energy Technology Data Exchange (ETDEWEB)

    Lee, M; Woo, B; Kim, J [Seoul National University, Seoul (Korea, Republic of); Jamshidi, N; Kuo, M [UCLA School of Medicine, Los Angeles, CA (United States)

    2015-06-15

    Purpose: Objective and reliable quantification of imaging phenotype is an essential part of radiogenomic studies. We compared the reproducibility of two semi-automatic segmentation methods for quantitative image phenotyping in magnetic resonance imaging (MRI) of glioblastoma multiforme (GBM). Methods: MRI examinations with T1 post-gadolinium and FLAIR sequences of 10 GBM patients were downloaded from the Cancer Image Archive site. Two semi-automatic segmentation tools with different algorithms (deformable model and grow cut method) were used to segment contrast enhancement, necrosis and edema regions by two independent observers. A total of 21 imaging features consisting of area and edge groups were extracted automatically from the segmented tumor. The inter-observer variability and coefficient of variation (COV) were calculated to evaluate the reproducibility. Results: Inter-observer correlations and coefficient of variation of imaging features with the deformable model ranged from 0.953 to 0.999 and 2.1% to 9.2%, respectively, and the grow cut method ranged from 0.799 to 0.976 and 3.5% to 26.6%, respectively. Coefficient of variation for especially important features which were previously reported as predictive of patient survival were: 3.4% with deformable model and 7.4% with grow cut method for the proportion of contrast enhanced tumor region; 5.5% with deformable model and 25.7% with grow cut method for the proportion of necrosis; and 2.1% with deformable model and 4.4% with grow cut method for edge sharpness of tumor on CE-T1W1. Conclusion: Comparison of two semi-automated tumor segmentation techniques shows reliable image feature extraction for radiogenomic analysis of GBM patients with multiparametric Brain MRI.

  11. 40 CFR 421.252 - Effluent limitations guidelines representing the degree of effluent reduction attainable by the...

    Science.gov (United States)

    2010-07-01

    ... property Maximum for any 1 day Maximum for monthly average mg/troy ounce of gold refined electrolytically... Pollutant or pollutant property Maximum for any 1 day Maximum for monthly average mg/troy ounce of gold and silver smelted Lead 0.546 0.260 Mercury 0.325 0.130 Silver 0.533 0.221 Zinc 1.898 0.793 Gold 0.130 Oil...

  12. Calculation of Ambient (H*(10)) and Personal (Hp(10)) Dose Equivalent from a 252Cf Neutron Source

    Energy Technology Data Exchange (ETDEWEB)

    Traub, Richard J.

    2010-03-26

    The purpose of this calculation is to calculate the neutron dose factors for the Sr-Cf-3000 neutron source that is located in the 318 low scatter room (LSR). The dose factors were based on the dose conversion factors published in ICRP-21 Appendix 6, and the Ambient dose equivalent (H*(10)) and Personal dose equivalent (Hp(10)) dose factors published in ICRP Publication 74.

  13. Vol. 4(1), S/No 13, January, 2015:252-262 ISSN: 2225-8590 (Print ...

    African Journals Online (AJOL)

    DR Nneka

    13 janv. 2015 ... Diplômée en traduction : Être bilingue n'est pas un siné qua non d' un bon traducteur donc, un traducteur est un professionnel qualifié, possédant les qualifications sur la traduction et l'expérience. Il a la capacité d'exprimer fidèlement les idées de quelqu'un d'autre dans une langue différente de celle.

  14. 48 CFR 252.251-7001 - Use of Interagency Fleet Management System (IFMS) vehicles and related services.

    Science.gov (United States)

    2010-10-01

    ... Fleet Management System (IFMS) vehicles and related services. As prescribed in 251.205, use the following clause: Use of Interagency Fleet Management System (IFMS) Vehicles and Related Services (DEC 1991... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Use of Interagency Fleet...

  15. 48 CFR 252.215-7005 - Evaluation Factor for Employing or Subcontracting With Members of the Selected Reserve.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Evaluation Factor for... Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS... documentation may include, but is not limited to— (1) Existing company documentation, such as payroll or...

  16. 48 CFR 252.226-7001 - Utilization of Indian organizations, Indian-owned economic enterprises, and native Hawaiian small...

    Science.gov (United States)

    2010-10-01

    ... governing body of any Indian tribe or entity established or recognized by the governing body of an Indian..., may rely on the representation of an Indian organization, Indian-owned economic enterprise, or Native... challenge to the representation of a subcontractor, the Contracting Officer will refer the matter to— (1...

  17. Characterization of epibenthic and demersal megafauna at Mississippi Canyon 252 shortly after the Deepwater Horizon Oil Spill.

    Science.gov (United States)

    Valentine, Marla M; Benfield, Mark C

    2013-12-15

    The Deepwater Horizon Oil Spill resulted in the release of a large quantity of oil and gas into the northern Gulf of Mexico from a bathypelagic source. Due to a lack of pre-spill quantitative data the baseline condition of the communities near the spill site is unknown. This makes it difficult to determine the impact of the spill on deepwater megafauna. Remotely operated vehicles were used to quantify megafauna at five study sites during August and September 2010:2000 m north, west, south, and east, and 500 m north of the Macondo well. Comparisons of animal abundances indicated that 2000 m-N and 2000 m-W had the greatest taxonomic richness and highest abundances while 2000 m-E had slightly lower values. In contrast 500 m-N and 2000 m-S had the lowest taxonomic richness and abundances. Our study also suggests that certain taxa were potentially more resistant or sensitive to the spill. Copyright © 2013 Elsevier Ltd. All rights reserved.

  18. GPU-accelerated atmospheric chemical kinetics in the ECHAM/MESSy (EMAC Earth system model (version 2.52

    Directory of Open Access Journals (Sweden)

    M. Alvanos

    2017-10-01

    Full Text Available This paper presents an application of GPU accelerators in Earth system modeling. We focus on atmospheric chemical kinetics, one of the most computationally intensive tasks in climate–chemistry model simulations. We developed a software package that automatically generates CUDA kernels to numerically integrate atmospheric chemical kinetics in the global climate model ECHAM/MESSy Atmospheric Chemistry (EMAC, used to study climate change and air quality scenarios. A source-to-source compiler outputs a CUDA-compatible kernel by parsing the FORTRAN code generated by the Kinetic PreProcessor (KPP general analysis tool. All Rosenbrock methods that are available in the KPP numerical library are supported.Performance evaluation, using Fermi and Pascal CUDA-enabled GPU accelerators, shows achieved speed-ups of 4. 5 ×  and 20. 4 × , respectively, of the kernel execution time. A node-to-node real-world production performance comparison shows a 1. 75 ×  speed-up over the non-accelerated application using the KPP three-stage Rosenbrock solver. We provide a detailed description of the code optimizations used to improve the performance including memory optimizations, control code simplification, and reduction of idle time. The accuracy and correctness of the accelerated implementation are evaluated by comparing to the CPU-only code of the application. The median relative difference is found to be less than 0.000000001 % when comparing the output of the accelerated kernel the CPU-only code.The approach followed, including the computational workload division, and the developed GPU solver code can potentially be used as the basis for hardware acceleration of numerous geoscientific models that rely on KPP for atmospheric chemical kinetics applications.

  19. Comparison of lipids A of several Salmonella and Escherichia strains by 252Cf plasma desorption mass spectrometry.

    Science.gov (United States)

    Karibian, D; Deprun, C; Caroff, M

    1993-01-01

    Plasma desorption mass spectrometry has recently been used with success to characterize underivatized lipid A preparations: the major molecular species present give signals indicating their masses, from which probable compositions could be inferred by using the overall composition determined by chemical analyses. In the present study, plasma desorption mass spectrometry was used to compare structures in lipid A preparations isolated from several smooth and rough strains of Escherichia and Salmonella species. Preparations isolated from strains of both genera revealed considerable variation in degree of heterogeneity (number of fatty acids and presence or absence of hexadecanoic acid, phosphorylethanolamine, and aminoarabinose). Molecular species usually associated with Salmonella lipid A were found in preparations from Escherichia sp. In addition, preparations from three different batches of lipid A from one strain of Salmonella minnesota showed significant differences in composition. These results demonstrate that preparations used for biological and structural analyses should be defined in terms of their particular molecular constituents and that no generalizations based on analysis of a single preparation should be made. PMID:8491718

  20. with esophageal squamous cell cancer

    Directory of Open Access Journals (Sweden)

    Tao Li

    2017-02-01

    Full Text Available Purpose: The aim of this study was to retrospectively observe and analyze the long-term treatment outcomes of 191 elderly patients with esophageal squamous cell cancer (ESCC who were treated with californium-252 (252Cf neutron brachytherapy (NBT in combination with external beam radiotherapy (EBRT. Material and methods : From January 2002 to November 2012, 191 patients with ESCC underwent NBT in combination with EBRT. The total radiation dose to the reference point via NBT was 8-25 Gy-eq in two to five fractions with one fraction per week. The total dose via EBRT was 50-60 Gy, which was delivered over a period of 5 to 6 weeks with normal fractionation. Results : The median survival time for the 191 patients was 23.6 months, and the 5-year rates for overall survival (OS and local-regional control (LRC were 28.7% and 54.2%, respectively. The patients’ age was a factor that was significantly associated with OS (p = 0.010, according to univariate analysis. The 5-year OS (LRC was 37.3% (58.6% for patients aged 70-74 years and 14.5% (47.9% for patients aged > 74 years (p = 0.010 and p = 0.038. In multivariate analysis, age and clinical N stage were associated with OS and LRC (p = 0.011 [0.041] and p = 0.005 [0.005]. From the time of treatment completion to the development of local-regional recurrence or death, 5 (2.6% patients experienced fistula and 15 (7.9% experienced massive bleeding. The incidence of severe late complications was related to older age (p = 0.027, higher NBT dose/fraction (20-25 Gy/5 fractions, and higher total dose (> 66 Gy. Conclusions : The clinical data indicated that NBT in combination with EBRT produced favorable local control and long-term survival rates for elderly patients with ESCC, and that the side effects were tolerable. Patient’s age, clinical stage N status, and radiation dose could be used to select the appropriate treatment for elderly patients.

  1. Dispersants as used in response to the MC252-spill lead to higher mobility of polycyclic aromatic hydrocarbons in oil-contaminated Gulf of Mexico sand.

    Directory of Open Access Journals (Sweden)

    Alissa Zuijdgeest

    Full Text Available After the explosion of the Deepwater Horizon oil rig, large volumes of crude oil were washed onto and embedded in the sandy beaches and sublittoral sands of the Northern Gulf of Mexico. Some of this oil was mechanically or chemically dispersed before reaching the shore. With a set of laboratory-column experiments we show that the addition of chemical dispersants (Corexit 9500A increases the mobility of polycyclic aromatic hydrocarbons (PAHs in saturated permeable sediments by up to two orders of magnitude. Distribution and concentrations of PAHs, measured in the solid phase and effluent water of the columns using GC/MS, revealed that the mobility of the PAHs depended on their hydrophobicity and was species specific also in the presence of dispersant. Deepest penetration was observed for acenaphthylene and phenanthrene. Flushing of the columns with seawater after percolation of the oiled water resulted in enhanced movement by remobilization of retained PAHs. An in-situ benthic chamber experiment demonstrated that aromatic hydrocarbons are transported into permeable sublittoral sediment, emphasizing the relevance of our laboratory column experiments in natural settings. We conclude that the addition of dispersants permits crude oil components to penetrate faster and deeper into permeable saturated sands, where anaerobic conditions may slow degradation of these compounds, thus extending the persistence of potentially harmful PAHs in the marine environment. Application of dispersants in nearshore oil spills should take into account enhanced penetration depths into saturated sands as this may entail potential threats to the groundwater.

  2. Dispersants as used in response to the MC252-Spill Lead to higher mobility of polycyclic aromatic hydrocarbons in oil-contaminated Gulf of Mexico sand

    NARCIS (Netherlands)

    Zuijdgeest, A.; Huettel, M.

    2012-01-01

    After the explosion of the Deepwater Horizon oil rig, large volumes of crude oil were washed onto and embedded in the sandy beaches and sublittoral sands of the Northern Gulf of Mexico. Some of this oil was mechanically or chemically dispersed before reaching the shore. With a set of

  3. 48 CFR 252.211-7007 - Reporting of Government-Furnished Equipment in the DoD Item Unique Identification (IUID) Registry.

    Science.gov (United States)

    2010-10-01

    ... interconnected and interdependent so as to become a new functional entity for special testing purposes. Special...). (iv) Added or removed code/flag. (v) Marker code (designates which code is used in the marker identifier, e.g., D=CAGE, UN=DUNS, LD=DODAAC). (vi) Marker identifier, e.g., Contractor's CAGE code or DUNS...

