
Sample records for cadmium 123

  1. Syntheses, Structures, and Characterization of Two Novel Copper(II) and Cadmium(II) Compounds Based on Pyridyl Conjugated 1,2,3-Triazole

    Energy Technology Data Exchange (ETDEWEB)

    Hong, Jinlong; Wang, Gaigai; Zhao, Hong [Southeast Univ., Nanjing (Korea, Republic of); Qu, Zhirong; Ma Huajun [Hangzhou Normal Univ., Hangzhou (China)


    Two new complexes with 5-methyl-1-(pyridine-3-yl)-1H-1,2,3-triazole-4-carboxylic acid ligand: [Cd(mptc){sub 2}(H{sub 2}O){sub 4}] and [Cu(mptc){sub 4}·2H{sub 2}O]{sub n} were prepared and their crystal structures were determined by single crystal X-ray diffraction analyses. In complex, the Cd(II) ions coordinates with the pyridyl nitrogen atom from the ligand, forming a mononuclear Cd(II) compound. Complex exhibits a novel two-dimensional (2D) polymer in which four ligands stabilize the Cu(II) atom. And the coordination involves one nitrogen atom of the triazole, one oxygen atom of the carboxylic acid and the pyridyl nitrogen atom. In addition, FT-IR and solid-state fluorescent emission spectroscopy of two compounds have been determined.

  2. Cadmium carcinogenesis

    International Nuclear Information System (INIS)

    Cadmium is a heavy metal of considerable environmental and occupational concern. Cadmium compounds are classified as human carcinogens by several regulatory agencies. The most convincing data that cadmium is carcinogenic in humans comes from studies indicating occupational cadmium exposure is associated with lung cancer. Cadmium exposure has also been linked to human prostate and renal cancer, although this linkage is weaker than for lung cancer. Other target sites of cadmium carcinogenesis in humans, such as liver, pancreas and stomach, are considered equivocal. In animals, cadmium effectively induces cancers at multiple sites and by various routes. Cadmium inhalation in rats induces pulmonary adenocarcinomas, in accord with its role in human lung cancer. Cadmium can induce tumors and/or preneoplastic lesions within the rat prostate after ingestion or injection. At relatively high doses, cadmium induces benign testicular tumors in rats, but these appear to be due to early toxic lesions and loss of testicular function, rather than from a specific carcinogenic effect of cadmium. Like many other metals, cadmium salts will induce mesenchymal tumors at the site of subcutaneous (s.c.) or intramuscular (i.m.) injections, but the human relevance of these is dubious. Other targets of cadmium in rodents include the liver, adrenal, pancreas, pituitary, and hematopoietic system. With the exception of testicular tumors in rodents, the mechanisms of cadmium carcinogenesis are poorly defined. Cadmium can cause any number of molecular lesions that would be relevant to oncogenesis in various cellular model systems. Most studies indicate cadmium is poorly mutagenic and probably acts through indirect or epigenetic mechanisms, potentially including aberrant activation of oncogenes and suppression of apoptosis

  3. Cadmium toxicity and treatment. (United States)

    Bernhoft, Robin A


    Cadmium is a heavy metal of considerable toxicity with destructive impact on most organ systems. It is widely distributed in humans, the chief sources of contamination being cigarette smoke, welding, and contaminated food and beverages. Toxic impacts are discussed and appear to be proportional to body burden of cadmium. Detoxification of cadmium with EDTA and other chelators is possible and has been shown to be therapeutically beneficial in humans and animals when done using established protocols.

  4. Cadmium Toxicity and Treatment

    Directory of Open Access Journals (Sweden)

    Robin A. Bernhoft


    Full Text Available Cadmium is a heavy metal of considerable toxicity with destructive impact on most organ systems. It is widely distributed in humans, the chief sources of contamination being cigarette smoke, welding, and contaminated food and beverages. Toxic impacts are discussed and appear to be proportional to body burden of cadmium. Detoxification of cadmium with EDTA and other chelators is possible and has been shown to be therapeutically beneficial in humans and animals when done using established protocols.

  5. Cadmium Toxicity and Treatment


    Bernhoft, Robin A.


    Cadmium is a heavy metal of considerable toxicity with destructive impact on most organ systems. It is widely distributed in humans, the chief sources of contamination being cigarette smoke, welding, and contaminated food and beverages. Toxic impacts are discussed and appear to be proportional to body burden of cadmium. Detoxification of cadmium with EDTA and other chelators is possible and has been shown to be therapeutically beneficial in humans and animals when done using established proto...

  6. Prediction of cadmium concentration in selected home-produced vegetables. (United States)

    Bešter, Petra Karo; Lobnik, Franc; Eržen, Ivan; Kastelec, Damijana; Zupan, Marko


    Soil contaminated with cadmium presents a potential hazard for humans, animals and plants. The latter play a major role in the transfer of cadmium to the food chain. The uptake of cadmium and its accumulation by plants is dependent on various soil, plants and environmental factors. In order to identify soil properties with statistically significant influence on cadmium concentration in vegetables and to reduce the collection of data, time and costs, regression models can be applied. The main objective of this research was to develop regression models to predict the concentration of cadmium in 9-vegetable species: zucchini, tomato, cabbage, onion, potato, carrot, red beet, endive and chicory, based on soil properties. Soil samples were collected from 123 home gardens of the Municipality of Celje and 59 of these gardens were also included in vegetable sampling. The concentration of elements (e.g. arsenic, cadmium, copper, lead, and zinc) in the samples was determined by Inductively Coupled Plasma Mass Spectrometry. Single (for cabbage, potato, red beet and chicory) and multiple (for tomato, onion, carrot and endive) linear regression models were developed. There was no statistically significant regression model for zucchini. The most significant parameter for the influencing the cadmium concentration in vegetables was the concentration of cadmium in soil. Other important soil properties were the content of organic matter, pH-value and the concentration of manganese. It was concluded that consuming carrots, red beets, endives, onions, potatoes and chicory which are grown in gardens with Cd concentrations (mgkg(-1) DW) above 2.4, 3.2, 6.3, 7.9, 8.3 and 10.9, respectively, might represent an important contribution to dietary Cd exposure. PMID:23886800

  7. Production and quality control of iodine-123

    International Nuclear Information System (INIS)

    The various methods for production and quality control are discussed. The author feels the 123Xe-123I generator is the best method of production. Preparation and use of 123I-labeled compounds are also considered

  8. Zinc and cadmium monosalicylates

    Energy Technology Data Exchange (ETDEWEB)

    Kharitonov, Yu.Ya.; Tujebakhova, Z.K. (Moskovskij Khimiko-Tekhnologicheskij Inst. (USSR))


    Zinc and cadmium monosalicylates of the composition MSal, where M-Zn or Cd, Sal - twice deprotonated residue of salicylic acid O-HOC/sub 6/H/sub 4/COOH (H/sub 2/Sal), are singled out and characterized. When studying thermograms, thermogravigrams, IR absorption spectra, roentgenograms of cadmium salicylate compounds (Cd(OC/sub 6/H/sub 4/COO) and products of their thermal transformations, the processes of thermal decomposition of the compounds have been characterized. The process of cadmium monosalicylate decomposition takes place in one stage. Complete loss of salicylate acido group occurs in the range of 320-460 deg. At this decomposition stage cadmium oxide is formed. A supposition is made that cadmium complex has tetrahedral configuration, at that, each salicylate group plays the role of tetradentate-bridge ligand. The compound evidently has a polymer structure.

  9. Cadmium status in Egypt

    Institute of Scientific and Technical Information of China (English)


    It is inferred from these studies that releases of Cd are still increasing and it is recommended that measures must be taken to reduce emissions of cadmium. Any cadmium discharged into the Egyptian environment may move from one compartment to another at varying rates,resulting in an accumulation in compartments such as soils and biota. Such accumulation can be expected to increase with continued emissions,and attention should be given to all sources of cadmium, natural as well as anthropogenic especially in the industrial cities in Egypt. Cadmium present in sewage, as well as industrial effluent (also, other liquid and solid wastes) and sewage sludge will increase levels in soils and is xpected to contribute to dietary levels and body burdens. The current information indicates that such effects may have to be evaluated over long periods of time, possibly as long as 50 - 100 years.

  10. Excitation of the reaction of 123I, 123Xe and 123Cs radionuclides production

    International Nuclear Information System (INIS)

    The results of calculations of charged particle induced reactions for the production of radioisotopes 123I, 123Cs, 123Xe are discussed. The excitation functions for reactions 124Xe(p,2n), 124Xe(d,3n), 124Xe(p,pn+np), 127I(p,5n), 124Xe(d,p2n), 123Te(p,n), 124Te(p,2n), 121Sb(α,2n)123I are calculated on the base of statistical model in energy range up to 80 MeV. The agreement between the calculations and experiment is reasonable as a rule. It is shown, that taking account of the radiative channel is very important near threshold, particularly for neutron deficient nuclei. The analysis performed showed that the calculations with code ALICE can serve as a reasonable evaluation for the excitation functions of various reactions, if they are tested by experiment and by comparison of relevant computer codes. 55 refs.; 9 figs.; 10 tabs

  11. Plausible Mechanisms of Cadmium Carcinogenesis (United States)

    Cadmium is a transition metal and an ubiquitous environmental and industrial pollutant. Laboratory animal studies and epidemiological studies have shown that exposure to cadmium is associated with various organ toxicities and carcinogenic effects. Several national and internation...

  12. Cadmium absorption inhibitors for soil

    Energy Technology Data Exchange (ETDEWEB)

    Kitamura, S.


    Cadmium absorption by soil is one cause of soil pollution. Cadmium adsorption inhibitors were prepared by mixing alginic acid which contained brown algae (Ascophyllum nodosum) and an inorganic material, shell fossils. This mixture was highly effective in preventing cadmium absorption by the soil.

  13. Dietary cadmium intake and breast cancer risk in Japanese women: a case-control study. (United States)

    Itoh, Hiroaki; Iwasaki, Motoki; Sawada, Norie; Takachi, Ribeka; Kasuga, Yoshio; Yokoyama, Shiro; Onuma, Hiroshi; Nishimura, Hideki; Kusama, Ritsu; Yokoyama, Kazuhito; Tsugane, Shoichiro


    Cadmium, an environmental pollutant, may act like an estrogen and be a potential risk factor for estrogen-dependent diseases such as breast cancer. We examined the hypothesis that higher dietary cadmium intake is associated with risk of overall and hormone receptor-defined breast cancer in Japanese women, a population with a relatively high cadmium intake. The study was conducted under a case-control design in 405 eligible matched pairs from May 2001 to September 2005 at four hospitals in Nagano Prefecture, Japan. Dietary cadmium intake was estimated using a food frequency questionnaire. Multivariable-adjusted odds ratios (ORs) and 95% confidence intervals (CIs) of breast cancer and its hormone-receptor-defined subtypes were calculated by tertile of dietary cadmium intake. We found no significant association between dietary cadmium and risk of total breast cancer in either crude or multivariable-adjusted analysis. Adjusted ORs for tertiles of cadmium intake were 1.00, 1.19, and 1.23 (95% CI, 0.76-2.00; P for trend=0.39) for whole breast cancer. Further, no significant associations were seen across strata of menopausal status, smoking, and diabetes in multivariable-adjusted models except for adjusted OR for continuous cadmium intake in postmenopausal women. A statistically significant association was found for estrogen receptor-positive (ER+) tumors among postmenopausal women (adjusted OR=1.00, 1.16, and 1.94 [95% CI, 1.04-3.63; P for trend=0.032]). Although the present study found no overall association between dietary cadmium intake and breast cancer risk, higher cadmium intake was associated with increased risk of ER+ breast cancer in postmenopausal women, at least at regular intake levels in Japanese women in the general population. Further studies are needed to confirm this association. PMID:23608001

  14. Collinear laser spectroscopy of atomic cadmium

    CERN Document Server

    Frömmgen, Nadja; Bissell, Mark L; Bieroń, Jacek; Blaum, Klaus; Cheal, Bradley; Flanagan, Kieran; Fritzsche, Stephan; Geppert, Christopher; Hammen, Michael; Kowalska, Magdalena; Kreim, Kim; Krieger, Andreas; Neugart, Rainer; Neyens, Gerda; Rajabali, Mustafa M; Nörtershäuser, Wilfried; Papuga, Jasna; Yordanov, Deyan T


    Hyperfine structure $A$ and $B$ factors of the atomic $5s\\,5p\\,\\; ^3\\rm{P}_2 \\rightarrow 5s\\,6s\\,\\; ^3\\rm{S}_1$ transition are determined from collinear laser spectroscopy data of $^{107-123}$Cd and $^{111m-123m}$Cd. Nuclear magnetic moments and electric quadrupole moments are extracted using reference dipole moments and calculated electric field gradients, respectively. The hyperfine structure anomaly for isotopes with $s_{1/2}$ and $d_{5/2}$ nuclear ground states and isomeric $h_{11/2}$ states is evaluated and a linear relationship is observed for all nuclear states except $s_{1/2}$. This corresponds to the Moskowitz-Lombardi rule that was established in the mercury region of the nuclear chart but in the case of cadmium the slope is distinctively smaller than for mercury. In total four atomic and ionic levels were analyzed and all of them exhibit a similar behaviour. The electric field gradient for the atomic $5s\\,5p\\,\\; ^3\\mathrm{P}_2$ level is derived from multi-configuration Dirac-Hartree-Fock calculatio...

  15. 29 CFR 570.123 - Agriculture. (United States)


    ... 29 Labor 3 2010-07-01 2010-07-01 false Agriculture. 570.123 Section 570.123 Labor Regulations... Provisions of the Fair Labor Standards Act of 1938, as Amended Exemptions § 570.123 Agriculture. (a) Section... agriculture outside of school hours for the school district where such employee is living while he is...

  16. 10 CFR 71.123 - Test control. (United States)


    ... 10 Energy 2 2010-01-01 2010-01-01 false Test control. 71.123 Section 71.123 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) PACKAGING AND TRANSPORTATION OF RADIOACTIVE MATERIAL Quality Assurance § 71.123 Test control. The licensee, certificate holder, and applicant for a CoC shall establish a...

  17. 21 CFR 123.10 - Training. (United States)


    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Training. 123.10 Section 123.10 Food and Drugs... CONSUMPTION FISH AND FISHERY PRODUCTS General Provisions § 123.10 Training. At a minimum, the following functions shall be performed by an individual who has successfully completed training in the application...

  18. 40 CFR 123.61 - Approval process. (United States)


    ... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Approval process. 123.61 Section 123... REQUIREMENTS Program Approval, Revision, and Withdrawal § 123.61 Approval process. (a) After determining that a...; and (6) Briefly outline the fundamental aspects of the State's proposed program, and the process...

  19. Industrial system for producing iodine-123

    International Nuclear Information System (INIS)

    An industrial system to produce iodine-123 required a complex set of steps involving new approaches by the Food and Drug Administration, difficult distribution procedures, and evidence from potential users that either very pure iodine-123 or inexpensive iodine-123 is needed. Industry has shown its willingness to invest in new radionuclides but needs strong evidence as to product potential to justify those investments

  20. 7 CFR 3015.123 - Suspension. (United States)


    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Suspension. 3015.123 Section 3015.123 Agriculture... AGRICULTURE UNIFORM FEDERAL ASSISTANCE REGULATIONS Grant and Subgrant Closeout, Suspension and Termination § 3015.123 Suspension. (a) When a recipient has materially failed to comply with the...

  1. 19 CFR 123.0 - Scope. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Scope. 123.0 Section 123.0 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO § 123.0 Scope. This part contains special regulations pertaining to Customs procedures at the Canadian and...

  2. 19 CFR 123.32 - Manifests. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Manifests. 123.32 Section 123.32 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Shipments in Transit Through the United States § 123.32 Manifests. (a) Form and number of copies required....

  3. 7 CFR 1260.123 - Research. (United States)


    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Research. 1260.123 Section 1260.123 Agriculture... AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE BEEF PROMOTION AND RESEARCH Beef Promotion and Research Order Definitions § 1260.123 Research. Research means studies relative to...

  4. 21 CFR 163.123 - Sweet chocolate. (United States)


    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Sweet chocolate. 163.123 Section 163.123 Food and... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.123 Sweet chocolate. (a) Description. (1) Sweet chocolate is the solid or semiplastic food prepared by intimately mixing and...

  5. 49 CFR 213.123 - Tie plates. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Tie plates. 213.123 Section 213.123 Transportation... TRANSPORTATION TRACK SAFETY STANDARDS Track Structure § 213.123 Tie plates. (a) In Classes 3 through 5 track where timber crossties are in use there shall be tie plates under the running rails on at least eight...

  6. 10 CFR 76.123 - Tests. (United States)


    ... 10 Energy 2 2010-01-01 2010-01-01 false Tests. 76.123 Section 76.123 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) CERTIFICATION OF GASEOUS DIFFUSION PLANTS Reports and Inspections § 76.123 Tests. The Corporation shall perform, or permit the Commission to perform, any tests the Commission deems appropriate or necessary for administration...

  7. Iodine-123 in Western Europe

    International Nuclear Information System (INIS)

    The major object of this panel was to obtain information on the state of art of Iodine-123 production in Western Europe. Technical, medical and organizational problems were discussed extensively during the one-day meeting and a stimulating exchange of information between the various 123I-producers and users has been initiated. Some specific examples of medical application were also included in order to get a feeling of the degree of acceptance by the medical community and the demand for this isotope. The meeting clearly demonstrated the great demand for this isotope but it also showed that the present rate of production is well below the demand. In order to fill this gap, not only further technical development is needed but also the organizational question of distribution has to be solved, perhaps within a network of collaborating cyclotrons, a task which is considerably more difficult in Western Europe than in the USA. (orig./HP)

  8. Cadmium in Sweden - environmental risks

    Energy Technology Data Exchange (ETDEWEB)

    Parkman, H.; Iverfeldt, Aa. [Swedish Environmental Research Inst. (Sweden); Borg, H.; Lithner, G. [Stockholm Univ. (Sweden). Inst. for Applied Environmental Research


    This report aims at assessing possible effects of cadmium in the Swedish environment. Swedish soils and soft freshwater systems are, due to a generally poor buffering capacity, severely affected by acidification. In addition, the low salinity in the Baltic Sea imply a naturally poor organism structure, with some important organisms living close to their limit of physiological tolerance. Cadmium in soils is mobilized at low pH, and the availability and toxicity of cadmium in marine systems are enhanced at low salinity. The Swedish environment is therefore extra vulnerable to cadmium pollution. The average concentrations of cadmium in the forest mor layers, agricultural soils, and fresh-waters in Sweden are enhanced compared to `back-ground concentrations`, with a general increasing trend from the north to the south-west, indicating strong impact of atmospheric deposition of cadmium originating from the central parts of Europe. In Swedish sea water, total cadmium concentrations, and the fraction of bio-available `free` cadmium, generally increases with decreasing salinity. Decreased emissions of cadmium to the environment have led to decreasing atmospheric deposition during the last decade. The net accumulation of cadmium in the forest mor layer has stopped, and even started to decrease. In northern Sweden, this is due to the decreased deposition, but in southern Sweden the main reason is increased leakage of cadmium from the topsoil as a consequence of acidification. As a result, cadmium in the Swedish environments is undergoing an extended redistribution between different soil compartments, and from the soils to the aquatic systems. 90 refs, 23 figs, 2 tabs. With 3 page summary in Swedish


    Directory of Open Access Journals (Sweden)

    Henryka Langauer-Lewowicka


    Full Text Available The paper presents some information about current status of cadmium as an environmental health problem. Agricultural uses of phosphate fertilizers, sewage sludge and industrial uses of Cd are the major source of widespread of this metal at trace levels into the general environment and human foodstuffs. It is well known that high cadmium (Cd exposure causes renal damage, anemia, enteropathy, osteoporosis, osteomalacia, whereas the dose-response relationship at low levels exposure is less established. During the last decade an increasing number of studies have found an adverse health effects due to low environmental exposure to Cd. Many authors try to determine the relationship between Cd intake and Cd toxicity indicators, especially dealing renal tubular damage. The level of b2-microglobulin in urine is regarded as the most sensitive biomarker of renal disfunction due to low environmental Cd concentrations.

  10. Cadmium sulfite hexahydrate revisited

    Directory of Open Access Journals (Sweden)

    Sergio Baggio


    Full Text Available The present structural revision of the title compound, tetracadmium tetrasulfite hexahydrate, [Cd4(SO34(H2O5]·H2O, is a low-temperature upgrade (T = 100 K and R = 0.017 of the original room-temperature structure reported by Kiers & Vos [Cryst. Struct. Commun. (1978. 7, 399–403; T = 293 K and R = 0.080. The compound is a three-dimensional polymer with four independent cadmium centres, four sulfite anions and six water molecules, five of them coordinated to two cadmium centres and the remaining one an unbound solvent molecule which completes the asymmetric unit. There are two types of cadmium environment: CdO8 (through four chelating sulfite ligands and CdO6 (by way of six monocoordinated ligands. The former groups form planar arrays [parallel to (001 and separated by half a unit cell translation along c], made up of chains running along [110] and [overline{1}10], respectively. These chains are, in turn, interconnected both in an intraplanar as well as in an interplanar fashion by the latter CdO6 polyhedra into a tight three-dimensional framework. There is, in addition, an extensive network of hydrogen bonds, in which all 12 water H atoms act as donors and eight O atoms from all four sulfite groups and two water molecules act as acceptors.

  11. Cadmium in blood and hypertension

    Energy Technology Data Exchange (ETDEWEB)

    Eum, Ki-Do; Lee, Mi-Sun [Department of Environmental Health, Graduate School of Public Health and Institute of Health and Environment, Seoul National University, Seoul (Korea, Republic of); Paek, Domyung [Department of Environmental Health, Graduate School of Public Health and Institute of Health and Environment, Seoul National University, Seoul (Korea, Republic of)], E-mail:


    Objectives:: This study is to examine the effect of cadmium exposure on blood pressure in Korean general population. Methods:: The study population consisted of 958 men and 944 women who participated in the 2005 Korean National Health and Nutrition Examination Survey (KNHANES), in which blood pressure and blood cadmium were measured from each participant. Results:: The mean blood cadmium level was 1.67 {mu}g/L (median level 1.55). The prevalence of hypertension was 26.2%. The blood cadmium level was significantly higher among those subjects with hypertension than those without (mean level 1.77 versus 1.64 {mu}g/dL). After adjusting for covariates, the odds ratio of hypertension comparing the highest to the lowest tertile of cadmium in blood was 1.51 (95% confidence interval 1.13 to 2.05), and a dose-response relationship was observed. Systolic, diastolic, and mean arterial blood pressure were all positively associated with blood cadmium level, and this effect of cadmium on blood pressure was markedly stronger when the kidney function was reduced. Conclusions:: Cadmium exposures at the current level may have increased the blood pressure of Korean general population.

  12. Projectbeschrijving Cadmium-informatiepunt (CIP)

    NARCIS (Netherlands)

    Meijer PJ


    To minimize the use of cadmium the Central Government has decided to perform the purchase of products and materials within the Central Government as much as possible within the Draft Cadmium Decree. The activities to achieve this are as far as could be seen at the start of the project in june 19

  13. Projectbeschrijving Cadmium-informatiepunt (CIP)


    Meijer PJ


    To minimize the use of cadmium the Central Government has decided to perform the purchase of products and materials within the Central Government as much as possible within the Draft Cadmium Decree. The activities to achieve this are as far as could be seen at the start of the project in june 1989, mentioned in this report.

  14. 29 CFR 1926.1127 - Cadmium. (United States)


    ... containment of cadmium or materials containing cadmium on the site or location at which construction...) SAFETY AND HEALTH REGULATIONS FOR CONSTRUCTION Toxic and Hazardous Substances § 1926.1127 Cadmium. (a... forms, in all construction work where an employee may potentially be exposed to cadmium....

  15. Cadmium exposure in the Swedish environment

    Energy Technology Data Exchange (ETDEWEB)



    This report gives a thorough description of cadmium in the Swedish environment. It comprises three parts: Cadmium in Sweden - environmental risks;, Cadmium in goods - contribution to environmental exposure;, and Cadmium in fertilizers, soil, crops and foods - the Swedish situation. Separate abstracts have been prepared for all three parts

  16. 27 CFR 28.123 - Export marks. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Export marks. 28.123..., or Transportation to a Manufacturing Bonded Warehouse § 28.123 Export marks. (a) General. In addition... filled under the provisions of part 24 of this chapter, the proprietor shall mark the word “Export”...

  17. 40 CFR 164.123 - Emergency order. (United States)


    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Emergency order. 164.123 Section 164.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS RULES OF PRACTICE GOVERNING HEARINGS, UNDER THE FEDERAL INSECTICIDE, FUNGICIDE, AND RODENTICIDE ACT, ARISING...

  18. 36 CFR 12.3 - Definitions. (United States)


    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Definitions. 12.3 Section 12.3 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR NATIONAL... headstone placed in a memorial section of a national cemetery with the words “In Memory Of” inscribed...

  19. 13 CFR 123.500 - Definitions. (United States)


    ... a small business) whose managerial or technical expertise is critical to the successful day-to-day... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Definitions. 123.500 Section 123.500 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION DISASTER LOAN PROGRAM...

  20. 40 CFR 123.22 - Program description. (United States)


    ... employees. The State need not submit complete job descriptions for every employee carrying out the State... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Program description. 123.22 Section... PROGRAM REQUIREMENTS State Program Submissions § 123.22 Program description. Any State that seeks...

  1. 19 CFR 123.33 - [Reserved (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false 123.33 Section 123.33 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Shipments in Transit Through the United States §...

  2. 29 CFR 1952.123 - Developmental schedule. (United States)


    ... 29 Labor 9 2010-07-01 2010-07-01 false Developmental schedule. 1952.123 Section 1952.123 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR... schedule. The Washington State plan is developmental. The following is the developmental schedule...

  3. Cadmium in newborns


    Eklund, Gunilla


    Cadmium (Cd) is a well-known nephrotoxic environmental contaminant but there are indications that the developing nervous system might be even more sensitive to Cd than the kidneys in adults. Infants are exposed to Cd from various formulas and infant diets and the gastrointestinal Cd uptake is believed to be higher in newborns than in adults. Cd levels monitored in infant foods ranged between 0.74 and 27.0 µg/kg. Cow's milk formulas had the lowest levels and cereal-based formulas had up to 21 ...

  4. N-isopropyl-p-[I[sup 123

    Energy Technology Data Exchange (ETDEWEB)

    Tada, Hiroshi; Morooka, Keiichi; Arimoto, Kiyoshi; Matsuo, Takiko; Takagi, Kazue; Yanagawa, Etsuko (Toho Univ., Tokyo (Japan). School of Medicine)


    We studied the clinical usefulness of I[sup 123]-IMP SPECT in 50 pediatric patients with CNS disorders, which were categorized into the convulsive disorder group (n=20), the cerebrovascular disorder group (n=10), the acute encephalopathy or CNS infection group (n=10), the metabolic or degenerative disorder group (n=6), the congenital abnormality group (n=2) and the migraine group (n=2). The findings obtained were compared with those of cranial CT. I[sup 123]-IMP SPECT revealed abnormal findings in 45 out of the 50 patients (90%), although cranial CT showed abnormal findings in only 24 patients (48%). This difference was statistically significant (p<0.01). In all groups except the migraine, we could find abnormal findings in more than 90% of the patients. Out of 28 patients without focal findings on the initial CT scanning. I[sup 123]-IMP SPECT showed focal abnormalities in 26 patients (93%). Moreover in many patients with focal neurological abnormalities, we found focal abnormalities of I[sup 123]-IMP SPECT related with neurological abnormalities of the patients. From these findings, we think I[sup 123]-IMP SPECT might be superior to CT scanning in examining a localized lesion. It was found that in many patients with focal abnormalities in CT scanning, I[sup 123]-IMP SPECT showed larger abnormalities in CT scanning. By using I[sup 123]-IMP SPECT we might be able to study the blood perfusional state surrounding the abnormal area shown by CT. In 3 patients with acute cerebrovascular disorders, I[sup 123]-IMP SPECT revealed abnormal findings 3 to 11 days earlier than cranial CT. I[sup 123]-IMP SPECT might be useful for early recognition of the pathological state. From these experiences, we concluded that I[sup 123]-IMP SPECT was useful for studying the pathophysiology of CNS disorders in children. (author).

  5. Cadmium immobilization by hydroxyapatite

    Directory of Open Access Journals (Sweden)

    Smičiklas Ivana D.


    Full Text Available The contamination of air, soil and water by cadmium is a great environmental problem. If cadmium occurs in nature in ionic form, soluble in water, it easily enters into the food chain. Hydroxyapatite (HAP, Ca-o(POAe(OH2 is a sparingly soluble salt and an excellent matrix for the removal of heavy metals from solutions. Considerable research attention has been paid to the bond between Cc/2+ ions and synthetic hydroxyapatite of known composition. The sorption mechanism is complex. The dominant process is ion exchange, but surface adsorption, surface complexation and coprecipitation can also contribute to the overall mechanism. The sorption capacity depends on the characteristics of hydroxyapatite itself and on the experimental conditions. Under optimum conditions a maximum capacity of 0.8 mol Cd2+/mol HAP can be achieved. HAP is a potential sorbent for the remediation of contaminated water and soil, for industrial waste treatment, and it is also referenced as a material that can be used as a barrier around waste depositories.

  6. Cyclotron production of high-purity 123I for medical applications via the 127I(p,5n)123Xe → 123I nuclear reaction

    International Nuclear Information System (INIS)

    The use of iodine-123 in nuclear medicine procedures is well documented in the scientific literature. Also, several methods for its production based on accelerator techniques have been described. Indirectly made 123I via the 127I(p,5n)123Xe → 123I reaction produces 123I of > 99.9% radionuclidic purity, with only 125I (123I production were developed at the University of California at Davis, where since 1974 the 76-in. isochronous cyclotron of the Crocker Nuclear Laboratory has been used for routine biweekly production of high-purity no-carrier-added 123I

  7. Dicty_cDB: SSK123 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSK123 (Link to dictyBase) - G21103 DDB0234056 Contig-U13955-1 SS...K123Z (Link to Original site) - - SSK123Z 655 - - - - Show SSK123 Library SS (Link to library) Clone ID SS...riginal site URL ...Representative seq. ID SSK123Z (Link to Original site) Representative DNA sequence >SSK123 (SSK123Q) /CSM/SS/SSK1-A/SS...AKKQAEALLVTANAQKKVQEIQGELYSKFPILAEIELAKIKSEALKSST LYITPQDAGNFMNSPFFFMERMLGKQQTNIKS*nisiv*h Translated Amino

  8. Cadmium(2) complexes of cytosine

    International Nuclear Information System (INIS)

    Complexes of cadmium(2) with cytosine obtained from aqueous or physiological solutions at room temperature are reported. The complexes were characterized by spectroscopic, conductometric, 1H-NMR, and 13C-NMR measurements and also by thermogravimetry. (Authors)

  9. Discovery of the Cadmium Isotopes


    Amos, S.; Thoennessen, M


    Thirty-seven cadmium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  10. Cadmium telluride nuclear radiation detectors

    International Nuclear Information System (INIS)

    The characteristics and performance of undoped high resistivity cadmium telluride detectors are compared to chlorine lifted counters. It is shown, in particular, that Undodep CdTe is in fact aluminium doped and that compensation occurs, as an silicon or germanium, by pair and triplet formation between the group III donor and the doubly charged cadmium vacancy acceptor. Furthermore, in chlorine doped samples, the polarization effect results from the unpaired level at Esub(c)-0,6eV

  11. Speciation of Dissolved Cadmium

    DEFF Research Database (Denmark)

    Holm, Peter Engelund; Andersen, Sjur; Christensen, Thomas Højlund


    ) method separates dissolved Cd into free divalent Cd (Cd 2+) and complexed Cd and furthermore separates the latter into the operationally defined forms: labile, slowly labile and stable complexes. The dialysis (ED) method determines high molecular weight Cd complexes (above 1000mol. wt). For both methods...... the reproducibility was good. By combining the results of the GEOCHEM calculations in terms of the inorganic complexes, and the IE results, the fractions of free and inorganically complexed Cd were estimated. The IE and ED results furthermore provided information about the organic complexes. Selected environmental......Equilibrium dialysis and ion exchange methods, as well as computer calculations (GEOCHEM), were applied for speciation of dissolved cadmium (Cd) in test solutions and leachate samples. The leachate samples originated from soil, compost, landfill waste and industrial waste. The ion exchange (IE...

  12. New 1,2,3-Selenadiazole and 1,2,3-Thiadiazole Derivatives

    Directory of Open Access Journals (Sweden)

    Samer Ratrout


    Full Text Available New 1,2,3-thiadiazole and 1,2,3-selenadiazole derivatives, 14-23, were prepared from the ketones 1-5 via the corresponding semicarbazones or hydrazones 6-12. The Hurd-Mori and Lalezari methods were used, respectively, for the preparation of these 1,2,3-thiadiazole and 1,2,3-selenadiazole derivatives. The intermediate 13 was also trapped, separated and fully characterized. These derivatives are important for photocrosslinking processes and due to their potential biological activity.

  13. Zinc-induced protection against cadmium

    Energy Technology Data Exchange (ETDEWEB)

    Early, J.L.; Schnell, R.C.


    Pretreatment of male rats with cadmium acetate potentiates the duration of hexobarbital hypnosis and inhibits the rate of hepatic microsomal drug metabolism. Pretreatment of rats with zinc acetate protects against these alterations in drug action elicited by cadmium.

  14. Bioavailability of cadmium from linseed and cocoa

    DEFF Research Database (Denmark)

    Hansen, Max; Sloth, Jens Jørgen; Rasmussen, Rie Romme

    In Denmark and EU the exposure of cadmium from food is at a level that is relatively close to the Tolerable Daily Intake (TDI). This report describes an investigation of the bioavailability of cadmium in selected food items known to contain high levels of cadmium. The purpose was to provide data ...... or crushed linseed nor the intake of cocoa and chocolate....

  15. Dual radioisotopes simultaneous SPECT of 99mTc-tetrofosmin and 123I-BMIPP using a semiconductor detector


    Yasuyuki Takahashi; Masao Miyagawa; Yoshiko Nishiyama; Naoto Kawaguchi; Hayato Ishimura; Teruhito Mochizuki


    Objective(s): The energy resolution of a cadmium-zinc-telluride (CZT) solid-state semiconductor detector is about 5%, and is superior to the resolution of the conventional Anger type detector which is 10%. Also, the window width of the high-energy part and of the low-energy part of a photo peak window can be changed separately. In this study, we used a semiconductor detector and examined the effects of changing energy window widths for 99mTc and 123 I simultaneous SPECT. ...

  16. Mechanisms of cadmium carcinogenesis

    International Nuclear Information System (INIS)

    Cadmium (Cd), a heavy metal of considerable occupational and environmental concern, has been classified as a human carcinogen by the International Agency for Research on Cancer (IARC). The carcinogenic potential of Cd as well as the mechanisms underlying carcinogenesis following exposure to Cd has been studied using in vitro cell culture and in vivo animal models. Exposure of cells to Cd results in their transformation. Administration of Cd in animals results in tumors of multiple organs/tissues. Also, a causal relationship has been noticed between exposure to Cd and the incidence of lung cancer in human. It has been demonstrated that Cd induces cancer by multiple mechanisms and the most important among them are aberrant gene expression, inhibition of DNA damage repair, induction of oxidative stress, and inhibition of apoptosis. The available evidence indicates that, perhaps, oxidative stress plays a central role in Cd carcinogenesis because of its involvement in Cd-induced aberrant gene expression, inhibition of DNA damage repair, and apoptosis.

  17. Oral cadmium chloride intoxication in mice

    DEFF Research Database (Denmark)

    Andersen, O; Nielsen, J B; Svendsen, P


    Diethyldithiocarbamate (DDC) is known to alleviate acute toxicity due to injection of cadmium salts. However, when cadmium chloride was administered by the oral route, DDC enhanced rather than alleviated the acute toxicity; both oral and intraperitoneal (i.p.) administration of DDC had this effect....... Thus, orally administered DDC enhanced cadmium-induced duodenal and ileal tissue damage and inhibition of peristalsis, as indicated by an increased intestinal transit time. At low cadmium doses, the whole-body retention of cadmium was increased by oral DDC administration. Intraperitoneally administered...

  18. Cadmium telluride module development

    Energy Technology Data Exchange (ETDEWEB)

    Albrigth, S.P.; Chamberlin, R.R.; Jordan, J.F. (Photon Energy, Inc., El Paso, TX (USA))


    Efficiencies of up to 12.3% have been achieved on small devices. It is expected that 14% efficiency will be exceeded on small devices by improving the fill factors on the present devices in the reasonably near future. Efficiencies in the range 16%-18% are expected to be achieved in the longer term. Modules of 6 W, approximately 929 cm{sup 2} in area with an active area efficiency of over 8% (aperture efficiency of 7.3%) have been achieved. The feasibility of producing 4 ft{sup 2} modules of CdS/CdTe has been shown and requires further efforts in order to realize the overall potentials. The structural integrity of the encapsulation design has been studied by thermal cycling and outdoor life testing. Submodules have been life tested for over 270 days with no observable degradation by the SERI Outdoor Reliability and Life Testing Laboratory. In addition to further optimization of materials and device structure, module output in the future will be increased by an improvement in the uniformity of the deposition process, and by minimizing the loss of active area due to cell division interconnections. Module output is expected to attain 135 W m{sup -2} in the mid 1990s and over 150 W m{sup -2} in the long term. (orig.).

  19. Arsenic-cadmium interaction in rats. (United States)

    Díaz-Barriga, F; Llamas, E; Mejía, J J; Carrizales, L; Santoyo, M E; Vega-Vega, L; Yáñez, L


    Simultaneous exposure to cadmium and arsenic is highly probable in the urban area of San Luis Potosi, Mexico due to common localization of copper and zinc smelters. Therefore, in this work, rats were intraperitoneally exposed either to cadmium or arsenic alone, or simultaneously to both metals. The effects of these treatments on three different toxicological parameters were studied. Cadmium modified the LD50 of arsenic and conversely arsenic modified the LD50 for cadmium. At the histopathological level, arsenic appeared to protect against the cadmium effects, especially on testes. This protective effect seemed to be related to the glutathione levels found in this tissue: rats exposed to both arsenic and cadmium, presented glutathione values intermediate to those observed after exposure to either metal alone; arsenic had the highest value and cadmium the lowest. In liver, rats exposed to arsenic, cadmium or arsenic and cadmium, presented glutathione values below those in the saline group, with the lowest value corresponding to the arsenic and cadmium treatment. The results appear to support the proposed interaction between arsenic and cadmium and coexposure to both metals seems to alter certain effects produced by either metal alone. PMID:2219140

  20. Determination of cadmium in biological samples. (United States)

    Klotz, Katrin; Weistenhöfer, Wobbeke; Drexler, Hans


    Analyses of cadmium concentrations in biological material are performed using inductively coupled plasma mass spectrometry (ICP-MS) and atomic absorption spectrometry (AAS), but also electrochemical methods, neutron activation analysis (NAA), and X-ray fluorescence spectrometry (XRF). The predominant sample matrices include blood, plasma, serum, and urine, as well as hair, saliva, and tissue of kidney cortex, lung, and liver. While cadmium in blood reveals rather the recent exposure situation, cadmium in urine reflects the body burden and is an indicator for the cumulative long term exposure.After chronic exposure, cadmium accumulates in the human body and causes kidney diseases, especially lesions of proximal tubular cells. A tubular proteinuria causes an increase in urinary excretion of microproteins. Excretions of retinol binding protein (RBP), β2-microglobulin (β2-M), and α1-microglobulin are validated biomarkers for analyzing cadmium effects. For this purpose, immunological procedures such as ELISA, and radio- and latex-immunoassays are used.However, proteinuria is not specific to cadmium, but can also occur after exposure to other nephrotoxic agents or due to various kidney diseases. In summary, cadmium in urine and blood are the most specific biomarkers of cadmium exposure. A combination of parameters of exposure (cadmium in blood, cadmium in urine) and parameters of effect (e.g., β2-M, RBP) is required to reveal cadmium-induced nephrological effects. PMID:23430771

  1. Iodine-123 program at the TRIUMF laboratory

    International Nuclear Information System (INIS)

    A research program for the production and utilization of iodine-123 is described. From 1979 to 1982 the spallation of elemental cesium by 500-MeV protons was used to provide 100 mCi/hr at the end of bombardment (EOB). Contaminants were 3% iodine-125 and 0.15% tellurium-121 at EOB + 36 hr. The material from weekly runs was used by remote clinics in Canada for evaluation as a radiochemical and for labeling studies. A new facility at TRIUMF will be operational in 1983 to produce iodine-123 by the (p,5n) reaction

  2. Fortsat indikation for jodid-123 ved thyroideaskintigrafi

    DEFF Research Database (Denmark)

    Andersen, Kim Francis; Hendel, Helle Westergren


    Diagnostic work-up of a coincidental finding of a mediastinal tumour in asymptomatic patients should initially be done by non-invasive imaging modalities. We present a case in which traditional use of 99mTc pertechnetate scintigraphy was insufficient in a male with an enlarged thyroid gland....... Application of iodine-123 can show diagnostic superiority owing to ideal tracer properties for scintigraphic imaging of the thyroid gland, such as pure gamma emission, organic binding and slow wash-out. The cons are a high radiation burden, price and lack of availability, as iodine-123 is a cyclotron product....