  4. Contribution of emissions to concentrations: the TAGGING 1.0 submodel based on the Modular Earth Submodel System (MESSy 2.52

    Directory of Open Access Journals (Sweden)

    V. Grewe

    2017-07-01

    Full Text Available Questions such as what is the contribution of road traffic emissions to climate change? or what is the impact of shipping emissions on local air quality? require a quantification of the contribution of specific emissions sectors to the concentration of radiatively active species and air-quality-related species, respectively. Here, we present a diagnostics package, implemented in the Modular Earth Submodel System (MESSy, which keeps track of the contribution of source categories (mainly emission sectors to various concentrations. The diagnostics package is implemented as a submodel (TAGGING of EMAC (European Centre for Medium-Range Weather Forecasts – Hamburg (ECHAM/MESSy Atmospheric Chemistry. It determines the contributions of 10 different source categories to the concentration of ozone, nitrogen oxides, peroxyacytyl nitrate, carbon monoxide, non-methane hydrocarbons, hydroxyl, and hydroperoxyl radicals ( =  tagged tracers. The source categories are mainly emission sectors and some other sources for completeness. As emission sectors, road traffic, shipping, air traffic, anthropogenic non-traffic, biogenic, biomass burning, and lightning are considered. The submodel obtains information on the chemical reaction rates, online emissions, such as lightning, and wash-out rates. It then solves differential equations for the contribution of a source category to each of the seven tracers. This diagnostics package does not feed back to any other part of the model. For the first time, it takes into account chemically competing effects: for example, the competition between NOx, CO, and non-methane hydrocarbons (NMHCs in the production and destruction of ozone. We show that the results are in-line with results from other tagging schemes and provide plausibility checks for concentrations of trace gases, such as OH and HO2, which have not previously been tagged. The budgets of the tagged tracers, i.e. the contribution from individual source categories (mainly emission sectors to, e.g., ozone, are only marginally sensitive to changes in model resolution, though the level of detail increases. A reduction in road traffic emissions by 5 % shows that road traffic global tropospheric ozone is reduced by 4 % only, because the net ozone productivity increases. This 4 % reduction in road traffic tropospheric ozone corresponds to a reduction in total tropospheric ozone by  ≈  0.3 %, which is compensated by an increase in tropospheric ozone from other sources by 0.1 %, resulting in a reduction in total tropospheric ozone of  ≈  0.2 %. This compensating effect compares well with previous findings. The computational costs of the TAGGING submodel are low with respect to computing time, but a large number of additional tracers are required. The advantage of the tagging scheme is that in one simulation and at every time step and grid point, information is available on the contribution of different emission sectors to the ozone budget, which then can be further used in upcoming studies to calculate the respective radiative forcing simultaneously.

  5. 48 CFR 252.209-7004 - Subcontracting with firms that are owned or controlled by the government of a terrorist country.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Subcontracting with firms....209-7004 Subcontracting with firms that are owned or controlled by the government of a terrorist country. As prescribed in 209.409, use the following clause: Subcontracting with Firms that are Owned or...

  6. Characterization of surface oil thickness distribution patterns observed during the Deepwater Horizon (MC-252) oil spill with aerial and satellite remote sensing.

    Science.gov (United States)

    Svejkovsky, Jan; Hess, Mark; Muskat, Judd; Nedwed, Tim J; McCall, Jenifer; Garcia, Oscar

    2016-09-15

    Knowledge of the spatial distribution of oil thickness patterns within an on-water spill is of obvious importance for immediate spill response activities as well as for subsequent evaluation of the spill impacts. For long-lasting continuous spills like the 2010 3-month Deepwater Horizon (DWH) event in the Gulf of Mexico, it is also important to identify changes in the dominant oil features through time. This study utilized very high resolution (≤5m) aerial and satellite imagery acquired during the DWH spill to evaluate the shape, size and thickness of surface oil features that dominated the DWH slick. Results indicate that outside of the immediate spill source region, oil distributions did not encompass a broad, varied range of thicknesses. Instead, the oil separated into four primary, distinct characterizations: 1) invisible surface films detectable only with Synthetic Aperture Radar imaging because of the decreased surface backscatter, 2) thicker sheen & rainbow areas (oil (>1mm) that were consistently hundreds of meters long but most commonly only 10-50m wide. Where present within the slick footprint, each of the three distinct visible oil thickness classes maintained its shape characteristics both spatially (at different distances from the source and in different portions of the slick), and temporally (from mid-May through July 2010). The region over the source site tended to contain a more continuous range of oil thicknesses, however, our results indicate that the continuous injection of subsurface dispersants starting in late May significantly altered (lowered) that range. In addition to characterizing the oil thickness distribution patterns through the timeline of one of the world's largest oil spills, this paper also details the extension of using high resolution aerial imagery to calibrate medium resolution satellite data sources such as USA's Thematic Mapper (30m) to provide larger-scale spatial views of major spills, and discusses implications for utilizing such data for oil spill characterizations and spill response. Copyright © 2016 Elsevier Ltd. All rights reserved.

  7. Effects of G/sub 2/102 for life prolongation of the mouse irradiated by neutron (Cf/sup 252/ source)

    Energy Technology Data Exchange (ETDEWEB)

    Kong, T.H.; Cho, W.H.; Kang, H.O. (Dongguk Univ., Seoul (Republic of Korea). Coll. of Liberal Art and Science)

    1981-12-01

    5 mrem/hr of neutron-dose was irradiated for 3 minutes in every two days to the mouse fed with alkaloid component of ginseng (G/sub 2/102). The results are as follows: 1) LD/sub 50/ of mouse (ICR species) is 3.75 mrem and the mouse survived more than 30 days with the neutron-dose of 0.25 mrem/days. 2) When the cancer-mouse was treated with neutron and G/sub 2/102 together the life was increased by 221%. 3) The mouse which fed with G/sub 2/102 for 35 days before neutron was irradiated with the dose of 4 mrem, were survived 100%. 4) By feeding G/sub 2/102 for 20-35 days before the neutron irradiation, the serum ..gamma..-globulin and albumin were recovered 100%. 5) It is assumed that ..cap alpha..-lipoprotein was decreased and chylomicron was increased by the neutron irradiation since the neutron inactivated the LPL (lipoprotein lipase). 6) Treatment of G/sub 2/102 seems to be effective on the recovery of lymphocytes, however, it does not seem to be effective on the neutrophills in 30 days.

  8. 48 CFR 252.225-7040 - Contractor Personnel Authorized to Accompany U.S. Armed Forces Deployed Outside the United States.

    Science.gov (United States)

    2010-10-01

    ..., et seq.); (ii) Pursuant to the War Crimes Act (18 U.S.C. 2441), Federal criminal jurisdiction also extends to conduct that is determined to constitute a war crime when committed by a civilian national of... Contracting Officer. (k) Vehicle or equipment licenses. Contractor personnel shall possess the required...

  9. Contribution of emissions to concentrations: the TAGGING 1.0 submodel based on the Modular Earth Submodel System (MESSy 2.52)

    Science.gov (United States)

    Grewe, Volker; Tsati, Eleni; Mertens, Mariano; Frömming, Christine; Jöckel, Patrick

    2017-07-01

    Questions such as what is the contribution of road traffic emissions to climate change? or what is the impact of shipping emissions on local air quality? require a quantification of the contribution of specific emissions sectors to the concentration of radiatively active species and air-quality-related species, respectively. Here, we present a diagnostics package, implemented in the Modular Earth Submodel System (MESSy), which keeps track of the contribution of source categories (mainly emission sectors) to various concentrations. The diagnostics package is implemented as a submodel (TAGGING) of EMAC (European Centre for Medium-Range Weather Forecasts - Hamburg (ECHAM)/MESSy Atmospheric Chemistry). It determines the contributions of 10 different source categories to the concentration of ozone, nitrogen oxides, peroxyacytyl nitrate, carbon monoxide, non-methane hydrocarbons, hydroxyl, and hydroperoxyl radicals ( = tagged tracers). The source categories are mainly emission sectors and some other sources for completeness. As emission sectors, road traffic, shipping, air traffic, anthropogenic non-traffic, biogenic, biomass burning, and lightning are considered. The submodel obtains information on the chemical reaction rates, online emissions, such as lightning, and wash-out rates. It then solves differential equations for the contribution of a source category to each of the seven tracers. This diagnostics package does not feed back to any other part of the model. For the first time, it takes into account chemically competing effects: for example, the competition between NOx, CO, and non-methane hydrocarbons (NMHCs) in the production and destruction of ozone. We show that the results are in-line with results from other tagging schemes and provide plausibility checks for concentrations of trace gases, such as OH and HO2, which have not previously been tagged. The budgets of the tagged tracers, i.e. the contribution from individual source categories (mainly emission sectors) to, e.g., ozone, are only marginally sensitive to changes in model resolution, though the level of detail increases. A reduction in road traffic emissions by 5 % shows that road traffic global tropospheric ozone is reduced by 4 % only, because the net ozone productivity increases. This 4 % reduction in road traffic tropospheric ozone corresponds to a reduction in total tropospheric ozone by ≈ 0.3 %, which is compensated by an increase in tropospheric ozone from other sources by 0.1 %, resulting in a reduction in total tropospheric ozone of ≈ 0.2 %. This compensating effect compares well with previous findings. The computational costs of the TAGGING submodel are low with respect to computing time, but a large number of additional tracers are required. The advantage of the tagging scheme is that in one simulation and at every time step and grid point, information is available on the contribution of different emission sectors to the ozone budget, which then can be further used in upcoming studies to calculate the respective radiative forcing simultaneously.

  10. Genome-wide association analysis of self-reported events in 6135 individuals and 252 827 controls identifies 8 loci associated with thrombosis

    DEFF Research Database (Denmark)

    Hinds, David A; Buil, Alfonso; Ziemek, Daniel

    2016-01-01

    belonging to the 23andMe cohort of research participants. Eight loci exceeded genome-wide significance. Among the genome-wide significant results, our study replicated previously known venous thromboembolism (VTE) loci near the F5, FGA-FGG, F11, F2, PROCR and ABO genes, and the more recently discovered...

  11. KANE, Adrian Taylor. (Ed.. The Natural World in Latin American Literatures: Ecocritical Essays on Twentieth- Century Writings. Jefferson: McFarland & Co., Publishers, 2010. 252 p.

    Directory of Open Access Journals (Sweden)

    Mauro Maia Laruccia

    2011-12-01

    Full Text Available De acordo com Donald Worster, para desenvolver a história ambiental, não basta mapear o campo e se concentrar no puramente mental ou intelectual, na expectativa de encontrar a natureza nas sociedadeshumanas. Esse é um processo em que percepções, ética, leis, mitos e outras estruturas de significados se tornam parte de um indivíduo ou um diálogo coletivo com a natureza. É claro que, se a tentativa ébuscar conclusões no cognitivo e traiçoeiro domínio semiótico, para, em seguida, reunir evidências aptas a apoiar tais conclusões, isso coloca um sério desafio. A literatura, porém, é uma fonte potencial - com limites e deficiências – para a qual os pesquisadores e historiadores ambientais podem voltar-se, a fim de, entre outros dados, buscar vestígios da natureza no discurso de um momento cultural específico. Em outras palavras, ficção e poesia qualificam-se como exemplos do que William Cronon afirmou serem fontes menos ortodoxas, ou seja, os tipos de provas que os pesquisadores e historiadores tomam emprestados de outras disciplinas, para desenvolver a história ambiental.

  12. Changes in white cell estimates and plasma chemistry measurements following oral or external dosing of double-crested cormorants, Phalacocorax auritus, with artificially weathered MC252 oil.

    Science.gov (United States)

    Dean, Karen M; Bursian, Steven J; Cacela, Dave; Carney, Michael W; Cunningham, Fred L; Dorr, Brian; Hanson-Dorr, Katie C; Healy, Kate A; Horak, Katherine E; Link, Jane E; Lipton, Ian; McFadden, Andrew K; McKernan, Moira A; Harr, Kendal E

    2017-12-01

    Scoping studies were designed whereby double-crested cormorants (Phalacocorax auritus) were dosed with artificially weathered Deepwater Horizon (DWH) oil either daily through oil injected feeder fish, or by application of oil directly to feathers every three days. Preening results in oil ingestion, and may be an effective means of orally dosing birds with toxicant to improve our understanding of the full range of physiological effects of oral oil ingestion on birds. Blood samples collected every 5-6 days were analyzed for a number of clinical endpoints including white blood cell (WBC) estimates and differential cell counts. Plasma biochemical evaluations were performed for changes associated with oil toxicity. Oral dosing and application of oil to feathers resulted in clinical signs and statistically significant changes in a number of biochemical endpoints consistent with petroleum exposure. In orally dosed birds there were statistically significant decreases in aspartate amino transferase (AST) and gamma glutamyl transferase (GGT) activities, calcium, chloride, cholesterol, glucose, and total protein concentrations, and increases in plasma urea, uric acid, and phosphorus concentrations. Plasma electrophoresis endpoints (pre-albumin, albumin, alpha-2 globulin, beta globulin, and gamma globulin concentrations and albumin: globulin ratios) were decreased in orally dosed birds. Birds with external oil had increases in urea, creatinine, uric acid, creatine kinase (CK), glutamate dehydrogenase (GLDH), phosphorus, calcium, chloride, potassium, albumin, alpha-1 globulin and alpha-2 globulin. Decreases were observed in AST, beta globulin and glucose. WBC also differed between treatments; however, this was in part driven by monocytosis present in the externally oiled birds prior to oil treatment. Copyright © 2017 Elsevier Inc. All rights reserved.

  13. Crystal structure of methyl 2-[5-(2-hy-droxy-phen-yl)-2H-tetra-zol-2-yl]acetate.

    Science.gov (United States)

    Lee, Seul Gi; Ryu, Ji Yeon; Lee, Junseong

    2017-12-01

    The title compound, C10H10N4O3, was synthesized by the esterification of hy-droxy-phenyl tetra-zole. There is an intra-molecular O-H⋯N hydrogen bond present involving the hy-droxy group and the tetra-zole ring. The tetra-zole ring is inclined to the phenol ring by 2.85 (13)°, while the methyl acetate group is almost normal to the tetra-zole ring, making a dihedral angle of 82.61 (14)°. In the crystal, mol-ecules are linked by pairs of C-H⋯O hydrogen bonds, forming inversion dimers. Within the dimers, the phenol rings are linked by offset π-π inter-actions [inter-centroid distance = 3.759 (2) Å]. There are no further significant inter-molecular inter-actions present in the crystal. The hy-droxy group is disordered about positions 2 and 6 on the benzene ring, with a refined occupancy ratio of 0.531 (5):0.469 (5).

  14. Edgardo Mondolfi Gudat, El lado oscuro de una epopeya. Los legionarios británicos en Venezuela, Caracas, Editorial Alfa, 2011, 252 p.

    OpenAIRE

    Quintero, Inés

    2012-01-01

    En su controversial biografía sobre Simón Bolívar, publicada por vez primera en 1858 en The New American Encyclopedia, Carlos Marx afirma que la independencia de la Nueva Granada se obtuvo gracias a la acción de los legionarios británicos que viajaron a aquellos territorios a apoyar a los ejércitos de la insurgencia; seguramente con el afán de restarle importancia a la figura de Bolívar, de quien emite juicios particularmente severos, el autor de El Capital, con comentarios como éste y otros ...

  15. Physics division annual report 2005.

    Energy Technology Data Exchange (ETDEWEB)

    Glover, J.; Physics

    2007-03-12

    This report highlights the research performed in 2005 in the Physics Division of Argonne National Laboratory. The Division's programs include operation of ATLAS as a national user facility, nuclear structure and reaction research, nuclear theory, medium energy nuclear research and accelerator research and development. The mission of Nuclear Physics is to understand the origin, evolution and structure of baryonic matter in the universe--the matter that makes up stars, planets and human life itself. The Division's research focuses on innovative new ways to address this mission and 2005 was a year of great progress. One of the most exciting developments is the initiation of the Californium Rare Ion Breeder Upgrade, CARIBU. By combining a Cf-252 fission source, the gas catcher technology developed for rare isotope beams, a high-resolution isobar separator, and charge breeding ECR technology, CARIBU will make hundreds of new neutron-rich isotope beams available for research. The cover illustration shows the anticipated intensities of low-energy beams that become available for low-energy experiments and for injection into ATLAS for reacceleration. CARIBU will be completed in early 2009 and provide us with considerable experience in many of the technologies developed for a future high intensity exotic beam facility. Notable results in research at ATLAS include a measurement of the isomeric states in {sup 252}No that helps pin down the single particle structure expected for superheavy elements, and a new low-background measurement of {sup 16}N beta-decay to determine the {sup 12}C({alpha},{gamma}){sup 16}O reaction rate that is so important in astrophysical environments. Precise mass measurements shed new light on the unitarity of the quark weak-mixing matrix in the search for physics beyond the standard model. ATLAS operated for 4686 hours of research in FY2005 while achieving 95% efficiency of beam delivery for experiments. In Medium-Energy Physics, radium

  16. Characterization of the occupational exposure and air transported particles using the techniques of PIXE {sup 252}Cf PMDS and alpha spectrometry; Caracterizacao da exposicao ocupacional e particulas transportadas pelo ar utilizando as tecnicas de PIXE {sup 252}Cf PDMS e espectrometria alfa

    Energy Technology Data Exchange (ETDEWEB)

    Carneiro, Luana Gomes

    2008-07-01

    The risk for human health due to exposure to aerosols depends on the intake pattern, the mass concentration and the speciation of the elements present in airborne particles. In this work PDMS (Plasma Desorption Mass Spectrometry) was used as complementary technique to the PIXE (Particle Induced X ray Emission) technique to characterize aerosols samples collected in the environment. The PIXE technique allows the identification of the elements present in the sample and to determine their mass concentrations. The mass spectrometry (PDMS) was used to identify the speciation of these elements present in the samples. The aerosol samples were collected using a six stage cascade impactor in three sites. The Mass Median Aerodynamic Diameter (MMAD) measured indicated that the airborne particulate were in the fine fraction of the aerosols. The theoretical uranium concentration in urine samples using ICRP lung model parameters suggest that the elemental mass concentration in respirable fraction of aerosol and the chemical speciation are important factors to determine the uranium concentration in urine and that the determination of specific solubility parameters for each compound is the most important factor to calculate the uranium concentration in urine. PIXE allows to identify and quantify the elements heavier than Na (Z=11) while PDMS allows to identify the organic and inorganic compounds present in the samples. As these techniques are used as complementary techniques they provide important information about the aerosols characterization. (author)

  17. Discovery of isotopes of the transuranium elements with 93≤Z≤98

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-01-15

    One hundred and five isotopes of the transuranium elements neptunium, plutonium, americium, curium, berkelium, and californium have been observed so far; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  18. Neutron-Activated Gamma-Emission: Technology Review

    Science.gov (United States)

    2012-01-01

    flux sources developed for boron neutron capture therapy ( BNCT ), found to be an experimental success in cancer treatment (26). 30 Improved flux on...achievable Am americium API associated particle imaging B boron Be beryllium BNCT boron neutron capture therapy C carbon Cf californium Cl

  19. Le palais d’Aiétès et son jardin chez Apollonios de Rhodes (Arg., III, v. 194-252. Un exemple de paysage-palimpseste antique ? The Palace of Aeetes and its Garden in Apollonius of Rhodes (Arg., III, lines 194-252. An example of ancient landscape as palimpsest? Il palazzo di Eeta e il suo giardino in Apollonio Rodio (Arg., III, 194-252. Un esempio di paesaggio-palinsesto antico?

    Directory of Open Access Journals (Sweden)

    Laury-Nuria André

    2012-07-01

    Full Text Available Lorsque le lecteur découvre au chant III des Argonautiques d’Apollonios de Rhodes l’espace du « paysage urbain » colque, au fur et à mesure de la progression visuelle des personnages, se dessine mentalement tout un espace littéraire fait de réminiscences homériques. L’espace végétal semble composé d’un bouquet d’intertextes de nature endogène tandis que l’architecture palatiale combine structure archaïque et ornements hellénistiques. Nulle trace d’exotisme donc, mais un espace composé de référents grecs typiques. Du fait de ces référents littéraires, la construction de l’espace palatial urbain emprunte sa configuration même au type d’écriture poétique sollicité par le poète épique : la réécriture. Comment comprendre alors que le palais d’Aiétès puisse être à l’image du palais du souverain grec hellénistique, image idéale d’une architecture s’inscrivant dans l’ordre divin ? Il faut voir ici non seulement la mise en image, l’illustration concrète via l’architecture et, partant, le « paysage urbain » qui se singularise par sa nature hybride, de la volonté de rapprocher Orient et Occident, mais aussi et surtout les moyens mêmes de cette mise en œuvre. Le palais et son jardin ne seraient alors qu’une promesse, un prototype d’un modèle idéal à étendre, grandeur nature, sur l’ensemble du territoire colque, et de l’oïkoumène tout entière.When the reader of the third book of Apollonius of Rhodes discovers, in the course of the characters’ visual progression, the space of a Colchian “urban landscape”, s/he mentally creates a literary space made of Homeric recollections. The garden space seems composed of a bouquet of intertexts of endogenous nature, whereas the palatial architecture combines archaic structure with hellenistic ornamentation. So no trace of the exotic, but a space composed of typical Greek references. As a result of these literary references, the construction of palatial urban space borrows its own configuration from the type of poetic writing the epic poet himself solicits: re-writing. How else can one explain that the palace of Aeetes can be the image of a hellenistic Greek royal palace, the perfect image of an architecture that inscribes itself into a divine order? One should see here not only the reconfiguration, the concrete illustration through the archictecture and, consequently, the urban “landscape” of such an unusual hybrid character, as a result of the wish to reconcile East and West, but also, perhaps especially, the means of its implementation. The palace and garden would then only be a promise, an ideal prototype to be extended, on a large scale, over all of the Colchian land and the entire oekoumene.Quando il lettore scopre, nel terzo libro delle Argonautiche di Apollonio Rodio, lo spazio del ‘paesaggio urbano’ colco, via che progredisce la visuale dei personaggi, viene tracciato mentalmente tutto uno spazio letterario fatto di reminiscenze omeriche. Lo spazio vegetale sembra composto da un insieme di intertesti endogeni, laddove l’architettura palaziale combina struttura arcaica e decorazioni ellenistiche. Nessuna traccia d’esotismo, quindi, ma uno spazio composto di tipici referenti greci. A partire da questi referenti letterari, la costruzione dello spazio palaziale urbano deve la sua stessa configurazione al tipo di scrittura poetica sollecitata dal poeta epico: la riscrittura. Come comprendere, allora, che il palazzo di Eeta possa essere a immagine del palazzo del sovrano greco ellenistico, immagine ideale di un’architettura che si inscrive nell’ordine divino? Occorre vedere qui non soltanto la raffigurazione, l’illustrazione concreta tramite l’architettura e, perciò, il ‘paesaggio urbano’ che si distingue per la sua natura ibrida, dalla volontà di avvicinare Oriente e Occidente, ma anche e soprattutto i mezzi stessi di questa attuazione. Il palazzo e il suo giardino non sarebbero allora altro che una promessa, un prototipo di un modello ideale da estendere, in scala naturale, all’insieme del territorio colco e dell’intera ecumene.

  20. ORF Alignment: NC_006396 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ALSTLDADYDYVIIDCPPFYGKLTDTGMYAAQNVLIPALT 180 ... Query: 252 VRKRVALQRAFSAGQSIFATEESCDMAAVFEDIAEELDEQ 291 ... ... ... VRKRVALQRAFSAGQSIFATEESCDMAAVFEDIAEELDEQ Sbjct: 241 VRKRVALQRAFSAGQSIFATEESCDMAAVFEDIAEELDEQ 280

  1. Make or Buy: A Systematic Approach to Department of Defense Sourcing Decisions

    Science.gov (United States)

    2013-07-30

    Material & Supply General 3151 Audiovisual Equipment 31.0 Equipment Material & Supply General 3152 Photographic Equipment 31.0 Equipment...Cost Element 251H Translation and Interpreting Services. 25.1 Advisory and Assistance Services Overhead Headquarters Management 252Q Safety and...Equipment Overhead Information Technology 252G Audiovisual Production and Services. 25.2 Other Services Overhead Information Technology 252H

  2. Rosario Sevilla Soler, La revolución mexicana y la opinión pública española. La prensa sevillana frente al proceso de insurrección, Madrid, CSIC, 2005, 252 p.

    OpenAIRE

    Bernabéu Albert, Salvador

    2007-01-01

    Buena conocedora de la prensa sevillana, a la que ha dedicado otros trabajos, la investigadora Rosario Sevilla ha recopilado y analizado, en este nuevo libro, las noticias aparecidas en los periódicos hispalenses entre 1910 y 1920 sobre la revolución mexicana. Aunque se voceaban en la capital hispalense una decena de periódicos, muchas de las tiradas eran simbólicas, por lo que la autora se centra en tres rotativos: El Liberal, independiente, El Noticiero Sevillano y El Correo de Andalucía, a...

  3. Comparison between effectiveness of a low-viscosity glass ionomer and a resin-based glutaraldehyde containing primer in treating dentine hypersensitivity--a 25.2-month evaluation.

    NARCIS (Netherlands)

    Polderman, R.N.; Frencken, J.E.F.M.

    2007-01-01

    OBJECTIVES: The null-hypothesis tested was; there is no difference in effectiveness between a new low-viscosity glass ionomer and a resin-based glutaraldehyde containing primer in treating hypersensitive teeth after 2 years. METHODS: Using a split-mouth design, hypersensitive teeth in 14 adult

  4. CHARACTERIZATION OF A SYNTHETIC 37-RESIDUE FRAGMENT OF A MONOCLONAL-ANTIBODY AGAINST HERPES-VIRUS BY CAPILLARY ELECTROPHORESIS ELECTROSPRAY (IONSPRAY) MASS-SPECTROMETRY AND CF-252 PLASMA DESORPTION MASS-SPECTROMETRY

    NARCIS (Netherlands)

    KOSTIAINEN, R; LASONDER, E; BLOEMHOFF, W; VANVEELEN, PA; WELLING, GW; BRUINS, AP

    A peptide comprising 37 amino acids of the antigen binding site of a monoclonal antibody directed against glycoprotein D of herpes simplex virus was synthesized. The synthetic peptide and the impurities formed in the synthesis were characterized by capillary electrophoresis/ionspray mass

  5. Corrigendum to "Crater functions for compound materials: A route to parameter estimation in coupled-PDE models of ion bombardment" [Nucl. Instr. Meth. Phys. Res. B 318B (2014) 245-252

    Science.gov (United States)

    Norris, Scott A.; Samela, Juha; Vestberg, Matias; Nordlund, Kai; Aziz, Michael J.

    2015-04-01

    Because Eq. (1) is independent of the details of the crater function Δh, updated formulae for { A, C,A‧,C‧ } that account for the curvature dependence are obtained simply by inserting Harrison and Bradley's expressions (2) into Eq. (1). As those authors show, at normal incidence the added terms are expected to have positive values, increasing estimates of C (which is a sum of SX,YZ, type terms), while producing a less noticable effect on the value of C‧ (which is a difference of SX,YZ, type terms). These modifications therefore do not alter the primary physical conclusions of our study, which are that for the GaSb system both C and (A‧ C -C‧ A) appear to be positive.