  3. Insulin Expression in Rats Exposed to Cadmium

    Institute of Scientific and Technical Information of China (English)


    Objectives To investigate the effects of cadmium exposure on insulin expression in rats. Methods Eighteen adult SD assessed. The levels of cadmium and zinc in pancreas, blood and urine glucose, serum insulin and urine NAG (N-acyetyl-β-glucosaminidase) were determined. The gene expressions of metallothionein (MT) and insulin were also measured,and the oral glucose tolerance tests (OGTT) were carried out. Results The contents of cadmium in pancreas in cadmium-treated rats were higher than that in the control group, which was associated with slight increase of zinc in pancreas.not change significantly after cadmium administration, and the UNAG had no change in Cd-treated group. The gene expression the change of the expression of insulin, MT-Ⅰ and MT-Ⅱ genes. Cadmium can influence the biosynthesis of insulin, but does not induce the release of insulin. The dysfunction of pancreas occurs earlier than that of kidney after administration of cadmium.

  4. Crystalline 1H-1,2,3-triazol-5-ylidenes

    Energy Technology Data Exchange (ETDEWEB)

    Bertrand, Guy; Gulsado-Barrios, Gregorio; Bouffard, Jean; Donnadieu, Bruno


    The present invention provides novel and stable crystalline 1H-1,2,3 triazolium carbenes and metal complexes of 1H-1,2,3 triazolium carbenes. The present invention also provides methods of making 1H-1,2,3 triazolium carbenes and metal complexes of 1H-1,2,3 triazolium carbenes. The present invention also provides methods of using 1H-1,2,3 triazolium carbenes and metal complexes of 1H-1,2,3 triazolium carbenes in catalytic reactions.

  5. 7 CFR 12.3 - Applicability. (United States)


    ... tribal land, in the fifty States, the District of Columbia, the Commonwealth of Puerto Rico, Guam, the... the Secretary of Agriculture HIGHLY ERODIBLE LAND AND WETLAND CONSERVATION General Provisions § 12.3... actions and determinations regarding wetlands and converted wetlands. Actions taken and...

  6. I-123 IMP SPECT in Parkinson's disease

    International Nuclear Information System (INIS)

    To examine semiquantitatively regional cerebral blood flow, SPECT with N-isopropyl-p-[I-123]iodoamphetamine (I-123 IMP) was undertaken in 17 patients with Parkinson's disease. Seven patients with Alzheimer's disease and 9 senile control subjects were also imaged for comparison. Both the Parkinson's disease group and the Alzheimer's disease group had a decreased uptake of I-123 IMP in the frontal lobe, in comparison with the control group. A remarkably decreased uptake was seen in the lateral and parietal lobes in the group of Parkinson's disease associated with dementia, as well as in the Alzheimer's disease group. A significantly decreased uptake was observed in the frontal lobe, lateral lobe, thalamus, and basal ganglia in the Parkinson's disease group, irrespective of the presence or absence of dementia. For Parkinson's disease associated with dementia, there was much more significant decrease in I-123 IMP uptake. The pattern of regional cerebral blood flow in the Alzheimer's disease group was analogous to that in the Parkinson's disease group associated with dementia. This supports the hypothesis that Alzheimer's disease may be somewhat involved in the occurrence of dementia for Parkinson's disease. (N.K.)

  7. 7 CFR 1942.123 - Loan closing. (United States)


    ... REGULATIONS (CONTINUED) ASSOCIATIONS Fire and Rescue and Other Small Community Facilities Projects § 1942.123... Rural Development Manager. (3) The Rural Development Manager will collect interest through the actual..., or destroyed, the Rural Development Manager will take the appropriate actions outlined in...

  8. 14 CFR 1264.123 - Protective order. (United States)


    ... PENALTIES ACT OF 1986 § 1264.123 Protective order. (a) A party or a prospective witness or deponent may file a motion for a protective order with respect to discovery sought by an opposing party or with... the following: (1) That the discovery not be had; (2) That the discovery may be had only on...

  9. Relationships of cadmium, mercury, and selenium with nutrient reserves of female lesser scaup (Aythya affinis) during winter and spring migration (United States)

    Anteau, M.J.; Afton, A.D.; Custer, Christine M.; Custer, T.W.


    Trace elements may have important effects on body condition of ducks during spring migration, because individuals are experiencing energetically costly events (e.g., migration, nutrient reserve accumulation, pair formation, feather molt, and ovarian follicle development). We examined relationships among hepatic cadmium, mercury, and selenium concentrations (??g/g dry wt) and nutrient reserves (lipid, protein, and mineral) of female lesser scaup (Aythya affinis) during winter and spring migration at four locations within the Mississippi Flyway (LA, IL, and MN, USA, and MB, Canada). Selenium concentrations (range, 3.73-52.29 (??g/g dry wt) were positively correlated with lipid reserves (F1,73 = 22.69, p lipid reserves (F1,73 = 6.92, p = 0.010, type III partial r2 = 0.09). The observed relationship between cadmium and lipid reserves may be cause for concern, because lipid reserves of females declined by 55 g (47%), on average, within the range of observed cadmium concentrations (0.23-7.24 ??g/g dry wt), despite the relatively low cadmium concentrations detected. Mean cadmium concentrations were higher in Minnesota (1.23 ??g/g dry wt) and Manitoba (1.11 ??g/g dry wt) than in Louisiana (0.80 ??g/g dry wt) and Illinois (0.69 ??g/g dry wt). However, mean cadmium concentrations predict lipid reserves of females to be only 11 g lower, on average, in Minnesota than in Illinois. Previous research documented that lipid reserves were 100 g lower in Minnesota than in Illinois; consequently, cadmium is unlikely to be the sole cause for decreases in lipid reserves of females during late-spring migration. ?? 2007 SETAC.

  10. Cadmium detoxification processes in the digestive gland of cephalopods in relation to accumulated cadmium concentrations


    Bustamante, Paco; Cosson, Richard; Gallien, Isabelle; Caurant, Florence; Miramand, Pierre


    International audience The high concentrations of cadmium recorded in the digestive gland of cephalopods from various temperate and subpolar waters suggest that these molluscs have developed efficient cadmium detoxification mechanisms. The subcellular distribution of cadmium in the digestive gland cells was investigated in seven cephalopod species from the Bay of Biscay (France) and the Faroe Islands. In most species, cadmium was mainly found in the cytosolic fraction of the digestive glan...

  11. Cadmium content of plants as affected by soil cadmium concentration

    Energy Technology Data Exchange (ETDEWEB)

    Lehoczky, E. [Pannon Univ. of Agricultural Sciences, Keszthely (Hungary); Szabados, I.; Marth, P. [Plant Health and Soil Conservation Station, Higany (Hungary)


    Pot experiments were conducted in greenhouse conditions to study the effects of increasing cadmium (Cd) levels on biomass production and Cd contents in corn, (Zea mays L.), garlic (Allium sativum L.), and spinach (Spinacia oleracea L.). Plants were grown in two soil types: Eutric cambisol soil and A gleyic luvisol soil. Spinach proved to be the most sensitive to Cd treatments as its biomass considerably decreased with the increasing Cd levels. Cadmium contents of the three crops increased with increasing levels of Cd applications. Statistical differences were observed in the Cd contents of crops depending on soil type. With the same Cd rates, Cd tissue concentration of test plants grown in the strongly acidic Gleyic luvisol soil were many times higher than that of plants grown in a neutral Eutric cambisol soil. 14 refs., 4 tabs.

  12. 17 CFR 256.123 - Investment in associate companies. (United States)


    ... UTILITY HOLDING COMPANY ACT OF 1935 2. Investments § 256.123 Investment in associate companies. This... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Investment in associate companies. 256.123 Section 256.123 Commodity and Securities Exchanges SECURITIES AND EXCHANGE...

  13. 29 CFR 780.123 - Raising of bees. (United States)


    ... 29 Labor 3 2010-07-01 2010-07-01 false Raising of bees. 780.123 Section 780.123 Labor Regulations... Raising of Livestock, Bees, Fur-Bearing Animals, Or Poultry § 780.123 Raising of bees. The term “raising of * * * bees” refers to all of those activities customarily performed in connection with...

  14. 38 CFR 4.123 - Neuritis, cranial or peripheral. (United States)


    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Neuritis, cranial or peripheral. 4.123 Section 4.123 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS....123 Neuritis, cranial or peripheral. Neuritis, cranial or peripheral, characterized by loss...

  15. 19 CFR 123.41 - Truck shipments transiting Canada. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Truck shipments transiting Canada. 123.41 Section 123.41 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO United States and Canada In-Transit Truck Procedures § 123.41 Truck shipments...

  16. 19 CFR 123.21 - Merchandise in transit. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Merchandise in transit. 123.21 Section 123.21 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Shipments in Transit Through Canada or Mexico § 123.21 Merchandise in transit. (a) Status....

  17. 19 CFR 123.25 - Certification and disposition of manifests. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Certification and disposition of manifests. 123.25 Section 123.25 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Shipments in Transit Through Canada or Mexico § 123.25 Certification...

  18. 19 CFR 123.34 - Certain vehicle and vessel shipments. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Certain vehicle and vessel shipments. 123.34 Section 123.34 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Shipments in Transit Through the United States § 123.34 Certain vehicle and...

  19. 19 CFR 123.24 - Sealing of conveyances or compartments. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Sealing of conveyances or compartments. 123.24 Section 123.24 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Shipments in Transit Through Canada or Mexico § 123.24 Sealing of conveyances...

  20. 19 CFR 123.72 - Written agreement requirement. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Written agreement requirement. 123.72 Section 123.72 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Land Border Carrier Initiative Program § 123.72 Written agreement requirement....

  1. 19 CFR 123.71 - Description of program. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Description of program. 123.71 Section 123.71 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Land Border Carrier Initiative Program § 123.71 Description of program. The Land Border...

  2. 19 CFR 123.3 - Inward foreign manifest required. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Inward foreign manifest required. 123.3 Section 123.3 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO General Provisions § 123.3 Inward foreign manifest required. (a) General requirements....

  3. 19 CFR 123.31 - Merchandise in transit. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Merchandise in transit. 123.31 Section 123.31 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Shipments in Transit Through the United States § 123.31 Merchandise in transit. (a) From...

  4. 19 CFR 123.10 - General order merchandise. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false General order merchandise. 123.10 Section 123.10 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO General Provisions § 123.10 General order merchandise. (a) Any merchandise or baggage...

  5. 12 CFR 225.123 - Activities closely related to banking. (United States)


    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Activities closely related to banking. 225.123 Section 225.123 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL... Holding Companies Interpretations § 225.123 Activities closely related to banking. (a) Effective June...

  6. 10 CFR 26.123 - Testing facility capabilities. (United States)


    ... 10 Energy 1 2010-01-01 2010-01-01 false Testing facility capabilities. 26.123 Section 26.123 Energy NUCLEAR REGULATORY COMMISSION FITNESS FOR DUTY PROGRAMS Licensee Testing Facilities § 26.123 Testing facility capabilities. Each licensee testing facility shall have the capability, at the...

  7. 40 CFR 60.123 - Test methods and procedures. (United States)


    ... 40 Protection of Environment 6 2010-07-01 2010-07-01 false Test methods and procedures. 60.123 Section 60.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... Smelters § 60.123 Test methods and procedures. (a) In conducting the performance tests required in §...

  8. 42 CFR 84.123 - Exhalation valve leakage test. (United States)


    ... 42 Public Health 1 2010-10-01 2010-10-01 false Exhalation valve leakage test. 84.123 Section 84.123 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES OCCUPATIONAL SAFETY....123 Exhalation valve leakage test. (a) Dry exhalation valves and valve seats will be subjected to...

  9. Cadmium Exposure and Pancreatic Cancer in South Louisiana


    Luckett, Brian G.; L. Joseph Su; Rood, Jennifer C.; Elizabeth T. H. Fontham


    Cadmium has been hypothesized to be a pancreatic carcinogen. We test the hypothesis that cadmium exposure is a risk factor for pancreatic cancer with a population-based case-control study sampled from a population with persistently high rates of pancreatic cancer (south Louisiana). We tested potential dietary and nondietary sources of cadmium for their association with urinary cadmium concentrations which reflect long-term exposure to cadmium due to the accumulation of cadmium in the kidney c...

  10. Zone refining of cadmium and related characterization

    Indian Academy of Sciences (India)

    N R Munirathnam; D S Prasad; Ch Sudheer; J V Rao; T L Prakash


    We present the zone refining results of cadmium using horizontal resistive zone refiner under constant flow of moisture free hydrogen gas. The boron impurity in cadmium can be avoided using quartz (GE 214 grade) boat in lieu of high pure graphite boat. The analytical results using inductively coupled plasma optical emission spectrometry (ICPOES) show that majority of the impurities are less than the detection limits. Comparatively, zinc is the most difficult impurity element to remove in cadmium matrix by zone refining.

  11. Electrodialytic Removal of Cadmium from Straw Ash

    DEFF Research Database (Denmark)

    Hansen, Henrik; Ottosen, Lisbeth M.; Villumsen, Arne;


    A problem with flyash from straw and wood combustion is the high level of heavy metals, especially cadmium. Two electrodialytic remediation experiments were carried out on cadmium polluted flyash from straw combustion. The flyash could be cleaned to 1/3 of its initial level after 24 days...... of remediation. Further removal of cadmium could be possible with longer remediation time or a higher current density...

  12. Bioavailability of cadmium from linseed and cocoa


    Hansen, Max; Rasmussen, Rie Romme; Sloth, Jens Jørgen


    The exposure of the European population to cadmium from food is high compared with the tolerable weekly intake of 2.5 μg/kg bodyweight set by EFSA in 2009. Only few studies on the bioavailability of cadmium from different food sources has been performed but this information in very important for the food authorities in order to give correct advises to the population. The aim of this study was to investigate the bioavailability of cadmium from whole linseed, crushed linseed, cocoa and cadmium ...

  13. The Epigenetic Effects of Prenatal Cadmium Exposure. (United States)

    Vilahur, Nadia; Vahter, Marie; Broberg, Karin


    Prenatal exposure to the highly toxic and common pollutant cadmium has been associated with adverse effects on child health and development. However, the underlying biological mechanisms of cadmium toxicity remain partially unsolved. Epigenetic disruption due to early cadmium exposure has gained attention as a plausible mode of action, since epigenetic signatures respond to environmental stimuli and the fetus undergoes drastic epigenomic rearrangements during embryogenesis. In the current review, we provide a critical examination of the literature addressing prenatal cadmium exposure and epigenetic effects in human, animal, and in vitro studies. We conducted a PubMed search and obtained eight recent studies addressing this topic, focusing almost exclusively on DNA methylation. These studies provide evidence that cadmium alters epigenetic signatures in the DNA of the placenta and of the newborns, and some studies indicated marked sexual differences for cadmium-related DNA methylation changes. Associations between early cadmium exposure and DNA methylation might reflect interference with de novo DNA methyltransferases. More studies, especially those including environmentally relevant doses, are needed to confirm the toxicoepigenomic effects of prenatal cadmium exposure and how that relates to the observed health effects of cadmium in childhood and later life.

  14. Cyclotron production of I-123: An evaluation of the nuclear reactions which produce this isotope (United States)

    Sodd, V. J.; Scholz, K. L.; Blue, J. W.; Wellamn, H. N.


    The reactions studied which produce I-123 directly were Sb-121(He-4,2n) I-123, Sb-121(He-3,n) I-123, Te-122(d,n) I-123, Te-122(He-4,p2n) I-123, Te-122(He-3,pn) I-123, and Te-123(He-3,p2n) I-123. Reactions which produce I-123 indirectly through the positron decay of 2.1-hour Xe-123 were Te-122(He-4,3n) Xe-123, Te-122(He-3,2n) Xe-123 and Te-123(He-3,3n) Xe-123. Use of the gas flow I-123 cyclotron target assembly is recommended for the production of I-123 with radiochemical purity greater than 99.995%.

  15. Opening of the 123rd Council session

    CERN Multimedia

    Patrice Loïez


    The CERN Council held its 123rd session on 13 December 2002 under the chairmanship of Professor Maurice Bourquin. The election of the next Director General, the Baseline Plan for 2003-2010 and a new status for non-European states were among the items agreed. Photo 01: (left to right) Director-General Prof. Luciano Maiani, President of Council Prof. Maurice Bourquin, and Director of administration Jan van der Boon.

  16. The H2BK123Rgument


    Latham, John A.; Dent, Sharon Y. R.


    The discovery of trans-regulation of histone H3K4 methylation by ubiquitination of histone H2BK123 generated much excitement in the field of chromatin biology. Recently, the veracity of this example of cross talk between histone modifications in yeast was challenged (Foster and Downs, 2009. J. Cell Biol. doi:10.1083/jcb.200812088) but ultimately reconfirmed in a study in this issue (Nakanishi et al., 2009. J. Cell Biol. doi:10.1083/jcb.200906005).

  17. Iodine-123 iodobenzofuran (I-123 IBF) SPECT in patients with parkinsonism

    Energy Technology Data Exchange (ETDEWEB)

    Nakabeppu, Yoshiaki; Nakajo, Masayuki; Mitsuda, Mitsuru; Tsuchimochi, Shinsaku; Tani, Atsushi; Osame, Mitsuhiro [Kagoshima Univ. (Japan). Faculty of Medicine


    Iodine-123 benzofuran (I-123 IBF) is a dopaminergic antagonist which is suitable for SPECT imaging of D2 receptors. The purpose of this study is to evaluate the potential usefulness of semi-quantitative parameters obtained from brain SPECT data of I-123 IBF for differential diagnosis in patients with parkinsonism (PN). Subjects were 10 patients with PN: 2 patients with striato-nigral degeneration (SND), 5 patients with Parkinson's disease (PD), 2 patients with progressive supranuclear palsy (PSP) and one patient with olivo-ponto-cerebellar atrophy (OPCA). The data were acquired with a triple-head gamma camera at 2 hours after intravenous injection of 167 MBq of I-123 IBF. Transverse images were reconstructed by means of filtered backprojection, and attenuation correction was performed by Chang's method ({mu}=0.08). The basal ganglia-to-frontal cortex ratio (GFR) and the basal ganglia-to-occipital cortex ratio (GOR) on slices of 5 different thicknesses were calculated. The GFR and GOR were lower in the SND group than in the other disease groups in all slices with different thicknesses (7.2 mm, 14.4 mm, 21.6 mm, 28.8 mm and 43.2 mm). The semiquantitative parameters (GFR and GOR) obtained from brain SPECT data at 2 hours after intravenous injection of I-123 IBF may be useful for differential diagnosis in patients with PN. (author)

  18. Improvement of cadmium phytoremediation after soil inoculation with a cadmium-resistant Micrococcus sp. (United States)

    Sangthong, Chirawee; Setkit, Kunchaya; Prapagdee, Benjaphorn


    Cadmium-resistant Micrococcus sp. TISTR2221, a plant growth-promoting bacterium, has stimulatory effects on the root lengths of Zea mays L. seedlings under toxic cadmium conditions compared to uninoculated seedlings. The performance of Micrococcus sp. TISTR2221 on promoting growth and cadmium accumulation in Z. mays L. was investigated in a pot experiment. The results indicated that Micrococcus sp. TISTR2221significantly promoted the root length, shoot length, and dry biomass of Z. mays L. transplanted in both uncontaminated and cadmium-contaminated soils. Micrococcus sp. TISTR2221 significantly increased cadmium accumulation in the roots and shoots of Z. mays L. compared to uninoculated plants. At the beginning of the planting period, cadmium accumulated mainly in the shoots. With a prolonged duration of cultivation, cadmium content increased in the roots. As expected, little cadmium was found in maize grains. Soil cadmium was significantly reduced with time, and the highest percentage of cadmium removal was found in the bacterial-inoculated Z. mays L. after transplantation for 6 weeks. We conclude that Micrococcus sp. TISTR2221 is a potent bioaugmenting agent, facilitating cadmium phytoextraction in Z. mays L.

  19. Dual radioisotopes simultaneous SPECT of 99mTc-tetrofosmin and 123I-BMIPP using a semiconductor detector.

    Directory of Open Access Journals (Sweden)

    Yasuyuki Takahashi


    Full Text Available Objective(s: The energy resolution of a cadmium-zinc-telluride (CZT solid-state semiconductor detector is about 5%, and is superior to the resolution of the conventional Anger type detector which is 10%. Also, the window width of the high-energy part and of the low-energy part of a photo peak window can be changed separately. In this study, we used a semiconductor detector and examined the effects of changing energy window widths for 99mTc and 123 I simultaneous SPECT. Methods: The energy “centerline” for 99mTc was set at 140.5 keV and that for 123I at 159.0 keV. For 99mTc, the “low-energy-window width” was set to values that varied from 3% to 10% of 140.5 keV and the “high-energy-window width” were independently set to values that varied from 3% to 6% of 140.5 keV. For 123I, the “low energy-window-width” varied from 3% to 6% of 159.0 keV and the high-energy-window width from 3% to 10% of 159 keV. In this study we imaged the cardiac phantom, using single or dual radionuclide, changing energy window width, and comparing SPECT counts as well as crosstalk ratio. Results: The contamination to the 123I window from 99mTc (the crosstalk was only 1% or less with cutoffs of 4% at lower part and 6% at upper part of 159KeV. On the other hand, the crosstalk from 123I photons into the 99mTc window mostly exceeded 20%. Therefore, in order to suppress the rate of contamination to 20% or less, 99mTc window cutoffs were set at 3% in upper part and 7% at lower part of 140.5 KeV. The semiconductor detector improves separation accuracy of the acquisition inherently at dual radionuclide imaging. In, this phantom study we simulated dual radionuclide simultaneous SPECT by 99mTc-tetrofosmin and 123 I-BMIPP. Conclusion: We suggest that dual radionuclide simultaneous SPECT of 99mTc and 123I using a CZT semiconductor detector is possible employing the recommended windows.

  20. Cadmium Modulates Biofilm Formation by Staphylococcus epidermidis

    NARCIS (Netherlands)

    Wu, Xueqing; Santos, Regiane R.; Fink-Gremmels, Johanna


    The aim of the study was to evaluate the effect of cadmium exposure on Staphylococcus epidermidis (ATCC 35984) biofilm formation. Bacteria were cultured in the absence or presence of different concentrations (0-50 mu M) of cadmium. Biofilm formation and bacterial viability were assessed. Quantitativ

  1. Cadmium stress in wheat seedlings: growth, cadmium accumulation and photosynthesis

    DEFF Research Database (Denmark)

    Ci, Dunwei; Jiang, Dong; Wollenweber, Bernd;


    Seedlings of wheat (Triticum aestivum L.) cultivars Jing 411, Jinmai 30 and Yangmai 10 were exposed to 0, 10, 20, 30, 40 or 50 μM of CdCl2 in a solution culture experiment. The effects of cadmium (Cd) stress on wheat growth, leaf photon energy conversion, gas exchange, and Cd accumulation in wheat...... parameters were generally depressed by Cd stress, especially under the high Cd concentrations. Cd concentration and accumulation in both shoots and roots increased with increasing external Cd concentrations. Relationships between corrected parameters of growth, photosynthesis and fluorescence and corrected...

  2. Immunoassay for Cadmium Detection and Quantification

    Institute of Scientific and Technical Information of China (English)



    Objective To detect cadmium in environmental and food samples by graphite furnace atomic absorption spectroscopy (GFAAS) and inductively coupled plasma atomic emission spectroscopy (ICPAES). Methods An indirect competitive enzyme-linked immunosorbent assay (IC-ELISA) was developed based on a cadmium-specific monoclonal antibody.IC-ELISA for cadmium in environmental and food samples was evaluated. Results IC-ELISA showed an IC50 of 45.6 μg/L with a detection limit of 1.95 μg/L for cadmium,and showed a mean recovery ranging 97.67%-107.08%.The coefficient of variations for intra- and iuterassay was 3.41%-6.61% and 4.70%-9.21%,respectively.The correlation coefficient between IC-ELISA and GFAAS was 0.998. Conclusion IC-ELISA can detect and quantify cadmium residue in environmental or food samples.

  3. Cadmium mobility and accumulation in soils of the European Communities

    NARCIS (Netherlands)

    Fraters B; van Beurden AUCJ


    In this overview of the effects of cadmium pollution on agricultural soils in the European Community, both the cadmium loads on agricultural land and the soil sensitivity to cadmium accumulation have been estimated. Cadmium loads have been estimated separately for arable land and grassland. The ef

  4. Peculiarities of preparation of cadmium isotopes of high enrichment

    International Nuclear Information System (INIS)

    Cascade equipped by gas centrifuges with regard for requirements to structural materials operating with chemically active compounds (dimethylcadmium) was devised for preparation of high-enriched cadmium isotopes. Solutions of such problems as overcoming of isotope memory, compensation of the effect of isotope overlapping, operative analytical accompanying permitted to optimize separation process and to obtain cadmium isotopes of high enrichment degree: cadmium-116 ∼98.9 %, cadmium-114 ∼98.7 %, cadmium-113 ∼93.3 %, cadmium-112 ∼99.1 %, cadmium-110 ∼95.8 %

  5. 19 CFR 123.22 - In-transit manifest. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false In-transit manifest. 123.22 Section 123.22 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Shipments in Transit Through Canada or Mexico § 123.22 In-transit manifest. (a) Manifest required....

  6. Recent developments in the field of 123I-radiopharmaceuticals

    International Nuclear Information System (INIS)

    Due to its advantageous nuclear physical properties iodine-123 is an excellent label for radiopharmaceuticals very well suited for measurements by γ-cameras and single-photon emission tomography. The development of 123I-radiopharmaceuticals should be based on a clear biochemical concept, reliable labelling procedures and careful pharmacokinetic studies in order to evaluate the physiological behaviour of the radioiodinated compounds being analogues of metabolic substrates. The development of 123I-labelled fatty acids and biogenic amines clearly proved the successful use of 123I for labelling compounds applied in medical diagnosis. (orig.)

  7. Response of Saccharomyces cerevisiae to cadmium stress

    Energy Technology Data Exchange (ETDEWEB)

    Moreira, Luciana Mara Costa; Ribeiro, Frederico Haddad; Neves, Maria Jose [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil). Lab. de Radiobiologia], e-mail:; Porto, Barbara Abranches Araujo; Amaral, Angela M.; Menezes, Maria Angela B.C. [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Lab. de Ativacao Neutronica], e-mail:; Rosa, Carlos Augusto [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Dept. de Microbiologia], e-mail: carlrosa@icb.ufmg


    The intensification of industrial activity has been greatly contributing with the increase of heavy metals in the environment. Among these heavy metals, cadmium becomes a serious pervasive environmental pollutant. The cadmium is a heavy metal with no biological function, very toxic and carcinogenic at low concentrations. The toxicity of cadmium and several other metals can be mainly attributed to the multiplicity of coordination complexes and clusters that they can form. Some aspects of the cellular response to cadmium were extensively investigated in the yeast Saccharomyces cerevisiae. The primary site of interaction between many toxic metals and microbial cells is the plasma membrane. Plasma-membrane permeabilisation has been reported in a variety of microorganisms following cadmium exposure, and is considered one mechanism of cadmium toxicity in the yeast. In this work, using the yeast strain S. cerevisiae W303-WT, we have investigated the relationships between Cd uptake and release of cellular metal ions (K{sup +} and Na{sup +}) using neutron activation technique. The neutron activation was an easy, rapid and suitable technique for doing these metal determinations on yeast cells; was observed the change in morphology of the strains during the process of Cd accumulation, these alterations were observed by Transmission Electron Microscopy (TEM) and Scanning Electron Microscopy (SEM) during incorporation of cadmium. (author)

  8. Response of Pleurotus ostreatus to cadmium exposure

    Energy Technology Data Exchange (ETDEWEB)

    Favero, N.; Bressa, G.; Costa, P. (Univ. of Padua (Italy))


    The possibility of utilizing agroindustrial wastes in the production of edible, high-quality products (e.g., mushrooms) implies the risk of bringing toxic substances, such as heavy metals, into the human food chain. Thus, growth in the presence of cadmium and cadmium accumulation limits have been studied in the industrially cultivated fungus P. ostreatus. Fruit body production is substantially unaffected in the presence of 25, 139, and 285 mg Cd/kg of dried substrate. Cadmium concentration in fruit bodies is related to cadmium substrate level, the metal being present at higher levels in caps (22-56 mg/kg dry wt) than in stems (13-36 mg/kg dry wt). Concentration factor (CF), very low in the controls (about 2), further decreases in treated specimens. The presence of a cadmium control mechanism in this fungi species is suggested. Fruit body cadmium levels could, however, represent a risk for P. ostreatus consumers, according to FAO/WHO limits related to weekly cadmium intake.

  9. Cadmium Toxicity to Ringed Seals (Phoca hispida)

    DEFF Research Database (Denmark)

    Sonne, Christian; Dietz, R.; Riget, F. F.;

    as laboratory mammals. We have studied possible cadmium induced histopathological changes in the kidneys as well as a demineralisation of the skeletal system (DXA-scanning of lumbal vertebraes). No obvious cadmium induced toxic changes were found. Food composition and physiological adaptations may explain......Cadmium concentrations in kidneys from ringed seals (Phoca hispida) from North West Greenland (Qaanaaq) are high. Concentrations range at level known to induce renal toxic effects (mainly tubulopathy) and demineralisation (osteopenia) of the skeletal system (Fanconi's Syndrome) in humans as well...

  10. Market for nickel-cadmium batteries (United States)

    Putois, F.

    Besides the lead/acid battery market, which has seen a tremendous development linked with the car industry, the alkaline rechargeable battery market has also been expanded for more than twenty years, especially in the field of portable applications with nickel-cadmium batteries. Today, nickel-cadmium batteries have to face newcomers on the market, such as nickel-metal hydride, which is another alkaline couple, and rechargeable lithium batteries; these new battery systems have better performances in some areas. This work illustrates the status of the market for nickel-cadmium batteries and their applications. Also, for two major applications—the cordless tool and the electric vehicles—the competitive situation of nickel-cadmium batteries; facing new systems such as nickel-metal hydride and lithium ion cells are discussed.


    Cadmium consumed in foods grown on soils contaminated by industrial Cd+Zn discharge has caused renal tubular dysfunction in exposed humans in discrete situations. However, lack of understanding about environmental Cd has caused wide concern that generalpopulations may...

  12. 5 CFR 610.123 - Travel on official time. (United States)


    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Travel on official time. 610.123 Section... DUTY Weekly and Daily Scheduling of Work Work Schedules § 610.123 Travel on official time. Insofar as practicable travel during nonduty hours shall not be required of an employee. When it is essential that...

  13. 40 CFR 1.23 - Office of the Administrator. (United States)


    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Office of the Administrator. 1.23... AND GENERAL INFORMATION Headquarters § 1.23 Office of the Administrator. The Environmental Protection Agency is headed by an Administrator who is appointed by the President, by and with the consent of...

  14. 22 CFR 123.5 - Temporary export licenses. (United States)


    ... from a U.S. Post Office (see 39 CFR part 20), as appropriate. The license for temporary export must be... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Temporary export licenses. 123.5 Section 123.5 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL TRAFFIC IN ARMS REGULATIONS LICENSES FOR THE EXPORT...

  15. 49 CFR 37.123 - ADA paratransit eligibility: Standards. (United States)


    ... 49 Transportation 1 2010-10-01 2010-10-01 false ADA paratransit eligibility: Standards. 37.123... INDIVIDUALS WITH DISABILITIES (ADA) Paratransit as a Complement to Fixed Route Service § 37.123 ADA paratransit eligibility: Standards. (a) Public entities required by § 37.121 of this subpart to...

  16. 14 CFR 415.123 - Computing systems and software. (United States)


    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Computing systems and software. 415.123... Launch Vehicle From a Non-Federal Launch Site § 415.123 Computing systems and software. (a) An applicant's safety review document must describe all computing systems and software that perform a...

  17. 19 CFR 123.11 - Supplies on international trains. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Supplies on international trains. 123.11 Section... OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO International Traffic § 123.11 Supplies on international trains. (a) Articles acquired abroad. Articles subject to internal revenue tax and...

  18. 14 CFR 65.123 - Additional type ratings: Requirements. (United States)


    ... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Additional type ratings: Requirements. 65.123 Section 65.123 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION... of the type for which he seeks a rating, in accordance with the manufacturer's instructions and...

  19. 14 CFR 21.123 - Production under type certificate. (United States)


    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Production under type certificate. 21.123 Section 21.123 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION... Production under type certificate. Each manufacturer of a product being manufactured under a type...

  20. 40 CFR 123.23 - Attorney General's statement. (United States)


    ... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Attorney General's statement. 123.23... PROGRAM REQUIREMENTS State Program Submissions § 123.23 Attorney General's statement. (a) Any State that seeks to administer a program under this part shall submit a statement from the State Attorney...

  1. 22 CFR 123.25 - Amendments to licenses. (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Amendments to licenses. 123.25 Section 123.25 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL TRAFFIC IN ARMS REGULATIONS LICENSES FOR THE EXPORT OF...; and change of foreign intermediate consignee if that party is only transporting the equipment and...

  2. 37 CFR 1.23 - Methods of payment. (United States)


    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Methods of payment. 1.23... COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES General Provisions Fees and Payment of Money § 1.23 Methods of payment. (a) All payments of money required for United States Patent and Trademark Office...

  3. 21 CFR 123.5 - Current good manufacturing practice. (United States)


    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Current good manufacturing practice. 123.5 Section 123.5 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... manufacturing practice. (a) Part 110 of this chapter applies in determining whether the facilities,...

  4. 19 CFR 123.62 - Baggage in possession of traveler. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Baggage in possession of traveler. 123.62 Section... OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Baggage § 123.62 Baggage in possession of traveler. For baggage arriving in the actual possession of a traveler, his declaration shall be accepted...

  5. 14 CFR 25.123 - En route flight paths. (United States)


    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false En route flight paths. 25.123 Section 25... AIRWORTHINESS STANDARDS: TRANSPORT CATEGORY AIRPLANES Flight Performance § 25.123 En route flight paths. (a) For the en route configuration, the flight paths prescribed in paragraph (b) and (c) of this section...

  6. 14 CFR 125.123 - Propeller deicing fluid. (United States)



  7. 14 CFR 93.123 - High density traffic airports. (United States)


    ... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false High density traffic airports. 93.123... (CONTINUED) AIR TRAFFIC AND GENERAL OPERATING RULES SPECIAL AIR TRAFFIC RULES High Density Traffic Airports § 93.123 High density traffic airports. (a) Each of the following airports is designated as a...

  8. 22 CFR 123.26 - Recordkeeping requirement for exemptions. (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Recordkeeping requirement for exemptions. 123.26 Section 123.26 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL TRAFFIC IN ARMS REGULATIONS... each such export. The business record should include the following information: A description of...

  9. Some Aspects of Sealed Nickel Cadmium Cells

    Directory of Open Access Journals (Sweden)

    P. K. Saha


    Full Text Available Sealed Nickel Cadmium Cell system is termed till today as the most reliable power pack for electronic apparatus specially in low temperature use. This paper brings out the development and production of sealed nickel cadmium cells of pocket plate construction. The author who has gained experience in production of Ni-Cd cells in East Germany discusses also the major problems faced by the battery manufactures of to-day.

  10. Cadmium zinc telluride spectral modeling

    International Nuclear Information System (INIS)

    Cadmium zinc telluride (CZT) detectors are the highest resolution room temperature gamma-ray detectors available for isotopic analysis. As with germanium detectors, accurate isotopic analysis using spectra requires peak deconvolution. The CZT peak shapes are asymmetric, with a long low energy tail. The asymmetry is a result of the physics of the electron/hole transport in the semiconductor. An accurate model of the physics of the electron/hole transport through an electric field will allow the parameterization of the peak shapes as a function of energy. In turn this leads to the ability to perform accurate spectral deconvolution and therefore accurate isotopic analysis. The model and the peak-shape parameterization as a function of energy will be presented

  11. Medical necessity for shorter lived radionuclides, specifically pure Iodine-123

    International Nuclear Information System (INIS)

    Iodine-123 has physical and radiochemical characteristics ideal for most tracer procedures performed in patients. Its use is generally preferable to the use of 131I for diagnosis. The potential for 123I can be realized only if a radiopharmaceutical of lesser radionuclide contamination is generally and economically available. Iodine-123 produced by direct methods has significant disadvantages relative to quality of procedure and radiation dosimetry. Our experience with 123I(p,5n) during the past 12 years causes us to vigorously encourage general availability of an 123I radiopharmaceutical of this quality. Using this product, the authors have prepared radiopharmaceuticals for use in the study of cancer, coagulation, and renal and thyroid diseases

  12. Cadmium leaching from thermal treated and gamma irradiated Mexican aluminosilicates

    Energy Technology Data Exchange (ETDEWEB)

    Davila-Rangel, J.I. [Departamento de Quimica, Instituto Nacional de Investigaciones Nucleares, Apdo. Postal 18-1027, Mexico 11801, D.F. (Mexico); Unidad Academica Centro Regional de Estudios Nucleares, Universidad Autonoma de Zacatecas Cipres 10, Frac. La Penuela, Zacatecas, Zacatecas 98068 (Mexico); Facultad de Ciencias, Universidad Autonoma del Estado de Mexico, Instituto Literario No. 100 Col. Centro C.P. 50000, Toluca, Edo. de Mexico (Mexico); Solache-Rios, M. [Departamento de Quimica, Instituto Nacional de Investigaciones Nucleares, Apdo. Postal 18-1027, Mexico 11801, D.F. (Mexico)], E-mail:


    Thermal and radiation effects on the leaching of cadmium from two cadmium exchanged zeolitic tuffs and one clay were determined. The cadmium exchanged aluminosilicates were heated at different temperatures (500, 700, 900 and 1100 {sup o}C), and the materials were then treated with NaCl (1 M and 5 M) and HNO{sub 3} (0.001 M and 1 M) solutions to determine the leaching behaviour of cadmium from the materials. The stability of cadmium in the materials increased as the heating temperature was increased. Cadmium leaching from gamma irradiated and heated materials at 1100 {sup o}C was higher than leaching from non-irradiated samples.

  13. Cadmium leaching from thermal treated and gamma irradiated Mexican aluminosilicates

    International Nuclear Information System (INIS)

    Thermal and radiation effects on the leaching of cadmium from two cadmium exchanged zeolitic tuffs and one clay were determined. The cadmium exchanged aluminosilicates were heated at different temperatures (500, 700, 900 and 1100 oC), and the materials were then treated with NaCl (1 M and 5 M) and HNO3 (0.001 M and 1 M) solutions to determine the leaching behaviour of cadmium from the materials. The stability of cadmium in the materials increased as the heating temperature was increased. Cadmium leaching from gamma irradiated and heated materials at 1100 oC was higher than leaching from non-irradiated samples

  14. Reviews of the environmental effects of pollutants: IV. Cadmium

    Energy Technology Data Exchange (ETDEWEB)

    Hammons, A.S.; Huff, J.E.; Braunstein, H.M.; Drury, J.S.; Shriner, C.R.; Lewis, E.B.; Whitfield, B.L.; Towill, L.E.


    This report is a comprehensive, multidisciplinary review of the health and environmental effects of cadmium and specific cadmium derivatives. More than 500 references are cited. The cadmium body burden in animals and humans results mainly from the diet. In the United States, the normal intake of cadmium for adult humans is estimated at about 50 per day. Tobacco smoke is a significant additional source of cadmium exposure. The kidneys and liver together contain about 50% of the total cadmium body burden. Acute cadmium poisoning is primarily an occupational problem, generally from inhalation of cadmium fumes or dusts. In the general population, incidents of acute poisoning by inhaled or ingested cadmium or its compounds are relatively rare. The kidney is the primary target organ for toxicity from prolonged low-level exposure to cadmium. No causal relationship has been established between cadmium exposure and human cancer, although a possible link between cadmium and prostate cancer has been indicated. Cadmium has been shown to be teratogenic in rats, hamsters, and mice, but no such effects have been proven in humans. Cadmium has been reported to increase the frequency of chromosomal aberrations in cultured Chinese hamster ovary cells and in human peripheral leukocytes. The major concern about environmental cadmium is the potential effects on the general population. There is no substantial evidence of hazard from current levels of cadmium in air, water, or food. However, because cadmium is a cumulative poison and because present intake provides a relatively small safety margin, there are adequate reasons for concern over possible future increases in background levels.