  6. Carcaça e não-componentes da carcaça de cordeiros recebendo polpa cítrica úmida prensada em substituição à silagem de milho - DOI: 10.4025/actascianimsci.v29i1.252 Carcass and non-carcass components of lambs fed with pressed citrus pulp replacing corn silage - DOI: 10.4025/actascianimsci.v29i1.252

    Directory of Open Access Journals (Sweden)

    Lina Yumi Noro

    2007-11-01

    Full Text Available O objetivo deste trabalho foi avaliar a substituição da silagem de milho pela polpa cítrica úmida prensada (PCUP sobre as características de carcaça e dos não-componentes da carcaça de cordeiros da raça Santa Inês. Vinte quatro cordeiros com idade média de 90 dias e peso vivo inicial médio de 18 kg foram confinados durante 67 dias, alimentados com dietas contendo níveis crescentes de PCUP em substituição à silagem de milho (0, 25, 50, 75% da MS. Não foi verificada diferença (p>0,05 para peso vivo ao abate (32,8 kg, rendimento de carcaça quente (44,7%, rendimento verdadeiro (50,3% e não-componentes da carcaça. Em relação aos rendimentos dos cortes, apenas o rendimento de lombo foi afetado (pThe objective of this study was to evaluate the replacement of corn silage by pressed citrus pulp (PCP on carcass characteristics and non-carcass components of Santa Ines lambs. Twenty-four lambs with average age of 90 days and initial weight of 18 kg were maintained in feedlot for 67 days, fed with increasing levels of PCP replacing corn silage (0, 25, 50, 75%, DM basis. There was no difference (p>0.05 for live weight at slaughter (32.8 kg, hot carcass yield (44.7%, true yield (50.3% and non-carcass components. In relation to cut yields, only loin yield was affected (p<0.05 by the diet, which showed quadratic response. For the carcass measurements, only the arm length was affected by the diet, showing quadratic behavior. The percentage of fat and muscle showed quadratic behavior according to replacement levels. The results suggest that pressed citrus pulp can substitute corn silage for lambs in feedlot without affecting the carcass characteristics and the non-carcass components.

  7. Cold valleys in the radioactive decay of 248−254Cf isotopes

    Indian Academy of Sciences (India)

    Geiger–Nuttal plots of log10(T1/2) vs. Q−1/2 for 48−52Ca emitting from various californium isotopes. Acknowledgement. One of the authors (KPS) would like to thank University Grants Commis- sion, Govt. of India for the financial support under project No. MRP(S)-. 352/2005(X Plan)/KLKA 002/UGC-SWRO. References.

  8. Directed evolution of the periodic table: probing the electronic structure of late actinides.

    Science.gov (United States)

    Marsh, M L; Albrecht-Schmitt, T E

    2017-07-25

    Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.

  9. ORF Sequence: NC_002952 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available s aureus subsp. aureus MRSA252] MNMKKQEKHAIRKKSIGVASVLVGTLIGFGLLSSKEADASENSMTQTENTSNESKSNDPSSVNAAPKTDNTNVSDS...QITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPEDSDSDPGSDSGSDSGSDSNSDSGSDS...GSDSTSDSGSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSTSDSDSTSDSDSASDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS...DSDSDSDSDSESDSDSDSDSDSDSDSDSDSDSDSVSDSDSDSDSDSESDSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS...DSDSDSDSDSDSESDSDSDSDSDSDSDSDSDSDSDSDSDSDLDSDSDSDSDSDSDSDSDSDSDSDSDSDSDLDSDSDSDS

  10. 76 FR 71922 - Defense Federal Acquisition Regulation Supplement: Separation of Combined Provisions and Clauses...

    Science.gov (United States)

    2011-11-21

    ... Military Recruiting on Campus, in all solicitations and contracts with institutions of higher education... Military Campus. Recruiting on Campus-- Representation. 252.216-7000, Economic Price 252.216-70XX, Economic..., Reserve Officer Training Corps and Military Recruiting on Campus--Representation. (iv) 252.216-70YY...

  11. 76 FR 58140 - Defense Federal Acquisition Regulation Supplement; Annual Representations and Certifications...

    Science.gov (United States)

    2011-09-20

    ... solicitations and contracts with institutions of higher education. (iii) 252.216-7003, Economic Price Adjustment... higher-level changes in the Code of Federal Regulation relating to annual representations and.... (viii) 252.225-7031, Secondary Arab Boycott of Israel. (ix) 252.225-7035, Buy American Act--Free Trade...

  12. Bright Light Therapy for Treatment of Sleep Problems Following Mild TBI https://www.dacspr.documentservices.dla.mil/dtic/livelink func=formwf.formedit and workid=4132484 and subworkid=4132484 and taskid=8 and formID=1 and viewname=jhg and editable=1176347093 and nexturl=%2Fdtic%2Flivelink%3Ffunc%3Dwork%2Etaskdone%26workid%3D4132484%26subworkid%3D4132484%26taskid%3D8%26xAction%3Dsave%26paneindex%3D1%26nexturl%3D%252Fdtic%252Flivelink%253Ffunc%253Dllworkspace and noredisplay=1#

    Science.gov (United States)

    2016-10-01

    changes within prefrontal brain regions associated with executive functions. These findings may have broader implication for using blue- enriched ...proficiency, enrich their training skills expertise, and broaden their understanding of the current research and analyses methods. The project has...treated with a medication like  lithium ,  NO            YES         sodium valproate (Depakote) or lamotrigine (Lamictal)?        THIS QUESTION IS NOT A

  13. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  14. Composition containing transuranic elements for use in the homeopathic treatment of aids

    Energy Technology Data Exchange (ETDEWEB)

    Lustig, D.

    1996-04-18

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author).

  15. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  16. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  17. Review of „Brand-urile în era Web 2.0. Conținutul generat de consumatori” [Web 2.0 Brands. User-generated Content] by Rodica Săvulescu, București: Tritonic, 2016, 252 p.

    Directory of Open Access Journals (Sweden)

    Alexandra Vițelar

    2017-01-01

    Full Text Available The web 2.0 era has shifted brand ownership from communication specialists towards consumers. This is the main idea on which Rodica Sãvulescu builds her argumentation in her recently published book, `Web 2.0 Brands. User-generated content` (2016. The emergence of new technologies blurs the lines between content producers and consumers. In this book, the author addresses the topic of democratization of content in relation with brand communication.

  18. Dietary exposure to benzoates (E210-E213), parabens (E214-E219), nitrites (E249-E250), nitrates (E251-E252), BHA (E320), BHT (E321) and aspartame (E951) in children less than 3 years old in France.

    Science.gov (United States)

    Mancini, F R; Paul, D; Gauvreau, J; Volatier, J L; Vin, K; Hulin, M

    2015-01-01

    This study aimed to estimate the exposure to seven additives (benzoates, parabens, nitrites, nitrates, BHA, BHT and aspartame) in children aged less than 3 years old in France. A conservative approach, combining individual consumption data with maximum permitted levels, was carried out for all the additives. More refined estimates using occurrence data obtained from products' labels (collected by the French Observatory of Food Quality) were conducted for those additives that exceeded the acceptable daily intake (ADI). Information on additives' occurrence was obtained from the food labels. When the ADI was still exceeded, the exposure estimate was further refined using measured concentration data, if available. When using the maximum permitted level (MPL), the ADI was exceeded for benzoates (1.94 mg kg(-1) bw day(-1)), nitrites (0.09 mg kg(-1) bw day(-1)) and BHA (0.39 mg kg(-1) bw day(-1)) in 25%, 54% and 20% of the entire study population respectively. The main food contributors identified with this approach were current foods as these additives are not authorised in specific infant food: vegetable soups and broths for both benzoates and BHA, delicatessen and meat for nitrites. The exposure estimate was significantly reduced when using occurrence data, but in the upper-bound scenario the ADI was still exceeded significantly by the age group 13-36 months for benzoates (2%) and BHA (1%), and by the age group 7-12 months (16%) and 13-36 months (58%) for nitrites. Measured concentration data were available exclusively for nitrites and the results obtained using these data showed that the nitrites' intake was below the ADI for all the population considered in this study. These results suggest that refinement of exposure, based on the assessment of food levels, is needed to estimate the exposure of children to BHA and benzoates for which the risk of exceeding the ADI cannot be excluded when using occurrence data.

  19. Abu Sada Caroline, ONG palestiniennes et construction étatique. L'expérience de Palestinian Agricultural Relief Committees (PARC dans les Territoires occupés palestiniens, 1983-2005, Institut Français du Proche-Orient, Beyrouth, 2007, 252 p.

    Directory of Open Access Journals (Sweden)

    Vincent Romani

    2009-09-01

    Full Text Available For more than one reason, Caroline Abu Sada's book is seminal. First of all, her work studies the re-shaping of polity inside the Palestinian society since the second Intifada. Based on the authors' PhD dissertation, this book contributes to the limited works on political sociology addressing post-Oslo Palestine (after 2000. This book is also promising in terms of methodology, claiming to conduct a ''bottom-up'' approach looking at a society still over-analyzed in terms of polemology, elites...

  20. Deepwater Horizon MC252 response data from the Environmental Resource Management Application (ERMA) containing Texture Classifying Neural Network Algorithm (TCNNA) from Synthetic Aperture Radar (SAR) nearshore potential oiling footprints collected from 2010-04-29 to 2010-08-11 in the Northern Gulf of Mexico (NCEI Accession 0163819)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This archival information package (AIP) contains Environmental Response Management Application (ERMA) GIS layers of outputs from Synthetic Aperture Radar (SAR)...

  1. Deepwater Horizon MC252 response data from the Environmental Resource Management Application (ERMA) containing National Environmental Satellite, Data, and Information Service (NESDIS) Synthetic Aperature Radar (SAR) composite days of oiling collected from 2010-04-01 to 2010-08-31 in the Northern Gulf of Mexico (NCEI Accession 0163805)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This Archival Information Package (AIP) contains Environmental Response Management Application (ERMA) GIS layers that are a compilation of all the individual Texture...

  2. Deepwater Horizon MC252 response data from the Environmental Resource Management Application (ERMA) containing National Environmental Satellite, Data, and Information Service (NESDIS) Synthetic Aperature Radar (SAR) composite days of oiling collected from 2010-04-23 to 2010-08-11 in the Northern Gulf of Mexico (NCEI Accession 0163820)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This Archival Information Package (AIP) contains Environmental Response Management Application (ERMA) GIS layers that are a compilation of all the individual Texture...

  3. Deepwater Horizon MC252 marine mammal data from the Environmental Response Management Application (ERMA) containing marine mammal aerial observations, bottlenose dolphin stock boundaries, dolphin telemetry datasets, marine mammal unusual mortality events (UME), related marine mammal data, and sea turtle data collected for the DWH response between 2010-04-28 and 2010-08-25 in the Northern Gulf of Mexico (NCEI Accession 0163809)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This Archival Information Package (AIP) contains Environmental Resource Management Application (ERMA) GIS layers that represent marine mammal surveys, observations,...

  4. Deepwater Horizon MC252 marine mammal data from the Environmental Response Management Application (ERMA) containing marine mammal aerial observations, bottlenose dolphin stock boundaries, marine mammal Unusual Mortality Events (UME), and related marine mammal data collected during the DWH Response from 2010-05-07 to 2015-01-31 in the Northern Gulf of Mexico (NCEI Accession 0163810)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This Archival Information Package (AIP) contains Environmental Resource Management Application (ERMA) GIS layers that represent marine mammal surveys, observations,...

  5. Deepwater Horizon MC252 response data from the Environmental Resource Management Application (ERMA) containing turtle and marine mammal observations National Marine Fisheries Service (NMFS) collected via aerial surveys 2010-01-01 to 2015-07-27 in the Northern Gulf of Mexico (NCEI Accession 0163821)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This Archival Information Package (AIP) contains Environmental Resource Management Application (ERMA) GIS layers that represent helicopter flights surveys...

  6. Deepwater Horizon MC 252 response data from the Environmental Resource Management Application (ERMA) containing EPA's airborne spectral photometric environmental collection technology (ASPECT) imagery collected from 2010-04-01 to 2010-08-31 in the Northern Gulf of Mexico (NCEI Accession 0163803)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This Archival Information Package (AIP) provides Environmental Response Management Application (ERMA) GIS layers of infrared and photographic images from EPA's...

  7. Deepwater Horizon MC252 oyster data from the Environmental Response Management Application (ERMA) containing oyster recruitment sampling results, estimates of subtidal habitat, percent cover, nearshore and subtidal abundance data, and other related datasets collected from 2009-01-01 to 2015-01-01 in the Northern Gulf of Mexico (NCEI Accession 0163812)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This Archival Information Package (AIP) contains Environmental Resource Management Application (ERMA) GIS layers that represent oyster recruitment and abundance...

  8. Deepwater Horizon MC252 sea turtle data from the Environmental Response Management Application (ERMA) containing synoptic surveys, turtle telemetry, workplan sample observations and tagging, density grids, direct capture, and probabilities of exposure, and related sea turtle data collected between 1989-11-15 and 2013-11-12 during the DWH response in the Northern Gulf of Mexico (NCEI Accession 0163813)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This Archival Information Package (AIP) contains Environmental Resource Management Application (ERMA) GIS layers that include turtle survey overflight observations,...