  15. Reviews of the environmental effects of pollutants: IV. Cadmium

    International Nuclear Information System (INIS)

    This report is a comprehensive, multidisciplinary review of the health and environmental effects of cadmium and specific cadmium derivatives. More than 500 references are cited. The cadmium body burden in animals and humans results mainly from the diet. In the United States, the normal intake of cadmium for adult humans is estimated at about 50 μg per day. Tobacco smoke is a significant additional source of cadmium exposure. The kidneys and liver together contain about 50% of the total cadmium body burden. Acute cadmium poisoning is primarily an occupational problem, generally from inhalation of cadmium fumes or dusts. In the general population, incidents of acute poisoning by inhaled or ingested cadmium or its compounds are relatively rare. The kidney is the primary target organ for toxicity from prolonged low-level exposure to cadmium. No causal relationship has been established between cadmium exposure and human cancer, although a possible link between cadmium and prostate cancer has been indicated. Cadmium has been shown to be teratogenic in rats, hamsters, and mice, but no such effects have been proven in humans. Cadmium has been reported to increase the frequency of chromosomal aberrations in cultured Chinese hamster ovary cells and in human peripheral leukocytes. The major concern about environmental cadmium is the potential effects on the general population. There is no substantial evidence of hazard from current levels of cadmium in air, water, or food. However, because cadmium is a cumulative poison and because present intake provides a relatively small safety margin, there are adequate reasons for concern over possible future increases in background levels

  16. Cadmium removal by Lemna minor and Spirodela polyrhiza. (United States)

    Chaudhuri, Devaleena; Majumder, Arunabha; Misra, Amal K; Bandyopadhyay, Kaushik


    The present study investigates the ability of two genus of duckweed (Lemna minor and Spirodela polyrhiza) to phytoremediate cadmium from aqueous solution. Duckweed was exposed to six different cadmium concentrations, such as, 0.5,1.0,1.5, 2.0, 2.5, and 3.0 mg/L and the experiment was continued for 22 days. Water samples were collected periodically for estimation of residual cadmium content in aqueous solution. At the end of treatment period plant samples were collected and accumulated cadmium content was measured. Cadmium toxicity was observed through relative growth factor and changes in chlorophyll content Experimental results showed that Lemna minor and Spirodela polyrhiza were capable of removing 42-78% and 52-75% cadmium from media depending upon initial cadmium concentrations. Cadmium was removed following pseudo second order kinetic model Maximum cadmium accumulation in Lemna minor was 4734.56 mg/kg at 2 mg/L initial cadmium concentration and 7711.00 mg/kg in Spirodela polyrhiza at 3 mg/L initial cadmium concentration at the end of treatment period. Conversely in both cases maximum bioconcentration factor obtained at lowest initial cadmium concentrations, i.e., 0.5 mg/L, were 3295.61 and 4752.00 for Lemna minor and Spirodela polyrhiza respectively. The present study revealed that both Lemna minor and Spirodela polyrhiza was potential cadmium accumulator. PMID:24933906

  17. N-isopropyl-p-[I123] iodoamphetamine single photon emission computed tomography (I123-IMP SPECT) and child neurology

    International Nuclear Information System (INIS)

    We studied the clinical usefulness of I123-IMP SPECT in 50 pediatric patients with CNS disorders, which were categorized into the convulsive disorder group (n=20), the cerebrovascular disorder group (n=10), the acute encephalopathy or CNS infection group (n=10), the metabolic or degenerative disorder group (n=6), the congenital abnormality group (n=2) and the migraine group (n=2). The findings obtained were compared with those of cranial CT. I123-IMP SPECT revealed abnormal findings in 45 out of the 50 patients (90%), although cranial CT showed abnormal findings in only 24 patients (48%). This difference was statistically significant (p123-IMP SPECT showed focal abnormalities in 26 patients (93%). Moreover in many patients with focal neurological abnormalities, we found focal abnormalities of I123-IMP SPECT related with neurological abnormalities of the patients. From these findings, we think I123-IMP SPECT might be superior to CT scanning in examining a localized lesion. It was found that in many patients with focal abnormalities in CT scanning, I123-IMP SPECT showed larger abnormalities in CT scanning. By using I123-IMP SPECT we might be able to study the blood perfusional state surrounding the abnormal area shown by CT. In 3 patients with acute cerebrovascular disorders, I123-IMP SPECT revealed abnormal findings 3 to 11 days earlier than cranial CT. I123-IMP SPECT might be useful for early recognition of the pathological state. From these experiences, we concluded that I123-IMP SPECT was useful for studying the pathophysiology of CNS disorders in children. (author)

  18. Selective toxicity of rhodamine 123 in carcinoma cells in vitro. (United States)

    Lampidis, T J; Bernal, S D; Summerhayes, I C; Chen, L B


    The study of mitochondria in situ has recently been facilitated through the use of rhodamine 123, a mitochondrial-specific fluorescent dye. It has been found to be nontoxic when applied for short periods to a variety of cell types and has thus become an invaluable tool for examining mitochondrial morphology and function in the intact living cell. In this report, however, we demonstrate that with continuous exposure, rhodamine 123 selectively kills carcinoma as compared to normal epithelial cells grown in vitro. At doses of rhodamine 123 which were toxic to carcinoma cells, the conversion of mitochondrial-specific to cytoplasmic-nonspecific localization of the drug was observed prior to cell death. At 10 microgram/ml, greater than 50% cell death occurred within 7 days in all nine of the carcinoma cell types and lines of different origin studied, while six of six normal epithelial cell types and lines remained unaffected. Cotreating carcinoma cells with 2-deoxyglucose and rhodamine 123 enhanced the inhibition of growth by rhodamine 123 alone in clonogenic survival assays. The observation of the selective toxicity of rhodamine 123 appears to be unique in view of the absence of selective toxicity reported in vitro for the various antitumor agents currently in clinical use. Preliminary results with rhodamine 123 in animal tumor systems indicate antitumor activity for carcinomas.

  19. Cadmium exposure induces hematuria in Korean adults

    International Nuclear Information System (INIS)

    Introduction: Toxic heavy metals have adverse effects on human health. However, the risk of hematuria caused by heavy metal exposure has not been evaluated. Methods: Data from 4701 Korean adults were obtained in the Korean National Health and Nutritional Examination Survey (2008–2010). Blood levels of the toxic heavy metals cadmium, lead, and mercury were measured. Hematuria was defined as a result of ≥+1 on a urine dipstick test. The odds ratios (ORs) for hematuria were measured according to the blood heavy metal levels after adjusting for multiple variables. Results: Individuals with blood cadmium levels in the 3rd and 4th quartiles had a greater OR for hematuria than those in the 1st quartile group: 3rd quartile, 1.35 (1.019–1.777; P=0.037); 4th quartile, 1.52 (1.140–2.017; P=0.004). When blood cadmium was considered as a log-transformed continuous variable, the correlation between blood cadmium and hematuria was significant: OR, 1.97 (1.224–3.160; Ptrend=0.005). In contrast, no significant correlations between hematuria and blood lead or mercury were found in the multivariate analyses. Discussion: The present study shows that high cadmium exposure is associated with a risk of hematuria. -- Highlights: • A high level of blood cadmium is associated with a high risk of hematuria. • This correlation is independent of several confounding factors. • Blood levels of lead and mercury are not associated with risk of hematuria. • This is the first study on the correlation between cadmium exposure and hematuria risk

  20. Cadmium exposure induces hematuria in Korean adults

    Energy Technology Data Exchange (ETDEWEB)

    Han, Seung Seok [Department of Internal Medicine, Seoul National University College of Medicine, Seoul 110-744 (Korea, Republic of); Kim, Myounghee, E-mail: [Department of Dental Hygiene, College of Health Science, Eulji University, Gyeonggi-do 461-713 (Korea, Republic of); Lee, Su Mi [Department of Internal Medicine, Seoul National University College of Medicine, Seoul 110-744 (Korea, Republic of); Lee, Jung Pyo [Department of Internal Medicine, Seoul National University Boramae Medical Center, Seoul 156-707 (Korea, Republic of); Kim, Sejoong [Department of Internal Medicine, Seoul National University Bundang Hospital, Gyeonggi-do 463-707 (Korea, Republic of); Joo, Kwon Wook [Department of Internal Medicine, Seoul National University College of Medicine, Seoul 110-744 (Korea, Republic of); Lim, Chun Soo [Department of Internal Medicine, Seoul National University Boramae Medical Center, Seoul 156-707 (Korea, Republic of); Kim, Yon Su; Kim, Dong Ki [Department of Internal Medicine, Seoul National University College of Medicine, Seoul 110-744 (Korea, Republic of)


    Introduction: Toxic heavy metals have adverse effects on human health. However, the risk of hematuria caused by heavy metal exposure has not been evaluated. Methods: Data from 4701 Korean adults were obtained in the Korean National Health and Nutritional Examination Survey (2008–2010). Blood levels of the toxic heavy metals cadmium, lead, and mercury were measured. Hematuria was defined as a result of ≥+1 on a urine dipstick test. The odds ratios (ORs) for hematuria were measured according to the blood heavy metal levels after adjusting for multiple variables. Results: Individuals with blood cadmium levels in the 3rd and 4th quartiles had a greater OR for hematuria than those in the 1st quartile group: 3rd quartile, 1.35 (1.019–1.777; P=0.037); 4th quartile, 1.52 (1.140–2.017; P=0.004). When blood cadmium was considered as a log-transformed continuous variable, the correlation between blood cadmium and hematuria was significant: OR, 1.97 (1.224–3.160; P{sub trend}=0.005). In contrast, no significant correlations between hematuria and blood lead or mercury were found in the multivariate analyses. Discussion: The present study shows that high cadmium exposure is associated with a risk of hematuria. -- Highlights: • A high level of blood cadmium is associated with a high risk of hematuria. • This correlation is independent of several confounding factors. • Blood levels of lead and mercury are not associated with risk of hematuria. • This is the first study on the correlation between cadmium exposure and hematuria risk.

  1. Hazards to wildlife from soil-borne cadmium reconsidered (United States)

    Beyer, W.N.


    Cadmium is a toxic element that should be included in environmental risk assessments of contaminated soils. This paper argues, however, that hazards to wildlife from cadmium have often been overstated. The literature contains only meager evidence that wild animals have been seriously harmed by cadmium, even at severely contaminated sites. Although some researchers have reported that wildlife have accumulated concentrations of cadmium in their kidneys that were above suggested injury thresholds, the thresholds may be disputed, since they were well below the World Health Organization criterion of 200 mg/kg (wet weight) of cadmium in the renal cortex for protecting human health. Recent risk assessments have concluded that soil cadmium concentrations less than 1 mg/kg are toxic to soil organisms and wildlife, which implies that background concentrations of cadmium naturally found in soils are hazardous. An examination of the databases used to support these assessments suggested that the toxicity of cadmium has been exaggerated.

  2. On the effect of thallium additions on cadmium amalgam potentials

    International Nuclear Information System (INIS)

    A study has been made of the influence of additives of thallium on potentials of cadmium amalgams with thallium contents of 10, 20, 30, and 40 at.% at 20, 40, 60, and 80 deg C. Additives of thallium have been found to shift the potential of cadmium amalgams towards the range of negative values which indicates an increase in the activity of cadmium. A possibility of calculation of the potential shift for heterogeneous cadmium amalgams on introducing thallium has been shown

  3. Recycling of Spent Nickel-Cadmium Batteries

    Institute of Scientific and Technical Information of China (English)


    A technique for recycling spent nickel-cadmium batteries, which makes separation of cadmium and nickel possible, is developed by laboratory-scale experiments. NH3-H2CO3 aqueous solution was used in this leaching technique. Since neutralization and/or solvent extraction were not required in the separation procedure of nickel and cadmium, the closed systemization of the process becomes possible. Experimental results show that, (1) if the NH3 concentration of leaching solution is sufficiently high and the ratio of H2CO3 to NH3 is properly adjusted, both Ni(OH)2 and Cd(OH)2 react with NH3 and quickly dissolve into leaching solution, and (2) Ni(OH)2 can be converted into insoluble NiO by calcination at 500€癈, and CdO from Cd(OH)2 by calcination maintains good solubility in NH3-H2CO3 aqueous solution. As a conclusion, the recycling technique characterized by two step leaching can be developed based on such changes in dissolution behavior by calcination. Meanwhile, the yields of 99.8% for nickel and 97.6% for cadmium are obtained, and the purities of recovered nickel and cadmium are 99.9% and 98.6%, respectively.

  4. Effect of anions on Toxicity of Cadmium Applied to MIcrobial Biomass in Red Soil

    Institute of Scientific and Technical Information of China (English)



    A laboratory incubation experiment was conducted to elucidat the effects of associated anions on toxicity of cadmium applied to microbial biomass in the red soil. Cadmium was applied at six different levels,i.e.,O(background),5,15,30,60 and 100μg g-1 soil in the form of either cadmium acetate or cadmium chloride. Application of cadmium as cadmium acetate markedly reduced the soil microbial biomass carbon compared to cadmium applied as cadmium chlorde at all the tested levels.Similarly,organic carbon to biomass carbon ration in the soil was markedly increased by increasing the level of the cadmium in the soil as cadmium acetate,while the change wa much smaller in the case of cadmium chloride at the same cadmium levels.The results suggested that due consideration should be given to the source of cadmium while deciding the cadmium levles in experiments.

  5. Cadmium induces cadmium-tolerant gene expression in the filamentous fungus Trichoderma harzianum. (United States)

    Cacciola, Santa O; Puglisi, Ivana; Faedda, Roberto; Sanzaro, Vincenzo; Pane, Antonella; Lo Piero, Angela R; Evoli, Maria; Petrone, Goffredo


    The filamentous fungus Trichoderma harzianum, strain IMI 393899, was able to grow in the presence of the heavy metals cadmium and mercury. The main objective of this research was to study the molecular mechanisms underlying the tolerance of the fungus T. harzianum to cadmium. The suppression subtractive hybridization (SSH) method was used for the characterization of the genes of T. harzianum implicated in cadmium tolerance compared with those expressed in the response to the stress induced by mercury. Finally, the effects of cadmium exposure were also validated by measuring the expression levels of the putative genes coding for a glucose transporter, a plasma membrane ATPase, a Cd(2+)/Zn(2+) transporter protein and a two-component system sensor histidine kinase YcbA, by real-time-PCR. By using the aforementioned SSH strategy, it was possible to identify 108 differentially expressed genes of the strain IMI 393899 of T. harzianum grown in a mineral substrate with the addition of cadmium. The expressed sequence tags identified by SSH technique were encoding different genes that may be involved in different biological processes, including those associated to primary and secondary metabolism, intracellular transport, transcription factors, cell defence, signal transduction, DNA metabolism, cell growth and protein synthesis. Finally, the results show that in the mechanism of tolerance to cadmium a possible signal transduction pathway could activate a Cd(2+)/Zn(2+) transporter protein and/or a plasma membrane ATPase that could be involved in the compartmentalization of cadmium inside the cell. PMID:26349455

  6. Cadmium-113m as a biogeochemical tracer for cadmium in Lake Michigan

    International Nuclear Information System (INIS)

    The Lake Michigan watershed has been sampled for 113mCd. This long-lived metastable isotope of cadmium allowed independent evaluation of cadmium distribution in this dynamic ecosystem. 113mCd analysis was not hampered by contamination or loss. These are problems which have plagued stable cadmium measurements. Sensitivity and specificity were necessary concerns. 113mCd has been preconcentrated from large samples in order to obtain sufficient activity for quantification. Specificity for the gross beta activity measured was secured in a rigorous ion exchange decontamination. Confirmation of the suspected 113mCd beta source was checked by reverse tracer analysis and modified Feather analysis range-energy relationships. The 113mCd activities confirm the expected semiconservative behavior for cadmium. This behavior manifests itself in a long residence time for cadmium in Lake Michigan. The inefficiency of outflow removal, the low sedimentation rate and the unquantified sediment resuspension and release of cadmium are factors contributing to this residence time. Steady state concentration of cadmium in Lake Michigan will increase if present input rates persist

  7. 19 CFR 123.73 - Application to participate. (United States)


    ... TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Land Border Carrier Initiative Program § 123.73... crime involving theft or smuggling or investigations into such crimes, or other dishonest conduct on...

  8. Reduction of Cadmium Uptake of Rice Plants Using Soil Amendments in High Cadmium Contaminated Soil: A Pot Experiment

    Directory of Open Access Journals (Sweden)

    Dian Siswanto


    Full Text Available The aims of this study were to investigate the effect of agricultural residues on reducing cadmium uptake in rice plants. The rice plants growing on no cadmium/free cadmium soils (N, Cd soils (Cds, and Cd soils each amended with 1% w/w of coir pith (CP, coir pith modified with sodium hydroxide (CPm and corncob (CC under high cadmium contaminated soil with an average 145 mg Cd kg-1 soil were investigated. The results showed that the cumulative transpiration of rice grown in various treatments under high cadmium contaminated soil followed the order: Cds > CPm ≥ CP ≥ CC. These transpirations directly influenced cadmium accumulation in shoots and husks of rice plants. The CC and CP seemed to work to reduce the cadmium uptake by rice plants indicated by accumulated cadmium in the husk that were 2.47 and 7.38 mg Cd kg-1 dry weight, respectively. Overall, transpiration tended to drive cadmium accumulation in plants for rice grown in high cadmium contaminated soil. The more that plants uptake cadmium, the lower cadmium that remains in the soil.

  9. 123I-metaiodobenzylguanidine myocardial scintigraphy in Parkinson's disease


    Orimo, S; Ozawa, E; Nakade, S; Sugimoto, T.; Mizusawa, H


    OBJECTIVES—123I-metaiodobenzylguanidine (MIBG) myocardial scintigraphy is clinically used to estimate local myocardial sympathetic nerve damage in some forms of heart disease, autonomic nerve disturbance in diabetic neuropathy, and disturbance of the autonomic nervous system in neurodegenerative disease. In the present study, examinations were performed to clarify (1) the proportion of cardiac sympathetic nerve disturbance in Parkinson's disease, (2) the usefulness of 123...

  10. Bireactor Electronuclear Systems with Liquid Cadmium Valve

    CERN Document Server

    Bznuni, S A; Zhamkochyan, V M; ASosnin, A N; Polanski, A; Khudaverdyan, A H


    Three main types of bireactor electronuclear systems are discussed. From the point of view of assuring high level of functional characteristics and safety bireactor electronuclear systems with booster using enriched uranium (20 %) and with a liquid cadmium valve appears to be the most effective. It is shown by means of Monte-Carlo modeling that such operation conditions can be achieved which lead to the destruction of the intermediate cadmium layer making the systems supercritical (k_{eff}>1). One can avoid the problem by using a special design of the liquid cadmium valve. In comparison with other nuclear systems (critical reactors, one-reactor electronuclear systems) cascade electronuclear systems have essential advantages allowing the decrease of the proton beam current by one order of magnitude and providing at same time the necessary level of power generation and neutron flux. Availability of both the thermal and fast cones allows one to transmute not only transuranics but also the fission products - cesi...


    Directory of Open Access Journals (Sweden)

    P. Bala Ramudu


    Full Text Available This paper presents the results of an experimental research undertaken to evaluate different purging solutions to enhance the removal of cadmium from spiked contaminated field soil by electrokinetic remediation. Three experiments were conducted when soil was saturated with deionised water and subsequently deionised water, ammonium citrate and sodium citrate were used as purging solutions at anode end. One experiment was conducted when the soil was saturated with ammonium citrate and itself was used as the purging solution. Results showed that 49% reduction of cadmium concentration was achieved in the case of soil saturated (washed with ammonium citrate as well as purging solution also was ammonium citrate. The soil pH and washing solutions were the most important factors in controlling the removal of cadmium in electrokinetic remediation process.

  12. Increased cadmium and lead uptake of a cadmium hyperaccumulator tomato by cadmium-resistant bacteria. (United States)

    He, Lin-Yan; Chen, Zhao-Jin; Ren, Gai-Di; Zhang, Yan-Feng; Qian, Meng; Sheng, Xia-Fang


    Two cadmium (Cd)-resistant strains Pseudomonas sp. RJ10 and Bacillus sp. RJ16 were investigated for their effects on the soil Cd and lead (Pb) solubilization and promotion of plant growth and Cd and Pb uptakes of a Cd-hyperaccumulator tomato. In the heavy metal-contaminated inoculated soil, the CaCl(2)-extractable Cd and Pb were increased by 58-104% and 67-93%, respectively, compared to the uninoculation control. The bacteria produced indole acetic acid, siderophore and 1-aminocyclopropane-1-carboxylate deaminase. Root elongation assay conducted on tomato under gnotobiotic conditions demonstrated increase in root elongation of inoculated tomato seedlings compared to the control plants. An increase in Cd and Pb contents of above-ground tissues varied from 92% to 113% and from 73% to 79% in inoculated plants growing in heavy metal-contaminated soil compared to the uninoculation control, respectively. These results show that the bacteria could be exploited for bacteria enhanced-phytoextraction of Cd- and Pb-polluted soils. PMID:19368973

  13. Treatment of cadmium dust with two-stage leaching process

    Institute of Scientific and Technical Information of China (English)


    The treatment of cadmium dust with a two-stage leaching process was investigated to replace the existing sulphation roast-leaching processes. The process parameters in the first stage leaching were basically similar to the neutralleaching in zinc hydrometallurgy. The effects of process parameters in the second stage leaching on the extraction of zincand cadmium were mainly studied. The experimental results indicated that zinc and cadmium could be efficiently recoveredfrom the cadmium dust by two-stage leaching process. The extraction percentages of zinc and cadmium in two stage leach-ing reached 95% and 88% respectively under the optimum conditions. The total extraction percentage of Zn and Cdreached 94%.

  14. Cadmium toxicity in the free-living nematode, Caenorhabditis elegans

    Energy Technology Data Exchange (ETDEWEB)

    Popham, J.D.; Webster, J.M.


    The effect of cadmium on the fecundity, growth, and fine structure of the free-living nematode Caenorhabditis elegans was studied. High concentrations of cadmium significantly decreased the fecundity and growth of these organisms. Electron microscopy showed that cadmium modifies the structure of the mitochondria in the esophagus and intestine, causes the formation of inclusion bodies in the nucleus of esophageal cells, and alters the morphology of cytosomes in the intestinal cells. The results suggest that the decreased fecundity and growth of cadmium-exposed C. elegans may be due to cadmium interfering with nutrient uptake or assimilation or both.

  15. Thermodynamic properties of cadmium in lead amalgam dilute solution

    International Nuclear Information System (INIS)

    Investigation of thermodynamic properties of cadmium dilute solutions in lead amalgam is carried out by means of electromotive force technique within 453-523 K temperature range. Cadmium thermodynamic functions are calculated: activity, activity ratio, Libbs partial energy and its excess value and integral characteristics, respectively. When changing cadmium content from 0.01 up to 0.1 χcd at T=473 K, logarithm of activity ratio does not depend on alloy composition, that is, Heury's law is fulfilled. Increase of cadmium content in amalgam results in the essential reduction of mercury and cadmium reaction

  16. Urinary excretion of cadmium and zinc among persons from Sweden

    Energy Technology Data Exchange (ETDEWEB)

    Elinder, C.G.; Kjellstrom, T.; Linnman, L.; Pershagen, G.


    Cadmium and zinc concentrations in the urine of 132 Swedes, including 50 pairs of identical twins, were measured. Atomic absorption spectrophotometry procedures were developed for the analysis. Cadmium concentration increased with age and was higher among smokers than among nonsmokers. Estimated 24-hr excretion of cadmium among nonsmokers increased from about 0.25 to 0.40 in persons from 20 to 70 years old. The 24-hr cadmium excretions among nonsmokers in different age-groups fitted better to total kidney burden than to daily cadmium intake from food. Zinc excretion, on the other hand, decreased after the age of 20.

  17. Ginkgo biloba extract alters the binding of the sodium [123I] iodide (Na123I) on blood constituents

    International Nuclear Information System (INIS)

    We evaluated the in vitro effect of an aqueous extract of Ginkgo biloba (EGb) on the distribution in blood cells (BC) and plasma (P) and on the binding of Na123I to the blood constituents using precipitation with trichloroacetic acid. The radioactivity percentages insoluble (SF) and insoluble fraction (IF) of blood constituents were determined. The EGb interfered (p123I in the P (from 69.64 to 86.13) and BC (from 30.36 to 13.87) and altered the fixation of the Na123I in IF-P and in IF-BC. - Highlights: ► Interaction between the Ginkgo biloba and blood constituents radiolabeled. ► Modification of the binding of sodium iodide (Na123I) to the blood constituents. ► This alteration should have influence in a diagnosis of nuclear medicine.

  18. Growth conditions and properties of Y123/Y211 and Y123/Y2O3 bulks (United States)

    Radušovská, M.; Volochová, D.; Antal, V.; Piovarči, S.; Diko, P.


    The single-grain YBCO samples were prepared by TSMG process. Two nominal compositions: 1 mol.Y123 + 0.25 mol.Y2O3 + 1.0 wt.% CeO2 (Y123/Y2O3) or 70 wt.% Y-123 + 30 wt.% Y-211 (Y123/Y211) and 1.0 wt.% CeO2 and two different types of substrates were tested. It is shown that the growth rate in both systems is influenced by segregation of CuO in to the nonsolidified part of the sample what causes stop of isothermal growth. Measured melt losses are lower for ZrO2 substrate than for Y2O3/Yb2O3 substrate what influence final microstructure of prepared bulk superconductors.

  19. Cadmium telluride quantum dots advances and applications

    CERN Document Server

    Donegan, John


    Optical Properties of Bulk and Nanocrystalline Cadmium Telluride, Núñez Fernández and M.I. VasilevskiyAqueous Synthesis of Colloidal CdTe Nanocrystals, V. Lesnyak, N. Gaponik, and A. EychmüllerAssemblies of Thiol-Capped CdTe Nanocrystals, N. GaponikFörster Resonant Energy Transfer in CdTe Nanocrystal Quantum Dot Structures, M. Lunz and A.L. BradleyEmission of CdTe Nanocrystals Coupled to Microcavities, Y.P. Rakovich and J.F. DoneganBiological Applications of Cadmium Telluride Semiconductor Quantum Dots, A. Le Cign

  20. Elektrokemisk fjernelse af cadmium fra bioasker

    DEFF Research Database (Denmark)

    Pedersen, Anne Juul; Ottosen, Lisbeth M.; Simonsen, Peter;

    Posteren viser resultater fra elektrokemiske rensningsforsøg på bioasker udført i forbindelse med PSO projekt 5205 "Elektrokemisk fjernelse af cadmium fra bioasker i pilotskala og vurdering af mulighederne for nyttiggørelse af behandlet aske i beton".......Posteren viser resultater fra elektrokemiske rensningsforsøg på bioasker udført i forbindelse med PSO projekt 5205 "Elektrokemisk fjernelse af cadmium fra bioasker i pilotskala og vurdering af mulighederne for nyttiggørelse af behandlet aske i beton"....

  1. Cadmium exposure and pancreatic cancer in south Louisiana. (United States)

    Luckett, Brian G; Su, L Joseph; Rood, Jennifer C; Fontham, Elizabeth T H


    Cadmium has been hypothesized to be a pancreatic carcinogen. We test the hypothesis that cadmium exposure is a risk factor for pancreatic cancer with a population-based case-control study sampled from a population with persistently high rates of pancreatic cancer (south Louisiana). We tested potential dietary and nondietary sources of cadmium for their association with urinary cadmium concentrations which reflect long-term exposure to cadmium due to the accumulation of cadmium in the kidney cortex. Increasing urinary cadmium concentrations were significantly associated with an increasing risk of pancreatic cancer (2nd quartile OR = 3.34, 3rd = 5.58, 4th = 7.70; test for trend P ≤ 0.0001). Potential sources of cadmium exposure, as documented in the scientific literature, found to be statistically significantly associated with increased risk of pancreatic cancer included working as a plumber, pipefitter or welder (OR = 5.88) and high consumption levels of red meat (4th quartile OR = 6.18) and grains (4th quartile OR = 3.38). Current cigarette smoking, at least 80 pack years of smoking, occupational exposure to cadmium and paints, working in a shipyard, and high consumption of grains were found to be statistically significantly associated with increased concentrations of urinary cadmium. This study provides epidemiologic evidence that cadmium is a potential human pancreatic carcinogen. PMID:23319964

  2. Cadmium Exposure and Pancreatic Cancer in South Louisiana

    Directory of Open Access Journals (Sweden)

    Brian G. Luckett


    Full Text Available Cadmium has been hypothesized to be a pancreatic carcinogen. We test the hypothesis that cadmium exposure is a risk factor for pancreatic cancer with a population-based case-control study sampled from a population with persistently high rates of pancreatic cancer (south Louisiana. We tested potential dietary and nondietary sources of cadmium for their association with urinary cadmium concentrations which reflect long-term exposure to cadmium due to the accumulation of cadmium in the kidney cortex. Increasing urinary cadmium concentrations were significantly associated with an increasing risk of pancreatic cancer (2nd quartile OR = 3.34, 3rd = 5.58, 4th = 7.70; test for trend P≤0.0001. Potential sources of cadmium exposure, as documented in the scientific literature, found to be statistically significantly associated with increased risk of pancreatic cancer included working as a plumber, pipefitter or welder (OR = 5.88 and high consumption levels of red meat (4th quartile OR = 6.18 and grains (4th quartile OR = 3.38. Current cigarette smoking, at least 80 pack years of smoking, occupational exposure to cadmium and paints, working in a shipyard, and high consumption of grains were found to be statistically significantly associated with increased concentrations of urinary cadmium. This study provides epidemiologic evidence that cadmium is a potential human pancreatic carcinogen.

  3. 40 CFR 123.36 - Establishment of technical standards for concentrated animal feeding operations. (United States)


    ... for concentrated animal feeding operations. 123.36 Section 123.36 Protection of Environment... § 123.36 Establishment of technical standards for concentrated animal feeding operations. If the State... CFR 412.4(c)(2), the Director shall establish such standards by the date specified in § 123.62(e)....

  4. Study of cadmium electrochemical deposition in sulfate medium

    Energy Technology Data Exchange (ETDEWEB)

    Montiel, T.; Solorza, O.; Sanchez, H.


    The cadmium electrochemical deposition process from sulfate medium was studied by means of different electrochemical techniques in both stationary and nonstationary diffusion regimes. The kinetics of the electrochemical reduction of cadmium on solid cadmium electrodes was examined and the kinetic parameters are presented, as well as the diffusion coefficient derived from the different techniques. Temperature has an important effect on the cadmium reduction kinetics, and the activation energy of the process was evaluated. The electrochemical deposition of cadmium is a complex process due to the coexistence of adsorption and nucleation processes; the adsorbed electroactive species appears to be Cd{sup +2}, and a mechanism for cadmium electrodeposition on solid cadmium electrodes is proposed.

  5. Murine strain differences and the effects of zinc on cadmium concentrations in tissues after acute cadmium exposure

    Energy Technology Data Exchange (ETDEWEB)

    King, L.M. [ARS USDA, Germplasm and Gamete Physiology Lab., Beltsville, MD (United States); Anderson, M.B. [Dept. of Anatomy, Tulane Univ. School of Medicine, New Orleans, LA (United States); Sikka, S.C. [Dept. of Urology, Tulane Univ. School of Medicine, New Orleans, LA (United States); George, W.J. [Dept. of Pharmacology, Tulane Univ. School of Medicine, New Orleans, LA (United States)


    The role of strain differences in cadmium tissue distribution was studied using sensitive (129/J) and resistant (A/J) mice. These murine strains have previously been shown to differ in their susceptibility to cadmium-induced testicular toxicity. Cadmium concentration was measured in testis, epididymis, seminal vesicle, liver, and kidney at 24 h after cadmium chloride exposure (4, 10, and 20 {mu}mol/kg CdCl{sub 2}). The 129/J mice exhibited a significant increase in cadmium concentration in testis, epididymis, and seminal vesicle at all cadmium doses used, compared to A/J mice. However, cadmium concentrations in liver and kidney were not different between the strains, at any dose, indicating that cadmium uptake is similar in these organs at 24 h. These murine strains demonstrate similar hepatic and renal cadmium uptake but significantly different cadmium accumulation in the reproductive organs at 24 h. The mechanism of the protective effect of zinc on cadmium toxicity was studied by assessing the impact of zinc acetate (ZnAc) treatment on cadmium concentrations in 129/J mice after 24 h. Zinc pretreatment (250 {mu}mol/kg ZnAc), given 24 h prior to 20 {mu}mol/kg CdCl{sub 2} administration, significantly decreased the amount of cadmium in the testis, epididymis, and seminal vesicle of 129/J mice, and significantly increased the cadmium content of the liver after 24 h. Cadmium levels in the kidney were unaffected at this time. Zinc pretreatment also prevented the cadmium-induced decrease in testicular sperm concentration and epididymal sperm motility seen in 129/J mice. These findings suggest that the differences in the two murine strains may be attributed partly to the differential accumulation of cadmium in murine gonads. This may be caused by strain differences in the specificity of cadmium transport mechanisms. The protective role of zinc in cadmium-induced testicular toxicity in the sensitive strain may be due to an interference in the cadmium uptake by susceptible

  6. Effects of bacteria on cadmium bioaccumulation in the cadmium hyperaccumulator plant Beta vulgaris var. cicla L. (United States)

    Chen, Su; Chao, Lei; Sun, Lina; Sun, Tieheng


    To investigate the effects of two cadmium-tolerant bacteria, Staphylococcus pasteuri (S. pasteuri X1) and Agrobacterium tumefaciens (A. tumefaciens X2), on cadmium uptake by the cadmium hyperaccumulator plant Beta vulgaris var. cicla L., a pot experiment with artificially contaminated soil was conducted. The results demonstrated that both cadmium-tolerant bacteria enhanced the dry weight of Beta vulgaris var. cicla L. The total dry weights of plants in the control CK20, S. pasteuri X1 and A. tumefaciens X2 treatments were 0.85, 1.13, and 1.38 g/pot, respectively. Compared with the control CK20 findings, the total dry weight of plants was increased by 32.8 and 61.1% after inoculation with S. pasteuri X1 and A. tumefaciens X2, respectively, indicating that A. tumefaciens X2 more strongly promoted the growth of Beta vulgaris var. cicla L. than S. pasteuri X1. In addition, inoculation with S. pasteuri X1 and A. tumefaciens X2 significantly (p < 0.05) promoted cadmium uptake by plants and improved the bioaccumulation of cadmium by the plants from the soil. Moreover, the inoculation of S. pasteuri X1 and A. tumefaciens X2 effectively facilitated the transfer of cadmium in the soil from the Fe-Mn oxide and residual fractions to the soluble plus exchangeable and weakly specially adsorbed fractions in the rhizosphere soils of plants. The bacterial enhancement of cadmium phytoavailability might provide a potential and promising method to increase the efficiency of phytoextraction. PMID:23488173

  7. Urinary cadmium and estimated dietary cadmium in the Women's Health Initiative. (United States)

    Quraishi, Sabah M; Adams, Scott V; Shafer, Martin; Meliker, Jaymie R; Li, Wenjun; Luo, Juhua; Neuhouser, Marian L; Newcomb, Polly A


    Cadmium, a heavy metal dispersed in the environment as a result of industrial and agricultural applications, has been implicated in several human diseases including renal disease, cancers, and compromised bone health. In the general population, the predominant sources of cadmium exposure are tobacco and diet. Urinary cadmium (uCd) reflects long-term exposure and has been frequently used to assess cadmium exposure in epidemiological studies; estimated dietary intake of cadmium (dCd) has also been used in several studies. The validity of dCd in comparison with uCd is unclear. This study aimed to compare dCd, estimated from food frequency questionnaires, to uCd measured in spot urine samples from 1,002 participants of the Women's Health Initiative. Using linear regression, we found that dCd was not statistically significantly associated with uCd (β=0.006, P-value=0.14). When stratified by smoking status, dCd was not significantly associated with uCd both in never smokers (β=0.006, P-value=0.09) and in ever smokers (β=0.003, P-value=0.67). Our results suggest that because of the lack of association between estimated dCd and measured uCd, dietary estimation of cadmium exposure should be used with caution in epidemiologic studies.


    Cadmium induced renal tubular dysfunction occurred where subsistence rice farmers produced their lifetime dietary rice on Zn-mine waste contaminated soils in Japan and other Asian countries. Research has shown that polished rice Cd is greatly increased while grain Zn is not incre...

  9. Field scale behaviour of cadmium in soil.

    NARCIS (Netherlands)

    Boekhold, A.E.


    Although total heavy metal contents of soil are often used to express the degree of contamination, they are of little value to judge environmental effects. The main objective of this thesis was to develop and test methodologies with which environmental risks of cadmium pollution of field soils can b

  10. Mobiliteit van cadmium in de bodem

    NARCIS (Netherlands)

    Chardon, W.J.


    The adsorption of cadmium by twelve Dutch soils was investigated under widely varying circumstances. The adsorption can be described with the Freundlich equation; the parameters of this equation can be predicted using the properties of the soil (pH, organic carbon and clay content).The adsorption ap

  11. Cadmium isotope variations in the Southern Ocean

    NARCIS (Netherlands)

    Xue, Z.; Rehkämper, M.; Horner, T.J.; Abouchami, W.; Middag, R.; van de Flierd, T.; de Baar, H.J.W.


    Cadmium concentrations and isotope compositions were determined for 47 seawater samples from the high nutrient low chlorophyll (HNLC) zone of the Atlantic sector of the Southern Ocean. The samples include 13 surface waters from a transect of the Weddell Gyre and 3 depth profiles from the Weddell Sea

  12. 123I and 13I purification for biomolecules labelling

    International Nuclear Information System (INIS)

    The 123I and 131I are iodine radioisotopes widely used in Nuclear Medicine. The radioisotope 123I is used in diagnosis through the SPECT technique and is routinely produced at IPEN in cyclotron through the reaction: '124Xe (p, 2n) '123Cs -> 123Xe -> 123I. The radioisotope 131I is used both in diagnosis and therapy due to its physical characteristics of decay by β- and its γ-ray emissions that are softened with the use of specific collimators for diagnosis. It is routinely produced at IPEN using the nuclear reactor through the indirect reaction: 130Te (n, γ) ->131Te -> 131I, irradiating compounds containing Te. The radiopharmaceuticals prepared with these radioisotopes go through rigorous quality control tests and the chemical purity of the primary radioisotopes 123I and 131I are within the permissible limits currently defined. However, the presence of some chemical contaminants can prejudice the biomolecules labeling (monoclonal antibodies and peptides), that will produce radiopharmaceuticals of first generation to the oncology area. The aim of this work was to obtain a new purification method of these radioisotopes, allowing the labeling of biomolecules and also to established a process control on those radioisotopes. The methodology was separated on 3 steps: Evaluation of '123I e 131I radionuclidic purity using a hyper pure germanium detector, chemical purity using ICP-OES and the retention and elution study of 131I in several absorbers to choose the most appropriate for the purification tests analyzing the behavior of the possible contaminants. The radionuclidic analyses showed the presence of Te and Co on 131I samples and Te, Tc e Co on 123I samples. The chemical purity analyses showed the presence of Al and Mo in 123I, coming from the window material of the target holder and the presence of Al and Te in 131I samples, coming from the target holder and the target, respectively. The retention and elution study selected the most promising adsorber to the

  13. 13 CFR 123.411 - What if SBA determines that your business loan request meets the selection criteria of § 123.409... (United States)


    ... business loan request meets the selection criteria of § 123.409 but SBA is unable to fund it because SBA has already allocated all program funds? 123.411 Section 123.411 Business Credit and Assistance SMALL... fund it because SBA has already allocated all program funds? If SBA determines that your business'...

  14. Cadmium phytoextraction potential of different Alyssum species

    Energy Technology Data Exchange (ETDEWEB)

    Barzanti, R., E-mail: [Department of Evolutionary Biology, Universita di Firenze, via Micheli 1, 50121 Firenze (Italy); Colzi, I., E-mail: [Department of Evolutionary Biology, Universita di Firenze, via Micheli 1, 50121 Firenze (Italy); Arnetoli, M., E-mail: [Department of Evolutionary Biology, Universita di Firenze, via Micheli 1, 50121 Firenze (Italy); Gallo, A., E-mail: [Department of Evolutionary Biology, Universita di Firenze, via Micheli 1, 50121 Firenze (Italy); Pignattelli, S., E-mail: [Department of Evolutionary Biology, Universita di Firenze, via Micheli 1, 50121 Firenze (Italy); Gabbrielli, R., E-mail: [Department of Evolutionary Biology, Universita di Firenze, via Micheli 1, 50121 Firenze (Italy); Gonnelli, C., E-mail: [Department of Evolutionary Biology, Universita di Firenze, via Micheli 1, 50121 Firenze (Italy)


    Highlights: Black-Right-Pointing-Pointer The possibility of using serpentine plants for phytoextraction of Cd was investigated. Black-Right-Pointing-Pointer Variation in Cd tolerance, accumulation and translocation in three Alyssum plants with different phenotypes were found. Black-Right-Pointing-Pointer Alyssum montanum showed higher Cd tolerance and accumulation than the Ni hyperaccumulator Alyssum bertolonii. Black-Right-Pointing-Pointer As for the kinetic parameters of the Cd uptake system, A. montanum presented a low apparent K{sub m} value. Black-Right-Pointing-Pointer The V{sub max} values were not significantly different among the plants. - Abstract: This work was planned for providing useful information about the possibility of using serpentine adapted plants for phytoextraction of cadmium, element scarcely represented in such metalliferous environment. To this aim, we investigated variation in cadmium tolerance, accumulation and translocation in three Alyssum plants with different phenotypes: Alyssum bertolonii, that is a serpentine endemic nickel hyperaccumulator, and two populations of Alyssum montanum, one adapted and one not adapted to serpentine soils. Plants were hydroponically cultivated in presence of increasing concentrations of CdSO{sub 4} for two weeks. For the metal concentration used in the experiments, the three different Alyssum populations showed variation in cadmium tolerance, accumulation and content. The serpentine adapted population of A. montanum showed statistically higher cadmium tolerance and accumulation than A. bertolonii and the population of A. montanum not adapted to serpentine soil thus deserving to be investigated for phytoextraction purposes. Furthermore, as for the kinetic parameters of the cadmium uptake system, A. montanum serpentine population presented a low apparent K{sub m} value, suggesting a high affinity for this metal of its uptake system, whereas the V{sub max} values were not significantly different among the

  15. Cadmium and Chrome Concentrations in Human Milk

    Directory of Open Access Journals (Sweden)

    Sima Nazarpour


    Full Text Available Introduction: Nutrition of children has the highest priority in any program aimed at children's health care. Milk contaminated with various toxic elements can have adverse effects on children's health. This study aimed to determine the concentration of heavy metals including cadmium(Cd and chromium (Cr of breast feeding women’s milk in Varamin. Methods: This is a cross sectional study. In the present study, chromium and cadmium levels in milk of 100 mothers attending clinics in the city of Varamin were measured in four to eight weeks after delivery, using atomic absorption spectrometry. Results: The mean values (±SD of Cd and Cr in human milk were 5±6.9 μg/ml and 3±2.7 μg/ml respectively. Result of Linear regression showed that cadmium levels were higher in breast milk of people living close to the factory or industrial center. Also, the chromium levels were higher in the breast milk of women in cases of: Smoking by spouses, consumption of imported rice, consumption of mineral water, and living close to the factory or an industrial center. Conclusion: This study showed that the relationship of some factors such as living near a factory or an industrial center, smoking by spouse, the type of consumed rice and water, with the level of cadmium and chromium. Cadmium and chromium levels of breast milk in this study were higher than the levels of these elements mentioned in the reviewed articles and international standard. Because some variables, such as living near a factory or an industrial center, smoking by spouse, the type of consumed rice and water can affect the amount of entering elements in breast milk. Actions can be taken to reduce or eliminate these variables in order to decrease the mentioned elements in human milk.