  9. Comment on Spracklandus Hoser, 2009 (Reptilia, Serpentes, ELAPIDAE): request for confirmation of availability of the generic name and for the nomenclatural validation of the journal in which it was published (Case 3601; BZN 70:234–237; 71:30–38; 133-135,181-182 ,252-253)

    Science.gov (United States)

    Rhodin, Anders G.J.; Kaiser, Hinrich; van Dijk, Peter Paul; Wüster, Wolfgang; O’Shea, Mark; Archer, Michael; Auliya, Mark; Boitani, Luigi; Bour, Roger; Clausnitzer, Viola; Contreras-MacBeath, Topiltzin; Crother, Brian I.; Daza, Juan M.; Driscoll, Carlos A.; Flores-Villela, Oscar; Frazier, Jack; Fritz, Uwe; Gardner, Alfred L.; Gascon, Claude; Georges, Arthur; Glaw, Frank; Grazziotin, Felipe G.; Groves, Colin P.; Haszprunar, Gerhard; Havaš, Peter; Hero, Jean-Marc; Hoffmann, Michael; Hoogmoed, Marinus S.; Horne, Brian D.; Iverson, John B.; Jäch, Manfred; Jenkins, Christopher L.; Jenkins, Richard K.B.; Kiester, A. Ross; Keogh, J. Scott; Lacher, Thomas E.; Lovich, Jeffrey E.; Luiselli, Luca; Mahler, D. Luke; Mallon, David P.; Mast, Roderic; McDiarmid, Roy W.; Measey, John; Mittermeier, Russell A.; Molur, Sanjay; Mosbrugger, Volker; Murphy, Robert W.; Naish, Darren; Niekisch, Manfred; Ota, Hidetoshi; Parham, James F.; Parr, Michael J.; Pilcher, Nicolas J.; Pine, Ronald H.; Rylands, Anthony B.; Sanderson, James G.; Savage, Jay M.; Schleip, Wulf; Scrocchi, Gustavo J.; Shaffer, H. Bradley; Smith, Eric N.; Sprackland, Robert; Stuart, Simon N.; Vetter, Holger; Vitt, Laurie J.; Waller, Tomás; Webb, Grahame; Wilson, Edward O.; Zaher, Hussam; Thomson, Scott

    2015-01-01

    In Case 3601 Raymond Hoser has asked the Commission to validate for the purposes of nomenclature the name Spracklandus Hoser, 2009, and ‘the journal in which it was published,’ issue 7 of the Australasian Journal of Herpetology (AJH). We note that the entire run of AJH has been written, edited, and published solely by Hoser. Although his requests to the Commission were presented as narrow and, in his words, ‘routine matters,’ we are convinced that they represent an important tipping-point with broad implications of major concern for zoological taxonomy and nomenclature as a whole and, by extension, the greater scientific community. Since Hoser’s actions and works have failed to follow scientific best practices (e.g. Turtle Taxonomy Working Group, 2007, 2014; Kaiser et al., 2013; Kaiser, 2014) and both the Commission’s general Recommendations and Code of Ethics in Appendix A, the global herpetological community has widely rejected his taxonomic decisions and resultant nomenclature. This has unfortunately caused a confusing dual nomenclature to develop in the herpetological community, with most boycotting or ignoring Hoser’s 700+ new names coined in the AJH, while he and a few personal followers actively promote their usage. We believe that suppression of the name Spracklandus, and all issues of AJH, is the only effective way to bring this contentious and confusing issue to resolution. The plenary power available under Article 81.1 of the Code exist specifically to allow the Commission to make rulings in individual cases that disturb stability and cause confusion, whether the works are Code-compliant or not. We maintain that it is in the interest of nomenclatural stability, not only for herpetology, but for all of zoological taxonomy, that the plenary power be invoked to declare the works in AJH unavailable, regardless of any narrow interpretation of their technical Code-compliance. We present our arguments for rejection of the validity of AJH in the following commentary. In view of the wide-reaching implications of this case for all of zoology, and reflecting the deep and broad-based community concern over these issues, our contributing authors include 70 global scientific leaders and accomplished amateurs from a wide variety of zoological disciplines.

  10. Deepwater Horizon MC252 analytical data from the Environmental Response Management Application (ERMA) containing sediment chemistry data, tissue chemistry data, environmental quality and monitoring data, sample pre/post oiling analysis data, and Total Polycyclic Aromatic Hydrocarbon (TPAH) contaminants chemistry data from samples collected from 2010-03-07 to 2013-08-28 in the Northern Gulf of Mexico (NCEI Accession 0163796)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This Archival Information Package (AIP) contains Environmental Resource Management Application (ERMA) GIS layers that represent nearshore tissue and sediment...

  11. 48 CFR 227.7103-15 - Subcontractor rights in technical data.

    Science.gov (United States)

    2010-10-01

    ... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE GENERAL CONTRACTING REQUIREMENTS PATENTS, DATA, AND COPYRIGHTS... Computer Software Previously Delivered to the Government; and (4) 252.227-7037, Validation of Restrictive...

  12. ORF Alignment: NC_002952 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Staphylococcus aureus subsp. aureus MRSA252] ... Length = 95 ... Query: 1 ... MSIDQILNFLGLAMRAGKVKTGESVIVNEIKKGNLKLVIVANDA...SNNTAKLITDKCKSYK 60 ... MSIDQILNFLGLAMRAGKVKTGESVIVNEIKKGNLKLVIVANDA...SNNTAKLITDKCKSYK Sbjct: 1 ... MSIDQILNFLGLAMRAGKVKTGESVIVNEIKKGNLKLVIVANDASNNTAKLITDKCKSYK 60 ...

  13. 78 FR 48404 - Defense Federal Acquisition Regulation Supplement: Clauses With Alternates-Contract Financing...

    Science.gov (United States)

    2013-08-08

    ... in the formation of a final rule. ADDRESSES: Submit comments identified by DFARS Case 2013-D014... 252 Government procurement. Manuel Quinones, Editor, Defense Acquisition Regulations System. Therefore...

  14. ORF Alignment: NC_002952 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available MRSA252] ... Length = 233 ... Query: 6 ... TAEEIIQYISDAKKSTPIKVYLNGNFEGITYPESFK...VFGSEQSKVIFCEADDWKPFYEAY 65 ... TAEEIIQYISDAKKSTPIKVYLNGNFEGITYPESFKVFGSEQSKVIFCEADDWKPFYEAY Sbjct: 1... ... TAEEIIQYISDAKKSTPIKVYLNGNFEGITYPESFKVFGSEQSKVIFCEADDWKPFYEAY 60 ... Query: 126 GEGTMIDMNATLGGRATTGKNVHXXXXXX

  15. 77 FR 20598 - Defense Federal Acquisition Regulation Supplement: Solicitation Provisions and Contract Clauses...

    Science.gov (United States)

    2012-04-05

    ... clause 52.203-13, Contractor Code of Business Ethics and Conduct, including solicitations and contracts...: Clause 252.219-7003, Small Business Subcontracting Plan; provision 252.225-7000, Buy American Act-Balance..., distributive impacts, and equity). E.O. 13563 emphasizes the importance of quantifying both costs and benefits...

  16. 77 FR 30355 - Defense Federal Acquisition Regulation Supplement: United States-Korea Free Trade Agreement...

    Science.gov (United States)

    2012-05-22

    ...). Therefore, new alternates are required for the provision and clause for acquisition of photovoltaic devices... already implemented in paragraph (c) of Alternate II to DFARS 252.225-7036, as well as in the basic....225-7017, Photovoltaic Devices (MAY 2012) (Section 846 of Pub. L. 111-383). (13)(i) ------ 252.225...

  17. 48 CFR 246.710 - Contract clauses.

    Science.gov (United States)

    2010-10-01

    ... OF DEFENSE CONTRACT MANAGEMENT QUALITY ASSURANCE Warranties 246.710 Contract clauses. (1) Use a clause substantially the same as the clause at 252.246-7001, Warranty of Data, in solicitations and... warranty clauses prescribed in FAR Part 46. (2) Use the clause at 252.246-7001, Warranty of Data, with its...

  18. 25m2 target-aligned heliostat with closed-loop control

    CSIR Research Space (South Africa)

    Roos, TH

    2007-09-01

    Full Text Available system making use of a solar tracker has been developed and tested on a 1.252m target-aligned miniheliostat. A tracking accuracy of 3.3 milliradians was obtained. A good focal spot has been obtained with the 252m target-aligned research heliostat....

  19. Knowledge of English language as a predictor of students\\' cognitive ...

    African Journals Online (AJOL)

    In this paper, the authors, using ex-post-facto procedure, attempted to show the effect of knowledge of English language on students\\' cognitive achievement in senior secondary school mathematics. In all 504 SS II students, comprising 252 males and 252 females were sampled, using cluster sampling technique.

  20. Finding Medical Care for Colorectal Cancer Symptoms: Experiences among Those Facing Financial Barriers

    Science.gov (United States)

    Thomson, Maria D.; Siminoff, Laura A.

    2015-01-01

    Financial barriers can substantially delay medical care seeking. Using patient narratives provided by 252 colorectal cancer patients, we explored the experience of financial barriers to care seeking. Of the 252 patients interviewed, 84 identified financial barriers as a significant hurdle to obtaining health care for their colorectal cancer…

  1. 76 FR 33166 - Defense Federal Acquisition Regulation Supplement (DFARS); Warranty Tracking of Serialized Items...

    Science.gov (United States)

    2011-06-08

    ... 252.246-7005, and included in the clause at 252.246-7006. Electronic business systems are being... the various business systems possible without modifying every DoD contract writing system. DFARS 246... administrator enterprise identifier'' was revised to include the term ``globally unique'' identifier code. The...

  2. NCBI nr-aa BLAST: CBRC-CBRE-01-0523 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-0523 ref|YP_040542.1| hypothetical protein SAR1129 [Staphylococcus aureus subsp. aureus MRSA...252] emb|CAG40132.1| putative membrane protein [Staphylococcus aureus subsp. aureus MRSA252] YP_040542.1 8e-04 25% ...

  3. Deepwater Horizon MC252 cumulative oiling workgroup data from the Environmental Response Management Application (ERMA) containing Texture Classifying Neural Network Algorithm (TCNNA) from Synthetic Aperture Radar (SAR) image polygons and National Environmental Satellite, Data, and Information Service (NESDIS) image polygons, and related data that helped responders delineate cumulative areas of oiling collected between 2010-04-23 to 2010-08-11 during the DWH response in the Northern Gulf of Mexico (NCEI Accession 0163807)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This Archival Information Package (AIP) contains Environmental Resource Management Application (ERMA) GIS layers that represent a variety of cumulative oiling...

  4. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes; Mesures des sections efficaces de capture et potentiels d'incineration des actinides mineurs dans les hauts flux de neutrons: Impact sur la transmutation des dechets

    Energy Technology Data Exchange (ETDEWEB)

    Bringer, O

    2007-10-15

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of {sup 241}Am and {sup 237}Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the {sup 241}Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  5. A gas secondary electron detector

    CERN Document Server

    Drouart, A; Alamanos, N; Auger, F; Besson, P; Bougamont, E; Bourgeois, P; Lobo, G; Pollacco, E C; Riallot, M

    2002-01-01

    A new Secondary Electron gas Detector (SED) is under development to be used in conjunction with an emissive foil to detect low energy heavy ions as an alternative to micro-channel plates. It could measure position and time of flight. Secondary electrons are accelerated to 10 keV so that they can cross through the 0.9 mu m Mylar entrance window. The electrons then are multiplied in the isobutane gas of the detector at 4-10 Torr. A time resolution of 150 ps and a spatial resolution of 3 mm have been obtained by using californium fission fragments on a prototype detector of 7x7 cm sup 2. The advantage of the SED against MCP is that its size is not limited. Our final goal is to build a large size detector (15x40 cm sup 2) that will operate at the focal plane of the VAMOS magnetic spectrometer at GANIL.

  6. Chelation and stabilization of berkelium in oxidation state +IV

    Science.gov (United States)

    Deblonde, Gauthier J.-P.; Sturzbecher-Hoehne, Manuel; Rupert, Peter B.; An, Dahlia D.; Illy, Marie-Claire; Ralston, Corie Y.; Brabec, Jiri; de Jong, Wibe A.; Strong, Roland K.; Abergel, Rebecca J.

    2017-09-01

    Berkelium (Bk) has been predicted to be the only transplutonium element able to exhibit both +III and +IV oxidation states in solution, but evidence of a stable oxidized Bk chelate has so far remained elusive. Here we describe the stabilization of the heaviest 4+ ion of the periodic table, under mild aqueous conditions, using a siderophore derivative. The resulting Bk(IV) complex exhibits luminescence via sensitization through an intramolecular antenna effect. This neutral Bk(IV) coordination compound is not sequestered by the protein siderocalin—a mammalian metal transporter—in contrast to the negatively charged species obtained with neighbouring trivalent actinides americium, curium and californium (Cf). The corresponding Cf(III)-ligand-protein ternary adduct was characterized by X-ray diffraction analysis. Combined with theoretical predictions, these data add significant insight to the field of transplutonium chemistry, and may lead to innovative Bk separation and purification processes.