  16. Hepatoprotective activity of Moringa oleifera against cadmium toxicity in rats

    Directory of Open Access Journals (Sweden)

    Reetu Toppo


    Full Text Available Aim: The present investigation has been conducted to evaluate the hepatoprotective activity of Moringa oleifera against cadmium-induced toxicity in rats. Materials and Methods: For this study, 18 Wistar albino rats were taken. Control group, Group I rats were given cadmium chloride @ 200 ppm per kg and Group II rats were treated with M. oleifera extract @ 500 mg/kg along with cadmium chloride @ 200 ppm per kg (daily oral for 28 days. On 29th day, animals were slaughtered and various parameters were determined. Serum biomarkers, oxidative stress parameters, histomorphological examination were carried out with estimation of cadmium concentration in liver tissues. Results: Oral administration of cadmium chloride @ 200 ppm/kg for 28 days resulted in a significant increase in aspartate aminotransferase (AST, alanine transaminase (ALT, alkaline phosphatase (ALP, significant (p≤0.01 increase of lipid peroxidation (LPO and decrease in superoxide dismutase (SOD, and increase in cadmium accumulation in liver. Treatment with M. oleifera @ 500 mg/kg significantly (p<0.01 decreased the elevated ALP, AST, ALT, LPO levels and increase in SOD levels, and as compared to cadmium chloride treated group. However, there was no significant difference in cadmium concentration in liver when compared with cadmium chloride treated group. Conclusion: The study conclude that supplementation of M. oleifera (500 mg/kg, daily oral for 28 days has shown protection against cadmium-induced hepatotoxicity.

  17. Modelling of Cadmium Transport in Soil-Crop System

    Institute of Scientific and Technical Information of China (English)


    A model for simulating cadmium transport in a soil-plant system was built using a commercial simu lating program named Powersim on the basis of input-output processes happening in the soil-plant system.Convective and dispersive transport processes of cadmium in soil profile are embedded. Simulations on a daily base have been done up to a total simulating time of 250 years. Results show that applications of sewage sludge and fertilizer at the simulated rates would only cause slight cadmium accumulations in each layer of the soil, and cadmium accumulation would be levelling off, reaching an equilibrium concentrations layer by layer downward after certain time. The time scale to reach an equilibrium concentration varies from 10 years for the top three layers to over 250 years for the bottom layers. Plant cadmium uptake would increase from 52 ug m-2 under initial soil cadmium concentrations to 65 μg m-2 under equilibrium soil cadmium concentrations, which would not exceed the maximum allowable cadmium concentration in wheat grains. Main parameters which influence cadmium accumulation and transport in soil are total cadmium input, rainfall, evaporation, plant uptake and soil properties.

  18. Collinear laser spectroscopy of atomic cadmium


    Frömmgen, Nadja; Balabanski, Dimiter L.; Bissell, Mark L.; Bieroń, Jacek; Blaum, Klaus; Cheal, Bradley; Flanagan, Kieran; Fritzsche, Stephan; Geppert, Christopher; Hammen, Michael; Kowalska, Magdalena; Kreim, Kim; Krieger, Andreas; Neugart, Rainer; Neyens, Gerda


    Hyperfine structure $A$ and $B$ factors of the atomic $5s\\,5p\\,\\; ^3\\rm{P}_2 \\rightarrow 5s\\,6s\\,\\; ^3\\rm{S}_1$ transition are determined from collinear laser spectroscopy data of $^{107-123}$Cd and $^{111m-123m}$Cd. Nuclear magnetic moments and electric quadrupole moments are extracted using reference dipole moments and calculated electric field gradients, respectively. The hyperfine structure anomaly for isotopes with $s_{1/2}$ and $d_{5/2}$ nuclear ground states and isomeric $h_{11/2}$ sta...

  19. Comparison of iodine-123 epidepride and iodine-123 IBZM for dopamine D{sub 2} receptor imaging in clinically non-functioning pituitary macroadenomas and macroprolactinomas

    Energy Technology Data Exchange (ETDEWEB)

    De Herder, W.W.; Lamberts, S.W.J. [Municipal Hospital Bergweg, Rotterdam (Netherlands). Dept. of Internal Medicine; Reijs, A.E.M.; De Swart, J.; Kaandorp, Y.; Kwekkeboom, D.J. [Department of Nuclear Medicine, University Hospital Rotterdam (Netherlands); Krenning, E.P. [Municipal Hospital Bergweg, Rotterdam (Netherlands). Dept. of Internal Medicine]|[Department of Nuclear Medicine, University Hospital Rotterdam (Netherlands)


    We compared pituitary iodine-123 epide- pride single-photon emission tomography (SPET) and {sup 123}I-IBZM SPET for the in vivo imaging of dopamine D{sub 2} receptors in 15 patients with clinically non-functioning pituitary adenomas. Four patients with dopamine agonist-sensitive macroprolactinomas were studied as positive controls. The uptake of radioactivity in the pituitary was established using a visual scoring system and an uptake index calculated by dividing the average count rates in the pituitary area by the average count rates in the cerebellum. All four macroprolactinomas showed specific binding of {sup 123}I-epidepride, but only one showed specific binding of {sup 123}I-IBZM. Specific binding of {sup 123}I-epidepride was demonstrated in 9 of the 15 clinically non-functioning pituitary adenomas (60%), but specific binding of {sup 123}I-IBZM was shown in only 6 of these 15 cases (40%). The uptake of {sup 123}I-epidepride in the pituitary region was consistently higher than that of {sup 123}I-IBZM. None of the patients who showed absence of uptake of {sup 123}I-epidepride in the pituitary area showed uptake of {sup 123}I-IBZM in this area. In conclusion: {sup 123}I-epidepride SPET is superior to {sup 123}I-IBZM SPET for the visualization of dopamine receptor-positive pituitary adenomas. Therefore, {sup 123}I-epidepride should replace {sup 123}I-IBZM for future D{sub 2} receptor SPET studies of pituitary adenomas. {sup 123}I-epidepride SPET potentially might serve to predict the response of clinically non-functioning pituitary adenomas to dopamine agonist therapy. (orig.) With 1 fig., 1 tab., 24 refs.

  20. Comparison of iodine-123 epidepride and iodine-123 IBZM for dopamine D2 receptor imaging in clinically non-functioning pituitary macroadenomas and macroprolactinomas

    International Nuclear Information System (INIS)

    We compared pituitary iodine-123 epide- pride single-photon emission tomography (SPET) and 123I-IBZM SPET for the in vivo imaging of dopamine D2 receptors in 15 patients with clinically non-functioning pituitary adenomas. Four patients with dopamine agonist-sensitive macroprolactinomas were studied as positive controls. The uptake of radioactivity in the pituitary was established using a visual scoring system and an uptake index calculated by dividing the average count rates in the pituitary area by the average count rates in the cerebellum. All four macroprolactinomas showed specific binding of 123I-epidepride, but only one showed specific binding of 123I-IBZM. Specific binding of 123I-epidepride was demonstrated in 9 of the 15 clinically non-functioning pituitary adenomas (60%), but specific binding of 123I-IBZM was shown in only 6 of these 15 cases (40%). The uptake of 123I-epidepride in the pituitary region was consistently higher than that of 123I-IBZM. None of the patients who showed absence of uptake of 123I-epidepride in the pituitary area showed uptake of 123I-IBZM in this area. In conclusion: 123I-epidepride SPET is superior to 123I-IBZM SPET for the visualization of dopamine receptor-positive pituitary adenomas. Therefore, 123I-epidepride should replace 123I-IBZM for future D2 receptor SPET studies of pituitary adenomas. 123I-epidepride SPET potentially might serve to predict the response of clinically non-functioning pituitary adenomas to dopamine agonist therapy. (orig.)

  1. Pulmonary inhalation scintigraphy using N-isopropyl-p-[123I]iodoamphetamine (123I-IMP) aerosol

    International Nuclear Information System (INIS)

    N-isopropyl-p-[123I]iodoamphetamine (123I-IMP) is lipophilic substance and permeates through the alveolar epithelium via intracellular transport, whereas 99mTc-DTPA is water-soluble substance and permeates through the alveolar epithelium via paracellular transport. We performed inhalation lung imaging using 123I-IMP and 99mTc-DTPA in order to assess alveolar epithelial permeability in 4 patients with restrictive ventilatory impairment, and 5 volunteers including one smoker. The time-activity (T/A) curves of 123I-IMP were well fitted into two compartments, first and slow, by least-squares fit technique, in contrast to 99mTc-DTPA fitted well with one compartment. In 4 normal volunteers, the T/A curves of the lower pulmonary fields declined faster than those of other pulmonary fields. In 99mTc-DTPA studies, the Kep values of patients with restrictive ventilatory impairment (n=4) were higher than those of normal volunteers (n=4) (2.14±0.30 x 10-4 vs 1.48±0.41 x 10-4, p123I-IMP studies, the Kep values of the patients were much lower than those of normal volunteers (6.79±0.55 x 10-5 vs 1.52±0.45 x 10-3, p<0.005). (author)

  2. SPECT imaging using [123I]β-CIT and [123I]IBF in extrapyramidal diseases

    International Nuclear Information System (INIS)

    Imaging of dopaminergic function is useful in the investigation of patients with Parkinson disease (iPD) and other extrapyramidal diseases. Using agents that bind to dopamine transporters ([123I]β-CIT) and receptors ([123I]IBF SPECT), we investigated SPECT in 9 healthy volunteers and 24 patients for dopamine transporters as well as 15 patients for dopamine receptors. In β-CIT SPECT studies, we examined 17 iPD patients (63.3±9.9 y/o), 3 multiple system atrophy (MSA) patients (olivopontocerebellar atrophy (OPCA) type) (64.0±8.0 y/o), 2 vascular parkinsonism (VP) patients (71.0±0.0 y/o), 1 progressive supranuclear palsy (PSP) patient (69 y/o), 1 cortico-basal degeneration (CBD) patient (50 y/o) and nine healthy controls (39.1±9.3 y/o). For IBF SPECT studies 11 iPD patients (60.6±10.9 y/o), 3 MSA patients (2 OPCA type (50.5±3.5 y/o) and 1 striatonigral degeneration (SND) type (65 y/o)) and 1 PSP patient (60 y/o) underwent SPECT scans after the injection of [123I]IBF. The specific to nonspecific striatal ratio (St/Oc-1), ratio of putaminal uptake to caudatal uptake (Pu/Ca), and asymmetry indices (AI) were estimated. β-CIT studies showed ST/Oc-1 as follows; iPD: 2.66±1.09 (n=17), VP: 5.73 and 7.39, MSA: 1.84±0.46 (n=3), PSP: 2.34, CBD: 2.16. In all extrapyramidal diseases except VP, St/Oc-1 ratios were significantly lower than those in normal volunteers (6.46±1.08) (p<0.01). Also in early-phase iPD patients (Yahr I-II), St/Oc-1 (3.16±1.49: n=4) was significantly lower than those in normal volunteers (p<0.01). In IBF studies, St/Oc-1 ratios were significantly higher in early-phase (Yahr I-II) iPD patients (1.82±0.25: n=5) than those in late-phase (Yahr III-IV) iPD patients (1.38±0.32: n=6) (p<0.05). The Pu/Ca ratios in iPD patients (1.12±0.13) and MSA (OPCA type) patients (0.95±0.05) were higher than that in MSA (SND type) patient (0.78) and were lower than that in PSP patient (1.55). In conclusion, β-CIT-SPECT is useful for the diagnosis of early

  3. I-123-insulin: A new marker for hepatoma

    Energy Technology Data Exchange (ETDEWEB)

    Sodoyez, J.C.; Goffaux, F.S.; Fallais, C.; Bourgeois, P.


    Previous studies have demonstrated that carrier-free I-123-Tyr Al4 insulin was taken up by the liver (by a saturable mechanism) and by the kidneys (by a non saturable mechanism). Autoradiographs of rat liver after injection of I-125-insulin showed that binding specifically occurred at the plasma membrane of the hepatocytes. I-123-Insulin binding to the hepatocyte plasma membrane appeared mediated by specific receptors. Indeed it was blocked by antibodies to the insulin receptors and by an excess of native insulin. Futhermore insulin derivatives with low biological potency (proinsulin and desoctapeptide insulin) did not inhibit I-123-insulin binding to the hepatocytes. I-123-Insulin (1.3 mCi) was I.V. injected into a patient in whom the right liver lobe was normal (normal uptake of Tc-99m-colloid sulfur) but the left liver lobe was occupied by a voluminous hepatoma (no uptake of Tc-99m-colloid sulfur). Liver blood supply was also studied by Tc-99m-pyrophosphate-labeled red cells. Computer analysis of the data revealed that compared to the normal liver lobe, binding of I-123-insulin to the hepatoma was more precocious (vascularization through the hepatic artery and not the portal vein), more intense and more prolonged (half-lives were 6 min in the normal liver and 14 min in the hepatoma). These results are consistent with characteristics of hepatoma cells in culture in which high insulin binding capacity contrasts with a markedly decreased insulin degrading activity. It is concluded that I-123-insulin may be used as a specific marker of hepatoma in man.

  4. I-123-insulin: A new marker for hepatoma

    International Nuclear Information System (INIS)

    Previous studies have demonstrated that carrier-free I-123-Tyr Al4 insulin was taken up by the liver (by a saturable mechanism) and by the kidneys (by a non saturable mechanism). Autoradiographs of rat liver after injection of I-125-insulin showed that binding specifically occurred at the plasma membrane of the hepatocytes. I-123-Insulin binding to the hepatocyte plasma membrane appeared mediated by specific receptors. Indeed it was blocked by antibodies to the insulin receptors and by an excess of native insulin. Futhermore insulin derivatives with low biological potency (proinsulin and desoctapeptide insulin) did not inhibit I-123-insulin binding to the hepatocytes. I-123-Insulin (1.3 mCi) was I.V. injected into a patient in whom the right liver lobe was normal (normal uptake of Tc-99m-colloid sulfur) but the left liver lobe was occupied by a voluminous hepatoma (no uptake of Tc-99m-colloid sulfur). Liver blood supply was also studied by Tc-99m-pyrophosphate-labeled red cells. Computer analysis of the data revealed that compared to the normal liver lobe, binding of I-123-insulin to the hepatoma was more precocious (vascularization through the hepatic artery and not the portal vein), more intense and more prolonged (half-lives were 6 min in the normal liver and 14 min in the hepatoma). These results are consistent with characteristics of hepatoma cells in culture in which high insulin binding capacity contrasts with a markedly decreased insulin degrading activity. It is concluded that I-123-insulin may be used as a specific marker of hepatoma in man

  5. Localization of a pheochromocytoma using I-123 MIBG adrenal scintigraphy.

    Directory of Open Access Journals (Sweden)

    Shirkare S


    Full Text Available In a patient with the clinical diagnosis of pheochromocytoma, the localization of the tumor is essential for planning treatment. Recently, we have performed I-123 metaiodobenzylguanidine (MIBG adrenal scintigraphy in a patient presenting with a history of paroxysmal hypertension. Scintigraphy accurately located an ectopic unilateral pheochromocytoma. The scintigraphic diagnosis was confirmed by surgery and a diagnosis of ectopic unilateral pheochromocytoma was made by histopathological examination. This case report illustrates the specific diagnosis of pheochromocytoma by I-123 MIBG scintigraphy which is especially useful when other diagnostic procedures are equivocal.

  6. Aluminum Dimer Containing Bulky 1,2,3-Triazolate Ligand

    Directory of Open Access Journals (Sweden)

    Issam Kobrsi


    Full Text Available The first molecular aluminum 1,2,3-triazolato complex was synthesized bearing a bulky 1,2,3-triazolate ligand. Oligomers and polymers were avoided due to the bulkiness and noncoordinating nature of the substituents. The novel Al2N4 ring formed contains symmetrical Al-N bond distances unexpectedly having asymmetric Al-N-N angles of 144.55(15° and 115.83(14°. This asymmetry demonstrates the effect of the steric hindrance of the ligand.

  7. Sup(123)I excretion in breast milk - additional data

    Energy Technology Data Exchange (ETDEWEB)

    Lawes, S.C. (Queen' s Medical Centre, Nottingham (United Kingdom))


    A woman with a suspected sublingual thyroid was referred for thyroid imaging with {sup 123}I-sodium iodide. On attending it was ascertained that she was currently breastfeeding her 3-month-old baby. Reference to the available literature showed little information regarding the excretion of {sup 123}I-sodium iodide in human breast milk apart from one single case. It was felt therefore that this would be an ideal opportunity to collect some useful data. Originally the presence of impurities in the radiopharmaceutical administered had been discounted as being of little significance. However, after consideration, a review of the contribution of any impurity was undertaken. (author).

  8. Assessment and management of risk to wildlife from cadmium

    International Nuclear Information System (INIS)

    Cadmium, a nonessential heavy metal that comes from natural and anthropogenic sources, is a teratogen, carcinogen, and a possible mutagen. Assessment of potential risk from cadmium requires understanding environmental exposure, mainly from ingestion, although there is some local exposure through inhalation. Chronic exposure is more problematic than acute exposure for wildlife. There is evidence for bioaccumulation, particularly in freshwater organisms, but evidence for biomagnification up the food chain is inconsistent; in some bird studies, cadmium levels were higher in species that are higher on the food chain than those that are lower. Some freshwater and marine invertebrates are more adversely affected by cadmium exposure than are birds and mammals. There is very little experimental laboratory research on the effects of cadmium in amphibians, birds and reptiles, and almost no data from studies of wildlife in nature. Managing the risk from cadmium to wildlife involves assessment (including ecological risk assessment), biomonitoring, setting benchmarks of effects, regulations and enforcement, and source reduction

  9. Study on electrokinetic remediation of cadmium contaminated soils

    Institute of Scientific and Technical Information of China (English)

    SHI Wen-xin; CUI Chong-wei; YU Shui-li; FENG Wei-ming


    Kaolinite from a lead-zinc mining district, which was spiked with cadmium, has been treated by electrokinetics to investigate effects of treatment time and applied voltage gradient. The results showed that the increased test duration had induced a higher removal rate of cadmium. Being treated for 7 days, cadmium was removed from kaolinite dramatically. It was also found that higher removal rate happened when a higher voltage gradient was applied and cadmium accumulated near the cathode because pH increased. Increase of pH near the cathode caused accumulation of cadmium. Moreover, it was observed that cation exchange membrane which was placed between kaolinite and cathode could make pH lower than the initial value and avoid the higher pH near the cathode. As a result, the high concentration accumulation of cadmium near the cathode was avoided.

  10. Research and Development of Cadmium Sulphoselenide Red Pigment

    Institute of Scientific and Technical Information of China (English)

    WU Jianfeng; LI Kun; XU Xiaohong; ZHANG Yaxiang; XU Xiaoyang; LAO Xinbin


    Cadmium sulphoselenide was synthesized continuous substitution solid solution and the only known pigment to yield bright red color on ceramic decoration. Encapsulated cadmium sulphoselenide pigments could yield abundant hues from yellow to red with high opacity at high temperature. The color generation has a linear function relation with the substitution rate. The encapsulation formation process of zirconium silicate encapsulated cadmium sulphoselenide was shown. Insufifcient encapsulation efifciency and potential hazard to human and environment had limited the industrial application of cadmium sulphoselenide red pigment. Ink-jet printing decoration required ifne size cadmium sulphoselenide red pigment on ceramic decoration. The review mainly focused on the synthesis techniques and industrial application of cadmium sulphoselenide red pigment.

  11. In search of biomonitors for cadmium: cadmium content of wild Swedish fauna during 1973-1976. (United States)

    Frank, A


    Forty-five species of birds and 22 species of mammals of the terrestrial and aquatic fauna, herbivores as well as carnivores, were investigated during the period 1973-1976 for cadmium-accumulating properties in order to find biomonitors for cadmium in the Swedish environment. The herbivores of the terrestrial fauna, birds as well as mammals, are preferred to carnivores, since they demonstrate generally higher renal Cd levels. The moose (Alces alces), roe deer (Capreolus capreolus) and hare (Lepus europeus and Lepus timidus) were found to be suitable as biomonitors because of their common occurrence and uniform geographical distribution. The eider duck (Somateria mollissima), although a short-distance migrating bird whose diet is composed mainly of mussels and crustaceans, and which lives along a great part of the Swedish coastline, is suggested as a biomonitor of cadmium for the aquatic environment. The accumulation rate of cadmium in the kidneys is rapid. Renal levels of cadmium in the parts per million range are reached 10 weeks after hatching. Juvenile birds should be collected for monitoring purposes before leaving their feeding domains at the end of the summer. PMID:3810147

  12. Growth of cadmium oxide whiskers on cadmium sulphide single crystals with copper as growth activator

    Energy Technology Data Exchange (ETDEWEB)

    Koparanova, N.; Simov, S. (Bylgarska Akademiya na Naukite, Sofia. Inst. po Fizika na Tvyrdoto Tyalo); Genchev, D. (Bylgarska Akademiya na Naukite, Sofia. Inst. za Yadrena Izsledvaniya i Yadrena Energetika); Metchenov, G. (Research Inst. of Criminalistics and Criminology, Sofia (Bulgaria))


    Some results on the growth and morphology of cadmium oxide whiskers, obtained on cadmium sulphide single crystals with copper as a growth activator, are presented in this work. Cadmium oxide whiskers have been obtained on brace 112-bar0 brace faces of cadmium sulphide plates with a copper layer deposited in advance. The whiskers grew during the annealing of the plates in a weak stream of technically pure argon at temperatures 670 to 730 deg C for 15 min to 3.5 h. Details about the procedure have been given elsewhere. The composition and morphology of the whiskers have been studied by an X-ray microanalyser JEOL 35 DDS and a scanning electron microscope JEOL, JSM 35. The optical microscopic observations have shown that after annealing, a gray-black granular layer is formed on the cadmium sulphide single crystals and this layer can easily be separated from the crystal substrate. Under the granular layer the crystal is heavily damaged. The whiskers grow on the granular layer and they are coloured yellow-brown or red-brown. The maximum whisker length attains several hundreds of micrometres and in some cases up to 1 mm or more.

  13. Oral cadmium exposure of adults in Germany. 1: Cadmium content of foodstuffs and beverages. (United States)

    Müller, M; Anke, M; Hartmann, E; Illing-Günther, H


    The cadmium contents of 94 and 105 foodstuffs bought in six-fold repetition in 1988 and in nine-fold repetition in 1991, respectively were analysed within the framework of a market-basket study. These foodstuffs were typical of German eating habits. Additionally, 170 samples of drinking water were investigated. The cadmium concentrations of the foodstuffs were comparable with results of recent studies carried out in Europe and North America. Fruit, milk and dairy products, sugar and sugar-rich foodstuffs as well as beverages showed mean cadmium contents cakes and pastries as well as farinaceous products were within the range of 20-40 ng/g. The most important bread, cakes and pastries (wheat and rye bread, toasted bread, rolls) contained 25-35 ng/g. A median cadmium concentration of 0.2 micrograms/l was found in the drinking water. As expected, liver and kidneys showed the highest cadmium levels of 73 and 204 ng/g, respectively on average. PMID:8718751

  14. Hepatotoxicity of Cadmium and Roles of Mitigating Agents

    Directory of Open Access Journals (Sweden)

    Elias Adikwu


    Full Text Available There are increasing reports on cadmium associated hepatotoxicity, due to these reports this study reviewed relevant literature on cadmium associated hepatotoxicity with emphasis on doses, route of administration, salt forms (cadmium compounds and the roles of mitigating agents. Reports have shown that continuous exposure of the liver to cadmium has led to hepatotoxicity. Humans are generally exposed to cadmium by two main routes, inhalation and ingestion. In this study, evaluation of relevant literature showed that irrespective of route of administration and salt forms cadmium hepatotoxicity is dose and time dependent. Cadmium associated hepatotoxicity manifested through impaired functions of hepatic biomarkers (transaminases, enzymatic and non enzymatic antioxidants. Histopathological damage to liver architecture manifested as swelling of hepatocytes, focal necrosis, hepatocytes degeneration, dilatation of ribosomes, damage of membrane-bounded lysosomes, nuclear pyknosis and cytoplasm vacuolization. Deterioration of mitochondrial cristae, deposition of collagen fibrils, hypertrophy of kuffer cells, congestion in central veins and sinusoids, infiltration of mixed inflammatory cells and peripheral hemorrhage also occurred. Hepatotoxic effect of cadmium was mitigated by Vitamin C, Vitamin E, Manganese (11 Chloride, N-acetylcysteine and Selenium. Extracts of plant origin including Solanum tuberosum, Calycopteris floribunda Hibiscus sabdariffa mitigated cadmium induced hepatotoxicity. Chemical substances of animal origin including honey and camel milk were reported to have ameliorated cadmium induced hepatotoxicity. One of the mechanisms of cadmium induced hepatotoxicity is reported to be associated with the up regulation of reactive oxygen species (oxidative stress which caused oxidative damage to lipid contents of membranes and direct liver injury. Conclusion cadmium is dose and time dependently hepatotoxic irrespective of route of administration

  15. Extraction-photometric determination of cadmium in meat products

    Energy Technology Data Exchange (ETDEWEB)

    Krylova, A.N.; Malyarova, M.A.; Zhulenko, V.N.


    As a result of industrial discharges, burning of solid and liquid fuels, and recycling of metal scrap, cadmium compounds enter the atmosphere and drop into the water and soil causing contamination. In this paper, a method was developed for determining cadmium in meat products. It involves wet ashing the sample, extractive separation of the cadmium as the diethyldithiocarbamate, reextraction, and determination as cadmium dithizonate or as a complex with 2,2'-dipyridyl. The detection limit with dithizone is 0.005 mg/kg and with 2,2'-dipyridyl 0.05 mg/kg. An analysis is shown to take less than 60 minutes.

  16. Cadmium elemination from phosphoric acid by ionic flotation

    International Nuclear Information System (INIS)

    The ion flotation process for the recovery of cadmium from wet phosphoric acid (30%P2O5) has been studied. This technique combines a chemical recation between the collector and the cadmium to form a precipitate (sublate) which is carried to the surface of the solution by air bubbles. the resulting foam containing the cadmium may then separated from solution. The influence of parameters such as collector and cadmium concentration as well as iron content have been investigated for the case a synthetic acid (30% P2O5). The result have been applied to the industrial phosphoric acid produced from Djebel Onk's phosphates (Algeria)

  17. Bioremoval of cadmium by lemna minor in different aquatic conditions

    Energy Technology Data Exchange (ETDEWEB)

    Uysal, Yagmur [Dept. of Environmental Engineering, Kahramanmaras Sutcu Imam University, Kahramanmaras (Turkey); Taner, Fadime [Dept. of Environmental Engineering, Mersin University, Mersin (Turkey)


    This study was undertaken to determine the cadmium removal efficiency of Lemna minor when it was used for treatment of wastewater having different characteristics, i. e., pH, temperature and cadmium concentration. Plants were cultivated in different pH solutions (4.5-8.0) and temperatures (15-35 C) in the presence of cadmium (0.1-10.0 mg/L) for 168 h. The amount of biomass obtained in the study period, the concentrations of cadmium in the tissues and in the media and net uptake of cadmium by Lemna have been determined for each condition. The percentages of cadmium uptake (PMU) and bioconcentration factors (BCF) were also calculated. The highest accumulation was obtained for the highest cadmium concentration of 10.0 mg Cd/L as 11.668 mg Cd/g at pH 6.0, and as 38.650 mg Cd/g at 35 C and pH 5.0. The cadmium accumulation gradually increased with initial concentration of the medium, but the opposite trend was observed for the PMU. However, the maximum PMU was obtained as 52.2% in the solution with the lowest concentration of 0.1 mg Cd/L. A mathematical model was used to describe the cadmium uptake and the equation obtained was seen to fit the experimental data very well. (Abstract Copyright [2010], Wiley Periodicals, Inc.)

  18. Effects of Cadmium on BMP Induced Bone Formation

    Institute of Scientific and Technical Information of China (English)

    陈秋生; 徐顺清


    To demonstrate the direct effects of cadmium on activities of bone morphogenetic protein (BMP), a complex containing BMP and cadmium chloride (CdCl2) was implanted beneath the abdominal skin of young male Wistar rats. The activity of BMP was studied by observing the histological changes, and measuring the activity of alkaline phosphatase (ALP) and acid phosphatase (ACP) and calcium content of the implants at different time points. Our results showed that during bone formation induced by BMP, cadmium inhibited the activities of osteoblasts and osteoclasts, and slowed the deposition of calcium. It is concluded that cadmium can directly affect biological activities of BMP directly.

  19. β—Correction Spectrophotometric Determination of Cadmium with Cadion

    Institute of Scientific and Technical Information of China (English)



    Cadmium has been determined by β-correction spectrophotometry with cadion,p-nitrobenzenediazoaminoaz-obenzone,and a non-ionic surfactant,tuiton X-100.The real absorbance of a Cd-cadion chelate in the colored solution can be accurately determined and the complex-ratio of cadion with Cd(II) has been worked out to be 2.Beer's law is obeyed over the concentration range of 0-0.20mg/1 cadmium and the detec-tion limit for cadmium is only 0.003mg/1.Satisfactory experimental results are presented with respect to the determination of trace cadmium in wastewaters.

  20. Elektrokemisk fjernelse af cadmium fra bioasker

    DEFF Research Database (Denmark)

    Pedersen, Anne Juul; Ottosen, Lisbeth M.; Simonsen, Peter;

    Hosliggende rapport formidler resultaterne fra PSO-projektet: ”Elektrokemisk fjernelse af cadmium fra bioasker” (PSO-F&U 3206), finansieret af Elkraft System og Energi E2 A/S. Projektet blev gennemført i perioden 01.05.2003 – 30.06.2004, og partnerne var Energi E2 A/S, BYG-DTU og Krüger A/S, med...... BYG-DTU som den primært udførende part. Projektets formål var at undersøge, om den elektrodialytiske rensningsmetode kunne bruges til at reducere indholdet af cadmium i asker fra biobrændsel (f.eks. træflis og halm) med henblik på nyttiggørelse af askerne. Projektet havde nær sammenhæng med det...

  1. Electron mobility in mercury cadmium telluride (United States)

    Patterson, James D.


    A previously developed program, which includes all electronic interactions thought to be important, does not correctly predict the value of electron mobility in mercury cadmium telluride particularly near room temperature. Part of the reason for this discrepancy is thought to be the way screening is handled. It seems likely that there are a number of contributors to errors in the calculation. The objective is to survey the calculation, locate reasons for differences between experiment and calculation, and suggest improvements.

  2. Prevention of cadmium bioaccumulation by herbal adaptogens


    K Bharavi; A. Gopala Reddy; G S Rao; Ravi Kumar, P.; D Srinivas Kumar; P Prabhu Prasadini


    Objectives : To evaluate the effect of various herbal adaptogens such as shade-dried powders of Withania somnifera, Ocimum sanctum, Asperagus recemosus, Andrographis paniculata, Asphaltum panjabinum (Shilajith), Gymnema sylvestre, Spirulina platensis, and Panex ginseng on cadmium (Cd)-induced oxidative stress and its accumulation in broiler chicken. Materials and Methods : A total of 80 male broiler chicks of day old age were randomly assigned to 10 equal groups. Group 1 birds were fed wi...



    P. Bala Ramudu; R. P. Tiwari; Srivastava, R. K.


    This paper presents the results of an experimental research undertaken to evaluate different purging solutions to enhance the removal of cadmium from spiked contaminated field soil by electrokinetic remediation. Three experiments were conducted when soil was saturated with deionised water and subsequently deionised water, ammonium citrate and sodium citrate were used as purging solutions at anode end. One experiment was conducted when the soil was saturated with ammonium citrate and itself wa...

  4. 14 CFR 417.123 - Computing systems and software. (United States)


    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Computing systems and software. 417.123... systems and software. (a) A launch operator must document a system safety process that identifies the... systems and software. (b) A launch operator must identify all safety-critical functions associated...

  5. 13 CFR 123.12 - Are books and records required? (United States)


    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Are books and records required... PROGRAM Overview § 123.12 Are books and records required? You must retain complete records of all... disaster business or economic injury loan, you must also maintain current and accurate books of...

  6. 13 CFR 123.3 - How are disaster declarations made? (United States)


    ... Overview § 123.3 How are disaster declarations made? (a) There are five ways in which disaster declarations... lower, and, as a direct result of such physical damage, 25 percent or more of the work force in their... that at least five small business concerns in a disaster area have suffered substantial economic...

  7. 49 CFR 192.123 - Design limitations for plastic pipe. (United States)


    ... 49 Transportation 3 2010-10-01 2010-10-01 false Design limitations for plastic pipe. 192.123... Design limitations for plastic pipe. (a) Except as provided in paragraph (e) and paragraph (f) of this section, the design pressure may not exceed a gauge pressure of 100 psig (689 kPa) for plastic pipe...

  8. 19 CFR 123.61 - Baggage arriving in baggage car. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Baggage arriving in baggage car. 123.61 Section... car. An inward foreign manifest on Customs Form 7533 shall be used for all baggage arriving in baggage cars....

  9. Critical currents and weak links in melt textured R123

    International Nuclear Information System (INIS)

    Weak link behavior is studied, using magnetization and Hall probe measurements of ring samples, in welded melt-textured R123 monoliths and in dual-seeded samples with disoriented domains. Techniques for welding samples yield transport currents across the junction that are in excess of 104 A/cm2

  10. An economical method for the continuous production of iodine-123 (United States)

    Blue, J. W.; Smith, W. R.; Sodd, V. J.


    Simple and inexpensive method produces iodine 123, in a conventional cyclotron. Tellurium 122, a stable isotope available in enrichments exceeding 95 percent, is held on a porous metal plate by a flowing stream of helium and bombarded with either alpha particles or helium 3.

  11. 47 CFR 76.123 - Satellite syndicated program exclusivity. (United States)


    ... Exclusivity and Sports Blackout § 76.123 Satellite syndicated program exclusivity. (a) Upon receiving... station licensed by the Commission, a program carried on a nationally distributed superstation or on a station carried pursuant to § 76.54 of this chapter when the syndicated program exclusivity rights to...

  12. 48 CFR 18.123 - Electronic funds transfer. (United States)


    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Electronic funds transfer... CONTRACTING METHODS AND CONTRACT TYPES EMERGENCY ACQUISITIONS Available Acquisition Flexibilities 18.123 Electronic funds transfer. Electronic funds transfer payments may be waived for acquisitions to...

  13. 29 CFR 784.123 - Operations performed on fishing equipment. (United States)


    ... 29 Labor 3 2010-07-01 2010-07-01 false Operations performed on fishing equipment. 784.123 Section... LABOR STANDARDS ACT APPLICABLE TO FISHING AND OPERATIONS ON AQUATIC PRODUCTS Exemptions Provisions Relating to Fishing and Aquatic Products General Character and Scope of the Section 13(a)(5)...

  14. 38 CFR 21.123 - On-job course. (United States)


    ...) VOCATIONAL REHABILITATION AND EDUCATION Vocational Rehabilitation and Employment Under 38 U.S.C. Chapter 31 Educational and Vocational Training Services § 21.123 On-job course. (a) Training establishment. This term... agency, or any State board of vocational education, or any joint apprenticeship committee, or the...

  15. 123I-IMP clearance of the lung in pneumoconiosis

    International Nuclear Information System (INIS)

    We studied 123I-IMP lung clearance on 10 cases of pneumoconiosis and compared it with the data of 5 non-smoking young adults. After the venous injection of 111 MBq of 123I-IMP we collected the lung dynamic data using 1 frame/10 sec for 10 minutes and 1 frame/min for following 40 minutes. The time activity curve after the injection of 123I-IMP was obtained as follows: C(t)=A1e-k1t+A2e-k2t (k1, k2: slopes of the exponential component at the early and delayed phase). The 123I-IMP clearance was delayed in the patients group especially on the early phase and the k1 was lower than that of the normal group. Our results indicate that the pulmonary blood flow of the patients with pneumoconiosis decreased because of the advanced fibrotic change. This dynamic analysis may prove useful for the evaluation of the pneumoconiosis objectively and quantitatively. (author)

  16. 33 CFR 159.123 - Coliform test: Type I devices. (United States)


    ... (CONTINUED) POLLUTION MARINE SANITATION DEVICES Design, Construction, and Testing § 159.123 Coliform test... milliliters when tested in accordance with 40 CFR part 136. (b) The 40 samples must be taken from the device... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Coliform test: Type I...

  17. Ozone Depletion Potentials of HCFC-123 and HCFC-124 (United States)

    Riepe, E. L.; Patten, K. O.; Wuebbles, D. J.


    The Montreal Protocol has phased out most chlorinated and brominated compounds because of their great efficiency in depleting ozone in the stratosphere. Compounds such as CHCl2CF3 (HCFC-123) and CHClFCF3 (HCFC-124) are being used in commercial refrigeration units and have much shorter atmospheric lifetimes than the chlorofluorocarbons they replace. Despite their small resulting Ozone Depletion Potentials (ODPs), these compounds are still currently expected to be eliminated under the existing Protocol, but there remain questions about finding suitable replacements that would not have other environmental effects. The HCFC-123 and HCFC-124 model-calculated atmospheric lifetimes of 1.3 years and 5.8 years are much shorter compared to the 45 years of CCl3F (CFC-11). In this study, we have reevaluated these compounds with an updated version of the UIUC two-dimensional chemical transport model and with the MOZART (version 3) three-dimensional chemical-transport model. The new version of the two-dimensional model gives ODPs of 0.012 and 0.0125 for HCFC-123 and HCFC-124, respectively. The ODP for HCFC-123 agrees well with previously reported values while the ODP for HCFC-124 is much smaller than earlier estimates. These analyses along with those from the three-dimensional modeling studies will be discussed in the presentation.

  18. 22 CFR 123.16 - Exemptions of general applicability. (United States)


    ... Control Act, or countries that are members of the European Space Agency or the European Union and involves... Directorate of Defense Trade Controls. These exemptions do not apply to: Proscribed destinations under § 126.1... writing, “22 CFR 123.16(b)(1) and the agreement or arrangement (identify/state number) applicable”;...

  19. Substituted 4-hydroxy-1,2,3-triazoles

    DEFF Research Database (Denmark)

    Pippione, Agnese C.; Dosio, Franco; Ducime, Alex;


    the distal (S)-glutamic acid carboxyl group using the 4-hydroxy-1,2,3-triazole moiety is applied, to obtain two promising glutamate analogs. In the second example, a scaffold hopping approach is applied, replacing the phenolic moiety present in MDG-1-33A, a potent inhibitor of Onchocerca volvulus chitinase...

  20. Transformation and biodegradation of 1,2,3-trichloropropane (TCP)

    NARCIS (Netherlands)

    Samin, Ghufrana; Janssen, Dick B.; Kronberg, Leif


    1,2,3-Trichloropropane (TCP) is a persistent groundwater pollutant and a suspected human carcinogen. It is also is an industrial chemical waste that has been formed in large amounts during epichlorohydrin manufacture. In view of the spread of TCP via groundwater and its toxicity, there is a need for

  1. 29 CFR 500.123 - Property damage insurance required. (United States)


    ... MIGRANT AND SEASONAL AGRICULTURAL WORKER PROTECTION Motor Vehicle Safety and Insurance for Transportation of Migrant and Seasonal Agricultural Workers, Housing Safety and Health for Migrant Workers Insurance § 500.123 Property damage insurance required. (a) When a person who is an employer of a migrant...

  2. 30 CFR 229.123 - Standards for audit activities. (United States)


    ... 229.123 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE... statement of standards. (iii) The auditor's report should contain a statement of positive assurance on those items tested and negative assurance on those items not tested. It should also include all instances...