  7. The CARIBU EBIS control and synchronization system

    Science.gov (United States)

    Dickerson, Clayton; Peters, Christopher

    2015-01-01

    The Californium Rare Isotope Breeder Upgrade (CARIBU) Electron Beam Ion Source (EBIS) charge breeder has been built and tested. The bases of the CARIBU EBIS electrical system are four voltage platforms on which both DC and pulsed high voltage outputs are controlled. The high voltage output pulses are created with either a combination of a function generator and a high voltage amplifier, or two high voltage DC power supplies and a high voltage solid state switch. Proper synchronization of the pulsed voltages, fundamental to optimizing the charge breeding performance, is achieved with triggering from a digital delay pulse generator. The control system is based on National Instruments realtime controllers and LabVIEW software implementing Functional Global Variables (FGV) to store and access instrument parameters. Fiber optic converters enable network communication and triggering across the platforms.

  8. Off-line commissioning of EBIS and plans for its integration into ATLAS and CARIBU

    Energy Technology Data Exchange (ETDEWEB)

    Ostroumov, P. N., E-mail: ostroumov@anl.gov; Barcikowski, A.; Dickerson, C. A.; Mustapha, B.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. [Argonne National Laboratory, Argonne, Illinois 60439 (United States)

    2016-02-15

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed at Argonne to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne Tandem Linac Accelerator System (ATLAS). The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and significantly improve the purity of reaccelerated radioactive ion beams. The CARIBU EBIS-CB has been successfully commissioned offline with an external singly charged cesium ion source. The performance of the EBIS fully meets the specifications to breed rare isotope beams delivered from CARIBU. The EBIS is being relocated and integrated into ATLAS and CARIBU. A long electrostatic beam transport system including two 180° bends in the vertical plane has been designed. The commissioning of the EBIS and the beam transport system in their permanent location will start at the end of this year.

  9. Populations of selected microbial and fungal species growing on the surface of rape seeds following treatment with desiccants or plant growth regulators.

    Science.gov (United States)

    Frac, Magdalena; Jezierska-Tys, Stefania; Tys, Jerzy

    2010-01-01

    The aim of this study was to determine the effects of desiccants and plant growth regulators on selected microbial species affecting rape seeds, with special emphasis on the growth of fungi and identification of the genus and species composition. The experimental material in the study was seeds of winter rape cv. Californium that were collected from the field during combine harvest. The chemical agents applied, both desiccants and growth regulators, generally decreased the populations of bacteria occurring on the surface of rape seeds. The responses of fungi depended upon the type of agent applied and were manifested as either stimulation or inhibition of the growth of the fungal species. The fungi isolated from the surface of rape seeds were characteristic of those found in the field environment (Cladosporium and Penicillium) and typical for those present on the surface of rape seeds (Alternaria).

  10. Triton and alpha-particle contribution from LiF converter for neutron dosimeter

    CERN Document Server

    Camacho, M E; Balcazar, M

    1999-01-01

    A personnel neutron dosimeter prototype based on chemical and electrochemical etched CR-39 detector, combined with LiF converter, has been calibrated using an ICRP-like phantom, under a heavy-water moderated Californium source neutron spectra; A conversion factor of 1.052+-126 spots cm sup - sup 2 mSv sup - sup 1 was obtained. The sealing properties of the detector holder showed a ten-fold reduction in radon background when it was tested in a high radon atmosphere. A convenient mechanical shock resistance was achieved in LiF converters by sintering to 11 tons pressure LiF powder at 650 deg. C, during one hour.

  11. 48 CFR 227.7103-17 - Overseas contracts with foreign sources.

    Science.gov (United States)

    2010-10-01

    ... COPYRIGHTS Rights in Technical Data 227.7103-17 Overseas contracts with foreign sources. (a) The clause at 252.227-7032, Rights in Technical Data and Computer Software (Foreign), may be used in contracts with...

  12. 78 FR 73475 - Defense Federal Acquisition Regulation Supplement: Clauses With Alternates-Research and...

    Science.gov (United States)

    2013-12-06

    ... be considered in the formation of a final rule. ADDRESSES: Submit comments identified by DFARS Case.... Manuel Quinones, Editor, Defense Acquisition Regulations System. Therefore, 48 CFR parts 235 and 252 are...

  13. 78 FR 48407 - Defense Federal Acquisition Regulation Supplement: Clauses With Alternates-Quality Assurance...

    Science.gov (United States)

    2013-08-08

    ... October 7, 2013, to be considered in the formation of a final rule. ADDRESSES: Submit comments identified... Parts 246 and 252 Government procurement. Manuel Quinones, Editor, Defense Acquisition Regulations...

  14. Prevalence and genetic characterization of Cryptosporidium, Enterocytozoon, Giardia and Cyclospora in diarrheal outpatients in China

    National Research Council Canada - National Science Library

    Liu, Hua; Shen, Yujuan; Yin, Jianhai; Yuan, Zhongying; Jiang, Yanyan; Xu, Yuxin; Pan, Wei; Hu, Yuan; Cao, Jianping

    2014-01-01

    ...) of a hospital in Shanghai, China, were collected between October 2012 and March 2013. All samples were examined for the presence of the four parasites by using molecular methods. In total, 76/252 (30.16...

  15. 77 FR 38736 - Defense Federal Acquisition Regulation Supplement: New Qualifying Country-Czech Republic (DFARS...

    Science.gov (United States)

    2012-06-29

    ... meaning of the basic DoD policy on contracting with qualifying country sources. Accordingly, the change... definition of ``Qualifying country,'' in paragraph (a) to read as follows: 252.225-7017 Photovoltaic Devices...

  16. THE LIVED ExPERIENCES OF LATE -ADOLESCENT FEMALE ...

    African Journals Online (AJOL)

    2010-06-08

    18). A phenomenological psychology research approach focuses on the psychological meanings of research participants' lived experiences in their particular life worlds. (Giorgi 1997:252–254; Kruger 1988:37–38). An arts- ...

  17. 48 CFR 246.705 - Limitations.

    Science.gov (United States)

    2010-10-01

    ... OF DEFENSE CONTRACT MANAGEMENT QUALITY ASSURANCE Warranties 246.705 Limitations. (a) In addition to the exceptions provided in FAR 46.705(a), warranties in the clause at 252.246-7001, Warranty of Data...

  18. When Contact Is Not Enough: Affecting First Year Medical Students’ Image towards Older Persons

    National Research Council Canada - National Science Library

    Kusumastuti, Sasmita; van Fenema, Esther; Polman-van Stratum, Eugenie C. F; Achterberg, Wilco; Lindenberg, Jolanda; Westendorp, Rudi G. J

    2017-01-01

    ...) and the Attitudes toward Old People (AOP; 34 positions) questionnaires. Participants Before and after a care internship involving interpersonal contact, 252 and 244 first-year medical students at the Leiden University Medical Centre (LUMC...

  19. Neznámé počátky české sociální psychologie. Otakar Machotka: Úloha nevědomého činitele ve společenském chování

    Czech Academy of Sciences Publication Activity Database

    Nešpor, Zdeněk

    2015-01-01

    Roč. 59, č. 3 (2015), s. 252-288 ISSN 0009-062X Institutional support: RVO:68378025 Keywords : social psychology * Czech psychology * Machotka Otakar Subject RIV: AO - Sociology, Demography Impact factor: 0.236, year: 2015

  20. All projects related to | Page 545 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: NATURAL DISASTERS, DISASTER MANAGEMENT, DISASTER PREPAREDNESS, WEATHER FORECASTS. Region: Costa Rica, North and Central America, Honduras, Nicaragua, South America. Program: Networked Economies. Total Funding: CA$ 252,700.00. Focus Cities : Reducing the Vulnerability, Poverty ...

  1. Book review: Reptiles and amphibians: Self-assessment color review

    Science.gov (United States)

    Green, David E.

    2017-01-01

    No abstract available.Book information: Reptiles and Amphibians: Self-Assessment Color Review. 2nd Edition. By Fredric L. Frye. CRC Press, Taylor and Francis Group, Boca Raton, Florida USA. 2015. 252 pp. ISBN 9781482257601.

  2. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available s ... putida KT2440] ... Length = 122 ... Query: 132 IELNSSLLFGSGDAMPSDKAFAIIEKVASILKPFANPVHVEGFT...DNLPIRTAQYPTNWEL 191 ... IELNSSLLFGSGDAMPSDKAFAIIEKVASILKPFANPVHVEGFTDNLPI...RTAQYPTNWEL Sbjct: 1 ... IELNSSLLFGSGDAMPSDKAFAIIEKVASILKPFANPVHVEGFTDNLPIRTAQYPTNWEL 60 ... Query: 252 SL 253 ... SL Sbjct: 121 SL 122

  3. 75 FR 71646 - Defense Federal Acquisition Regulation Supplement; Annual Representations and Certifications...

    Science.gov (United States)

    2010-11-24

    ... with institutions of higher education. (ii) 252.225-7000, Buy American Act--Balance of Payments Program... Arab Boycott of Israel. This provision applies to all solicitations unless an exception applies or a...

  4. 78 FR 11227 - Notice of Determinations Regarding Eligibility To Apply for Worker Adjustment Assistance

    Science.gov (United States)

    2013-02-15

    ... 30, 2012. Inc. 82,252 Heritage Footwear Inc.. Fort Payne, AL......... December 12, 2011. 82,260 H.B. Smith Company, Inc Westfield, MA July 22, 2012. (The). 82,268 Red Wing Shoe Company, Danville, KY April...

  5. Book Review | Masuku | Southern African Journal of Environmental ...

    African Journals Online (AJOL)

    Abstract. Intergenerational Learning and Transformative Leadership for Sustainable Futures. 2014. Eds. Peter Blaze Corcoran, Brandon P. Hollingshead. Wageningen: Wageningen Academic Press ISBN: 978-90-8686-252-8 ...

  6. Population genetics provides an efficient tool to quantify fragmentation impact in forest ecosystems

    Directory of Open Access Journals (Sweden)

    2005-01-01

    Full Text Available A method in population genetics (Dutech et al., Am. J. Bot. 92 (2, 252-261, February 2005 is described and discussed as an interesting tool for investigating the effects of fragmentation in forest ecosystems.

  7. Managing Osteoarthritis Pain with Medicines: A Review of the Research for Adults

    Science.gov (United States)

    ... also consider the quality of the product. 7 Wholesale Prices of Prescription Analgesics Drug Name NSAIDs Celecoxib ... Once aday $156 $252 *Prices are the average wholesale prices as listed from RED BOOK Online® . Generic ...

  8. South African Family Practice - Vol 55, No 3 (2013)

    African Journals Online (AJOL)

    Eating disorders are real treatable medical illnesses · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. A Revelas, 252-255. http://dx.doi.org/10.1080/20786204.2013.10874346 ...

  9. Ten-Competence: Life-Long Competence Development and Learning

    NARCIS (Netherlands)

    Koper, Rob; Specht, Marcus

    2006-01-01

    Koper, R., & Specht, M. (2008). Ten-Competence: Life-Long Competence Development and Learning. In M-A. Cicilia (Ed.), Competencies in Organizational e-learning: concepts and tools (pp. 234-252). Hershey: IGI-Global.

  10. 48 CFR 211.275-1 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... Documents 211.275-1 Definitions. Bulk commodities, case, palletized unit load, passive RFID tag, and radio frequency identification are defined in the clause at 252.211-7006, Radio Frequency Identification. ...

  11. Percepcion y expectativas de los alumnos universitarios frente al profesor no pedagogo

    National Research Council Canada - National Science Library

    Villalobos Claveria, Alejandro; Melo Hermosilla, Yenia; Perez Villalobos, Cristhian

    2010-01-01

    ... la docencia que reciben. Para esto se encuesto a 252 alumnos, incluyendo estudiantes de pre y posgrado, aplicandoles encuestas para evaluar sus percepciones y expectativas en torno a la docencia universitaria...

  12. 29 CFR 783.40 - “Documented” vessel.

    Science.gov (United States)

    2010-07-01

    ..., enrolled and licensed, or licensed by the Bureau of Customs under the laws of the United States (46 U.S.C. 11, 193, 251-252, 258, 840). Although Bureau of Customs regulations provide for three types of...

  13. Effect of environmental conditions on the genotypic difference in ...

    African Journals Online (AJOL)

    Jane

    2011-10-03

    #, ... Selection for nitrogen (N) efficient cultivars is typically conducted under favorable field conditions with only difference in soil N availability. ..... biomass, and radiation utilization. Field Crops Res. 31: 233-252. Mackay AD ...

  14. 76 FR 58138 - Defense Federal Acquisition Regulation Supplement (DFARS); Alternative Line Item Structure (DFARS...

    Science.gov (United States)

    2011-09-20

    ... process reviews performed by DoD cross-service working groups, which were chartered by the Defense Finance... the provision at 252.225-7010, Commercial Derivative Military Article--Specialty Metals Compliance...