  3. Bioavailability of cadmium from linseed and cocoa

    DEFF Research Database (Denmark)

    Hansen, Max; Rasmussen, Rie Romme; Sloth, Jens Jørgen


    for the food authorities in order to give correct advises to the population. The aim of this study was to investigate the bioavailability of cadmium from whole linseed, crushed linseed, cocoa and cadmium chloride in rats. An experiment where 40 rats were divided into 4 groups and a control group and dosed...... with whole linseed, crushed linseed, cocoa and CdCl2 for 3 weeks was performed. Linseed or cocoa made up 10% of the feed (by weight) and was added as a replacement for carbohydrate source. The rats were dosed for 3 weeks and the cadmium content in the rats' kidneys was measured by ICPMS as a biomarker...... be measured in the kidney compared to the calculated total intake was as follows: Control 2.0 %, Crushed linseed 0.9 %, whole linseed, 1.5 %, cocoa 0.7 % and CdCl2 4.6 %. Based on this study it could not be concluded that the bioavailability in rats form whole linseed is lower that for crushed linseed...

  4. Cadmium biosorption rate in protonated Sargassum biomass

    Energy Technology Data Exchange (ETDEWEB)

    Yang, J.; Volesky, B. [McGill Univ., Montreal, Quebec (Canada). Dept. of Chemical Engineering


    Biosorption of the heavy metal ion Cd{sup 2+} by protonated nonliving brown alga Sargassum fluitans biomass was accompanied by the release of hydrogen protons from the biomass. The uptake of cadmium and the release of proton matched each other throughout the biosorption process. The end-point titration methodology was used to maintain the constant pH 4.0 for developing the dynamic sorption rate. The sorption isotherm could be well represented by the Langmuir sorption model. A mass transfer model assuming the intraparticle diffusion in a one-dimensional thin plate as a controlling step was developed to describe the overall biosorption rate of cadmium ions in flat seaweed biomass particles. The overall biosorption mathematical model equations were solved numerically yielding the effective diffusion coefficient D{sub e} about 3.5 {times} 10{sup {minus}6} cm{sup 2}/s. This value matches that obtained for the desorption process and is approximately half of that of the molecular diffusion coefficient for cadmium ions in aqueous solution.

  5. Soil ecotoxicity assessment using cadmium sensitive plants

    International Nuclear Information System (INIS)

    The crop plants, sorghum and cucumber, can be used as indicator species to assess ecotoxicity of soils contaminated by cadmium. - Four crop plant species (sweet corn, Zea may; wheat, Triticum aestivum; cucumber, Cucumis sativus; and sorghum, Sorghum bicolor) were tested to assess an ecotoxicity in cadmium-amended soils. The measurement endpoints used were seed germination and seedling growth (shoot and root). The presence of cadmium decreased the seedling growth. The medium effective concentration values (EC50) for shoot or root growth were calculated by the Trimmed Spearman-Karber method. Due to the greater accumulation of Cd to the roots, root growth was a more sensitive endpoint than shoot growth. Bioavailability and transport of Cd within plant were related to concentration and species. The ratio of bioaccumulation factor (BAF) in the shoots to the roots indicated high immobilization of Cd in the roots. Seed germination was insensitive to Cd toxicity, and is not recommended for a suitable assay. Among the test plants and test endpoints, root growth of sorghum and cucumber appears to be a good protocol to assess ecotoxicity of soils contaminated by Cd

  6. Soil ecotoxicity assessment using cadmium sensitive plants

    Energy Technology Data Exchange (ETDEWEB)

    An, Youn-Joo


    The crop plants, sorghum and cucumber, can be used as indicator species to assess ecotoxicity of soils contaminated by cadmium. - Four crop plant species (sweet corn, Zea may; wheat, Triticum aestivum; cucumber, Cucumis sativus; and sorghum, Sorghum bicolor) were tested to assess an ecotoxicity in cadmium-amended soils. The measurement endpoints used were seed germination and seedling growth (shoot and root). The presence of cadmium decreased the seedling growth. The medium effective concentration values (EC50) for shoot or root growth were calculated by the Trimmed Spearman-Karber method. Due to the greater accumulation of Cd to the roots, root growth was a more sensitive endpoint than shoot growth. Bioavailability and transport of Cd within plant were related to concentration and species. The ratio of bioaccumulation factor (BAF) in the shoots to the roots indicated high immobilization of Cd in the roots. Seed germination was insensitive to Cd toxicity, and is not recommended for a suitable assay. Among the test plants and test endpoints, root growth of sorghum and cucumber appears to be a good protocol to assess ecotoxicity of soils contaminated by Cd.

  7. Reduction of Cadmium Uptake of Rice Plants Using Soil Amendments in High Cadmium Contaminated Soil: A Pot Experiment


    Dian Siswanto; Parinda Suksabye; Paitip Thiravetyan


    The aims of this study were to investigate the effect of agricultural residues on reducing cadmium uptake in rice plants. The rice plants growing on no cadmium/free cadmium soils (N), Cd soils (Cds), and Cd soils each amended with 1% w/w of coir pith (CP), coir pith modified with sodium hydroxide (CPm) and corncob (CC) under high cadmium contaminated soil with an average 145 mg Cd kg-1 soil were investigated. The results showed that the cumulative transpiration of rice grown in various treatm...

  8. Influence of a high level of dietary cadmium on cadmium content in milk, excretion, and cow performance

    Energy Technology Data Exchange (ETDEWEB)

    Miller, W.J.; Lampp, B.; Powell, G.W.; Salotti, C.A.; Blackmon, D.M.


    Three Holstein cows were each given 3.0 g of cadmium daily (two equal doses) for two weeks by gelatin capsules. There was a sharp drop in concentrate consumption for the first few days of cadmium administration but, by the second week, consumption returned to normal. Milk production declined sharply for several days and then increased appreciably, but to a level still substantially lower than that of controls during the last five days cadmium was given. When cadmium treatments ceased, milk production increased by 50%. Fat content of milk was elevated considerably during the week when production was most reduced. Cows given cadmium lost considerable weight. There were no other clinical manifestations of toxicity. As determined by the chromic oxide indicator method and twice-daily grab samples, fecal excretion of cadmium for the second week averaged 82% of that given. The cadmium level in the urine was below the limits of detectability of the method (0.5 ppm of urine). The cadmium content of the milk was less than 0.1 ppm of the milk, which was the lower reliability limit of the procedure used. On this basis less than 0.22% of the amount administered appeared in the milk. In vitro studies demonstrated that cadmium combines with the casein and whey protein fractions of the milk readily, with the amount combined being linear when levels from 1.0 to 25.0 ppm are added to milk. Smaller amounts were present in the lactose and mineral fractions.

  9. Cadmium sulfate complexing with thiourea during preparation of cadmium sulfide films

    International Nuclear Information System (INIS)

    Composition of complexes deposited from cadmium sulfate and thiourea(TU) aqueous solution is studied. Its influence on cadmium sulfide film deposition during solution spraying is ascertained. It is shown that with increase of TU concentration in aqueous solution gradual substitution of TU molecules for the first sphere SO42- ions takes place. As a result CdS deposition from these solutions is initiated when the ratio of CdSO4:TU concentrations is 1:2 and for prepartation of uniform films a five-fold TU excess as a minimum is necessary

  10. Correlative characteristic of cadmium in soils of steppe Dnieper region

    Directory of Open Access Journals (Sweden)

    N. M. Tsvetkova


    Full Text Available Much attention is paid to searching for methods of establishing environmental standards for objective assessment of admissibility of anthropogenic load on the biosphere. The main pollutants of the environment are xenobiotics; heavy metals such as cadmium occupy hold a special place among them. Cadmium is one of the most dangerous environmental toxic agents, belonging to the 1stclass of hazard. Due to insufficient and fragmented information available on the distribution of cadmium in the city edaphotopes, it’s necessary to conduct additional research, taking into account the properties of soils and the biological characteristics of every element. The paper shows the ratio of cadmium in soils and soil-forming rocks of steppe Dnieper region. Environmental assessment of cadmium content in Dniprodzerzhinsk city soilsis made, and the problem of topsoil contamination of the city as a territory of high anthropogenic load is considered. It is found that the content of cadmium down the profile in natural soil increases. Enrichment of the topsoil with cadmium occurs due to contamination. The value of movable forms content, expressed as a percentage of the total content, varies from 12% to 70%, providing the evidence of the technogenic origin of cadmium in Dniprodzerzhinsk city topsoil. General and proximate correlation analyses of interrelation of soil cadmium and specifically selected characteristics of soil (pH, humus, sulfate ions, dry solid, chloride ions, total alkalinity, hygroscopic moisture were made. It is established that cadmium concentration in the movable forms of natural soils of the steppe Dnieper region depends primarily on pH value. With the increase in pH value, concentration of movable cadmium in soil increases.

  11. Cadmium induces transcription independently of intracellular calcium mobilization.

    Directory of Open Access Journals (Sweden)

    Brooke E Tvermoes

    Full Text Available BACKGROUND: Exposure to cadmium is associated with human pathologies and altered gene expression. The molecular mechanisms by which cadmium affects transcription remain unclear. It has been proposed that cadmium activates transcription by altering intracellular calcium concentration ([Ca(2+](i and disrupting calcium-mediated intracellular signaling processes. This hypothesis is based on several studies that may be technically problematic; including the use of BAPTA chelators, BAPTA-based fluorescent sensors, and cytotoxic concentrations of metal. METHODOLOGY/PRINCIPAL FINDING: In the present report, the effects of cadmium on [Ca(2+](i under non-cytotoxic and cytotoxic conditions was monitored using the protein-based calcium sensor yellow cameleon (YC3.60, which was stably expressed in HEK293 cells. In HEK293 constitutively expressing YC3.60, this calcium sensor was found to be insensitive to cadmium. Exposing HEK293::YC3.60 cells to non-cytotoxic cadmium concentrations was sufficient to induce transcription of cadmium-responsive genes but did not affect [Ca(2+](i mobilization or increase steady-state mRNA levels of calcium-responsive genes. In contrast, exposure to cytotoxic concentrations of cadmium significantly reduced intracellular calcium stores and altered calcium-responsive gene expression. CONCLUSIONS/SIGNIFICANCE: These data indicate that at low levels, cadmium induces transcription independently of intracellular calcium mobilization. The results also support a model whereby cytotoxic levels of cadmium activate calcium-responsive transcription as a general response to metal-induced intracellular damage and not via a specific mechanism. Thus, the modulation of intracellular calcium may not be a primary mechanism by which cadmium regulates transcription.

  12. Critical review of animal carcinogenesis by cadmium and its inorganic compounds

    International Nuclear Information System (INIS)

    Animal carcinogenic biassays relative to 6 inorganic cadmium substances (cadmium metal, cadmium oxide, cadmium sulfide, cadmium sulfate, cadmium chloride and cadmium acetate) are reviewed (speciation). Critical evaluation of literature data on carcinogenicity has been performed by making reference to E.C. guidelines of good laboratory practice. There are few data on routes relevant for human risk assessment: experiments on inhalation demonstrate lung carcinogenicity of cadmium oxide, cadmium sulfide, cadmium sulfate and cadmium chloride in rats but not in mice nor in hamsters; no carcinogenic effects of cadmium compounds are observed following oral administration. For routes of less or no relevance for human risk assessment, some results are clearly positive: subcutaneous injection induces cancers in situ (various cadmium compounds), testicular tumours (cadmium sulfate and cadmium chloride) and prostatic tumours (cadmium chloride) but such effects are not observed using relevant malignancies in rats. With respect to other no relevant routes (intraperitoneal, intrarenal...) tumours are incidentally produced in situ, but not in remote organs. Numerous studies fail to demonstrate cadmium carcinogenicity, but methodologically acceptable negative ones are very limited in number. Accordingly strain dependent effects and dose effect relationship could not be thoroughly assessed

  13. 13 CFR 123.4 - What is a disaster area and why is it important? (United States)


    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What is a disaster area and why is it important? 123.4 Section 123.4 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION DISASTER LOAN PROGRAM Overview § 123.4 What is a disaster area and why is it important? Each...

  14. 13 CFR 123.100 - Am I eligible to apply for a home disaster loan? (United States)


    ... disaster loan? 123.100 Section 123.100 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION DISASTER LOAN PROGRAM Home Disaster Loans § 123.100 Am I eligible to apply for a home disaster loan? (a) You are eligible to apply for a home disaster loan if you: (1) Own and occupy your primary...

  15. 13 CFR 123.11 - Does SBA require collateral for any of its disaster loans? (United States)


    ... any of its disaster loans? 123.11 Section 123.11 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION DISASTER LOAN PROGRAM Overview § 123.11 Does SBA require collateral for any of its disaster loans? Generally, SBA will not require that you pledge collateral to secure a disaster home loan or a...

  16. 13 CFR 123.101 - When am I not eligible for a home disaster loan? (United States)


    ... disaster loan? 123.101 Section 123.101 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION DISASTER LOAN PROGRAM Home Disaster Loans § 123.101 When am I not eligible for a home disaster loan? You are not eligible for a home disaster loan if: (a) You have been convicted, during the past year, of...

  17. 13 CFR 123.303 - How can my business spend my economic injury disaster loan? (United States)


    ... economic injury disaster loan? 123.303 Section 123.303 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION DISASTER LOAN PROGRAM Economic Injury Disaster Loans § 123.303 How can my business spend my economic injury disaster loan? (a) You can only use the loan proceeds for working capital necessary...

  18. 13 CFR 123.2 - What are disaster loans and disaster declarations? (United States)


    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are disaster loans and disaster declarations? 123.2 Section 123.2 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION DISASTER LOAN PROGRAM Overview § 123.2 What are disaster loans and disaster declarations? SBA offers...

  19. 13 CFR 123.8 - Does SBA charge any fees for obtaining a disaster loan? (United States)


    ... obtaining a disaster loan? 123.8 Section 123.8 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION DISASTER LOAN PROGRAM Overview § 123.8 Does SBA charge any fees for obtaining a disaster loan? SBA does not charge points, closing, or servicing fees on any disaster loan. You will be responsible for payment...

  20. 40 CFR 91.123 - Denial, revocation of certificate of conformity. (United States)


    ... conformity. 91.123 Section 91.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... Certification Provisions § 91.123 Denial, revocation of certificate of conformity. (a) If, after review of the... conformity if the Administrator finds any one of the following infractions to be substantial: (1) The...

  1. 40 CFR 90.123 - Denial, revocation of certificate of conformity. (United States)


    ... conformity. 90.123 Section 90.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... Emission Standards and Certification Provisions § 90.123 Denial, revocation of certificate of conformity... conformity if the Administrator finds any one of the following infractions to be substantial: (1) The...

  2. 16 CFR 1028.123 - Early termination of research support: Evaluation of applications and proposals. (United States)


    ... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Early termination of research support: Evaluation of applications and proposals. 1028.123 Section 1028.123 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION GENERAL PROTECTION OF HUMAN SUBJECTS § 1028.123 Early termination of research...

  3. 34 CFR 97.123 - Early termination of research support: Evaluation of applications and proposals. (United States)


    ... 34 Education 1 2010-07-01 2010-07-01 false Early termination of research support: Evaluation of applications and proposals. 97.123 Section 97.123 Education Office of the Secretary, Department of Education... Protection of Human Research Subjects) § 97.123 Early termination of research support: Evaluation...

  4. 7 CFR 1c.123 - Early termination of research support: Evaluation of applications and proposals. (United States)


    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Early termination of research support: Evaluation of applications and proposals. 1c.123 Section 1c.123 Agriculture Office of the Secretary of Agriculture PROTECTION OF HUMAN SUBJECTS § 1c.123 Early termination of research support: Evaluation of applications...

  5. 10 CFR 745.123 - Early termination of research support: Evaluation of applications and proposals. (United States)


    ... 10 Energy 4 2010-01-01 2010-01-01 false Early termination of research support: Evaluation of applications and proposals. 745.123 Section 745.123 Energy DEPARTMENT OF ENERGY PROTECTION OF HUMAN SUBJECTS § 745.123 Early termination of research support: Evaluation of applications and proposals. (a)...

  6. 28 CFR 46.123 - Early termination of research support: Evaluation of applications and proposals. (United States)


    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Early termination of research support: Evaluation of applications and proposals. 46.123 Section 46.123 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) PROTECTION OF HUMAN SUBJECTS § 46.123 Early termination of research support: Evaluation...

  7. 45 CFR 46.123 - Early termination of research support: Evaluation of applications and proposals. (United States)


    ... Research Subjects § 46.123 Early termination of research support: Evaluation of applications and proposals... 45 Public Welfare 1 2010-10-01 2010-10-01 false Early termination of research support: Evaluation of applications and proposals. 46.123 Section 46.123 Public Welfare DEPARTMENT OF HEALTH AND...

  8. 40 CFR 26.123 - Early termination of research support: Evaluation of applications and proposals. (United States)


    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Early termination of research support: Evaluation of applications and proposals. 26.123 Section 26.123 Protection of Environment ENVIRONMENTAL... Research Conducted or Supported by EPA § 26.123 Early termination of research support: Evaluation...

  9. 15 CFR 27.123 - Early termination of research support: Evaluation of applications and proposals. (United States)


    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Early termination of research support: Evaluation of applications and proposals. 27.123 Section 27.123 Commerce and Foreign Trade Office of the Secretary of Commerce PROTECTION OF HUMAN SUBJECTS § 27.123 Early termination of research...

  10. 14 CFR 1230.123 - Early termination of research support: Evaluation of applications and proposals. (United States)


    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Early termination of research support: Evaluation of applications and proposals. 1230.123 Section 1230.123 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION PROTECTION OF HUMAN SUBJECTS § 1230.123 Early termination of...

  11. 22 CFR 225.123 - Early termination of research support: Evaluation of applications and proposals. (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Early termination of research support: Evaluation of applications and proposals. 225.123 Section 225.123 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT PROTECTION OF HUMAN SUBJECTS § 225.123 Early termination of research support: Evaluation...

  12. 32 CFR 219.123 - Early termination of research support: Evaluation of applications and proposals. (United States)


    ....123 Early termination of research support: Evaluation of applications and proposals. (a) The... 32 National Defense 2 2010-07-01 2010-07-01 false Early termination of research support: Evaluation of applications and proposals. 219.123 Section 219.123 National Defense Department of...

  13. 49 CFR 11.123 - Early termination of research support: Evaluation of applications and proposals. (United States)


    ... 49 Transportation 1 2010-10-01 2010-10-01 false Early termination of research support: Evaluation of applications and proposals. 11.123 Section 11.123 Transportation Office of the Secretary of Transportation PROTECTION OF HUMAN SUBJECTS § 11.123 Early termination of research support: Evaluation...

  14. 19 CFR 123.16 - Entry of returning trucks, busses, or taxicabs in international traffic. (United States)


    ... international traffic. 123.16 Section 123.16 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO International Traffic § 123.16 Entry of returning trucks, busses, or taxicabs in international traffic. (a)...

  15. 19 CFR 123.26 - Transshipment of merchandise moving through Canada or Mexico. (United States)


    ... or Mexico. 123.26 Section 123.26 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Shipments in Transit Through Canada or Mexico § 123.26 Transshipment of merchandise moving through Canada or Mexico....

  16. 19 CFR 123.12 - Entry of foreign locomotives and equipment in international traffic. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Entry of foreign locomotives and equipment in international traffic. 123.12 Section 123.12 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO International Traffic § 123.12 Entry of...

  17. 19 CFR 123.81 - Merchandise found in building on the boundary. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Merchandise found in building on the boundary. 123.81 Section 123.81 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Miscellaneous Provisions § 123.81 Merchandise found in building on the...

  18. 19 CFR 123.6 - Train sheet for arriving railroad trains. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Train sheet for arriving railroad trains. 123.6 Section 123.6 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO General Provisions § 123.6 Train sheet for arriving railroad trains. The conductor...

  19. 19 CFR 123.17 - Foreign repairs to domestic trucks, busses, taxicabs and their equipment. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Foreign repairs to domestic trucks, busses, taxicabs and their equipment. 123.17 Section 123.17 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO International Traffic § 123.17 Foreign repairs...

  20. 19 CFR 123.9 - Explanation of a discrepancy in a manifest. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Explanation of a discrepancy in a manifest. 123.9 Section 123.9 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO General Provisions § 123.9 Explanation of a discrepancy in a manifest....

  1. 19 CFR 123.4 - Inward foreign manifest forms to be used. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Inward foreign manifest forms to be used. 123.4 Section 123.4 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO General Provisions § 123.4 Inward foreign manifest forms to be used. The...

  2. 19 CFR 123.42 - Truck shipments transiting the United States. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Truck shipments transiting the United States. 123.42 Section 123.42 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO United States and Canada In-Transit Truck Procedures § 123.42 Truck...

  3. 19 CFR 123.27 - Feeding and watering animals in Canada. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Feeding and watering animals in Canada. 123.27 Section 123.27 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Shipments in Transit Through Canada or Mexico § 123.27 Feeding and watering animals...

  4. 19 CFR 123.5 - Certification and filing of inward foreign manifest. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Certification and filing of inward foreign manifest. 123.5 Section 123.5 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO General Provisions § 123.5 Certification and filing of inward...

  5. 19 CFR 123.13 - Foreign repairs to domestic locomotives and other domestic railroad equipment. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Foreign repairs to domestic locomotives and other domestic railroad equipment. 123.13 Section 123.13 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO International Traffic § 123.13 Foreign...

  6. 49 CFR 40.123 - What are the MRO's responsibilities in the DOT drug testing program? (United States)


    ... drug testing program? 40.123 Section 40.123 Transportation Office of the Secretary of Transportation... Verification Process § 40.123 What are the MRO's responsibilities in the DOT drug testing program? As an MRO... whether there is a problem that may cause a test to be cancelled (see §§ 40.199-40.203 ). As an MRO,...

  7. 31 CFR 12.3 - Sale of tobacco products in vending machines prohibited. (United States)


    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Sale of tobacco products in vending machines prohibited. 12.3 Section 12.3 Money and Finance: Treasury Office of the Secretary of the Treasury RESTRICTION OF SALE AND DISTRIBUTION OF TOBACCO PRODUCTS § 12.3 Sale of tobacco products in vending machines prohibited. The sale of...

  8. Drikkevands optagelse af cadmium og bly fra armaturer

    DEFF Research Database (Denmark)

    Nielsen, K.

    Notatet omfatter rapporter fra to forsøgsrækker vedr. brugsvands optagelse af bly og cadmium. Den første omhandler brugsvandsarmaturers afgivelse af bly og cadmium til syntetisk brugsvand med en sammensætning svarende til en sur, blød vandtype. Forsøgene omfatter 10 armaturer og armaturdele...

  9. Cadmium-induced ectopic apoptosis in zebrafish embryos

    Energy Technology Data Exchange (ETDEWEB)

    Chan, Po Kwok; Cheng, Shuk Han [Department of Biology and Chemistry, City University of Hong Kong, 83 Tat Chee Avenue, Kowloon (Hong Kong)


    In this study, we tested the hypothesis that cadmium-induced developmental toxicity was mediated via ectopic occurrence of apoptosis during embryonic development. We employed confocal microscopy to acquire images of whole-mount staining of apoptotic cells in zebrafish embryo exposed to 100 {mu}M cadmium from 5 hours post fertilisation (hpf) to 28 hpf. Three-dimensional reconstruction of the images was performed and the spatial and temporal distributions of apoptotic cells in the embryos were compared. In cadmium-treated embryos with varying degrees of gross developmental malformations, significantly higher numbers of apoptotic cells were detected with this method. In order to detect the precise locations of apoptotic cells, we performed terminal deoxynucleotidyl transferase-mediated dUTP nick end labelling (TUNEL) assay in sectioned embryos. In the degenerating neural tube of cadmium-treated embryos apoptotic cells were detected, while in the healthy neural tube of the untreated controls no apoptotic cells were found. We then employed flow cytometry to investigate whether cadmium exposure would affect the dynamics of apoptosis or induce any abnormalities in cell-cycle progression. It appeared that cadmium did not induce cell-cycle arrest. The percentages of apoptotic cells did not differ in the two groups at 13, 16 or 19 hpf. At 28 hpf, however, a significantly higher percentage of apoptotic cells were found in the cadmium-treated group. Exposure to cadmium, therefore, induced ectopic apoptosis at 28 hpf without affecting the dynamics of apoptosis at earlier developmental stages. (orig.)

  10. Cadmium inhibits neurogenesis in zebrafish embryonic brain development

    Energy Technology Data Exchange (ETDEWEB)

    Chow, Elly Suk Hen [Division of Biology, California Institute of Technology, 1200 California Boulevard, Pasadena, CA 91125 (United States); Hui, Michelle Nga Yu; Lin Chunchi [Department of Biology and Chemistry, City University of Hong Kong, 83 Tat Chee Avenue, Kowloon, Hong Kong (China); Cheng Shukhan [Department of Biology and Chemistry, City University of Hong Kong, 83 Tat Chee Avenue, Kowloon, Hong Kong (China)], E-mail:


    Cadmium is a non-essential heavy metal found abundantly in the environment. Children of women exposed to cadmium during pregnancy display lower motor and perceptual abilities. High cadmium body burden in children is also related to impaired intelligence and lowered school achievement. However, little is known about the molecular and cellular basis of developmental neurotoxicity in the sensitive early life stages of animals. In this study, we explore neurological deficits caused by cadmium during early embryonic stages in zebrafish by examining regionalization of the neural tube, pattern formation and cell fate determination, commitment of proneural genes and induction of neurogenesis. We show that cadmium-treated embryos developed a smaller head with unclear boundaries between the brain subdivisions, particularly in the mid-hindbrain region. Embryos display normal anterior to posterior regionalization; however, the commitment of neural progenitor cells was affected by cadmium. We observe prominent reductions in the expression of several proneuronal genes including ngn1 in cell clusters, zash1a in the developing optic tectum, and zash1b in the telencephalon and tectum. Cadmium-treated embryos also have fewer differentiated neurons and glia in the facial sensory ganglia as indicated by decreased zn-12 expression. Also, a lower transcription level of neurogenic genes, ngn1 and neuroD, is observed in neurons. Our data suggest that cadmium-induced neurotoxicity can be caused by impaired neurogenesis, resulting in markedly reduced neuronal differentiation and axonogenesis.

  11. Epigenetic Effects of Cadmium [Abstract and Poster 2014 (United States)

    We have reviewed the literature on in vitro and in vivo experiments as well as human studies on cadmium to understand the epigenetic mechanisms involved in cadmium- induced toxicity and carcinogenicity. This presentation will identify gaps in our current understanding and suggest...

  12. Electrolytic indium refining from cadmium in glycerine electrolyte

    International Nuclear Information System (INIS)

    The results of investigations directed on development of electrochemical indium cleaning from cadmium in glycerine base electrolyte are presented. Optimal operational conditions, specific consumption of reactants and electric power are determined. Relationship between variation of concentration of cadmium impurity in refined metal and duration of electrolysis is revealed. The method for determination of cleaning time is proposed. Developed process was put into commercial operation

  13. Method of making a thin film cadmium telluride solar cell

    International Nuclear Information System (INIS)

    A method for making a photovoltaic cell is described comprising the steps of: (a) depositing a transparent or semi-transparent conductive window layer onto a substrate; (b) depositing a layer of cadmium telluride including phosphorus onto the window layer; (c) depositing a layer of lead telluride onto the layer of cadmium telluride; and (d) depositing a metallic electrode onto the lead telluride layer

  14. Removing cadmium from electroplating wastewater by waste saccharomyces cerevisiae

    Institute of Scientific and Technical Information of China (English)

    DAI Shu-juan; WEI De-zhou; ZHOU Dong-qin; JIA Chun-yun; WANG Yu-juan; LIU Wen-gang


    The appropriate condition and scheme of removing cadmium from electroplating wastewater were investigated by adsorption-precipitation method using waste saccharomyces cerevisiae(WSC) as sorbent. Effect factors on biosorption of cadmium in cadmium-containing electroplating wastewater by waste saccharomyces cerevisiae and precipitation process of waste saccharomyces cerevisiae after adsorbing cadmium were studied. The results show that removal rate of cadmium is over 88% after 30 min adsorbing under the condition of cadmium concentration 26 mg/L, the dosage of waste saccharomyces cerevisiae 16.25 g/L, temperature 18 ℃, pH 6.0 and precipitation time 4 h. Biosorption-precipitation method is effective to remove cadmium in cadmium-containing electroplating wastewater by waste saccharomyces cerevisiae. The SEM, infrared spectroscopy and Zeta-potential of the cells show that chemical chelating is the main adsorption form; electrostatic attraction, hydrogen bonding and van der Waals force all function in adsorption process; and ―NH2―,―C=O―,―C=O―NH―,―CH3, ―OH are the main adsorption groups.

  15. Cadmium and zinc reversibly arrest development of Artemia larvae

    Energy Technology Data Exchange (ETDEWEB)

    Bagshaw, J.C.; Rafiee, P.; Matthews, C.O.; MacRae, T.H.


    Despite the widespread distribution of heavy metals such as cadmium and zinc in the environment and their well-known cytotoxicity and embryotoxicity in mammals, comparatively little is known about their effect on aquatic organisms, particularly invertebrates. Post-gastrula and early larval development of the brine shrimp, Artemia, present some useful advantages for studies of developmental aspects of environmental toxicology. Dormant encysted gastrulae, erroneously called brine shrimp eggs, can be obtained commercially and raised in the laboratory under completely defined conditions. Following a period of post-gastrula development within the cyst, pre-nauplius larvae emerge through a crack in the cyst shell. A few hours later, free-swimming nauplius larvae hatch. Cadmium is acutely toxic to both adults and nauplius larvae of Artemia, but the reported LC50s are as high as 10 mM, depending on larval age. In this paper the authors show that pre-nauplius larvae prior to hatching are much more sensitive to cadmium than are hatched nauplius larvae. At 0.1, cadmium retards development and hatching of larvae; higher concentrations block hatching almost completely and thus are lethal. However, the larvae arrested at the emergence stage survive for 24 hours or more before succumbing to the effects of cadmium, and during this period the potentially lethal effect is reversible if the larvae are placed in cadmium-free medium. The effects of zinc parallel those of cadmium, although zinc is somewhat less toxic than cadmium at equal concentrations.

  16. Cadmium Removal from Aqueous Solutions by Ground Pine Cone

    Directory of Open Access Journals (Sweden)

    H Izanloo, S Nasseri


    Full Text Available A study on the removal of cadmium ions from aqueous solutions by pine cone was conducted in batch conditions. Kinetic data and equilibrium removal isotherms were obtained. The influence of different experimental parameters such as contact time, initial concentration of cadmium, pine cone mass and particle size, and temperature on the kinetics of cadmium removal was studied. Results showed that the main parameters that played an important role in removal phenomenon were initial cadmium concentration, particle size and pine cone mass. The necessary time to reach equilibrium was between 4 and 7 hours based on the initial concentration of cadmium. The capacity of cadmium adsorption at equilibrium increased with the decrease of pine cone particle size. The capacity of cadmium adsorption at equilibrium by pine cone increased with the quantity of pine cone introduced (1–4 g/L. Temperature in the range of 20-30°C showed a restricted effect on the removal kinetics (13.56 mg/g at 20°C and a low capacity of adsorption about 11.48 mg/g at 30°C. The process followed pseudo second-order kinetics. The cadmium uptake of pine cone was quantitatively evaluated using adsorption isotherms. Results indicated that the Langmuir model gave a better fit to the experimental data in comparison with the Freundlich equation.

  17. Effect of environmental exposure to Cadmium on pregnancy outcome

    Directory of Open Access Journals (Sweden)

    F. Ramezanzadeh


    Full Text Available "n "n "nBackgrounds andObjectives:The objective of the present study was to evaluate the potential effect of environmental exposure to toxic metal (cadmium on pregnancy outcome and fetal growth."nMaterials and Methods: 330 normal pregnant women were randomly selected from vali-e-asr hospital, from July 2003 through Feb. 2005. Cadmium was measured in umbilical cord blood and mother whole blood of postpartum women without occupational exposure to metals in Tehran, Iran, using inductively coupled plasma mass spectrometry"nResult: Whole blood cadmium and cord blood cadmium ranged from 0/00 to 6/30 μg/L ,respectivly. in the group higher level of maternal blood cadmium (> 0.40 μg/L 1cm decrease was seen in neonatal birth height. (p = 0.007 There was a significant association between cadmium exposure and birth weight.Mann-whitney test showed that, maternal blood cadmium level, was significantly negatively associated with neonatal birth weight (z = -1.83, P < 0.06."nConclusion: It was concluded that environmental exposure to cadmium significantly reduces neonatal birth height.

  18. Risk of overestimation of urinary cadmium concentrations: interference from molybdenum

    Directory of Open Access Journals (Sweden)

    Cañas A.I.


    Full Text Available We show here that the selection of analytical method is critical when measuring low levels of cadmium in human urine. Cadmium is today usually analyzed by Inductively Coupled Plasma Mass Spectrometry (ICP-MS, which has a higher sensitivity than Atomic Absorption Spectroscopy (AAS. ICP-MS cadmium measurements show interference from tin (114Sn and molybdenum oxides, which can result in an overestimation of cadmium levels. The 114Sn interference is stable and can be mathematically corrected. Molybdenum concentrations in urine are variable and different from individual to individual. We have estimated the degree of error which molybdenum interference introduces in the measurement of cadmium in urine by conventional ICP-MS. 268 urine samples from mothers and their children were measured. Removal of the molybdenum oxide interference (DRC-ICP-MS method reduced urinary cadmium concentrations significantly (47.8%. The urinary molybdenum concentration in children was higher than in their mothers, resulting in greater overestimation. Our results clearly show that the DRC method is essential for reliable measurements of urinary cadmium concentrations, particularly in children. Furthermore, care should be taken when comparing Human Biomonitoring data for cadmium in urine and attention should be paid to which analytical method has been used (e.g. AAS and ICP-Ms, and especially if the measurements have been corrected for molybdenum interference.

  19. Imaging the pre- and postsynaptic side of striatal dopaminergic synapses in idiopathic cervical dystonia: a SPECT study using [123I] epidepride and [123I] beta-CIT. (United States)

    Naumann, M; Pirker, W; Reiners, K; Lange, K W; Becker, G; Brücke, T


    There is increasing evidence that a dysfunction of the dopaminergic system may be involved in the pathogenesis of idiopathic dystonia. To visualize possible alterations of the pre- and postsynaptic side of striatal dopaminergic synapses, SPECT studies using the radiotracers [123I] epidepride and [123I] beta-CIT were performed in 10 patients with idiopathic cervical dystonia. Eleven age- and sex-matched subjects served as controls. [123I] Epidepride is a new highly affine marker of D2 receptors, and [123I] beta-CIT binds to dopamine transporters on dopaminergic nerve endings. [123I] Epidepride binding was significantly reduced in both striata of dystonia patients compared with controls (p < 0.05). In contrast, striatal [123I beta-CIT uptake did not differ from controls. We conclude that dopaminergic dysfunction in idiopathic focal dystonia mainly involves postsynaptic mechanisms and suggest a disturbance of the indirect pathway of the motor circuit resulting in a disinhibited thalamocortical stimulation. PMID:9539347

  20. The effect of phosphate fertilizer cadmium on cadmium in soils and crops

    NARCIS (Netherlands)

    Smilde, K.W.; Luit, van B.


    Een van de oorzaken, waardoor bodemvervuiling met cadmium optreedt en dus een bevordering van cadmiumopname door het gewas, is toepassing van fosfaatkunstmest, waarin zich verschillende gehaltes van dit zware metaal bevinden. Dit rapport behandelt het onderzoek naar de stijging van het cadmiumgehalt


    Biosolids and Cd salt-amended soils were collected from a long-term field experiment established in 1976. Cadmium sorption experiments were conducted on different fractions of soils amended with biosolids, Cd salt, and unamended soils (control). The organic carbon (OC) of soils ...

  2. Comparison of toxicity and disposition of cadmium chloride and cadmium metallothionein in rats.

    NARCIS (Netherlands)

    Groten, J.P.


    In Chapter 1 of this thesis a general introduction is presented with a survey of the literature. It gives a brief overview of the factors involved in the absorption, metabolism and toxicity of Cd after oral intake.In short, the main source of environmental exposure to cadmium for no

  3. Cadmium chronic administration to lactating ewes. Reproductive performance, cadmium tissue accumulation and placental transfer

    Energy Technology Data Exchange (ETDEWEB)

    Floris, B.; Bomboi, G.; Sechi, P.; Marongiu, M. L. [Sassari Univ., Sassari (Italy). Dipt. di Biologia Animale; Pirino, S. [Sassari Univ., Sassari (Italy). Ist. di Patologia Generale, Anatomia Patologica e Clinica Ostetrico-chirurgica Veterinaria


    20 lactating ewes were allotted to two groups: 10 subjects received orally 100 mg/day of CdCl{sub 2} for 108 consecutive days, and the remaining 10 acted as control. Reproductive performance in ewes and cadmium tissue accumulation, both in ewes and their lambs, were investigated. The results showed that in ewes: 1) the regular cadmium intestinal intake negatively influences all reproductive parameters; 2) cadmium is particularly accumulated in kidney and liver, bur also in mammary gland, although at distinctly lower level; 3) chronic administration does not increase cadmium placental transfer in lactating pregnant subjects. [Italian] 20 pecore in lattazione sono state suddivise in 2 gruppi: 10 soggetti ricevettero per os 100 mg/giorno di CdCl{sub 2} per 108 giorni consecutivi, e i restanti 10 funsero da controllo. Sono stati studiati i parametri riproduttivi delle pecore e l'accumulo di cadmio nei tessuti, sia delle pecore che dei loro agnelli. I risultati hanno mostrato che negli ovini: 1) il regolare assorbimento intestinale di cadmio influenza negativamente tutti i parametri riproduttivi; 2) il cadmio viene accumulato principalmente nei reni e nel fegato, ma anche dalla ghiandola mammaria, sebbene in misura nettamente inferiore; 3) la somministrazione cronica di cadmio nei soggetti gravidi non incrementa il suo passaggio transplacentare.

  4. Adsorption of cadmium from aqueous solutions by perlite. (United States)

    Mathialagan, T; Viraraghavan, T


    The present study examined the use of perlite for the removal of cadmium from aqueous solutions. The effects of pH and contact time on the adsorption process were examined. The optimum pH for adsorption was found to be 6.0. Residual cadmium concentration reached equilibrium in 6h and the rate of cadmium adsorption by perlite was rapid in the first hour of the reaction time. Ho's pseudo-second-order model best described the kinetics of the reaction. Batch adsorption experiments conducted at room temperature (22+/-1 degrees C) showed that the adsorption pattern followed the Freundlich isotherm model. The maximum removal of cadmium obtained from batch studies was 55%. Thomas model was used to describe the adsorption data from column studies. The results generally showed that perlite could be considered as a potential adsorbent for cadmium removal from aqueous solutions.

  5. Cadmium adsorption in montmorillonite as affected by glyphosate

    Institute of Scientific and Technical Information of China (English)

    WANG Yu-jun; ZHOU Dong-mei; LUO Xiao-san; SUN Rui-juan; CHEN Huai-man


    Behaviors of soil heavy metals are often affected by coexisting herbicides due to their physical and chemical interaction. Effect of glyphosate, an herbicide containing -PO32- and -COOH groups, on cadmium adsorption in montmorillonite was studied in detail. The results showed that cadmium adsorption quantity in montmorillonite increased with increasing soil solution pH and cadmium concentration as usual, but decreased with glyphosate, which is due to the formation of a low affinity complex of Cd and glyphosate and decreasing solution pH induced by glyphosate addition. When the equilibrium solution pH was below 6.7, glyphosate has little effect on cadmium adsorption, but when the equilibrium solution pH was above 6.7, glyphosate significantly decreased cadmium adsorption quantity in montmorillonite. In addition, the adding order of Cd and glyphosate also influenced Cd adsorption quantity in montmorillonite.

  6. Synthesis of cadmium chalcogenide nanotubes at room temperature

    KAUST Repository

    Pan, Jun


    Cadmium chalcogenide (CdE, E=S, Se, Te) polycrystalline nanotubes have been synthesized from precursor of CdS/cadmium thiolate complex at room temperature. The precursor was hydrothermally synthesized at 180 °C using thioglycolic acid (TGA) and cadmium acetate as starting materials. The transformation from the rod-like precursor of CdS/cadmium thiolate complex to CdS, CdSe and CdTe nanotubes were performed under constant stirring at room temperature in aqueous solution containing S 2-, Se 2- and Te 2-, respectively. The nanotube diameter can be controlled from 150 to 400 nm related to the dimension of templates. The XRD patterns show the cadmium chalcogenide nanotubes all corresponding to face-centered cubic structure. © 2012 Elsevier B.V. All rights reserved.

  7. Determination of the cadmium and copper content inherent to metallothionein

    Energy Technology Data Exchange (ETDEWEB)

    Raspor, B.; Kozar, S.; Pavicic, J.; Juric, D. [Ruder Boskovic Institute, Center for Marine Research Zagreb, P.O.B. 1016, HR-10 001 Zagreb (Croatia)


    The reliability of the voltammetric determination of the cadmium and copper content (at pH 1.0), inherent to metallothionein (MT) isolated from the digestive gland of Mytilus galloprovincialis, was investigated. An artifact signal enhancement of copper, caused by the cupric-thionein complex adsorption at the mercury electrode, was established. This artifact was removed by UV-digestion of the sample for 15-20 h prior to analysis. A similar artifact was not detected for cadmium, because at this pH the cadmium-thionein complex has dissociated, and cadmium exists in the ionic form. Therefore, the voltammetric analysis of the cadmium content can be performed directly at pH 1.0, without prior UV-digestion of the sample. (orig.) With 3 figs., 1 tab., 12 refs.

  8. Effect of pregnancy on cadmium-treated rats

    Energy Technology Data Exchange (ETDEWEB)

    Takizama, Y. (Akita Univ. School of Medicine, Japan); Nakamura, I.; Kurayama, R.; Hirasawa, F.; Kawai, K.


    It is well known that itai-itai disease with the osteopathy is broken out among multiparas, 40 years of age and up Japanese residents. In this paper we described an experimental study of effect of pregnancy on cadmium treated rats. Female mature rats were administered drinking water containing 50 and 200 ppm cadmium as CdCl/sub 2/. During 180 days of the experiment, three times of pregnancy were succesful, though slight depression of body weight gain was noticed in the 200 ppm group. The cadmium was accumulated in the kidneys, liver and bone proportionally to the amount of cadmium administered. No significant change was recognized in serum calcium, phosphorus and alkaline phosphatase levels after 180 days. Though cadmium 200 ppm treated rats showed slight histological lesions in the proximal convoluted tubules of the kidney, there appeared to be no osteomalacia including excess formation of osteoid tissue.

  9. New Multi-1,2,3-Selenadiazole Aromatic Derivatives

    Directory of Open Access Journals (Sweden)

    S. Ratrout


    Full Text Available The aromatic polyketones 3a-d are versatile compounds for the synthesis of the multi-1,2,3-selenadiazole aromatic derivatives 1a-d. The preparation starts with the reaction between the multi-bromomethylene benzene derivatives 2a-d and 4-hydroxy- acetophenone to give compounds 3a-d which are transformed through the reaction with semicarbazide hydrochloride or ethyl hydrazine carboxylate into the corresponding semicarbazones derivatives 4a-d or hydrazones 5a-d. The reaction with selenium dioxide leads to regiospecific ring closure of semicarbazones or hydrazones to give the multi- 1,2,3-selenadiazole aromatic derivatives in high yield.

  10. 美商酷嘛Webcam 1-2-3

    Institute of Scientific and Technical Information of China (English)



    @@ 这一款"Webcam 1-2-3"为网络直播(webcast)软件,使用者只需一部可上网的个人计算机、固定IP及网络摄影机,即可将所拍摄的画面,经由互联网传到世界上的各个角落."Webcam 1-2-3"安装简易,即使不会制作网页的使用者或网络生手,也能在一分钟内完成设置.浏览者也不需安装特殊软件,只要使用可执行Java的浏览器,如IE或Netscape,即可收看实时广播.

  11. Clinical application of l-123 MlBG cardiac imaging

    Energy Technology Data Exchange (ETDEWEB)

    Kang, Do Young [College of Medicine, Donga Univ., Busan (Korea, Republic of)


    Cardiac neurotransmission imaging allows in vivo assessment of presynaptic reuptake, neurotransmitter storage and postsynaptic receptors. Among the various neurotransmitter, I-123 MlBG is most available and relatively well-established. Metaiodobenzylguanidine (MIBG) is an analogue of the false neurotransmitter guanethidine. It is taken up to adrenergic neurons by uptake-1 mechanism as same as norepinephrine. As tagged with I-123, it can be used to image sympathetic function in various organs including heart with planar or SPECT techniques. I-123 MIBG imaging has a unique advantage to evaluate myocardial neuronal activity in which the heart has no significant structural abnormality or even no functional derangement measured with other conventional examination. In patients with cardiomyopathy and heart failure, this imaging has most sensitive technique to predict prognosis and treatment response of betablocker or ACE inhibitor. In diabetic patients, it allow very early detection of autonomic neuropathy. In patients with dangerous arrhythmia such as ventricular tachycardia or fibrillation, MIBG imaging may be only an abnormal result among various exams. In patients with ischemic heart disease, sympathetic derangement may be used as the method of risk stratification. In heart transplanted patients, sympathetic reinnervation is well evaluated. Adriamycin-induced cardiotoxicity is detected earlier than ventricular dysfunction with sympathetic dysfunction. Neurodegenerative disorder such as Parkinson's disease or dementia with Lewy bodies has also cardiac sympathetic dysfunction. Noninvasive assessment of cardiac sympathetic nerve activity with l-123 MlBG imaging may be improve understanding of the pathophysiology of cardiac disease and make a contribution to predict survival and therapy efficacy.

  12. Effects of diethyldithiocarbamate on the toxicokinetics of cadmium chloride in mice

    DEFF Research Database (Denmark)

    Andersen, O; Nielsen, J B


    Diethyldithiocarbamate (DDC) efficiently alleviates the acute toxicity of injected cadmium chloride, but enhances the acute toxicity of orally administered cadmium chloride. Further, DDC induces extensive changes in organ distribution of cadmium, and mobilizes aged cadmium depots. The present study...... investigates effects of DDC on the toxicokinetics of cadmium at lower doses of cadmium than those used in previous studies. During single exposure to subtoxic oral doses of cadmium chloride DDC enhanced intestinal cadmium absorption, both after intraperitoneal and oral administration of DDC. In such acute...... exposure experiments orally administered DDC only slightly changed the relative organ distribution of absorbed cadmium, while intraperitoneal administration of DDC induced extensive changes in organ preference of absorbed cadmium. The relative hepatic and testicular deposition was reduced, while...

  13. Fast-neutron scattering from elemental cadmium

    International Nuclear Information System (INIS)

    Neutron differential-elastic-scattering cross sections of elemental cadmium are measured from approx. = 1.5 to 4.0 MeV at incident-neutron energy intervals of 50 to 200 keV and at 10 to 20 scattering angles distributed between approx. = 20 and 160 degrees. Concurrently, lumped-level neutron inelastic-excitation cross sections are measured. The experimental results are used to deduce parameters of an optical-statistical model that is descriptive of the observables and are compared with corresponding quantities given in ENDF/B-V

  14. Modeling cadmium in the feed chain and cattle organs

    Directory of Open Access Journals (Sweden)

    van der Fels-Klerx, I.


    Full Text Available The objectives of this study were to estimate cadmium contamination levels in different scenarios related to soil characteristics and assumptions regarding cadmium accumulation in the animal tissues, using quantitative supply chain modeling. The model takes into account soil cadmium levels, soil pH, soil-to-plant transfer, animal consumption patterns, and transfer into animal organs (liver and kidneys. The model was applied to cattle up to the age of six years which were fed roughage (maize and grass and compound feed. Cadmium content in roughage and cadmium intake by cattle were calculated for six different (soil scenarios varying in soil cadmium levels and soil pH. For each of the six scenarios, the carry-over of cadmium from intake into the cattle organs was estimated applying two model assumptions, i.e., linear accumulation and a steady state situation. The results showed that only in the most extreme soil scenario (cadmium level 2.5, pH 4.5, cadmium exceeded the EC maximum tolerated level in roughage. Assuming linear accumulation, cadmium levels in organs of cattle up to six years of age, ranged from 0.37-4.03 of fresh weight for kidneys and from 0.07 to 0.77 of fresh weight for livers. The maximum tolerated levels in one or both organs were exceeded in several scenarios. When considering organ excretion of cadmium, internal cadmium levels in organs were approximately one order of magnitude lower as compared to the results of the linear accumulation model. In this case only in the most extreme soil scenario, the maximum tolerated level in the kidney was exceeded. It was concluded that the difference between the two assumptions (linear model versus a steady state situation to estimate cadmium carry-over in cattle is negligible in the animal's first five years of life, but will become relevant at higher ages. For the current case, the linear approach is a good descriptor for worst case situations. Furthermore, this

  15. Sources of cadmium exposure among healthy premenopausal women

    International Nuclear Information System (INIS)

    Background: Cadmium, a persistent and widespread environmental pollutant, has been associated with kidney function impairment and several diseases. Cigarettes are the dominant source of cadmium exposure among smokers; the primary source of cadmium in non-smokers is food. We investigated sources of cadmium exposure in a sample of healthy women. Methods: In a cross-sectional study, 191 premenopausal women completed a health questionnaire and a food frequency questionnaire. The cadmium content of spot urine samples was measured with inductively-coupled plasma mass spectrometry and normalized to urine creatinine content. Multivariable linear regression was used to estimate the strength of association between smoking habits and, among non-smokers, usual foods consumed and urinary cadmium, adjusted for age, race, multivitamin and supplement use, education, estimated total energy intake, and parity. Results: Geometric mean urine creatinine-normalized cadmium concentration (uCd) of women with any history of cigarette smoking was 0.43 μg/g (95% confidence interval (CI): 0.38-0.48 μg/g) and 0.30 μg/g (0.27-0.33 μg/g) among never-smokers, and increased with pack-years of smoking. Analysis of dietary data among women with no reported history of smoking suggested that regular consumption of eggs, hot cereals, organ meats, tofu, vegetable soups, leafy greens, green salad, and yams was associated with uCd. Consumption of tofu products showed the most robust association with uCd; each weekly serving of tofu was associated with a 22% (95% CI: 11-33%) increase in uCd. Thus, uCd was estimated to be 0.11 μg/g (95% CI: 0.06-0.15 μg/g) higher among women who consumed any tofu than among those who consumed none. Conclusions: Cigarette smoking is likely the most important source of cadmium exposure among smokers. Among non-smokers, consumption of specific foods, notably tofu, is associated with increased urine cadmium concentration. - Research highlights: →Urine cadmium, usual

  16. Sources of cadmium exposure among healthy premenopausal women

    Energy Technology Data Exchange (ETDEWEB)

    Adams, Scott V., E-mail: [Fred Hutchinson Cancer Research Center, PO Box 19024, M4-B402, Seattle, WA 98109 (United States); Department of Epidemiology, University of Washington, Box 357236, Seattle, WA 98195 (United States); Newcomb, Polly A. [Fred Hutchinson Cancer Research Center, PO Box 19024, M4-B402, Seattle, WA 98109 (United States); Department of Epidemiology, University of Washington, Box 357236, Seattle, WA 98195 (United States); Shafer, Martin M. [Environmental Chemistry and Technology Program, University of Wisconsin and Wisconsin State Laboratory of Hygiene, Madison, WI (United States); Atkinson, Charlotte [Department of Oral and Dental Science, Bristol Dental School, Bristol (United Kingdom); Bowles, Erin J. Aiello [Group Health Research Institute, Seattle, WA (United States); Newton, Katherine M. [Department of Epidemiology, University of Washington, Box 357236, Seattle, WA 98195 (United States); Group Health Research Institute, Seattle, WA (United States); Lampe, Johanna W. [Fred Hutchinson Cancer Research Center, PO Box 19024, M4-B402, Seattle, WA 98109 (United States); Department of Epidemiology, University of Washington, Box 357236, Seattle, WA 98195 (United States)


    Background: Cadmium, a persistent and widespread environmental pollutant, has been associated with kidney function impairment and several diseases. Cigarettes are the dominant source of cadmium exposure among smokers; the primary source of cadmium in non-smokers is food. We investigated sources of cadmium exposure in a sample of healthy women. Methods: In a cross-sectional study, 191 premenopausal women completed a health questionnaire and a food frequency questionnaire. The cadmium content of spot urine samples was measured with inductively-coupled plasma mass spectrometry and normalized to urine creatinine content. Multivariable linear regression was used to estimate the strength of association between smoking habits and, among non-smokers, usual foods consumed and urinary cadmium, adjusted for age, race, multivitamin and supplement use, education, estimated total energy intake, and parity. Results: Geometric mean urine creatinine-normalized cadmium concentration (uCd) of women with any history of cigarette smoking was 0.43 {mu}g/g (95% confidence interval (CI): 0.38-0.48 {mu}g/g) and 0.30 {mu}g/g (0.27-0.33 {mu}g/g) among never-smokers, and increased with pack-years of smoking. Analysis of dietary data among women with no reported history of smoking suggested that regular consumption of eggs, hot cereals, organ meats, tofu, vegetable soups, leafy greens, green salad, and yams was associated with uCd. Consumption of tofu products showed the most robust association with uCd; each weekly serving of tofu was associated with a 22% (95% CI: 11-33%) increase in uCd. Thus, uCd was estimated to be 0.11 {mu}g/g (95% CI: 0.06-0.15 {mu}g/g) higher among women who consumed any tofu than among those who consumed none. Conclusions: Cigarette smoking is likely the most important source of cadmium exposure among smokers. Among non-smokers, consumption of specific foods, notably tofu, is associated with increased urine cadmium concentration. - Research highlights: {yields

  17. Accumulation and distribution of arsenic and cadmium by tea plants

    Institute of Scientific and Technical Information of China (English)

    Yuan-zhi SHI; Jian-yun RUAN; Lifeng MA; Wen-yan HAN; Fang WANG


    It is important to research the rules about accumulation and distribution of arsenic and cadmium by tea plants, which will give us some scientific ideas about how to control the contents of arsenic and cadmium in tea. In this study, by field inves- tigation and pot trial, we found that mobility of arsenic and cadmium in tea plants was low. Most arsenic and cadmium absorbed were fixed in feeding roots and only small amount was transported to the above-ground parts. Distribution of arsenic and cadmium, based on their concentrations of unit dry matter, in tea plants grown on un-contaminated soil was in the order: feeding roots>stems≈main roots>old leaves>young leaves. When tea plants were grown on polluted soils simulated by adding salts of these two metals, feeding roots possibly acted as a buffer and defense, and arsenic and cadmium were transported less to the above- ground parts. The concentration of cadmium in soil significantly and negatively correlated with chlorophyll content, photosyn- thetic rate, transpiration rate and biomass production of tea plants.

  18. Cadmium Uptake in Synechococcus aquatilis (Reynaud Strain SY01

    Directory of Open Access Journals (Sweden)

    Ruperto Vallarta Jr.


    Full Text Available Cadmium uptake in Synechococcus aquatilis (Reynaud Strain SY01 showed a biphasic behavior, with an initial rapid passive cell wall interaction phase and a later slow intracellular cation uptake process. The cell wall uptake process followed Michaelis-Menten kinetics. The apparent Km of the uptake system was 38.89 µM, a relatively high affinity Km value compared to other metal uptake systems. Fitting of experimental data to the Langmuir and Freundlich adsorption isotherms showed that binding of cadmium to the cell surface was monolayer and/or multilayer, although the monolayer adsorption was more probable, as exemplified by a high correlation coefficient. This could be explained by the presence of a strong primary binding site which was responsible for a monolayer adsorption and a weak secondary binding site which could be responsible for a multilayer adsorption. The uptake process was found to be relatively specific for cadmium. Equimolar amounts (200 µM of cobalt, nickel, magnesium, and copper did not significantly affect cadmium uptake. Synechococcus aquatilis Strain SY01 cells also showed an efflux mechanism for cadmium, although the amount of excluded cadmium was insignificant compared with the amount of adsorbed cadmium in the cell wall.

  19. Bacterial bioremediation of aquatic cadmium 11 of area of Pakistan

    International Nuclear Information System (INIS)

    Cadmium Cd/sup +2/ pollution arises mainly from contamination of minerals used in agriculture and from industrial process. The usual situation is of large volume of soil and H/sub 2/O that are contaminated with low but significant concentration of Cd/sup +2/. Cadmium is one of the most dangerous heavy metal both to human health and aquatic ecosystem. Microorganisms have developed different strategies to regulate uptake and to detoxify heavy metals viz; by different mechanisms i.e. by adsorption to cell surface, by intercellular accumulation, precipitation, biosynthesis of metallothioneins to volatile compounds. Microcosm experiments in chemostat incubated at 20 deg. C showed that Cadmium Contamination does not greatly affect bacterial communities in cultures contaminated with up to 1mg CdI/sup -1/. acterial productivity remains unchanged and Cadmium- resistant strains arise quickly and in great number. The cadmium accumulation by bacteria depend on the bacterial productivity. The free bacteria can accumulate up to 1200 ppm Cadmium Where as the adhering bacteria concentrate up to 6100 ppm. At a steady state, 11-29% Cadmium is removed from the water phase of cultures. This paper includes Cd (II) removal by Bacteria from waste water of Wah Cantonment Pakistan. (author)

  20. Gadolinium chloride pretreatment ameliorates acute cadmium-induced hepatotoxicity. (United States)

    Kyriakou, Loukas G; Tzirogiannis, Konstantinos N; Demonakou, Maria D; Kourentzi, Kalliopi T; Mykoniatis, Michael G; Panoutsopoulos, Georgios I


    Cadmium is a known industrial and environmental pollutant. It causes hepatotoxicity upon acute administration. Features of cadmium-induced acute hepatoxicity encompass necrosis, apoptosis, peliosis and inflammatory infiltration. Gadolinium chloride (GdCl3) may prevent cadmium-induced hepatotoxicity by suppressing Kupffer cells. The effect of GdCl3 pretreatment on a model of acute cadmium-induced liver injury was investigated. Male Wistar rats 4-5 months old were injected intraperitoneally with normal saline followed by cadmium chloride (CdCl2; 6.5 mg/kg) or GdCl3 (10 mg/kg) followed by CdCl2 (6.5 mg/kg; groups I and II, respectively). Rats of both the groups were killed at 9, 12, 16, 24, 48 and 60 h after cadmium intoxication. Liver sections were analyzed for necrosis, apoptosis, peliosis and mitoses. Liver regeneration was also evaluated by tritiated thymidine incorporation into hepatic DNA. Serum levels of aspartate aminotransferase (AST) and alanine aminotransferase (ALT) were also determined. Hepatic necrosis, hepatocyte and nonparenchymal cell apoptosis and macroscopic and microscopic types of peliosis hepatis were minimized by gadolinium pretreatment. Serum levels of AST and ALT were also greatly diminished in rats of group II. Tritiated thymidine incorporation into hepatic DNA was increased in gadolinium pretreatment rats. Kupffer cell activation was minimal in both the groups of rats. Gadolinium pretreatment attenuates acute cadmium-induced liver injury in young Wistar rats, with mechanisms other than Kupffer cell elimination.

  1. Screening of Amaranth Cultivars (Amaranthus mangostanus L.) for Cadmium Hyperaccumulation

    Institute of Scientific and Technical Information of China (English)

    FAN Hong-li; ZHOU Wei


    The potential harm of soil cadmium pollution to ecological environment and human health has been increasingly widely concerned. Phytoremediation, as a kind of new and effective technology, has become an important method for cleaning up cadmium in contaminated sites. The amaranth (Amaranthus mangostanus L.) is widely distributed and has abundant varieties in China, its rapid growth and large biomass can be served as candidate for cadmium hyperaccumulators for phytoremediation. To obtain cadmium hyper-accumulator, Cd uptake in 23 amaranth euitivars from different ecological region was investigated under hydroponic culture condition. Meanwhile, pot experiment was established to probe phytoremediation potentiality of Cd contaminated soil by amaranth. Three treatment (Cd 5, 10, and 25 mg kg-1) were imposed to red soil, yellow brown soil, and vegetable soil. The results showed that under hydroponic culture with Cd 3 mg L-1, the cadmium concentration in the shoots of the cultivar Tianxingmi reached 260 mg kg-1, and its total cadmium uptake was the highest among various cultivars. In the treatment Cd 25 mg kg-1, the cadmium concentration in the shoots of the cultivar Tianxingmi reached 212 mg kg-1, while bioaccumulation factor and shoot purification rate reached 8.50 and 3.8%, respectively. Further, the total biomass and shoot biomass were not decreased significantly under Cd exposure.These results suggested that eultivar Tianxingmi is a typical Cd hyperaccumulator, and can be expected to be used in phytoremediation of Cd contaminated soil.

  2. Blood cadmium concentration and lipid profile in Korean adults

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Kisok, E-mail: [Department of Public Health, Keimyung University, 1000 Shindang-dong, Daegu 704-701 (Korea, Republic of)


    Although animal experiments have shown that cadmium exposure induces alterations in lipid profiles, no epidemiological study of this relationship has been performed. The objective of this study was to evaluate the association between blood cadmium concentration and blood lipid levels in Korean adults. A cross-sectional study comprising participants (n=3903) aged 20 years or older from the 2005, 2008, and 2009 Korea National Health and Nutrition Examination Surveys was conducted. Demographic characteristics and dietary intake were obtained from the participants by questionnaire, and cadmium and lipid levels were determined by analysis of blood samples. After adjusting for demographic and dietary factors, blood concentration of cadmium was positively associated with the risk of low high-density lipoprotein cholesterol (HDL-C) in a dose-dependent manner (p for trend <0.001). In addition, the odds ratios (ORs) of a high triglyceride to HDL-C ratio was significantly increased in the high blood cadmium groups [OR=1.36; 95% confidence interval (CI), 1.03-1.79 for fourth quintile and OR=1.41; 95% CI, 1.07-1.86 for fifth quintile] compared with the lowest quintile group. However, high blood cadmium was not associated with a risk of high total cholesterol, high low-density lipoprotein cholesterol, or high triglycerides. These data suggest that an increased cadmium body burden increases the risk of dyslipidemia, mainly due to the increased risk of low HDL-C and the high ratio of triglycerides to HDL-C.

  3. An eukaryotic translation initiation factor, AteIF5A-2, affects cadmium accumulation and sensitivity in Arabidopsis

    Institute of Scientific and Technical Information of China (English)

    Xiao-Yan Xu; Zhong-Jie Ding; Lei Chen; Jin-Ying Yan; Gui-Xin Li; Shao-Jian Zheng


    Cadmium (Cd) is one of the most toxic elements and can be accumulated in plants easily;meanwhile, eIF5A is a highly conserved protein in all eukaryotic organisms. The present work tried to investigate whether eIF5A is involved in Cd accumulation and sensitivity in Arabidopsis (Arabidopsis thaliana L.) by comparing the wild-type Columbia-0 (Col-0) with a knockdown mutant of AteIF5A-2, fbr12-3 under Cd stress conditions. The results showed that the mutant fbr12-3 accumulated more Cd in roots and shoots and had significantly lower chlorophyll content, shorter root length, and smaller biomass, suggesting that downregulation of AteIF5A-2 makes the mutant more Cd sensitive. Real-time polymerase chain reaction revealed that the expressions of metal transporters involved in Cd uptake and translocation including IRT1, ZIP1, AtNramp3, and AtHMA4 were signifi-cantly increased but the expressions of PCS1 and PCS2 related to Cd detoxification were decreased notably in fbr12-3 compared with Col-0. As a result, an increase in MDA and H2O2 content but decrease in root trolox, glutathione and proline content under Cd stress was observed, indicating that a severer oxidative stress occurs in the mutant. All these results demonstrated for the first time that AteIF5A influences Cd sensitivity by affecting Cd uptake, accumulation, and detoxification in Arabidopsis.

  4. Cadmium minimization in wheat: A critical review. (United States)

    Rizwan, Muhammad; Ali, Shafaqat; Abbas, Tahir; Zia-Ur-Rehman, Muhammad; Hannan, Fakhir; Keller, Catherine; Al-Wabel, Mohammad I; Ok, Yong Sik


    Cadmium (Cd) accumulation in wheat (Triticum aestivum L.) and its subsequent transfer to food chain is a major environmental issue worldwide. Understanding wheat response to Cd stress and its management for aiming to reduce Cd uptake and accumulation in wheat may help to improve wheat growth and grain quality. This paper reviewed the toxic effects, tolerance mechanisms, and management of Cd stress in wheat. It was concluded that Cd decreased germination, growth, mineral nutrients, photosynthesis and grain yield of wheat and plant response to Cd toxicity varies with cultivars, growth conditions and duration of stress applied. Cadmium caused oxidative stress and genotoxicity in wheat plants. Stimulation of antioxidant defense system, osmoregulation, ion homeostasis and over production of signalling molecules are important adaptive strategies of wheat under Cd stress. Exogenous application of plant growth regulators, inorganic amendments, proper fertilization, silicon, and organic, manures and biochar, amendments are commonly used for the reduction of Cd uptake in wheat. Selection of low Cd-accumulating wheat cultivars, crop rotation, soil type, and exogenous application of microbes are among the other agronomic practices successfully employed in reducing Cd uptake by wheat. These management practices could enhance wheat tolerance to Cd stress and reduce the transfer of Cd to the food chain. However, their long-term sustainability in reducing Cd uptake by wheat needs further assessment.

  5. Selenium protection from cadmium and chromium poisoning

    International Nuclear Information System (INIS)

    The interaction of selenium with cadmium and chromium was studied in 168 chicken-broilers (DWCxWR) divided into four equal groups. Eight-week old control animals received an intravenous dose of /sup 115m/Cd Chloride 370 KBq/Kg (Group I), or 51Cr Chloride 370 KBq/Kg (Group II). The kinetics of these isotopes were studied by scintillation spectrometry (NaI/TI) carried out for whole blood, plasma, plasma proteins, urine, feces and homogenates of all organs at various time intervals. Animals in Groups III and IV received eight subcutaneous doses of sodium selenate (5ug) at 8-week intervals prior to /sup 115m/Cd or 51Cr. The kinetics of these elements were studied as in the previous two groups. It was found that selenium affected those kinetics in two ways: (a) by increasing the excretion of Cd by 11 +/- 3% (P < 0.001) and that of Cr by 7 +/- 1% (P < 0.001); and (b) by favoring redistribution of those elements, with significant (P < 0.001) reductions in liver, endocrine glands and kidney and increases (P < 0.01) in bone. The study suggests that selenium protects the animals' vital organs from environmental pollutants, such as cadmium and chromium

  6. Cadmium minimization in wheat: A critical review. (United States)

    Rizwan, Muhammad; Ali, Shafaqat; Abbas, Tahir; Zia-Ur-Rehman, Muhammad; Hannan, Fakhir; Keller, Catherine; Al-Wabel, Mohammad I; Ok, Yong Sik


    Cadmium (Cd) accumulation in wheat (Triticum aestivum L.) and its subsequent transfer to food chain is a major environmental issue worldwide. Understanding wheat response to Cd stress and its management for aiming to reduce Cd uptake and accumulation in wheat may help to improve wheat growth and grain quality. This paper reviewed the toxic effects, tolerance mechanisms, and management of Cd stress in wheat. It was concluded that Cd decreased germination, growth, mineral nutrients, photosynthesis and grain yield of wheat and plant response to Cd toxicity varies with cultivars, growth conditions and duration of stress applied. Cadmium caused oxidative stress and genotoxicity in wheat plants. Stimulation of antioxidant defense system, osmoregulation, ion homeostasis and over production of signalling molecules are important adaptive strategies of wheat under Cd stress. Exogenous application of plant growth regulators, inorganic amendments, proper fertilization, silicon, and organic, manures and biochar, amendments are commonly used for the reduction of Cd uptake in wheat. Selection of low Cd-accumulating wheat cultivars, crop rotation, soil type, and exogenous application of microbes are among the other agronomic practices successfully employed in reducing Cd uptake by wheat. These management practices could enhance wheat tolerance to Cd stress and reduce the transfer of Cd to the food chain. However, their long-term sustainability in reducing Cd uptake by wheat needs further assessment. PMID:27062345

  7. Cadmium determination in Lentinus edodes mushroom species

    Directory of Open Access Journals (Sweden)

    Vera Akiko Maihara


    Full Text Available Many studies have drawn attention to the occurrence and concentration of toxic elements found in the fruiting body of mushrooms. Some edible mushroom species are known to accumulate high levels of inorganic contaminants, mainly cadmium, mercury, and lead. There are about 2,000 known edible mushroom species, but only 25 of them are cultivated and used as food. In Brazil, the most marketed and consumed mushroom species are Agaricus bisporus, known as Paris champignon, Lentinus edodes, or Shitake and Pleurotus sp, also called Shimeji or Hiratake. In this study, the concentration of cadmium was determined in Lentinus edodes mushrooms from different cities in São Paulo state and some samples imported from Japan and China. The analyses were performed by graphite furnace atomic absorption spectrometry after HNO3-H2O2 digestion. The results showed a lower concentration of Cd in the mushrooms cultivated in São Paulo (0.0079 to 0.023 in natura than that of the mushrooms cultivated abroad (0.125 to 0.212 in natura. Although there is no tolerance limit for Cd in mushrooms in Brazil, the results show that Lentinus edodes mushrooms can be safely consumed.

  8. Exposure dose response relationships of the freshwater bivalve Hyridella australis to cadmium spiked sediments

    Energy Technology Data Exchange (ETDEWEB)

    Marasinghe Wadige, Chamani P.M., E-mail:; Maher, William A.; Taylor, Anne M.; Krikowa, Frank


    Highlights: • The exposure–dose–response approach was used to assess cadmium exposure and toxicity. • Accumulated cadmium in H. australis reflected the sediment cadmium exposure. • Spill over of cadmium into the biologically active pool was observed. • Increased cadmium resulted in measurable biological effects. • H. australis has the potential to be a cadmium biomonitor in freshwater environments. - Abstract: To understand how benthic biota may respond to the additive or antagonistic effects of metal mixtures in the environment it is first necessary to examine their responses to the individual metals. In this context, laboratory controlled single metal-spiked sediment toxicity tests are useful to assess this. The exposure–dose–response relationships of Hyridella australis to cadmium-spiked sediments were, therefore, investigated in laboratory microcosms. H. australis was exposed to individual cadmium spiked sediments (<0.05 (control), 4 ± 0.3 (low) and 15 ± 1 (high) μg/g dry mass) for 28 days. Dose was measured as cadmium accumulation in whole soft body and individual tissues at weekly intervals over the exposure period. Dose was further examined as sub-cellular localisation of cadmium in hepatopancreas tissues. The biological responses in terms of enzymatic and cellular biomarkers were measured in hepatopancreas tissues at day 28. H. australis accumulated cadmium from spiked sediments with an 8-fold (low exposure organisms) and 16-fold (high exposure organisms) increase at day 28 compared to control organisms. The accumulated tissue cadmium concentrations reflected the sediment cadmium exposure at day 28. Cadmium accumulation in high exposure organisms was inversely related to the tissue calcium concentrations. Gills of H. australis showed significantly higher cadmium accumulation than the other tissues. Accumulated cadmium in biologically active and biologically detoxified metal pools was not significantly different in cadmium exposed

  9. Cadmium biosorption by baker’s yeast in aqueous suspension


    Tálos Katalin; Pernyeszi Tímea; Majdik Cornelia; Hegedűsova Alzbeta; Páger Csilla


    The biosorption of cadmium from artificial aqueous solutions using native baker’s yeast was investigated. The highest metal uptake value was 110 mg g-1 in a suspension of 0.3 g L-1. The effect of pH, initial cadmium concentration, adsorption time and biosorbent dosage on biosorption by baker’s yeast was studied. The maximum biosorption capacity of cadmium by yeast was observed at pH 6.0. The adsorption equilibrium was reached within sixty minutes and the sorption process followed pseudo...

  10. Application of sequential extraction analysis to electrokinetic remediation of cadmium, nickel and zinc from contaminated soils

    Energy Technology Data Exchange (ETDEWEB)

    Giannis, Apostolos, E-mail: [Department of Environmental Engineering, Technical University of Crete, Politechnioupolis, Chania 73100 (Greece); Pentari, Despina [Department of Mineral Resources Engineering, Technical University of Crete, Politechnioupolis, Chania 73100 (Greece); Wang, Jing-Yuan [Residues and Resource Reclamation Centre (R3C), Nanyang Technological University, 50 Nanyang Avenue, 639798 Singapore (Singapore); Gidarakos, Evangelos, E-mail: [Department of Environmental Engineering, Technical University of Crete, Politechnioupolis, Chania 73100 (Greece)


    An enhanced electrokinetic process for the removal of cadmium (Cd), nickel (Ni) and zinc (Zn) from contaminated soils was performed. The efficiency of the chelate agents nitrilotriacetic acid (NTA), diethylenetriaminepentaacetic acid (DTPA) and diaminocycloexanetetraacetic acid (DCyTA) was examined under constant potential gradient (1.23 V/cm). The results showed that chelates were effective in desorbing metals at a high pH, with metal-chelate anion complexes migrating towards the anode. At low pH, metals existing as dissolved cations migrated towards the cathode. In such conflicting directions, the metals accumulated in the middle of the cell. Speciation of the metals during the electrokinetic experiments was performed to provide an understanding of the distribution of the Cd, Ni and Zn. The results of sequential extraction analysis revealed that the forms of the metals could be altered from one fraction to another due to the variation of physico-chemical conditions throughout the cell, such as pH, redox potential and the chemistry of the electrolyte solution during the electrokinetic treatment. It was found that binding forms of metals were changed from the difficult type to easier extraction type.

  11. Application of sequential extraction analysis to electrokinetic remediation of cadmium, nickel and zinc from contaminated soils. (United States)

    Giannis, Apostolos; Pentari, Despina; Wang, Jing-Yuan; Gidarakos, Evangelos


    An enhanced electrokinetic process for the removal of cadmium (Cd), nickel (Ni) and zinc (Zn) from contaminated soils was performed. The efficiency of the chelate agents nitrilotriacetic acid (NTA), diethylenetriaminepentaacetic acid (DTPA) and diaminocycloexanetetraacetic acid (DCyTA) was examined under constant potential gradient (1.23 V/cm). The results showed that chelates were effective in desorbing metals at a high pH, with metal-chelate anion complexes migrating towards the anode. At low pH, metals existing as dissolved cations migrated towards the cathode. In such conflicting directions, the metals accumulated in the middle of the cell. Speciation of the metals during the electrokinetic experiments was performed to provide an understanding of the distribution of the Cd, Ni and Zn. The results of sequential extraction analysis revealed that the forms of the metals could be altered from one fraction to another due to the variation of physico-chemical conditions throughout the cell, such as pH, redox potential and the chemistry of the electrolyte solution during the electrokinetic treatment. It was found that binding forms of metals were changed from the difficult type to easier extraction type. PMID:20833468

  12. Transcriptomic analysis of cadmium stress response in the heavy metal hyperaccumulator Sedum alfredii Hance. (United States)

    Gao, Jun; Sun, Ling; Yang, Xiaoe; Liu, Jian-Xiang


    The Sedum alfredii Hance hyperaccumulating ecotype (HE) has the ability to hyperaccumulate cadmium (Cd), as well as zinc (Zn) and lead (Pb) in above-ground tissues. Although many physiological studies have been conducted with these plants, the molecular mechanisms underlying their hyper-tolerance to heavy metals are largely unknown. Here we report on the generation of 9.4 gigabases of adaptor-trimmed raw sequences and the assembly of 57,162 transcript contigs in S. alfredii Hance (HE) shoots by the combination of Roche 454 and Illumina/Solexa deep sequencing technologies. We also have functionally annotated the transcriptome and analyzed the transcriptome changes upon Cd hyperaccumulation in S. alfredii Hance (HE) shoots. There are 110 contigs and 123 contigs that were up-regulated (Fold Change ≥ 2.0) and down-regulated (Fold Change

  13. Transcriptomic analysis of cadmium stress response in the heavy metal hyperaccumulator Sedum alfredii Hance.

    Directory of Open Access Journals (Sweden)

    Jun Gao

    Full Text Available The Sedum alfredii Hance hyperaccumulating ecotype (HE has the ability to hyperaccumulate cadmium (Cd, as well as zinc (Zn and lead (Pb in above-ground tissues. Although many physiological studies have been conducted with these plants, the molecular mechanisms underlying their hyper-tolerance to heavy metals are largely unknown. Here we report on the generation of 9.4 gigabases of adaptor-trimmed raw sequences and the assembly of 57,162 transcript contigs in S. alfredii Hance (HE shoots by the combination of Roche 454 and Illumina/Solexa deep sequencing technologies. We also have functionally annotated the transcriptome and analyzed the transcriptome changes upon Cd hyperaccumulation in S. alfredii Hance (HE shoots. There are 110 contigs and 123 contigs that were up-regulated (Fold Change ≥ 2.0 and down-regulated (Fold Change

  14. Application of sequential extraction analysis to electrokinetic remediation of cadmium, nickel and zinc from contaminated soils

    International Nuclear Information System (INIS)

    An enhanced electrokinetic process for the removal of cadmium (Cd), nickel (Ni) and zinc (Zn) from contaminated soils was performed. The efficiency of the chelate agents nitrilotriacetic acid (NTA), diethylenetriaminepentaacetic acid (DTPA) and diaminocycloexanetetraacetic acid (DCyTA) was examined under constant potential gradient (1.23 V/cm). The results showed that chelates were effective in desorbing metals at a high pH, with metal-chelate anion complexes migrating towards the anode. At low pH, metals existing as dissolved cations migrated towards the cathode. In such conflicting directions, the metals accumulated in the middle of the cell. Speciation of the metals during the electrokinetic experiments was performed to provide an understanding of the distribution of the Cd, Ni and Zn. The results of sequential extraction analysis revealed that the forms of the metals could be altered from one fraction to another due to the variation of physico-chemical conditions throughout the cell, such as pH, redox potential and the chemistry of the electrolyte solution during the electrokinetic treatment. It was found that binding forms of metals were changed from the difficult type to easier extraction type.

  15. Chromosomal Locus for Cadmium Resistance in Pseudomonas putida Consisting of a Cadmium-Transporting ATPase and a MerR Family Response Regulator


    Lee, Seon-Woo; Glickmann, Eric; Cooksey, Donald A.


    Pseudomonads from environmental sources vary widely in their sensitivity to cadmium, but the basis for this resistance is largely uncharactarized. A chromosomal fragment encoding cadmium resistance was cloned from Pseudomonas putida 06909, a rhizosphere bacterium, and sequence analysis revealed two divergently transcribed genes, cadA and cadR. CadA was similar to cadmium-transporting ATPases known mostly from gram-positive bacteria, and to ZntA, a lead-, zinc-, and cadmium-transporting ATPase...

  16. Inclusion free cadmium zinc tellurium and cadmium tellurium crystals and associated growth method (United States)

    Bolotnikov, Aleskey E.; James, Ralph B.


    The present disclosure provides systems and methods for crystal growth of cadmium zinc tellurium (CZT) and cadmium tellurium (CdTe) crystals with an inverted growth reactor chamber. The inverted growth reactor chamber enables growth of single, large, high purity CZT and CdTe crystals that can be used, for example, in X-ray and gamma detection, substrates for infrared detectors, or the like. The inverted growth reactor chamber enables reductions in the presence of Te inclusions, which are recognized as an important limiting factor in using CZT or CdTe as radiation detectors. The inverted growth reactor chamber can be utilized with existing crystal growth techniques such as the Bridgman crystal growth mechanism and the like. In an exemplary embodiment, the inverted growth reactor chamber is a U-shaped ampoule.

  17. Crystal growth process of Y123 film fabricated by modified TFA-MOD process

    International Nuclear Information System (INIS)

    Modified metal-organic deposition (MOD) process using precursor solution of trifluoroacetates (TFA) for Y and Ba and F-free salt for Cu is one of the most promising low cost non-vacuum methods to fabricate the coated conductor of YBa2Cu3O7-X (Y123) film with high critical current density. Since Y123 phase grows in the precursor film by the release of HF with supplying H2O, liquid/gas evolution affects the growth process, microstructure and properties of Y123 film. However, details of the growth mechanism of Y123 crystals are still unknown. To clarify the growth mechanism of Y123 film, the growth process of Y123 crystal was studied by the experimental method and the numerical method (FDM analysis). The quenching experiments during the growth of Y123 crystals on LaAlO3 (LAO) and/or CeO2/LAO substrates revealed the microstructures of growing Y123 crystals through TEM observations. The growth model for Y123 crystals in YBCO film with some process-controlling parameters was obtained on the basis of the experimental results. The growth processes of faceted Y123 crystals with various crystal orientations were simulated by the two-dimensional numerical method using c-axis and a-axis growth rate functions, and the effects of initial distributions of nucleated crystals and particles were discussed

  18. Serotonin transporters in dopamine transporter imaging: a head-to-head comparison of dopamine transporter SPECT radioligands 123I-FP-CIT and 123I-PE2I

    DEFF Research Database (Denmark)

    Ziebell, Morten; Holm-Hansen, Signe; Thomsen, Gerda;


    the SPECT radioligands (123)I-2-ß-carbomethoxy-3ß-(4-iodophenyl)-N-(3-fluoropropyl)nortropane ((123)I-FP-CIT) and (123)I-N-(3-iodoprop-2E-enyl)-2-ß-carbomethoxy-3ß-(4-methylphenyl) nortropane ((123)I-PE2I), which has a 10-fold higher selectivity than (123)I-FP-CIT for DAT versus SERT [corrected]....

  19. Serotonin transporters in dopamine transporter imaging: a head-to-head comparison of dopamine transporter SPECT radioligands 123I-FP-CIT and 123I-PE2I

    DEFF Research Database (Denmark)

    Ziebell, Morten; Holm-Hansen, Signe; Thomsen, Gerda;


    the SPECT radioligands (123)I-2-β-carbomethoxy-3β-(4-iodophenyl)-N-(3-fluoropropyl)nortropane ((123)I-FP-CIT) and (123)I-N-(3-iodoprop-2E-enyl)-2-β-carbomethoxy-3β-(4-methylphenyl) nortropane ((123)I-PE2I), which has a 10-fold higher selectivity than (123)I-FP-CIT for DAT versus SERT [corrected]....

  20. Fractionation of Stable Cadmium Isotopes in the Cadmium Tolerant Ricinus communis and Hyperaccumulator Solanum nigrum


    Rongfei Wei; Qingjun Guo; Hanjie Wen; Congqiang Liu; Junxing Yang; Marc Peters; Jian Hu; Guangxu Zhu; Hanzhi Zhang; Liyan Tian; Xiaokun Han; Jie Ma; Chuanwei Zhu; Yingxin Wan


    Cadmium (Cd) isotopes provide new insights into Cd uptake, transport and storage mechanisms in plants. Therefore, the present study adopted the Cd-tolerant Ricinus communis and Cd-hyperaccumulator Solanum nigrum, which were cultured under controlled conditions in a nutrient solution with variable Cd supply, to test the isotopic fractionation of Cd during plant uptake. The Cd isotope compositions of nutrient solutions and organs of the plants were measured by multiple collector inductively cou...