  15. Gclust Server: 34444 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available CTED: similar to Amphiregulin precursor (AR) (Colorectum cell-derived growth factor) (CRDGF) ; no annotation...e length 252 Representative annotation XP_001125684.1 PREDICTED: similar to Amphiregulin precursor (AR) (Color

  16. Dicty_cDB: Contig-U13016-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tntgntg 72 Query: 73 atttngatccnaaaccnttcntttgtaaaactgcngctgntgtttcngttggngttgctg 132 ||||||||||||||||||||||...|||||||||||||||||||||||||||||||||||||| Sbjct: 73 atttngatccnaaaccnttcntttgtaaaactgcngctgntgtttcngttggngttgct...gtntttatttttgnnggnaanaaag 192 Query: 193 gttatgacttntggaaancnagtcaaggngntncnatggccccntcnaatgccnatcccc 252 ||...|||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 193 gttatgacttntggaaancnagtcaaggngntncnatggccccntcnaatgccna...e-30 Identities = 165/186 (88%) Strand = Plus / Plus Query: 71 tgatttngatccnaaaccnttcntttgtaaaactgcngctgntgt

  17. Evaluating species limits and hybridization in the Carex complanata complex using morphology, amplified fragment length polymorphisms, and restriction fragment analysisThis paper is one of a selection of papers published in the Special Issue on Systematics Research

    National Research Council Canada - National Science Library

    Waterway, Marcia J; Smith, Tyler W

    2008-01-01

    We used a combination of morphology, amplified fragment length polymorphisms (AFLP), and restriction-site data from 252 individuals from 51 populations to investigate species limits and hybridization in the Carex complanata complex...

  18. HOME Rent Limits

    Data.gov (United States)

    Department of Housing and Urban Development — In accordance with 24 CFR Part 92.252, HUD provides maximum HOME rent limits. The maximum HOME rents are the lesser of: The fair market rent for existing housing for...

  19. Few highly abundant operational taxonomic units dominate within rumen methanogenic archaeal species in New Zealand sheep and cattle

    National Research Council Canada - National Science Library

    Seedorf, Henning; Kittelmann, Sandra; Janssen, Peter H

    2015-01-01

    Sequencing and analyses of 16S rRNA gene amplicons were performed to estimate the composition of the rumen methanogen community in 252 samples from eight cohorts of sheep and cattle, separated into 16...

  20. 48 CFR 52.212-5 - Contract Terms and Conditions Required To Implement Statutes or Executive Orders-Commercial Items.

    Science.gov (United States)

    2010-10-01

    ...). ___(2) 52.203-13, Contractor Code of Business Ethics and Conduct (APR 2010)(Pub. L. 110-252, Title VI... required by the clause— (i) 52.203-13, Contractor Code of Business Ethics and Conduct (APR 2010) (Pub. L... Business Ethics and Conduct (APR 2010) (Pub. L. 110-252, Title VI, Chapter 1 (41 U.S.C. 251 note)). (B) 52...

  1. A New Simplified System for the Evaluation of BNCT Pharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    Byrne, T.E.; Kabalka, G.W.; Martin, R.C.; Miller, L.F.

    1998-09-13

    A system for testing potential BNCT pharmaceuticals in cell cultures has been developed with the cooperation of Oak Ridge National Laboratory (ORNL), the University of Tennessee Chemistry Department and the University of Tennessee Nuclear Engineering Department. A BNCT test model has been established with the use of the human lung cancer cell line A 549. These cells were maintained in standard laboratory facilities and subjected to boronated chemicals. Following toxicity studies the human luug cancer cells were exposed to {sup 252}Cf neutron sources provided by the Radiochemical Engineering Development Center (REDC) at ORNL The isotope {sup 252}Cf performs effectively for BNCT applications. The neutron spectrum is similar to that of a reactor fission source with an average energy of 2.1 MeV. A 50 mg source of {sup 252}Cf moderated by water provides a source on the order of 1 x 10{sup 9} thermal neutrons/cm{sup 2}/sec at a distance of 3 cm. The half-life of {sup 252}Cf is 2.65 years, and thus may provide a simple and reliable source of neutrons for BNCT in locations without suitable nuclear reactors. The REDC of ORNL stores and processes the U.S. stockpile of {sup 252}Cf.

  2. LU 302 872 and its racemate (LU 224 332) show balanced endothelin-A/B receptor affinity, high oral activity, and inhibit human prostate tissue contractions.

    Science.gov (United States)

    Raschack, M; Göck, S; Unger, L; Hahn, A; Amberg, W; Jansen, R; Alken, P; Weber, A; Hergenröder, S

    1998-01-01

    LU 302 872 (racemate LU 224 332) is a new glycerinic acid derivative related to the selective ETA receptor antagonist LU 135 252. LU 302 872 exhibits high and balanced affinity to ETA and ETB receptors (Ki 2.2 and 5.8 nmol/L), whereas LU 135 252 is ETA-selective (Ki 1.4 and 184 nmol/L). Two hours after oral treatment of rats with 10 mg/kg of LU 302 872 or of LU 135 252, the big ET-1-induced (20 micrograms/kg i.v.) blood pressure increase is inhibited by 59 +/- 8% or 52 +/- 2% (n = 6-8; p testing in benign prostate hyperplasia (BPH).

  3. Systematic studies of the fundamental chemistry of pyrochlore oxides. An{sub 2}Zr{sub 2}O{sub 7} [An=Pu, Am, Cm, Bk and Cf

    Energy Technology Data Exchange (ETDEWEB)

    Haire, R.G.; Assefa, Z. [Oak Ridge National Laboratory, Oak Ridge, TN (United States); Raison, P.E. [Commissariat a l' Energie Atomique, CEA-Cadarache DRN/DEC/SPUA/LACA (France)

    2002-11-01

    Our efforts to pursue the fundamental science of actinide pyrochlore oxides, An{sub 2}Zr{sub 2}O{sub 7}, (An=plutonium through californium), are presented. We have addressed their structural and chemical behavior via X-ray diffraction, Raman spectroscopy and by considering the pseudo-oxidation potentials of the actinides. The structure, fundamental chemistry, ionic radii and the electronic configuration of the specific actinide involved in these oxide systems all have a significant impact on their science. We are also exploring a calculational approach based on valence-bond relationships to assess the position of the oxygen atoms located at the general crystallographic position. The oxygen position is important regarding the chemical behavior and thermal stability of these materials. Also considered is the structural stability of the materials regarding self-irradiation, and with some compounds, their resistance towards oxidation. These aspects will be discussed using a systematic evaluation of the five-actinide systems together with comparable lanthanide systems studied. (author)

  4. 1982 US-CEC neutron personnel dosimetry intercomparison study

    Energy Technology Data Exchange (ETDEWEB)

    Swaja, R.E.; Sims, C.S.; Greene, R.T.; Schraube, H.; Burger, G.

    1983-11-01

    A neutron personnel dosimetry intercomparison study was conducted during April 19-23, 1982, as a joint effort between the United States and the Commission of European Communities. Dosimeters from 48 participating agencies were mounted on cylindrical phantoms and exposed to a range of low-level dose equivalents (0.48-13.91 mSv neutron and 0.02-1.32 mSv gamma) in nine different radiation fields. Exposure conditions considered in this study included four mixed-field spectra produced using the Health Physics Research Reactor, four monoenergetic neutron fields generated by accelerators, and one 15-cm D/sub 2/O-moderated californium source spectrum. In general, neutron results reported by the participating agencies were consistent with expected dosimeter performance based on energy response characteristics of the detection systems. Albedo dosimeters, which were the most popular neutron monitoring systems used in this study, provided the best overall accuracy for all exposure conditions. Film, Cr-39 recoil track, and Th-232 fission track systems generally underestimated dose equivalents relative to reference values. Associated gamma measurements showed that TLD monitors produced more accurate results than film dosimeters although both systems overestimated gamma dose equivalents in mixed radiation fields. 24 references, 10 figures, 19 tables.

  5. Application of the backward extrapolation method to pulsed neutron sources

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto; Gohar, Yousry

    2018-01-01

    Particle detectors operated in pulse mode are subjected to the dead-time effect. When the average of the detector counts is constant over time, correcting for the dead-time effect is simple and can be accomplished by analytical formulas. However, when the average of the detector counts changes over time it is more difficult to take into account the dead-time effect. When a subcritical nuclear assembly is driven by a pulsed neutron source, simple analytical formulas cannot be applied to the measured detector counts to correct for the dead-time effect because of the sharp change of the detector counts over time. This work addresses this issue by using the backward extrapolation method. The latter can be applied not only to a continuous (e.g. californium) external neutron source but also to a pulsed external neutron source (e.g. by a particle accelerator) driving a subcritical nuclear assembly. The backward extrapolation method allows to obtain from the measured detector counts both the dead-time value and the real detector counts.

  6. The cross sections of fusion-evaporation reactions: the most promising route to superheavy elements beyond Z=118

    Science.gov (United States)

    Jadambaa, Khuyagbaatar

    2017-11-01

    The synthesis of superheavy elements beyond oganesson (Og), which has atomic number Z = 118, is currently one of the main topics in nuclear physics. An absence of sufficient amounts of target material with atomic numbers heavier than californium (Z = 98) forces the use of projectiles heavier than 48Ca (Z = 20), which has been successfully used for the discoveries of elements with Z = 114 - 118 in complete fusion reactions. Experimental cross sections of 48Ca with actinide targets behave very differently to "cold" and "hot" fusion-evaporation reactions, where doubly-magic lead and deformed actinides are used as targets, respectively. The known cross sections of these reactions have been analysed compared to calculated fission barriers. It has been suggested that observed discrepancies between the cross sections of 48Ca-induced and other fusionevaporation reactions originate from the shell structure of the compound nucleus, which lies in the island of the stability. Besides scarcely known data on other reactions involving heavier projectiles, the most promising projectile for the synthesis of the elements beyond Og seems to be 50Ti. However, detailed studies of 50Ti, 54Cr, 58Fe and 64Ni-induced reactions are necessary to be performed in order to fully understand the complexities of superheavy element formation.

  7. Report to the DOE nuclear data committee. [EV RANGE 10-100; CROSS SECTIONS; PHOTONEUTRONS; NEUTRONS; GAMMA RADIATION; COUPLED CHANNEL THEORY; DIFFERENTIAL CROSS SECTIONS; MEV RANGE 01-10; ; CAPTURE; GAMMA SPECTRA; THERMAL NEUTRONS; COMPUTER CALCULATIONS; DECAY; FISSION PRODUCTS; FISSION YIELD; SHELL MODELS; NUCLEAR DATA COLLECTIONS

    Energy Technology Data Exchange (ETDEWEB)

    Struble, G.L.; Haight, R.C.

    1981-03-01

    Topics covered include: studies of (n, charged particle) reactions with 14 to 15 MeV neutrons; photoneutron cross sections for /sup 15/N; neutron radiative capture; Lane-model analysis of (p,p) and (n,n) scattering on the even tin isotopes; neutron scattering cross sections for /sup 181/Ta, /sup 197/Au, /sup 209/Bi, /sup 232/Th, and /sup 238/U inferred from proton scattering and charge exchange cross sections; neutron-induced fission cross sections of /sup 245/Cm and /sup 242/Am; fission neutron multiplicities for /sup 245/Cm and /sup 242/Am; the transport of 14 MeV neutrons through heavy materials 150 < A < 208; /sup 249/Cm energy levels from measurement of thermal neutron capture gamma rays; /sup 231/Th energy levels from neutron capture gamma ray and conversion electron spectroscopy; new measurements of conversion electron binding energies in berkelium and californium; nuclear level densities; relative importance of statistical vs. valence neutron capture in the mass-90 region; determination of properties of short-lived fission products; fission yield of /sup 87/Br and /sup 137/I from 15 nuclei ranging from /sup 232/Th to /sup 249/Cf; evaluation of charged particle data for the ECPL library; evaluation of secondary charged-particle energy and angular distributions for ENDL; and evaluated nuclear structure libraries derived from the table of isotopes. (GHT)

  8. Activation analysis of ITER blanket first wall

    Energy Technology Data Exchange (ETDEWEB)

    Lopatkin, A.; Muratov, V. [RDIPE (NIKIET), Moscow (Russian Federation)

    1998-09-01

    To analyze the activation of ITER blanket structural components, the authors have prepared the AUCDAS code that calculates changes in nuclide concentrations and radioactivity characteristics during neutron irradiation and during cooling. UCDAS takes into account all neutron reactions and decay types, the prepared library of constants contains nuclear data of nuclides from hydrogen to californium. A comparative analysis of the results as obtained using UCDAS code and the widely known FISPACT code is given. The analysis of decay heat, gas generation and activity of ITER blanket first wall`s structural components was carried out. The beryllium coating, copper alloy and stainless steel were analysed. Calculations were performed for the first plasma burning pulse, 6 months and 1 year of operation in accordance with the ITER scenario. The materials recommended by ITER central team and their Russian analogs were considered: TGR and B1 (beryllium coating), GlidCop AL-25 Ds and Br-MKX (copper alloy), 316LN-IG and 12Cr18Ni10Ti (stainless steel). It has been demonstrated that there is a difference in all of the considered characteristics between the above materials. It is caused by impurities which are present in the materials. The report also considers the accumulation of gases (H, D, T, He{sup 3}, He{sup 4}) in the above materials. Besides, the change in the activity of irradiated materials during the cooling of up to 10{sup 7} years was calculated. (orig.) 7 refs.