  1. Iodine-123 miniplasmin for the detection of deep venous thrombosis

    International Nuclear Information System (INIS)

    Human plasminogen (MW 90'000) is cleaved by elastase into several fragments, including one with a molecular weight of 38'000 (mini-plasminogen). This fragment retains sufficiently preserved fibrin binding sites but lacks the affinity for α2-antiplasmin. Therefore radiolabelled miniplasmin was tested in 21 patients with suspected deep venous thrombosis, in 5 patients with lymphedema and in 5 healthy controls for its potential use as fast marker of deep venous thrombosis. 250 μCi of Iodine-123 miniplasmin was given i.v. after previous activation with 3000 IU urokinase. The tracer distribution was measured 15, 30 and 60 minutes after injection at 10 points over each leg. The mean left/right ratio obtained in the 5 volunteers was 1.04 (range 0.89-1.12). In the patients the test was considered positive when the left/right ratio was greater than 1.15 or smaller than 0.85 at two adjacent locations and in two consecutive measuring times. In the 21 patients studied both tests gave concurrent results in 19, while in one patient with a positive and in one patient with a negative phlebography the miniplasmintest gave opposite results. In 4 of the 5 patients with edema and no thrombosis the miniplasmintest was negative. Most positive tests were conclusive as early as 15 minutes after injection of miniplasmin. The sensitivity was calculated to be 90% and the specificity 85%. Therefore Iodine-123 miniplasmin has been estimated as a fast, non invasive marker for the diagnosis of deep venous thrombosis and preliminary clinical studies with scintigraphy have been performed on over 50 patients. Evaluation gave a sensitivity between 40% and 86% and a specificity between 62% and 100%. Clinical studies have not been continued. Since I-123 miniplasmin is not available around the clock, it can't be used in emergency diagnosis. (author) 2 figs., 5 tabs., 30 refs

  2. Electrochemical removal of cadmium from bio-ash; Elektrokemisk fjernelse af cadmium fra bioasker

    Energy Technology Data Exchange (ETDEWEB)

    Juul Pedersen, Anne; Ottosen, Lisbeth M.; Simonsen, Peter; Christensen, Terkel C.


    The potential of using the method electrodialytic remediation for removal of cadmium from bioashes has been investigated. Five different types of fly ash from biomass combustion were included in the study: 1) A straw combustion fly ash from grate-firing at Avedoere power plant. 2) A fly ash from co-firing of wood and fuel oil at Avedoere power plant. 3) A suspended, grain size fractionated straw fly ash, obtained from PSO project FU 2201, fine and coarse size fraction. The ash was originally produced at Avedoere power plant. 4) A straw pellet fly ash from dust-firing at Amager power plant. Thr five ashes were characterised, and a series of preliminary elekctrodialytic remediation experiments were conducted on each ash. In spite a significant differences between the five ashes with respect to parameters such as pH and content of cadmium, all ashes showed promising remediation potential. For all ashes cadmium concentrations below the regulatory limits for recycling were reached in one or more of the preliminary remediation experiements. The best results were obtained with the suspended straw ash from PSO FU 2201, whereas the results with the wood chips ash, due to a high initial pH value, were less sucessful, meaning that the remediation process was progressing more slowly. (BA)

  3. Transformation and biodegradation of 1,2,3-trichloropropane (TCP)


    Samin, Ghufrana; Janssen, Dick B.


    Purpose 1,2,3-Trichloropropane (TCP) is a persistent groundwater pollutant and a suspected human carcinogen. It is also is an industrial chemical waste that has been formed in large amounts during epichlorohydrin manufacture. In view of the spread of TCP via groundwater and its toxicity, there is a need for cheap and efficient technologies for the cleanup of TCP-contaminated sites. In situ or on-site bioremediation of TCP is an option if biodegradation can be achieved and stimulated. This pap...

  4. Transformation and biodegradation of 1,2,3-trichloropropane (TCP)


    Samin, Ghufrana; Janssen, Dick B.; Kronberg, Leif


    1,2,3-Trichloropropane (TCP) is a persistent groundwater pollutant and a suspected human carcinogen. It is also is an industrial chemical waste that has been formed in large amounts during epichlorohydrin manufacture. In view of the spread of TCP via groundwater and its toxicity, there is a need for cheap and efficient technologies for the cleanup of TCP-contaminated sites. In situ or on-site bioremediation of TCP is an option if biodegradation can be achieved and stimulated. This paper prese...


    Directory of Open Access Journals (Sweden)

    Putu Diah Vedayanti


    Full Text Available Graves’ disease is the most common form of thyrotoxicosis which caused byautoimmune that attacks the thyroid gland. This disease will lead such followingsyndromes: thyrotoxicosis, goiter, ophthalmopathy, dermopathy. The sensitive TSHassay is the single best screening test for hyperthyroidism, and in most outpatientclinical situations. But when there is a doubt to distinguish diffuse toxic goiter (Graves’disease from autonomous toxic nodule (Plummer’s disease, radioinuclide scanning canbe performed. I-123 is one of the preferable radiosisotope because it can produce clearimage and short enough half-life, although the price is expensive. 

  6. Soil biogeochemistry, plant physiology and phytoremediation of cadmium contaminated soils (United States)

    Cadmium (Cd) loading in soil and the environment has been accelerated worldwide due to enhanced industrialization and intensified agricultural production, particularly in the developing countries. Soil Cd pollution, resulting from both anthropogenic and geogenic sources, has posed an increasing chal...

  7. A Study of Growth of Cadmium Oxide Nano structure

    International Nuclear Information System (INIS)

    Cadmium oxide nano structure were synthesized by solid-vapor deposition without catalyst. Cadmium Oxide powder was heated to 1320 K in a tube furnace, and the resultant vapor was carried to the silicon substrate zone by an argon flow. Field electron scanning electron microscopy revealed that the product was dendrite-like petals of Cadmium Oxide nano structure. The grown nano structure had random orientations and a grain size of 30 nm. Photoluminescence spectroscopy was conducted to investigate the optical properties of the nano structures. The red-shift direct band gap energy of Cadmium Oxide nano structure was at 548 nm (2.26 eV), whereas that of CdO bulk was at 491 nm (2.5 eV). (author)

  8. Polycrystalline Thin-Film Research: Cadmium Telluride (Fact Sheet)

    Energy Technology Data Exchange (ETDEWEB)


    Capabilities fact sheet that includes scope, core competencies and capabilities, and contact/web information for Polycrystalline Thin-Film Research: Cadmium Telluride at the National Center for Photovoltaics.

  9. Electrodialytic removal of cadmium from straw combustion fly ash

    DEFF Research Database (Denmark)

    Hansen, Henrik K.; Ottosen, Lisbeth M.; Villumsen, Arne


    Fly ash from straw combustion contains valuable nutrients when returned to agricultural soils. In many instances, however, this fly ash may contain heavy metals, such as cadmium, at levels which often exceed the limits given by the Danish legislation. Thus before utilizing the nutrients, cadmium...... must be removed from these ashes. The use of an electrodialytic remediation method to remove cadmium from fly ash arising from straw combustion and containing 11.2 mg Cd kg$+-1$/ DM (dry matter) was accessed. After 36 days of remediation at a constant current density of 5.6 mA cm$+-2$/ more than 97......% of the cadmium had been removed from around 150 g ash on a dry basis. $CPY 2004 Society of Chemical Industry....

  10. Literature review on pickling inhibitors and cadmium electroplating processes (United States)

    Elsea, A. R.; Fletcher, E. E.; Groeneveld, T. P.


    Because introduction of hydrogen during bright-cadmium electroplating of high strength steels causes hydrogen-stress cracking, a program was undertaken to evaluate various processes and materials. Report describes effectiveness of inhibitors for reducing hydrogen absorption by steels.


    Cadmium (Cd) is a ubquitous element and a significant inorganic pollutant that has previously been found to bioaccumulate in reproductive organs of fish and disrupt important endocrine processes, especially those involved in synthesis, release and metabolism of hormones. Clearly,...

  12. A Facile Glycosylation of Spirostanol Catalyzed by Cadmium Carbonate

    Institute of Scientific and Technical Information of China (English)


    A facile glycosylation for the synthesis of spirostanol glycosides was reported. Using cadmium carbonate as a catalyst in CH3CN, a series of saponins was synthesized efficiently in a satisfactory yield.

  13. Ion exchange of Cobalt and Cadmium in Zeolite X

    International Nuclear Information System (INIS)

    The growing development in the industry has an important contribution to the environmental damage, where the natural effluents are each day more contaminated by toxic elements, such as: mercury, chromium, lead and cadmium. So as to separate such elements it has sorbent must have enough stability, and have a sharp capacity of sorption. In this work it was studied the sorption behavior of cobalt and on the other hand, cadmium in aqueous solutions, which along with sodic form of the Zeolite X, undergoes a phenomenon of ionic interchange. Such interchange was verify to different concentration of cadmium, cobalt and hydronium ion. The content of cobalt and sodium in the interchanged samples was detected through the neutronic activation analysis. The results disclose a higher selectivity for cadmium than cobalt. (Author)

  14. Surfactant Mediated Cadmium Determination with Dithizone in Aqueous Solution


    Ismael, Fouad Jawad


    ABSTRACT: Cadmium is a toxic and hazardous trace metal that has become a serious environmental pollutant since industrialization and intensive farming began in late 19th century. Although there are many established wet-chemical and instrumental methods for qualitative and quantitative determination of cadmium, most involve the formation of the Cd-dithizone complex in the presence of the highly toxic potassium cyanide which is then extracted into carcinogenic chlorinated organic solvents such ...

  15. Ecotoxicity and genotoxicity of cadmium in different marine trophic levels. (United States)

    Pavlaki, Maria D; Araújo, Mário J; Cardoso, Diogo N; Silva, Ana Rita R; Cruz, Andreia; Mendo, Sónia; Soares, Amadeu M V M; Calado, Ricardo; Loureiro, Susana


    Cadmium ecotoxicity and genotoxicity was assessed in three representative species of different trophic levels of marine ecosystems - the calanoid copepod Acartia tonsa, the decapod shrimp, Palaemon varians and the pleuronectiform fish Solea senegalensis. Ecotoxicity endpoints assessed in this study were adult survival, hatching success and larval development ratio (LDR) for A. tonsa, survival of the first larval stage (zoea I) and post-larvae of P. varians, egg and larvae survival, as well as the presence of malformations in the larval stage of S. senegalensis. In vivo genotoxicity was assessed on adult A. tonsa, the larval and postlarval stage of P. varians and newly hatched larvae of S. senegalensis using the comet assay. Results showed that the highest sensitivity to cadmium is displayed by A. tonsa, with the most sensitive endpoint being the LDR of nauplii to copepodites. Sole eggs displayed the highest tolerance to cadmium compared to the other endpoints evaluated for all tested species. Recorded cadmium toxicity was (by increasing order): S. senegalensis eggs < P. varians post-larvae < P. varians zoea I < S. senegalensis larvae < A. tonsa eggs < A. tonsa LDR. DNA damage to all species exposed to cadmium increased with increasing concentrations. Overall, understanding cadmium chemical speciation is paramount to reliably evaluate the effects of this metal in marine ecosystems. Cadmium is genotoxic to all three species tested and therefore may differentially impact individuals and populations of marine taxa. As A. tonsa was the most sensitive species and occupies a lower trophic level, it is likely that cadmium contamination may trigger bottom-up cascading effects in marine trophic interactions. PMID:27203468

  16. Avalanche multiplication of electrons and holes in cadmium telluride

    CERN Document Server

    Demich, N V


    Determination of the ratio of the coefficients of the electrons and holes of the diode structures impact ionization is carried out with the purpose of optimizing the parameters of the avalanche diodes from the cadmium telluride. It is shown experimentally, that the process of the impact ionization in the cadmium telluride is stimulated by holes. The ratio of the coefficients of the holes and electrons impact ionization constitutes approx = 30-40

  17. Association between blood cadmium levels and malnutrition in peritoneal dialysis


    Hsu, Ching-Wei; Lin, Ja-Liang; Lin-Tan, Dan-Tzu; Huang, Wen-Hung; Chen, Kuan-Hsing; Yen, Tzung-Hai


    Background Malnutrition is associated with an increased risk of cardiovascular death and may cause protein-energy wasting in individuals with chronic kidney disease. A previous study demonstrated that blood cadmium levels (BCLs) were associated with malnutrition in maintenance hemodialysis (MHD) patients. However, the correlation between cadmium exposure and malnutrition remains unclear in chronic peritoneal dialysis (CPD) patients. This study examined the possible adverse effects of environm...

  18. Study on Systemic Separation of Palladium, Silver, Cadmium and Tin

    Institute of Scientific and Technical Information of China (English)

    YU; Zhen-hua; HUANG; Kun


    To accurately measure the yields of palladium,silver,cadmium and tin that generated from the fission of plutonium,radiochemical method is needed because there is much interference in using directγ-spectroscopy measurements.Usually,we want to get as much as possible the experiment data from one target,so it is required systemic separation of palladium,silver,cadmium and tin.Considering the

  19. Harmful effects of cadmium on olfactory system in mice. (United States)

    Bondier, Jean-Robert; Michel, Germaine; Propper, Alain; Badot, Pierre-Marie


    The inhalation of certain metals can result in olfactory epithelial injury, an altered sense of smell, and direct delivery of the metal from the olfactory epithelium to the olfactory bulbs and other parts of the central nervous system. The purpose of this study was to examine whether mice given an intranasal instillation of cadmium would develop altered olfactory function and to assess whether cadmium may be transported directly from the olfactory epithelium to the central nervous system. To evaluate cadmium's ability to induce anosmia and on the basis of olfactory epithelium sensitivity to metals, the aim of this study was first to study cadmium effects on the olfactory function and secondly to check whether cadmium may be transported from the nasal area to the central nervous system. After an intranasal instillation of a solution containing CdCl2 at 136 mM, we observed in treated mice: (1) a partial destruction of the olfactory epithelium, which is reduced to three or four basal cell layers followed by a progressive regeneration; (2) a loss of odor discrimination with a subsequent recovery; and (3) a cadmium uptake by olfactory bulbs demonstrated using atomic absorption spectrophotometry, but not by other parts of the central nervous system. Cadmium was delivered to the olfactory bulbs, most likely along the olfactory nerve, thereby bypassing the intact blood-brain barrier. We consider that cadmium can penetrate olfactory epithelium and hence be transported to olfactory bulbs. The olfactory route could therefore be a likely way to reach the brain and should be taken into account for occupational risk assessments for this metal.

  20. Cadmium removal in a biosorption column

    Energy Technology Data Exchange (ETDEWEB)

    Volesky, B.; Prasetyo, I. (McGill Univ., Montreal, Quebec (Canada). Dept. of Chemical Engineering)


    New biosorbent material derived from a ubiquitous brown marine alga Ascophyllum nodosum has been examined in packed-bed flow-through sorption columns. It effectively removed 10 mg/L of cadmium down to 1.5 ppb levels in the effluent, representing 99.985% removal. The experimental methodology used was based on the early Bohart and Adams sorption model, resulting in quantitative determination of the characteristic process parameters which can be used for performance comparison and process design. An average metal loading of the biosorbent (N[sub 0]) determined was 30 mg Cd/g, corresponding closely to that observed for the batch equilibrium metal concentration of 10 mg Cd/L. The critical bed depth (D[sub min]) for the potable water effluent quality standard varied with the column feed flow rate from 20 to 50 cm. The sorption column mass transfer and dispersion coefficients were determined, which are also required for solving the sorption model equations.

  1. Cadmium substituted high permeability lithium ferrite

    Indian Academy of Sciences (India)

    S S Bellad; S C Watawe; A M Shaikh; B K Chougule


    Polycrystalline Li0.5–/2 Cd Fe2.5–/2O4 ferrites where = 0, 0.1, 0.2, 0.3, 0.4, 0.5 and 0.6 were prepared by a double sintering ceramic technique and characterized by X-ray diffraction and scanning electron microscopy (SEM). The lattice parameter is found to increase monotonically with the cadmium content. It is explained in terms of the sizes of component ions. The grain size of the samples increases up to = 0.3 and then it decreases for higher values of . A similar trend is observed in the variation of Ms with Cd2+ content. The initial permeability () is however found to increase continuously with . The increase in is attributed to decrease of anisotropy constant K1 and higher grain size of the samples.

  2. Synthesis and Electroluminescence Characterization of Cadmium Complex

    Directory of Open Access Journals (Sweden)



    Full Text Available We have synthesized and characterized a new electroluminescence material,Cadmium [(2-(2-hydroxyphenylbenzoxazole(8-hydoxyquinoline] Cd(HPBq. The absorption spectra of this material show maxima at 378 nm. It may be attributed due to π° – π* transition. The photoluminescence showed peak at 520 nm. TGA data of the material shows stability up to 370 °C .Organic light emitting diode have been fabricated with this material and the fundamental structures of the device is ITO/α-NPD/ Cd(HPBq/BCP/Alq3/LiF/Al exhibited a luminescence peak at 550 nm. The maximum luminescence of the device was 295 cd/m2 with current density of 6687 A/m2 at 20 V. The maximum current efficiency of OLED was 1.01 cd/A at 17 V and power efficiency was 1.01 lm/w at 17 V.

  3. Soil Cadmium Regulates Antioxidases in Sorghum

    Institute of Scientific and Technical Information of China (English)

    LIU Da-lin; ZHANG Shu-pan; CHEN Zheng; QIU Wei-wei


    The regulatory mechanism of soil cadmium(Cd)on antioxidases in sorghum was studied using 3 sorghum species viz.,sweet sorghum[Sorghum bicolor(L.)],sorghum hybrid sudangrass(Sorghum bicolor × S.sudanense,cv.Everlush)and sudangrass[Sorghum sudanense(Piper)Stapf cv.Xinjiang].The results showed that low concentrations of Cd2+(≤10 mg kg-1)induced the activities of 4 antioxidases in leaves of the 3 species of sorghum,but high Cd2+concentrations(≥50 mg kg-1)significantly reduced the activities of all the four antioxidases.The glutathione(GSH)contents in leaves of the 3 species of sorghum correlated positively with the Cd2+concentrations.The maximum antioxidase activities were observed at the elongation stage of sorghum during the whole growth period.

  4. Flotation of cadmium-loaded biomass. (United States)

    Matis, K A; Zouboulis, A I


    Biosorption of heavy metal ions such as Cd(2+) by dead biomass has been recognized as a potential alternative to existing removal technologies applied to wastewater treatment. Two bacterial strains were studied in the laboratory, streptomyces griseus and S. clavuligerus, an industrial by-product. Both washed and unwashed samples were examined. Foam flotation proposed in this work as the separation state following biosorption. Effective biomass separation was conducted in the presence of a frother, ethanol. The pH of the solution was a crucial parameter for flotation and also for metal binding. Other basic parameters of flotation examined were the initial cadmium concentration in the dilute aqueous solution and the quantity of biomass used. A study of zeta-potential measurements of the actinomycetes was carried out under the conditions used in the separation; surface tension was also measured. These provided useful information on the process. PMID:18618752

  5. Morphological stability of Sm123 superconductor during peritectic solidification from Sm211 + L mixture

    International Nuclear Information System (INIS)

    The interface stability of the Sm 123 superconductor was analyzed in accordance with the constitutional undercooling criterion. As the single-crystal growth of the 123 phase is largely dependent on the growth-interface stability, a quantitative analysis was very much required. From this analysis, it was clarified that the constitutional undercooling must exist in the liquid when the 123 growth interface comes close to a 211 particle during the peritectic solidification. It was also predicted that the larger 211 particle radius, smaller volume fraction of the 211 particles, larger growth rate, or smaller imposed temperature gradient would cause easy occurrence of the constitutional undercooling ahead of the 123 growth interface. Taking into account the nucleation at the L/211 interface just ahead of the 123 growth front due to the constitutional undercooling, the transition of 123 growth from a planar-interface morphology to an equiaxed blocky morphology was investigated quantitatively and qualitatively

  6. Dynamic myocardial scintigraphy with 123I-labelled free fatty acids

    International Nuclear Information System (INIS)

    In this thesis, long-chain radioiodinated free fatty acids (123I-FFA), 16-iodo-123I-cis-Δ9-hexadecenoic acid (123I-HA) and 17-iodo-123I-heptade-canoic acid (123I-Hsup(o)A), were employed for myocardial scintigraphy in patients with coronary artery disease. The results indicate that clearance of 123I-FFA from the myocardium is dependent on the nature of ischemic injury. Clearance is delayed if the injury is reversible and accelerated in case of irreversible ischemia. Mechanisms responsible for divergent behaviour of FFA in patients with acute myocardial infarction versus patients with angina pectoris are purely speculative. This differential clearance from normally perfused, transiently ischemic and infarcted myocardium has practical application. The test provides a means to assess the nature of ischemic injury rapidly. These findings may have major consequences for logical management of patients presenting with chest pain and suspected coronary artery disease. (Auth.)

  7. Cyclotron production of I-123: An evaluation of the nuclear reactions which produce this isotope (United States)

    Sodd, V. J.; Scholz, K. L.; Blue, J. W.; Wellman, H. N.


    The use of the various nuclear reactions is described by which I-123,a low radiation dose radiopharmaceutical, can be cyclotron-produced. Methods of directly producing I-123 and those which indirectly produce the radionuclide through the beta (+) decay of its nautral precursor, Xe-123. It is impossible to separate from the radioiodine contaminants, notably I-124, which occur in the direct method. Thus, it is preferable to produce pure I-123 from Xe-123 which is easily separated from the radioiodines. Among the characteristics of I-123 is the capability of reducing the patient dose in a thyroid uptake measurement to a very small percentage of that delivered by the more commonly used I-131.

  8. Cadmium in goods - contribution to environmental exposure

    Energy Technology Data Exchange (ETDEWEB)

    Bergbaeck, B.; Jonsson, Arne [Kalmar Univ. (Sweden). Dept. of Natural Science


    The total amount of Cd used in Sweden since 1940 is approximately 5000 tonnes, including alloys, fertilizers and impurities in zinc. The stock of Cd in goods in the Swedish anthroposphere is dominated by NiCd-batteries. However, when one considers the degree of exposure to corrosion, Cd stabilizers are dominant. Emissions of Cd from industrial plants and other point sources have been historically important. However, these point source emissions must be seen in relation to the increasingly significant fugitive `consumption emissions`, from the use and/or end-use of various goods. In this study, methods of reconstructing the flows of cadmium (Cd) and estimating the emissions over time are discussed. This is done through studies of the development of production, technology, trade and the longevity of metals in Swedish society. This last part in the chain will form the `consumption emissions` calculated from emission factors giving the proportion of the cadmium content in goods that eventually will reach the environment. The main accumulation of metals in the anthroposphere occurs in urban areas where the influx of metals is greatest. Urban areas probably represent `hot spots` as far as this type of environmental impact is concerned. Extreme Cd concentrations in surface sediments in central Stockholm indicate an ongoing release of Cd from the anthroposphere. The sources are so far unknown, i.e. this Cd flow to the biosphere cannot be explained in terms of deposition or emissions from point sources. Approximately 40 tonnes of Cd in goods are exposed to corrosion in varying degrees. This stock is dominated by Cd in stabilizers and pigments, and as impurities in Zn 15 refs, 2 figs, 8 tabs

  9. Tantalum-cadmium film coatings: Preparation, phase composition, and structure (United States)

    Tuleushev, Yu. Zh.; Volodin, V. N.; Zhakanbaev, E. A.


    Ion-plasma sputtering and codeposition of ultrafine Ta and Cd particles were used for the first time to prepare solid solutions, namely, alloys with up to 66.2 at % Cd in the form of coatings; the fact of such a production confirms the thermal-fluctuation melting and coalescence of small particles. When the coatings are formed by tantalum and cadmium nanolayers, the mutual dissolution of the components takes place, which is accompanied by the formation of solid solutions of one metal in the other. When the cadmium concentration is above 44 at %, the β-Ta tetragonal lattice transforms into the α-Ta body-centered cubic lattice. Beginning from 74.4 at % Cd, a hexagonal structure typical of cadmium is formed, and tantalum is present in the coatings in the form of amorphous phase. The formation of β-Ta- and Cd-based interstitial and α-Ta-based substitute solid solutions is stated. At 700°C, cadmium evaporates from Ta-based solid solutions, and porous tantalum is formed. The evaporation of cadmium from coatings, which consist of the mixture of tantalum solid solution in cadmium and amorphous tantalum, leads to the formation of tantalum characterized by a highly developed surface. The prepared Ta-based materials assume the technological application of the results of the investigation.

  10. Trichosporon jirovecii-mediated synthesis of cadmium sulfide nanoparticles. (United States)

    El-Baz, Ashraf Farag; Sorour, Noha Mohamed; Shetaia, Youssria Mohamed


    Cadmium sulphide is one of the most promising materials for solar cells and of great interest due to its useful applications in photonics and electronics, thus the development of bio-mediated synthesis of cadmium sulphide nanoparticles (CdS NPs) is one of the essential areas in nanoparticles. The present study demonstrates for the first time the eco-friendly biosynthesis of CdS NPs using the yeast Trichosporon jirovecii. The biosynthesis of CdS NPs were confirmed by UV-Vis spectrum and characterized by X-ray diffraction assay and electron microscopy. Scanning and transmission electron microscope analyses shows the formation of spherical CdS NPs with a size range of about 6-15 nm with a mean Cd:S molar ratio of 1.0:0.98. T. jirovecii produced hydrogen sulfide on cysteine containing medium confirmed by positive cysteine-desulfhydrase activity and the colony color turned yellow on 0.1 mM cadmium containing medium. T. jirovecii tolerance to cadmium was increased by the UV treatment and three 0.6 mM cadmium tolerant mutants were generated upon the UV radiation treatment. The overall results indicated that T. jirovecii could tolerate cadmium toxicity by its conversion into CdS NPs on cysteine containing medium using cysteine-desulfhydrase as a defense response mechanism. PMID:26467054

  11. Clinical study on the mechanism of abnormal accumulation in lung scanning with N-isopropyl-p-123I-iodoamphetamine (123I-IMP)

    International Nuclear Information System (INIS)

    Sixty-three cases with gross abnormalities on chest radiograms were studied by lung scanning with 123I-IMP. Abnormal accumulation in comparison with the normal lung field was detected in all patients 24 hours after the intravenous injection of 123I-IMP and these sites were seen within hypoperfusion areas observed by lung scanning using 99mTc-MAA. However, no intratumoral accumulation was detected in the patients with tumor. Comparison between the image obtained after the initial distribution of 123I-IMP and that obtained 24 hours later showed that during this period, 123I-IMP accumulated in the area of decreased or no distribution of 123I-IMP. It was speculated that the area of low pulmonary blood flow showed abnormal accumulation, because even in a low blood flow, 123I-IMP reached the sites of receptor, and the wash-out from these sites was delayed. These findings indicate the possibility that lung scanning with 123I-IMP is a useful agent as assessing pulmonary blood flow. (author)

  12. Standardization of reference values for thyroid uptake using I-123

    International Nuclear Information System (INIS)

    Purpose: To establish new normal ranges for thyroid uptake after 2, 6 and 24 hours,using 123I. Methods: The author reviewed data of 316 patients in a Nuclear Medicine laboratory whose free T4 and TSH values were within the normal range; and the thyroid uptake 2, 6, and 24 hours after 123I administration. Results: the results were statistically analyzed using the Kolmogorov-Smirnov test, asymmetry and kurtosis, and appear to belong to a gaussian distribution; therefore, the reference interval was built considering it. The author also performed the unpaired t test in order to compare means and variances in both sexes. The results showed p = 0.2039 for mean testing and p = 0.0716 for variance testing, meaning that the differences between these two parameters in both sexes were not statistically significant. Three new normal ranges were established: 2-hour uptake, 0 to 8%; 6-hour uptake, 0 to 16% and, 24-hour uptake, 3 to 23%. Conclusions: The author concluded that the thyroid uptake normal range must be periodically established for each individual laboratory; specially when there is any kind of change in thyroid uptake technology

  13. 123I-Mibg scintigraphy and 18F-Fdg-Pet imaging for diagnosing neuroblastoma


    Bleeker, Gitta; Tytgat, Godelieve Am; Adam, Judit A; Caron, Huib N.; Kremer, Leontien Cm; Hooft, Lotty; van Dalen, Elvira C.


    Background Neuroblastoma is an embryonic tumour of childhood that originates in the neural crest. It is the second most common extracranial malignant solid tumour of childhood. Neuroblastoma cells have the unique capacity to accumulate Iodine-123-metaiodobenzylguanidine (123I-MIBG), which can be used for imaging the tumour. Moreover, 123I-MIBG scintigraphy is not only important for the diagnosis of neuroblastoma, but also for staging and localization of skeletal lesions. If these are present,...

  14. 19 CFR 123.1 - Report of arrival from Canada or Mexico and permission to proceed. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Report of arrival from Canada or Mexico and permission to proceed. 123.1 Section 123.1 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO General Provisions § 123.1 Report of arrival from Canada...

  15. 19 CFR 123.29 - Procedure on arrival at port of reentry. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Procedure on arrival at port of reentry. 123.29 Section 123.29 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Shipments in Transit Through Canada or Mexico § 123.29 Procedure on arrival at...

  16. 19 CFR 123.23 - Train sheet for in-transit rail shipments. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Train sheet for in-transit rail shipments. 123.23 Section 123.23 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Shipments in Transit Through Canada or Mexico § 123.23 Train sheet for...

  17. The Role of Exopolymers in Protection of Ralstonia sp., a Cadmium-resistant Bacterium, from Cadmium Toxicity


    Anchulee Watcharamusik; Benjaphorn Prapagdee


    Production of exopolymers is one of heavy metal resistance mechanisms in bacteria. Ralstonia sp. TAK1, a cadmium-resistant bacterium, was isolated from a high cadmium (Cd) contaminated soil at the zinc mine, Tak province, Thailand. The bacterium was cultivated in LB broth and its growth was monitored. The yields of exopolymers were measured by the phenol-sulfuric method at different growth phases. The levels of Cd resistance were quantitatively determined by survival cell assay. The highest a...

  18. Synthesis and characterization of 5-heteroarylsulfanyl-4-aryl-1,2,3-selena/thiadiazoles

    Indian Academy of Sciences (India)

    Ramaiyan Manikannan; Masilamani Shanmugaraja; Seetharaman Manojveer; Shanmugam Muthusubramanian


    Synthesis and spectral characterization of 2-methyl-5-[(4-aryl-1,2,3-selenadiazol-5-yl)sulfanyl]-1,3,4-thiadiazoles, 5-[4-aryl-1,2,3-selenadiazol-5-yl]sulfanyl-1-phenyl-1-1,2,3,4-tetraazoles, 4-aryl-5-[(5-methyl-1,3,4-thiadiazol-2-yl)sulfanyl]-1,2,3-thiadiazole and 5-[4-aryl-1,2,3-thiadiazol-5-yl]sulfanyl-1-phenyl-1-1,2,3,4-tetraazole have been reported.

  19. The decay energy of the pure s-process nuclide 123Te

    Directory of Open Access Journals (Sweden)

    P. Filianin


    Full Text Available A direct and high-precision measurement of the mass difference of 123Te and 123Sb has been performed with the Penning-trap mass spectrometer SHIPTRAP using the recently introduced phase-imaging ion-cyclotron-resonance technique. The obtained mass difference is 51.912(67 keV/c2. Using the masses of the neutral ground states and the energy difference between the ionic states an effective half-life of 123Te has been estimated for various astrophysical conditions. A dramatic influence of the electron capture process on the decay properties of 123Te in hot stellar conditions has been discussed.

  20. N-isopropyl-p-I-123-Iodoamphetamine is a sensitive test for detecting malignant melanoma

    International Nuclear Information System (INIS)

    N-isopropyl-p-I-123-Iodoamphetamine (I-123-IMP) was originally developed for the measurement of the brain blood flow. I-123-IMP is known to be incorporated into melanin-producing cells suggesting that I-123-IMP is incorporated in malignant melnoma. We tested both I-123-IMP and Ga-67 citrate in 36 cases with malignant melanoma in order to compare their clinical utility in the same patients. Of the 22 primary lesions, 11 (50%) were detected by I-123-IMP scan, but only 6 (22.7%) were detected by Ga-67 citrate scan. Of the 28 metastatic lesions, 15 (53.6%) were detected by I-123-IMP scan, but only 13 (46.4%) were detected by Ga-67 citrate scan. Among the I-123-IMP scans, there were no false positive cases, but Ga-67 citrate detected post operative lesions. In conclusion, I-123 IMP has advantages in the detection of malignant melanoma in terms of sensitivity and specificity. (author)

  1. The decay energy of the pure s-process nuclide 123Te (United States)

    Filianin, P.; Schmidt, S.; Blaum, K.; Block, M.; Eliseev, S.; Giacoppo, F.; Goncharov, M.; Lautenschlaeger, F.; Novikov, Yu.; Takahashi, K.


    A direct and high-precision measurement of the mass difference of 123Te and 123Sb has been performed with the Penning-trap mass spectrometer SHIPTRAP using the recently introduced phase-imaging ion-cyclotron-resonance technique. The obtained mass difference is 51.912 (67) keV /c2. Using the masses of the neutral ground states and the energy difference between the ionic states an effective half-life of 123Te has been estimated for various astrophysical conditions. A dramatic influence of the electron capture process on the decay properties of 123Te in hot stellar conditions has been discussed.

  2. Human absorbed dose calculations for 123I labeled phenyl pentadecanoic acid

    International Nuclear Information System (INIS)

    I-123 labeled fatty acids have been proposed for studying myocardial metabolism by scintigraphic methods. With the availability of clean I-123 and the advent of single photon emission tomography, I-123 labeled fatty acids would be well suited to study regional myocardial viability or metabolism in humans. The authors have studied I-125 and I-123 labeled iodophenyl pentadecanoic acid (IPPA) in rats and dogs. Clinical studies are in progress with I-123 (IPPA). They have studied the pharmacokinetics of this tracer in male Sprague-Dawley rats at 0.25, 0.5, 1, 3, 6, and 24 hours postinjection. The cumulated doses, due to both pure I-123 and a version contaminated with 1.4% I-125, in various organs and the total body in humans are estimated. The average dose to organs for humans injected with I-123 IPPA with pure I-123 and contaminated I-123 respectively, are (rads to organ per mCi injected): heart wall (0.0507, 0.0514), liver (0.0792, 0.0875), kidneys (0.0479, 0.0561), thyroid (0.0517, 0.0638), ovaries (0.0427, 0.0561), testes (0.0307, 0.0309), total body (0.0386, 0.0392). 12 references, 9 figures, 5 tables

  3. {sup 123}I-meta-iodobenzylguanidine myocardial scintigraphy in arrhythmia disease; La scintigraphie myocardique a la {sup 123}I-metaiodobenzylguanidine dans les arythmies

    Energy Technology Data Exchange (ETDEWEB)

    Valli, N.; Ducassou, D.; Barat, J.L. [Universite Victor-Segalen, Service de Medecine Nucleaire, Hopital du Haut-Leveque, 33 - Pessac (France)


    Meta-iodobenzylguanidine-iodine 123 ({sup 123}I-Mibg) myocardial scintigraphy is one of only the few methods available for the objective evaluation of cardiac sympathetic function at the clinical level. Disorders of cardiac sympathetic function play an important role in a variety of heart diseases and particularly arrhythmia disease. Mibg abnormalities have been described in various arrhythmia diseases. Their signification and their prognostic value are still not clear. This article focuses on reviewing the characteristics of {sup 123}I-Mibg myocardial scintigraphy in different arrhythmia diseases. (authors)

  4. Correlations of urinary cadmium with hypertension and diabetes in persons living in cadmium-contaminated villages in northwestern Thailand: A population study

    International Nuclear Information System (INIS)

    Risk for hypertension and diabetes has not been conclusively found to be a result of cadmium exposure. A population-based study was conducted in 2009 to examine the correlations of urinary cadmium, a good biomarker of long-term cadmium exposure, with hypertension and diabetes in persons aged 35 years and older who lived in the 12 cadmium-contaminated rural villages in northwestern Thailand. A total of 5273 persons were interviewed and screened for urinary cadmium, hypertension, and diabetes. The geometric mean level of urinary cadmium for women (2.4±2.3 μg/g creatinine) was significantly greater than that for men (2.0±2.2 μg/g creatinine). Hypertension was presented in 29.8% of the study population and diabetes was detected in 6.6%. The prevalence of hypertension significantly increased from 25.0% among persons in the lowest tertile of urinary cadmium to 35.0% in the highest tertile. In women, the rate of hypertension significantly increased with increasing urinary cadmium levels in both ever and never smokers, after adjusting for age, alcohol consumption, body mass index, and diabetes. In men, such association was less significantly found in never smokers. The study revealed no significant association between urinary cadmium and diabetes in either gender. Our study supports the hypothesis that environmental exposure to cadmium may increase the risk of hypertension. Risk for diabetes in relation to cadmium exposure remains uncertain in this exposed population.

  5. Correlations of urinary cadmium with hypertension and diabetes in persons living in cadmium-contaminated villages in northwestern Thailand: A population study

    Energy Technology Data Exchange (ETDEWEB)

    Swaddiwudhipong, Witaya, E-mail: [Department of Community and Social Medicine, Mae Sot General Hospital, Tak 63110 (Thailand); Mahasakpan, Pranee [Department of Community and Social Medicine, Mae Sot General Hospital, Tak 63110 (Thailand); Limpatanachote, Pisit; Krintratun, Somyot [Department of Internal Medicine, Mae Sot General Hospital, Tak (Thailand)


    Risk for hypertension and diabetes has not been conclusively found to be a result of cadmium exposure. A population-based study was conducted in 2009 to examine the correlations of urinary cadmium, a good biomarker of long-term cadmium exposure, with hypertension and diabetes in persons aged 35 years and older who lived in the 12 cadmium-contaminated rural villages in northwestern Thailand. A total of 5273 persons were interviewed and screened for urinary cadmium, hypertension, and diabetes. The geometric mean level of urinary cadmium for women (2.4{+-}2.3 {mu}g/g creatinine) was significantly greater than that for men (2.0{+-}2.2 {mu}g/g creatinine). Hypertension was presented in 29.8% of the study population and diabetes was detected in 6.6%. The prevalence of hypertension significantly increased from 25.0% among persons in the lowest tertile of urinary cadmium to 35.0% in the highest tertile. In women, the rate of hypertension significantly increased with increasing urinary cadmium levels in both ever and never smokers, after adjusting for age, alcohol consumption, body mass index, and diabetes. In men, such association was less significantly found in never smokers. The study revealed no significant association between urinary cadmium and diabetes in either gender. Our study supports the hypothesis that environmental exposure to cadmium may increase the risk of hypertension. Risk for diabetes in relation to cadmium exposure remains uncertain in this exposed population.

  6. Effects of Soil pH,Texture,Moisture,Organic Matter and Cadmium Content on Cadmium Diffusion Coefficient

    Institute of Scientific and Technical Information of China (English)



    The supply of cadmium from soil to plant roots mainly depends on the diffusion prooess.This work was conducted to study the effects of some soil properties on cadmium diffusion coefficient (D) in soil. Measurements were made using the Shofield and Graham-Bryce's isotopic labelling method.Cadmium diffusion coefficients varied from 10-7to 10-9 cms2-1.Higher values were observed in acid sandy soils and lower values in calcareous clay soils.Liming an acid soil resulted in a substantial decrease of D.Addition of cadmium as nitrate salt generally increased D,while addition of sewage sludge and organic matter resulted in a significant decrease of cadmium diffusion.The rhizospheric activity also induced a moderate reduction in D.The relationships between D(10-9cms2-1)on the on hand and soil pH.moisture(Mc,g kg-1) ,organic matter(OM,g kg-1),clay(Cy,gkg-1)and cadmium content(Cd,mgkg-1) on the other were obtained by the multiple regression:D=182.1-29.91pH+0.210Mc-0.303OM+0.011Cy+1.64Cd(R2=0.859,n=22).