  9. Design of the low energy beam transport line between CARIBU and the EBIS charge breeder

    Energy Technology Data Exchange (ETDEWEB)

    Perry, A., E-mail: aperry4@hawk.iit.edu [Argonne National Laboratory, Argonne, IL 60439, USA and Illinois Institute of Technology, Chicago, IL 60616 (United States); Ostroumov, P. N.; Barcikowski, A.; Dickerson, C.; Kondrashev, S. A.; Mustapha, B.; Savard, G. [Argonne National Laboratory, Argonne, IL 60439 (United States)

    2015-01-09

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at ATLAS. The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and improve the purity of reaccelerated radioactive ion beams. The EBIS-CB is in the final stage of off-line commissioning. Currently, we are developing a low energy beam transport (LEBT) system to transfer CARIBU beams to the EBIS-CB. As was originally planned, an RFQ cooler-buncher will precede the EBIS-CB. Recently, it was decided to include a multi-reflection time-of-flight (MR-TOF) mass-spectrometer following the RFQ. MR-TOF is a relatively new technology used to purify beams with a mass-resolving power up to 3×10{sup 5} as was demonstrated in experiments at CERN/ISOLDE. Very high purity singly-charged radioactive ion beams will be injected into the EBIS for charge breeding and due to its inherent properties, the EBIS-CB will maintain the purity of the charge bred beams. Possible contamination of residual gas ions will be greatly suppressed by achieving ultra-high vacuum in the EBIS trap. This paper will present and discuss the design of the LEBT and the overall integration of the EBIS-CB into ATLAS.

  10. MinT: Middleware for Cooperative Interaction of Things

    Directory of Open Access Journals (Sweden)

    Soobin Jeon

    2017-06-01

    Full Text Available This paper proposes an Internet of Things (IoT middleware called Middleware for Cooperative Interaction of Things (MinT. MinT supports a fully distributed IoT environment in which IoT devices directly connect to peripheral devices easily construct a local or global network, and share their data in an energy efficient manner. MinT provides a sensor abstract layer, a system layer and an interaction layer. These enable integrated sensing device operations, efficient resource management, and active interconnection between peripheral IoT devices. In addition, MinT provides a high-level API to develop IoT devices easily for IoT device developers. We aim to enhance the energy efficiency and performance of IoT devices through the performance improvements offered by MinT resource management and request processing. The experimental results show that the average request rate increased by 25% compared to Californium, which is a middleware for efficient interaction in IoT environments with powerful performance, an average response time decrease of 90% when resource management was used, and power consumption decreased by up to 68%. Finally, the proposed platform can reduce the latency and power consumption of IoT devices.

  11. MinT: Middleware for Cooperative Interaction of Things

    Science.gov (United States)

    Jeon, Soobin; Jung, Inbum

    2017-01-01

    This paper proposes an Internet of Things (IoT) middleware called Middleware for Cooperative Interaction of Things (MinT). MinT supports a fully distributed IoT environment in which IoT devices directly connect to peripheral devices easily construct a local or global network, and share their data in an energy efficient manner. MinT provides a sensor abstract layer, a system layer and an interaction layer. These enable integrated sensing device operations, efficient resource management, and active interconnection between peripheral IoT devices. In addition, MinT provides a high-level API to develop IoT devices easily for IoT device developers. We aim to enhance the energy efficiency and performance of IoT devices through the performance improvements offered by MinT resource management and request processing. The experimental results show that the average request rate increased by 25% compared to Californium, which is a middleware for efficient interaction in IoT environments with powerful performance, an average response time decrease of 90% when resource management was used, and power consumption decreased by up to 68%. Finally, the proposed platform can reduce the latency and power consumption of IoT devices. PMID:28632182

  12. An Account of Oak Ridge National Laboratory's Thirteen Research Reactors

    Energy Technology Data Exchange (ETDEWEB)

    Rosenthal, Murray Wilford [ORNL

    2009-08-01

    The Oak Ridge National Laboratory has built and operated 13 nuclear reactors in its 66-year history. The first was the graphite reactor, the world's first operational nuclear reactor, which served as a plutonium production pilot plant during World War II. It was followed by two aqueous-homogeneous reactors and two red-hot molten-salt reactors that were parts of power-reactor development programs and by eight others designed for research and radioisotope production. One of the eight was an all-metal fast burst reactor used for health physics studies. All of the others were light-water cooled and moderated, including the famous swimming-pool reactor that was copied dozens of times around the world. Two of the reactors were hoisted 200 feet into the air to study the shielding needs of proposed nuclear-powered aircraft. The final reactor, and the only one still operating today, is the High Flux Isotope Reactor (HFIR) that was built particularly for the production of californium and other heavy elements. With the world's highest flux and recent upgrades that include the addition of a cold neutron source, the 44-year-old HFIR continues to be a valuable tool for research and isotope production, attracting some 500 scientific visitors and guests to Oak Ridge each year. This report describes all of the reactors and their histories.

  13. Neutron Detector Signal Processing to Calculate the Effective Neutron Multiplication Factor of Subcritical Assemblies

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division; Gohar, Yousry [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division

    2016-06-01

    This report describes different methodologies to calculate the effective neutron multiplication factor of subcritical assemblies by processing the neutron detector signals using MATLAB scripts. The subcritical assembly can be driven either by a spontaneous fission neutron source (e.g. californium) or by a neutron source generated from the interactions of accelerated particles with target materials. In the latter case, when the particle accelerator operates in a pulsed mode, the signals are typically stored into two files. One file contains the time when neutron reactions occur and the other contains the times when the neutron pulses start. In both files, the time is given by an integer representing the number of time bins since the start of the counting. These signal files are used to construct the neutron count distribution from a single neutron pulse. The built-in functions of MATLAB are used to calculate the effective neutron multiplication factor through the application of the prompt decay fitting or the area method to the neutron count distribution. If the subcritical assembly is driven by a spontaneous fission neutron source, then the effective multiplication factor can be evaluated either using the prompt neutron decay constant obtained from Rossi or Feynman distributions or the Modified Source Multiplication (MSM) method.

  14. Report on the workshop "Decay spectroscopy at CARIBU: advanced fuel cycle applications, nuclear structure and astrophysics". 14-16 April 2011, Argonne National Laboratory, USA.

    Energy Technology Data Exchange (ETDEWEB)

    Kondev, F.; Carpenter, M.P.; Chowdhury, P.; Clark, J.A.; Lister, C.J.; Nichols, A.L.; Swewryniak, D. (Nuclear Engineering Division); (Univ. of Massachusetts); (Univ. of Surrey)

    2011-10-06

    A workshop on 'Decay Spectroscopy at CARIBU: Advanced Fuel Cycle Applications, Nuclear Structure and Astrophysics' will be held at Argonne National Laboratory on April 14-16, 2011. The aim of the workshop is to discuss opportunities for decay studies at the Californium Rare Isotope Breeder Upgrade (CARIBU) of the ATLAS facility with emphasis on advanced fuel cycle (AFC) applications, nuclear structure and astrophysics research. The workshop will consist of review and contributed talks. Presentations by members of the local groups, outlining the status of relevant in-house projects and availabile equipment, will also be organized. time will also be set aside to discuss and develop working collaborations for future decay studies at CARIBU. Topics of interest include: (1) Decay data of relevance to AFC applications with emphasis on reactor decay heat; (2) Discrete high-resolution gamma-ray spectroscopy following radioactive decya and related topics; (3) Calorimetric studies of neutron-rich fission framgents using Total ABsorption Gamma-Ray Spectrometry (TAGS) technique; (4) Beta-delayed neutron emissions and related topics; and (5) Decay data needs for nuclear astrophysics.

  15. The cross sections of fusion-evaporation reactions: the most promising route to superheavy elements beyond Z=118

    Directory of Open Access Journals (Sweden)

    Jadambaa Khuyagbaatar

    2017-01-01

    Full Text Available The synthesis of superheavy elements beyond oganesson (Og, which has atomic number Z = 118, is currently one of the main topics in nuclear physics. An absence of sufficient amounts of target material with atomic numbers heavier than californium (Z = 98 forces the use of projectiles heavier than 48Ca (Z = 20, which has been successfully used for the discoveries of elements with Z = 114 - 118 in complete fusion reactions. Experimental cross sections of 48Ca with actinide targets behave very differently to “cold” and “hot” fusion-evaporation reactions, where doubly-magic lead and deformed actinides are used as targets, respectively. The known cross sections of these reactions have been analysed compared to calculated fission barriers. It has been suggested that observed discrepancies between the cross sections of 48Ca-induced and other fusionevaporation reactions originate from the shell structure of the compound nucleus, which lies in the island of the stability. Besides scarcely known data on other reactions involving heavier projectiles, the most promising projectile for the synthesis of the elements beyond Og seems to be 50Ti. However, detailed studies of 50Ti, 54Cr, 58Fe and 64Ni-induced reactions are necessary to be performed in order to fully understand the complexities of superheavy element formation.

  16. Exxon Valdez to Deepwater Horizon: comparable toxicity of both crude oils to fish early life stages.

    Science.gov (United States)

    Incardona, John P; Swarts, Tanya L; Edmunds, Richard C; Linbo, Tiffany L; Aquilina-Beck, Allisan; Sloan, Catherine A; Gardner, Luke D; Block, Barbara A; Scholz, Nathaniel L

    2013-10-15

    The 2010 Deepwater Horizon disaster in the Gulf of Mexico was the largest oil spill in United States history. Crude oils are highly toxic to developing fish embryos, and many pelagic fish species were spawning in the northern Gulf in the months before containment of the damaged Mississippi Canyon 252 (MC252) wellhead (April-July). The largest prior U.S. spill was the 1989 grounding of the Exxon Valdez that released 11 million gallons of Alaska North Slope crude oil (ANSCO) into Prince William Sound. Numerous studies in the aftermath of the Exxon Valdez spill defined a conventional crude oil injury phenotype in fish early life stages, mediated primarily by toxicity to the developing heart. To determine whether this type of injury extends to fishes exposed to crude oil from the Deepwater Horizon - MC252 incident, we used zebrafish to compare the embryotoxicity of ANSCO alongside unweathered and weathered MC252 oil. We also developed a standardized protocol for generating dispersed oil water-accommodated fractions containing microdroplets of crude oil in the size range of those detected in subsurface plumes in the Gulf. We show here that MC252 oil and ANSCO cause similar cardiotoxicity and photo-induced toxicity in zebrafish embryos. Morphological defects and patterns of cytochrome P450 induction were largely indistinguishable and generally correlated with polycyclic aromatic compound (PAC) composition of each oil type. Analyses of embryos exposed during different developmental windows provided additional insight into mechanisms of crude oil cardiotoxicity. These findings indicate that the impacts of MC252 crude oil on fish embryos and larvae are consistent with the canonical ANSCO cardiac injury phenotype. For those marine fish species that spawned in the northern Gulf of Mexico during and after the Deepwater Horizon incident, the established literature can therefore inform the assessment of natural resource injury in the form of potential year-class losses

  17. A Methodology for the Analysis of Programmer Productivity and Effort Estimation within the Framework of Software Conversion.

    Science.gov (United States)

    1984-05-01

    00143*STLOC 104 Therefore, the total effort hours( EGEA ) were computed as follows: EGEA = (0.00351*STLOC + .00143*STLOC)*8 E = 0395*STLOC GEA * This...EHS =0.0853*STLOC+25.2*P EGEA =0.0395*STLOC+25.2*P Ew =24.06STLOC 0 .4 7 EBF =0.0835*STLOC 0 .98 Table 11. Validation/Accuracy Measures of Basic Models...2 Average Average Pred. Model RPred Squared Pred. Error Error(Hours) EFCSC 0.440 729236 680.72 EHS 0.841 207681 99.18 EGEA 0.538 602174 607.30 Ew

  18. Las penas privativas de libertad: sistemas de cumplimiento

    OpenAIRE

    Ramón Martín, Aitana

    2008-01-01

    Contiene actividades de discusión sobre: a) Fines, naturaleza y justificación de la pena de prisión. b) Significado y aplicación del principio de resolucialización (art. 25.2 CE) Referencias bibliográficas. Evolución histórica de los sistemas penitenciarios y de la normativa penitenciaria en España. Actividades relacionadas con los fines, naturaleza y justificación de la pena de prisión y el significado del principio de resocialización previsto en el art. 25.2 CE.

  19. Applicability of Superconducting Interconnection Technology for High Speed ICs and Systems

    Science.gov (United States)

    1992-10-01

    and Van Duyer, "Fields and Waves in Communications Electronics", John Wiley & Sons, New York 1965, pp. 249-252, 286-293 and 444-446. 2. Fred E. Gardiol...Electronics", John Wiley & Sons, New York 1965, pp. 249-252, 286-293 and 444-446. 2. Fred E. Gardiol, "Lossy Transmission Lines", Artech House, Inc...program "HiQ" from Bimillennium Corp., 101 Albright Way, Los Gatos, CA 95030, (800) 488-8662, running on either a Mackintosh Ifx or a Powerbook 170 was used

  20. Behavior or Nonmetallic Materials in Shale Oil Derived Jet Fuels and in High Aromatic and High Sulfur Petroleum Fuels

    Science.gov (United States)

    1978-07-01

    MATERIAL FUEL (pSi) (MPa) (% Coh) EC-2216 None (controls) 1600 11.0 Base JP-4, .1% sulfur 1710 11.9 40 + 25% arom . , 1% sulfur 1040* 7.2 15 + 35% arom ...1% sulfur ** ** + 45% arom . , 1% sulfur ** ** Synthetic JP-4 1310 9.0 35 Synthetic JET-A 1030 7.1 10 FM-47 None (Controls) 4250 29.3 100 Base JP-4...1% sulfur 3660 25.2 100 + 25% arom .-, 1% sulfur 3490 24.1 100 + 35% arom .-, 1% sulfur 3630 25.0 100 + 45% atom.-, 1% sulfur 3660 25.2 95 Synthetic JP