  7. Effects of cadmium accumulation from suspended sediments and phytoplankton on the Oyster Saccostrea glomerata

    International Nuclear Information System (INIS)

    Highlights: • Saccostrea glomerata accumulated cadmium from sediments and phytoplankton. • Effects were similar for both pathways. • Antioxidant capacity, lipid peroxidation and lysosomal destabilisation were affected. • Clear exposure–dose–response relationships were demonstrated. - Abstract: Metals are accumulated by filter feeding organisms via water, ingestion of suspended sediments or food. The uptake pathway can affect metal toxicity. Saccostrea glomerata were exposed to cadmium through cadmium-spiked suspended sediments (19 and 93 μg/g dry mass) and cadmium-enriched phytoplankton (1.6–3 μg/g dry mass) and cadmium uptake and effects measured. Oysters accumulated appreciable amounts of cadmium from both low and high cadmium spiked suspended sediment treatments (5.9 ± 0.4 μg/g and 23 ± 2 μg/g respectively compared to controls 0.97 ± 0.05 μg/g dry mass). Only a small amount of cadmium was accumulated by ingestion of cadmium-enriched phytoplankton (1.9 ± 0.1 μg/g compared to controls 1.2 ± 0.1 μg/g). In the cadmium spiked suspended sediment experiments, most cadmium was desorbed from sediments and cadmium concentrations in S. glomerata were significantly related to dissolved cadmium concentrations (4–21 μg/L) in the overlying water. In the phytoplankton feeding experiment cadmium concentrations in overlying water were <0.01 μg/L. In both exposure experiments, cadmium-exposed oysters showed a significant reduction in total antioxidant capacity and significantly increased lipid peroxidation and percentage of destabilised lysosomes. Destabilised lysosomes in the suspended sediments experiments also resulted from stress of exposure to the suspended sediments. The study demonstrated that exposure to cadmium via suspended sediments and to low concentrations of cadmium through the ingestion of phytoplankton, can cause sublethal stress to S. glomerata

  8. Effects of cadmium accumulation from suspended sediments and phytoplankton on the Oyster Saccostrea glomerata

    Energy Technology Data Exchange (ETDEWEB)

    Schmitz, Helena A.; Maher, William A., E-mail:; Taylor, Anne M.; Krikowa, Frank


    Highlights: • Saccostrea glomerata accumulated cadmium from sediments and phytoplankton. • Effects were similar for both pathways. • Antioxidant capacity, lipid peroxidation and lysosomal destabilisation were affected. • Clear exposure–dose–response relationships were demonstrated. - Abstract: Metals are accumulated by filter feeding organisms via water, ingestion of suspended sediments or food. The uptake pathway can affect metal toxicity. Saccostrea glomerata were exposed to cadmium through cadmium-spiked suspended sediments (19 and 93 μg/g dry mass) and cadmium-enriched phytoplankton (1.6–3 μg/g dry mass) and cadmium uptake and effects measured. Oysters accumulated appreciable amounts of cadmium from both low and high cadmium spiked suspended sediment treatments (5.9 ± 0.4 μg/g and 23 ± 2 μg/g respectively compared to controls 0.97 ± 0.05 μg/g dry mass). Only a small amount of cadmium was accumulated by ingestion of cadmium-enriched phytoplankton (1.9 ± 0.1 μg/g compared to controls 1.2 ± 0.1 μg/g). In the cadmium spiked suspended sediment experiments, most cadmium was desorbed from sediments and cadmium concentrations in S. glomerata were significantly related to dissolved cadmium concentrations (4–21 μg/L) in the overlying water. In the phytoplankton feeding experiment cadmium concentrations in overlying water were <0.01 μg/L. In both exposure experiments, cadmium-exposed oysters showed a significant reduction in total antioxidant capacity and significantly increased lipid peroxidation and percentage of destabilised lysosomes. Destabilised lysosomes in the suspended sediments experiments also resulted from stress of exposure to the suspended sediments. The study demonstrated that exposure to cadmium via suspended sediments and to low concentrations of cadmium through the ingestion of phytoplankton, can cause sublethal stress to S. glomerata.

  9. Cadmium: A toxin and a nutrient for marine phytoplankton. Doctoral thesis

    Energy Technology Data Exchange (ETDEWEB)

    Lee, J.G.


    Although cadmium is known to be very toxic, it exhibits nutrient-like vertical concentration profiles in the open ocean. Cadmium enhances the growth of the marine diatom Thalassiosira weissflogii, a chlorophyte and some prymnesiophytes at inorganic zinc and cadmium concentrations typical of surface seawater. Detailed studies of T. weissflogii show that cadmium is also regulated like a nutrient over a wide range of external inorganic cadmium (5-500pM) and inorganic zinc (2-16pM) concentrations. The cellular cadmium concentration is maintained at relatively constant levels both through uptake and, at high inorganic cadmium concentrations (5nM), export of cadmium, most likely complexed to the metal-binding polypeptide phytochelatin. Cadmium may play an essential role in carbon uptake under conditions of zinc limitation. The same low level of inorganic cadmium that enhances the growth of T. weissflogii restores the activity of carbonic anhydrase, thought to be the key enzyme limiting growth at low zinc. Cadmium coelutes with a least one of the multiple isoforms of carbonic anhydrase produced by T. weissfiogii and covaries with activity of this isoform. The substitution of cadmium for zinc in carbonic anhydrase links the geochemical cycle of cadmium to those of zinc and carbon.

  10. Evaluation of myocardial distribution of iodine-123 labeled metaiodobenzylguanidine ([sup 123]I-MIBG) in normal subjects

    Energy Technology Data Exchange (ETDEWEB)

    Tsuchimochi, Shinsaku; Tamaki, Nagara; Shirakawa, Seishi; Fujita, Toru; Yonekura, Yoshiharu; Konishi, Junji; Nohara, Ryuji; Sasayama, Shigetake; Nishioka, Kenya (Kyoto Univ. (Japan). Faculty of Medicine)


    The normal pattern of the myocardial sympathetic innervation was studied in 15 subjects using gamma camera scintigraphy with iodine-123 labeled metaiodobenzylguanidine ([sup 123]I-MIBG). Seven younger subjects (mean age 24.6[+-]3.6) and eight older patients (mean age 60.9[+-]8.4) with normal cardiac function were studied. Planar imaging was obtained at 15 minutes and 3 hours, and SPECT was also performed 3 hours after injection of 111 MBq (3 mCi) of MIBG. The younger subjects showed higher the heart to mediastinum count ratio (2.91[+-]0.25 vs. 2.67[+-]0.34; p<0.05) and higher inferior to anterior count ratio (1.19[+-]0.15 vs. 0.97[+-]0.13; p<0.05) on the late scan. The bull's-eye polar map also differences in counts in the mid-inferior (p<0.005), basal-inferior (p<0.005) and mid-lateral sectors (p<0.01). But there was no significant difference in MIBG washout rate from myocardium between two groups. These data suggest that there is a difference of the cardiac sympathetic innervation, with older subjects having fewer sympathetic nerve terminals, especially in inferior than younger subjects. We conclude that the age difference in sympathetic nerve function should be considered in the interpretation of MIBG scan. (author).

  11. Lifetime Measurements in XENON(119-123), Cesium -121, CESIUM-123, and IODINE-119 Using the Recoil-Distance - (United States)

    Chaudhury, Arati

    Lifetime measurements were performed for transitions in the decoupled bands based on the h(,11/2) band-head in ('119-123)Xe, ('121,123)Cs and ('119)I using the Recoil Distance Method to study the systematics of reduced transition probabilities (B(E2)'s) as a function of the proton number and the neutron number in the Z > 50 region and to test the validity of various theoretical models. Levels were populated using the ('104,106,108)Pd (('19)F,p3n(gamma)), ('106,108)Pd(('19)F,4n(gamma)); ('104)Pd(('19)F,2p2n(gamma)); ('115)In(('11)B,3n(gamma)); ('115)In(('11)B,4n(gamma)) ('106)Pd(('16)O,3n(gamma)) and ('106)Pd(('16)O,p2n(gamma)) reactions on enriched, thin, self supporting, stretched targets. The stoppers were stretched gold foils of appropriate thickness. The measured mean lifetimes in ('123)Xe are 21.4 ps (15/2('-), 714 kev), 4.5 ps (19/2('-), 1331 kev) and 1.6 ps (23/2('-), 2084 kev) for ('122)Xe 108 ps (2('+), 331.5 kev), 8.7 ps (4('+), 828.8 kev), 3.6 ps (6('+), 1467.3 kev) and 1.4 ps (8('+), 2217.9 kev); for ('121)Xe 20.4 ps (15/2('-), 687 kev) and 4.0 ps (19/2('-), 1274 Kev); for ('120)Xe, 123 ps (2('+), 321.8 kev), 13 ps (4('+), 794.6 kev); 3.6 ps (6('+), 1395.6 kev); for ('119)Xe, 20.4 ps (15/2('-), 649kev), 3.9 ps (19/2('-), 1224 kev) and 1.5 ps (23/2('-), 1932 kev); for ('123)Cs are 66.5 ps (15/2(' -), 480 kev) and 5.2 ps (19/2('-), 1002 kev); for ('121)Cs, 93.2 ps (15/2('-), 286 kev), 7.6 ps (19/2('-), 758 kev) and 2.0 ps (23/2('-), 1373 kev); and for ('119)50.0 ps (15('-)/2, 1024 kev), 8.7 ps (19('-)/2, 1486 kev) and 2.2 ps (23/2('-), 2076 kev). The numbers in parentheses are the spin and energy of the given level. The systematics of the B(E2)'s obtained both as a function of proton number and the neutron number are presented and compared with the prediction of the Interacting Boson Fermion Model (IBFM) and the Particle plus Triaxial Rotor Model (PTRM) to ascertain the comparative suitability of these models in this region. Both models appear to

  12. The effect of aging and smoking on N-isopropyl-p-[123I]iodoamphetamine (123I-IMP) accumulation in the human lung

    International Nuclear Information System (INIS)

    123I-IMP clearance on dynamic lung scintigraphy was studied by two exponential compartments analysis in order to evaluate the effects of aging and smoking on the pulmonary function. Twenty-four patients (14 smokers and 10 non-smokers), referred for 123I-IMP brain perfusion study, underwent lung dynamic scintigraphy for 42 min immediately after 123I-IMP injection. In the non-smoking group 123I-IMP lung clearance was delayed with aging. A significant correlation was found between aging and clearance rate in the lung. There was also a significant difference in the clearance rates between smoker and non-smoker groups. These findings suggest that smoking and aging affect the pulmonary function. (author)


    Directory of Open Access Journals (Sweden)

    Anetta Lukáčová


    Full Text Available The cadmium concentrations depend on the environmental conditions and food production methods. The monitoring of cadmium concentration in meat is important for human health. The concentrations of cadmium in meat and meat products collected from central Slovakia, in the central Europe region and from different countries of West Europe were assessed using by AA spectrometer with graphite furnace (PerkinElmer AAnalyst 80, MA, USA. Within starting materials we detected the highest values of cadmium in beef from foreign production (0.1101 ppm, followed by pork from foreign production (0.0901 ppm in Lovecka salama and pork thigh (0.0523 ppm in selected ham. In Lovecka salami we were found the highest concentration of cadmium in final samples from foreign starting materials, followed by homogenized samples from foreign starting materials, final samples from domestic starting materials and homogenized samples from domestic starting materials (0.3728, 0.3549, 0.2387, 0.2112 ppm, respectively. The highest concentration of cadmium in selected ham were found in final products from foreign starting materials, homogenized samples from foreign starting materials, final products from domestic starting materials and homogenized samples from domestic starting materials (0.1453, 0.1382,0.0810, 0.0734 ppm, respectively. The obtained results suggested that the concentrations of cadmium are higher in homogenized samples and final products in Lovecka salami and selected ham in comparison with to starting materials. Technological process of meat processing can create a potential source of heavy metals in final products.

  14. Predictors of urinary cadmium levels in adult females

    Energy Technology Data Exchange (ETDEWEB)

    McElroy, Jane A. [University of Wisconsin Paul P. Carbone Comprehensive Cancer Center, 610 Walnut Street, 370 WARF, Madison, WI 53726 (United States)]. E-mail:; Shafer, Martin M. [University of Wisconsin, Environmental Chemistry and Technology Program, 600 N Park Street, Madison, WI 53706 (United States); Hampton, John M. [University of Wisconsin Paul P. Carbone Comprehensive Cancer Center, 610 Walnut Street, 370 WARF, Madison, WI 53726 (United States); Newcomb, Polly A. [University of Wisconsin Paul P. Carbone Comprehensive Cancer Center, 610 Walnut Street, 370 WARF, Madison, WI 53726 (United States); Fred Hutchinson Cancer Research Center, Cancer Prevention Program, 1100 Fairview Ave N, M4-B402 PO Box 19024, Seattle, WA 98109 (United States)


    Ubiquitous exposure to low levels of cadmium has raised concern about adverse health effects. The aim of this study was to identify characteristics of non-occupationally exposed adult females that correlated with creatinine-adjusted urinary cadmium levels. In our population-based study, trained interviewers collected information from 254 female Wisconsin residents aged 20-69 years on tobacco use, limited dietary consumption patterns, reproductive history, demographics, and residential history. Participants provided spot-urine specimens collected at home. Urine cadmium concentrations were quantified using inductively-coupled plasma mass spectrometry and creatinine levels were also determined. Least square means and 95% confidence intervals for the natural log of the creatinine-adjusted urinary cadmium levels were calculated for each characteristic using multivariate analysis of variance adjusting for age and smoking status. Results were calculated on the log scale and then transformed to the original scale by taking the exponent of each of the values. We observed statistically significant increasing creatinine-adjusted urinary cadmium mean levels relative to smoking status, older age, parity, lower body surface area, mineral zinc supplement consumption, and high income. We did not observe a difference relative to consumption of organ meats, crustaceans, alcohol, multivitamins, multiminerals or homegrown vegetables, age of menopause, menarche of participant or oldest daughter, menopausal status or urban-rural residential location. Approximately 40% of the variance in creatinine-adjusted urinary cadmium levels in adult women was explained by several characteristics. Similar to other studies, age and smoking were the strongest determinants of creatinine-adjusted urinary cadmium concentration.

  15. Cadmium, ATPase-P, yeast. From transport to toxicity

    International Nuclear Information System (INIS)

    Two projects has been developed during my PhD. One consisting in the functional study of CadA, the Cd2+-ATPase from Listeria monocytogenes, the other one was focused on the toxicity of cadmium and the associated response of the yeast Saccharomyces cerevisiae. This two studies used a a phenotype of sensitivity to cadmium induced by CadA expression in yeast. This phenotype was used as a screening tool to identify essential amino acids of Cd transport by CadA and to study cadmium toxicity and the corresponding yeast cellular response. CadA actively transports Cd using ATP hydrolysis as energy source. Directed mutagenesis of the membranous polar, sulphur and charged amino-acids revealed that Cd transport pathway implied four transmembrane segments (Tm) and more precisely the cysteine C354, C356 and proline P355 of the CPC motif located in Tm6, aspartate D692 in Tm8, glutamate E164 in Tm4 and methionine M149 in Tm5. From our studies, 2 Cd ions would be translocated for each hydrolysis ATP. Expression of CadA in the yeast Saccharomyces cerevisiae induces an hypersensitivity to Cd. A wild type cell can grow up to 100 μm cadmium whereas CadA expressing yeast cannot grow with 1 μm cadmium in the culture medium. This cadmium sensitivity was due to the localisation of CadA in the endoplasmic reticulum membrane. Transport of cadmium in this compartment produces an accumulation of mis-folded proteins that induces the Unfolded Protein Response (UPR). As UPR also occurs in a wild type yeast exposed to low Cd concentration, one can point out endoplasmic reticulum as a extremely sensitive cellular compartment. UPR also appears as an early response to Cd as it happens far before any visible signs of toxicity. (author)

  16. Effect of Biochar on Relieving Cadmium Stress and Reducing Accumulation in Super japonica Rice

    Institute of Scientific and Technical Information of China (English)

    ZHANG Zhen-yu; MENG Jun; DANG Shu; CHEN Wen-fu


    It is of great importance to solve the threats induced by cadmium pollution on crops. This paper examined the effect of biochar on cadmium accumulation in japonica rice and revealed the mechanism underlying the response of protective enzyme system to cadmium stress. Biochar derived from rice straw was applied at two application rates under three cadmium concentrations. Shennong 265, super japonica rice variety, was selected as the test crop. The results indicated that cadmium content in above-ground biomass of rice increased with increasing soil cadmium concentrations, but the biochar application could suppress the accumulation of cadmium to some extent. Under high concentrations of cadmium, content of free proline and MDA (malondialdehyde) were high, so did the SOD (superoxide dismutase), POD (peroxidase) and CAT (catalase) activity in the lfag leaf of rice. However, the protective enzyme activities remained at low level when biochar was added.

  17. Accumulation and effects of cadmium on guppy (Poecilia reticulata) fed cadmium-dosed cladocera (Moina macrocopa)

    Energy Technology Data Exchange (ETDEWEB)

    Hatakeyama, S.; Yasuno, M.


    The study examines the rate of cadmium uptake and body burdens which cause adverse effects on the survival and growth of guppies when they are exposed to Cd dosed in zooplankton (Moina macrocopa) and Cd dissolved in water. Eight guppies fed Moina dosed at 20 Cd/L water died before 10 days. Growth of the remainder of the guppies exposed at this rate was impaired initially but was returned to control level around the 10th day of the study. (JMT)

  18. Rotigaptide (ZP123) reverts established atrial conduction velocity slowing. (United States)

    Haugan, Ketil; Kjølbye, Anne Louise; Hennan, James K; Petersen, Jørgen Søberg


    Rotigaptide (ZP123) increases gap junction intercellular communication (GJIC) and prevents stress-induced cardiac conduction velocity (CV) slowing. However, the effect of rotigaptide on established cardiac conduction slowing and the duration of effect on rotigaptide during washout is unknown. Metabolic stress (induced by superfusion with nonoxygenated glucose-free Tyrodes buffer) was associated with a 30% decrease in atrial CV in vehicle-treated rat atria. Rotigaptide treatment initiated after a period of 30 minutes of metabolic stress produced a rapid and significant increase in CV compared to vehicle-treated time controls. During washout of rotigaptide for 30 min (while subjected to metabolic stress), there was a minor decrease in atrial CV; however, this was not significantly different from atrial CV in a rotigaptide-treated time control group. Rotigaptide treatment rapidly normalizes established conduction slowing in atria subjected to metabolic stress. However, the cessation of effect was considerably slower than the onset of action.

  19. I-123 IMP SPECT in patients with intracranial tumor

    International Nuclear Information System (INIS)

    N-isopropyl-p-I-123 iodoamphetamine (IMP) was used in single photon emission computed tomography (SPECT) for intracranial tumor (n = 11). Ten patients had decreased radionuclide activity in tumors, which was almost consistent with the tumorous and the surrounding edematous area as seen on X-ray computed tomography (XCT). The ratio of tumorous to non-tumorous area for activity tended to decrease in ring-shaped enhanced mass, as compared with homogeneously enhanced mass, as seen on XCT. Three patients had decreased activity in the remote cortical area and cerebellum. Circumferential analysis was even more useful in delineating IMP distribution and its sequential changes in the area surrunding the tumor, remote cortical area, and cerebellum. In the other two patients, each having cerebellar granuloma or cysticercosis, IMP SPECT was considered useful, as well as for intracranial tumor, in examining blood flow in the area surrounding lesions and remote area. (Namekawa, K.)

  20. I-123 IMP SPECT in patients with intracranial tumor

    Energy Technology Data Exchange (ETDEWEB)

    Nakano, Shunichi; Hasegawa, Yoshihisa; Ibuka, Keijiro; Hashizume, Terumi; Noguchi, Atushi; Nakagawa, Hidemitsu; Taki, Takuyu; Nii, Yasuo


    N-isopropyl-p-I-123 iodoamphetamine (IMP) was used in single photon emission computed tomography (SPECT) for intracranial tumor (n = 11). Ten patients had decreased radionuclide activity in tumors, which was almost consistent with the tumorous and the surrounding edematous area as seen on X-ray computed tomography (XCT). The ratio of tumorous to non-tumorous area for activity tended to decrease in ring-shaped enhanced mass, as compared with homogeneously enhanced mass, as seen on XCT. Three patients had decreased activity in the remote cortical area and cerebellum. Circumferential analysis was even more useful in delineating IMP distribution and its sequential changes in the area surrunding the tumor, remote cortical area, and cerebellum. In the other two patients, each having cerebellar granuloma or cysticercosis, IMP SPECT was considered useful, as well as for intracranial tumor, in examining blood flow in the area surrounding lesions and remote area. (Namekawa, K.).

  1. A facile synthesis of 1,2,3-triazolyl indole hybrids via SbCl3-catalysed Michael addition of indoles to 1,2,3-triazolyl chalcones

    Indian Academy of Sciences (India)

    Poovan Shanmugavelan; Murugan Sathishkumar; Sangaraiah Nagarajan; Alagusundaram Ponnuswamy


    An efficient, facile and environmentally benign synthesis of a library of 1,2,3-triazolyl chalcone hybrids (3a-u) has been accomplished by grinding the reactants at room temperature in excellent yields in very short reaction time. Subsequently, SbCl3 catalysed Michael addition of indoles to the chalcones afford 1,2,3-triazolyl indole hybrids (5a-l) in excellent yields.

  2. Cadmium Impairs p53 Activity in HepG2 Cells


    Urani, C.; Melchioretto, P.; M. Fabbri; Bowe, G.; Maserati, E.; Gribaldo, L.


    Cadmium and cadmium compounds are contaminants of the environment, food, and drinking water and are important constituents of cigarette smoke. Cd exposure has also been associated with airborne particulate CdO and with Cd-containing quantum dots in medical therapy. Adverse cadmium effects reported in the literature have stimulated during recent years an ongoing discussion to better elucidate cadmium outcomes at cell and molecular level. The present work is designed to gain an insight into the...

  3. Cadmium Stress Induced Changes in Antioxidant Enzymes, Lipid Peroxidation and Hydrogen Peroxide Contents in Barley Seedlings


    Amel Alayat; Lynda Souiki; Mohammed Reda Djebar; Zine Eddine Boumedris; Ouissem Moumeni; Houria Berrebbah


    Cadmium pollution is a problem of increasing significance for ecological, nutritional and environmental reasons. Different plant species and varieties show a wide range of plasticity in Cadmium tolerance, from a high degree of sensitivity to the hyper-accumulating phenotype of some tolerant plants. To avoid Cadmium toxicity, plants adopt various defense strategies. The present study was undertaken to assess and investigate the antioxidant responses of barley (Hordeum vulgare) L.) to cadmium t...

  4. A method for making a cadmium anode for a hermetically sealed alkaline storage battery

    Energy Technology Data Exchange (ETDEWEB)

    Morioka, Y.; Yosikhira, Y.


    Metallic cadmium powder and a glue solution are added to CdO powder. The compound is applied to a current tap and dried. The powder form metallic cadmium is prepared from a mixture of zinc and nickel powder which is dispersed in a solution of cadmium salts. As a result of the replacement reaction, a spongy metallic cadmium is produced which contains nickel. The sponge is ground. The obtained powder is used as an additive for the CdO.

  5. Evaluation of the Serotonin Transporter Ligand 123I-ADAM for SPECT Studies on Humans

    DEFF Research Database (Denmark)

    Frokjaer, V.G.; Pinborg, Lars Hageman; Madsen, J.;


    transporters using (123)I-labeled 2-((2-((dimethylamino)methyl)phenyl)thio)-5-iodophenylamine (ADAM) in humans: an arterial plasma input model, simplified and Logan reference tissue models, and standardized uptake value ratios. METHODS: Nine subjects were scanned with dynamic (123)I-ADAM SPECT (mean age, 31 y...

  6. 13 CFR 123.509 - What can't you use Military Reservist EIDL funds for? (United States)


    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What can't you use Military Reservist EIDL funds for? 123.509 Section 123.509 Business Credit and Assistance SMALL BUSINESS... use Military Reservist EIDL funds for? Your small business can not use Military Reservist EIDL...

  7. 13 CFR 123.508 - How can you use Military Reservist EIDL funds? (United States)


    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false How can you use Military Reservist EIDL funds? 123.508 Section 123.508 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION... Reservist EIDL funds? Your small business can use Military Reservist EIDL to: (a) Meet obligations as...

  8. Tandem Amine Propargylation-Huisgen Cycloaddition to Functionalized Substituted 1,2,3-Triazoles

    Institute of Scientific and Technical Information of China (English)

    WANG,Peng; ZHAO,Ya-Bin; LIANG,Yong-Ming


    @@ The chemistry of 1,2,3-triazoles has received much attention because of their wide range applications.[1] They have been used as fungicides, herbicides, light stabilizers, fluorescent whiteners, optical brightening agents. Therefore, it is important to develop new and more efficient synthetic pathways to a diverse array of 1,2,3-triazoles.

  9. 13 CFR 123.504 - How do you apply for a Military Reservist EIDL? (United States)


    ... essential to the successful day-to-day operations of the business (detailing the employee's duties and... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false How do you apply for a Military Reservist EIDL? 123.504 Section 123.504 Business Credit and Assistance SMALL BUSINESS...

  10. Reproducibility of [123I]PE2I binding to dopamine transporters with SPECT

    DEFF Research Database (Denmark)

    Ziebell, Morten; Thomsen, Gerda; Knudsen, Gitte M;


    The iodinated cocaine derivative [(123)I]PE2I is a new selective ligand for in vivo studies of the dopamine transporter (DAT) with SPECT. Recently, a bolus/infusion (B/I) protocol for [(123)I]PE2I measurements of DAT density was established [Pinborg LH et al. J Nucl Med 2005;46:1119-271]. The aims...

  11. 40 CFR 721.3807 - Formaldehyde, polymer with phenol and 1,2,3-propanetriol, methylated. (United States)


    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Formaldehyde, polymer with phenol and... Significant New Uses for Specific Chemical Substances § 721.3807 Formaldehyde, polymer with phenol and 1,2,3... chemical substance identified as formaldehyde, polymer with phenol and 1,2,3-propanetriol, methylated...

  12. 40 CFR 89.123 - Amending the application and certificate of conformity. (United States)


    ... certificate of conformity. 89.123 Section 89.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... of conformity. (a) The manufacturer of nonroad compression-ignition engines must notify the... be made to a product line covered by a certificate of conformity. This notification must include...

  13. 38 CFR 16.123 - Early termination of research support: Evaluation of applications and proposals. (United States)


    ... research support: Evaluation of applications and proposals. 16.123 Section 16.123 Pensions, Bonuses, and... research support: Evaluation of applications and proposals. (a) The department or agency head may require... approving applications or proposals covered by this policy the department or agency head may take...

  14. 45 CFR 690.123 - Early termination of research support: Evaluation of applications and proposals. (United States)


    ... of research support: Evaluation of applications and proposals. (a) The department or agency head may... 45 Public Welfare 3 2010-10-01 2010-10-01 false Early termination of research support: Evaluation of applications and proposals. 690.123 Section 690.123 Public Welfare Regulations Relating to...

  15. 19 CFR 123.28 - Merchandise remaining in or exported to Canada or Mexico. (United States)


    ... regulations, 15 CFR part 370. (b) In-transit merchandise exported to Canada or Mexico. Merchandise to be... Mexico. 123.28 Section 123.28 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Shipments in Transit...

  16. 19 CFR 123.63 - Examination of baggage from Canada or Mexico. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Examination of baggage from Canada or Mexico. 123...; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Baggage § 123.63 Examination of baggage from Canada or Mexico. (a) Opening vehicle or compartment to examine baggage. Customs officers...

  17. 19 CFR 123.76 - Authorization by Customs for participants to use certain drivers. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Authorization by Customs for participants to use certain drivers. 123.76 Section 123.76 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Land Border Carrier Initiative Program §...

  18. 21 CFR 123.6 - Hazard analysis and Hazard Analysis Critical Control Point (HACCP) plan. (United States)


    ... Control Point (HACCP) plan. 123.6 Section 123.6 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION FISH AND FISHERY PRODUCTS General... processor shall have and implement a written HACCP plan whenever a hazard analysis reveals one or more...

  19. 13 CFR 123.15 - What if I change my mind? (United States)


    ..., and Regulation Z of the Federal Reserve Board, 12 CFR part 226. Your note and any collateral documents... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What if I change my mind? 123.15... § 123.15 What if I change my mind? If SBA required you to pledge collateral for your loan, you...

  20. 13 CFR 123.200 - Am I eligible to apply for a physical disaster business loan? (United States)


    ..., corporation, limited liability company, or other legal entity recognized under State law. Your business' size... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Am I eligible to apply for a physical disaster business loan? 123.200 Section 123.200 Business Credit and Assistance SMALL...

  1. Transport of radioactive 123Xe gas through a tube fifty metres long

    International Nuclear Information System (INIS)

    Calculations and experiments are reported which culminated in a demonstration of the feasibility of transferring continuously production quantities of 123Xe gas between a target room of the Harwell Variable Energy Cyclotron, and 123I processing equipment fifty metres distant. (author)

  2. Nrf2 activation prevents cadmium-induced acute liver injury

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Kai C. [Department of Pharmacology, Toxicology, and Therapeutics, University of Kansas Medical Center, Kansas City, KS (United States); Liu, Jie J. [Department of Internal Medicine, University of Kansas Medical Center, Kansas City, KS (United States); Klaassen, Curtis D., E-mail: [Department of Internal Medicine, University of Kansas Medical Center, Kansas City, KS (United States)


    Oxidative stress plays an important role in cadmium-induced liver injury. Nuclear factor erythroid 2-related factor 2 (Nrf2) is a transcription factor that up-regulates cytoprotective genes in response to oxidative stress. To investigate the role of Nrf2 in cadmium-induced hepatotoxicity, Nrf2-null mice, wild-type mice, kelch-like ECH-associated protein 1-knockdown (Keap1-KD) mice with enhanced Nrf2, and Keap1-hepatocyte knockout (Keap1-HKO) mice with maximum Nrf2 activation were treated with cadmium chloride (3.5 mg Cd/kg, i.p.). Blood and liver samples were collected 8 h thereafter. Cadmium increased serum alanine aminotransferase (ALT) and lactate dehydrogenase (LDH) activities, and caused extensive hepatic hemorrhage and necrosis in the Nrf2-null mice. In contrast, Nrf2-enhanced mice had lower serum ALT and LDH activities and less morphological alternations in the livers than wild-type mice. H{sub 2}DCFDA (2′,7′-dichlorodihydrofluoresein diacetate) staining of primary hepatocytes isolated from the four genotypes of mice indicated that oxidative stress was higher in Nrf2-null cells, and lower in Nrf2-enhanced cells than in wild-type cells. To further investigate the mechanism of the protective effect of Nrf2, mRNA of metallothionein (MT) and other cytoprotective genes were determined. Cadmium markedly induced MT-1 and MT-2 in livers of all four genotypes of mice. In contrast, genes involved in glutathione synthesis and reducing reactive oxygen species, including glutamate-cysteine ligase (Gclc), glutathione peroxidase-2 (Gpx2), and sulfiredoxin-1 (Srxn-1) were only induced in Nrf2-enhanced mice, but not in Nrf2-null mice. In conclusion, the present study shows that Nrf2 activation prevents cadmium-induced oxidative stress and liver injury through induction of genes involved in antioxidant defense rather than genes that scavenge Cd. -- Highlights: ► Cadmium caused extensive hepatic hemorrhage and necrosis in Nrf2-null mice. ► Keap1-KD and Keap1-HKO mice

  3. Nrf2 activation prevents cadmium-induced acute liver injury

    International Nuclear Information System (INIS)

    Oxidative stress plays an important role in cadmium-induced liver injury. Nuclear factor erythroid 2-related factor 2 (Nrf2) is a transcription factor that up-regulates cytoprotective genes in response to oxidative stress. To investigate the role of Nrf2 in cadmium-induced hepatotoxicity, Nrf2-null mice, wild-type mice, kelch-like ECH-associated protein 1-knockdown (Keap1-KD) mice with enhanced Nrf2, and Keap1-hepatocyte knockout (Keap1-HKO) mice with maximum Nrf2 activation were treated with cadmium chloride (3.5 mg Cd/kg, i.p.). Blood and liver samples were collected 8 h thereafter. Cadmium increased serum alanine aminotransferase (ALT) and lactate dehydrogenase (LDH) activities, and caused extensive hepatic hemorrhage and necrosis in the Nrf2-null mice. In contrast, Nrf2-enhanced mice had lower serum ALT and LDH activities and less morphological alternations in the livers than wild-type mice. H2DCFDA (2′,7′-dichlorodihydrofluoresein diacetate) staining of primary hepatocytes isolated from the four genotypes of mice indicated that oxidative stress was higher in Nrf2-null cells, and lower in Nrf2-enhanced cells than in wild-type cells. To further investigate the mechanism of the protective effect of Nrf2, mRNA of metallothionein (MT) and other cytoprotective genes were determined. Cadmium markedly induced MT-1 and MT-2 in livers of all four genotypes of mice. In contrast, genes involved in glutathione synthesis and reducing reactive oxygen species, including glutamate-cysteine ligase (Gclc), glutathione peroxidase-2 (Gpx2), and sulfiredoxin-1 (Srxn-1) were only induced in Nrf2-enhanced mice, but not in Nrf2-null mice. In conclusion, the present study shows that Nrf2 activation prevents cadmium-induced oxidative stress and liver injury through induction of genes involved in antioxidant defense rather than genes that scavenge Cd. -- Highlights: ► Cadmium caused extensive hepatic hemorrhage and necrosis in Nrf2-null mice. ► Keap1-KD and Keap1-HKO mice were


    It has been postulated that nonvegetarians may be exposed to less cadmium than vegetarians because of the cadmium-poor meat in their diet. This study attempts to test this possibility by measuring the cadmium exposure and accumulation in a population subgroup that includes many v...

  5. 76 FR 57682 - Petition Requesting Regulations Restricting Cadmium in Children's Products (United States)


    ... cadmium in children's products, especially toy metal jewelry. On September 6, 2011, the Commission granted... cadmium in children's jewelry is published by ASTM International, Inc. (``ASTM'') within three months after September 16, 2011. If a voluntary standard for cadmium in children's jewelry is published by...

  6. 40 CFR 415.640 - Applicability; description of the cadmium pigments and salts production subcategory. (United States)


    ... cadmium pigments and salts production subcategory. 415.640 Section 415.640 Protection of Environment... POINT SOURCE CATEGORY Cadmium Pigments and Salts Production Subcategory § 415.640 Applicability; description of the cadmium pigments and salts production subcategory. The provisions of this subpart...

  7. Subcellular Localization of Cadmium in Chlorella vulgaris Beijerinck Strain Bt-09

    Directory of Open Access Journals (Sweden)

    P.B. Lintongan


    Full Text Available Growth response curves of Chlorella vulgaris Beijerinck strain Bt-09 to sublethal concentrations of cadmium were evaluated. The growth responses of this microalgal isolate was determined through analysis of chlorophyll a levels. Cadmium was effectively taken up by the cells as determined by Flame Atomic Absorption Spectrophotometry (F-AAS. Subcellular fractionation was undertaken to locate sites that accumulate cadmium.

  8. SNF1-related protein kinases type 2 are involved in plant responses to cadmium stress.

    NARCIS (Netherlands)

    A. Kulik; A. Anielska-Mazur; M. Bucholc; E. Koen; E. Szymańska; A. Żmieńko; E. Krzywińska; I. Wawer; F. McLoughlin; D. Ruszkowski; M. Figlerowicz; C. Testerink; A. Sklodowska; D. Wendehenne; G. Dobrowolska


    Cadmium ions are notorious environmental pollutants. To adapt to cadmium-induced deleterious effects plants have developed sophisticated defense mechanisms. However, the signaling pathways underlying the plant response to cadmium are still elusive. Our data demonstrate that SnRK2s (for SNF1-related

  9. Kinetic parameters and TL mechanism in cadmium tetra borate phosphor

    Energy Technology Data Exchange (ETDEWEB)

    Annalakshmi, O. [Radiological Safety Division, Materials Physics Division, Indira Gandhi Centre for Atomic Research, Kalpakkam-603102 (India); Jose, M.T., E-mail: [Radiological Safety Division, Materials Physics Division, Indira Gandhi Centre for Atomic Research, Kalpakkam-603102 (India); Sridevi, J. [Central Leather Research Institute, Council of Scientific and Industrial Research, Chennai 600 020, Tamilnadhu (India); Venkatraman, B. [Radiological Safety Division, Materials Physics Division, Indira Gandhi Centre for Atomic Research, Kalpakkam-603102 (India); Amarendra, G. [Materials Physics Division, Indira Gandhi Centre for Atomic Research, Kalpakkam-603102 (India); Mandal, A.B. [Central Leather Research Institute, Council of Scientific and Industrial Research, Chennai 600 020, Tamilnadhu (India)


    Polycrystalline powder samples of cadmium tetra borate were synthesized by a simple solid state sintering technique and gamma irradiated sample showed a simple Thermoluminescence (TL) glow peak around 460 K. The TL kinetic parameters of gamma irradiated phosphor were determined by initial rise (IR), isothermal decay (ID), peak shape (PS), variable heating rate (VHR) and glow curve de-convolution method. The kinetic parameters such as activation energy (E), frequency factor (s) and order of kinetics (b) were calculated by IR, ID, PS and VHR methods are in the order of ∼1.05 eV, 10{sup 9}–10{sup 12} s{sup −1} and 1.58, respectively. From the results of TL and PL emission studies carried out on the phosphor revealed that the defect centers related to TL is different from that for PL. EPR measurements were carried out to identify the defect centers formed in cadmium tetra borate phosphor on gamma irradiation. Based on EPR studies the mechanism for TL process in cadmium tetra borate is proposed in this paper -- Highlights: • Polycrystalline powder samples of undoped cadmium tetra borate synthesized. • Cadmium tetra borate phosphor exhibits a dosimetric peak at 458 K. • Kinetic parameters of the trap responsible for TL evaluated. • TL mechanism is proposed from TL to EPR correlation studies.

  10. Cadmium sorption characteristics of phosphorylated sago starch-extraction residue

    International Nuclear Information System (INIS)

    The residue produced by the extraction of sago starch is usually discarded as a waste material. In this study, we phosphorylated the sago starch-extraction residue with phosphoryl chloride and used the phosphorylated residue to remove cadmium from wastewater. The phosphoric ester functionality in the phosphorylated residue was evaluated by means of infrared microspectrometry and solid-state NMR. The dependence of the cadmium sorption behavior on pH, contact time, and electrolyte concentration and the maximum sorption capacity of the phosphorylated residue were also studied. The cadmium sorption varied with pH and electrolyte concentration, and the maximum sorption capacity was 25.2 mg g-1, which is almost half the capacity of commercially available weakly acidic cation exchange resins. The phosphorylated residue could be reused several times, although cadmium sorption gradually decreased as the number of sorption-desorption cycles increased. The phosphorylated residue sorbed cadmium rapidly, which is expected to be favorable for the continuous operation in a column.

  11. Lead and cadmium in indoor air and the urban environment

    International Nuclear Information System (INIS)

    The present study was conducted to find potential terrestrial biomonitors for heavy metals in indoor air in an urban environment. TSP, PM10, and PM2.5 were collected in three retirement facilities in the urban area of Vienna. In addition, particulate matter and soil, vegetation, and isopods (Porcellio scaber L.) were collected in the adjacent garden areas. Aerosols were sampled with a low-volume air sampler. The sampled materials were wet ashed and total lead and cadmium contents were determined. Water-soluble heavy metal concentrations were measured in aqueous extracts from air exposed filters, soil, and vegetation. Lead and cadmium were analyzed by graphite furnace AAS. Lead contents in the vegetation were inferred from water-soluble lead in soils. Lead in isopods generally reflected the contents in vegetation. Cadmium in plants probably derived from soil solutions as well as from atmospheric input. Isopods reflected the total cadmium contents in soils. Particulate matter was dominated by PM2.5, both with respect to mass concentrations and to heavy metal contents. The indoor aerosol was found to be influenced by human activity, indoor sources, and outdoor particles. Relationships between indoor airborne heavy metals and the contents in vegetation (lead and cadmium: positive) and isopods (lead: negative) were identified to have the potential for biomonitoring indoor air quality. - Urban vegetation and isopods are potential indicators for indoor aerial heavy metals

  12. Lead and cadmium in indoor air and the urban environment. (United States)

    Komarnicki, Günter J K


    The present study was conducted to find potential terrestrial biomonitors for heavy metals in indoor air in an urban environment. TSP, PM(10), and PM(2.5) were collected in three retirement facilities in the urban area of Vienna. In addition, particulate matter and soil, vegetation, and isopods (Porcellio scaber L.) were collected in the adjacent garden areas. Aerosols were sampled with a low-volume air sampler. The sampled materials were wet ashed and total lead and cadmium contents were determined. Water-soluble heavy metal concentrations were measured in aqueous extracts from air exposed filters, soil, and vegetation. Lead and cadmium were analyzed by graphite furnace AAS. Lead contents in the vegetation were inferred from water-soluble lead in soils. Lead in isopods generally reflected the contents in vegetation. Cadmium in plants probably derived from soil solutions as well as from atmospheric input. Isopods reflected the total cadmium contents in soils. Particulate matter was dominated by PM(2.5), both with respect to mass concentrations and to heavy metal contents. The indoor aerosol was found to be influenced by human activity, indoor sources, and outdoor particles. Relationships between indoor airborne heavy metals and the contents in vegetation (lead and cadmium: positive) and isopods (lead: negative) were identified to have the potential for biomonitoring indoor air quality.

  13. Single photon emission computed tomography in Alzheimer's disease. Abnormal iofetamine I 123 uptake reflects dementia severity

    International Nuclear Information System (INIS)

    To determine whether abnormalities in regional cerebral functional activity estimated by iofetamine hydrochloride I 123 and single photon emission computed tomography can be detected in mild or moderate as well as severe cases of Alzheimer's disease (AD), we performed iofetamine I 123-single photon emission computed tomography in 37 patients with probable AD (nine patients with mild, 18 patients with moderate, and ten patients with severe dementia) and nine age-matched control subjects. Iofetamine I 123 uptake was measured in right and left frontal, temporal, parietal, and occipital cortices. Mean (right and left) iofetamine I 123 activity was lowest in the parietal region of patients with AD and was significantly reduced in the other three regions compared with control subjects. Only in the parietal region was lower relative iofetamine I 123 activity associated with an impaired level of patient function and with cognitive deficit

  14. Preparation of [123I]- and [125I]epidepride: a dopamine D-2 receptor antagonist radioligand

    International Nuclear Information System (INIS)

    (S)-(-)-N-[(1-ethyl-2-pyrrolidinyl)methyl]-5-[123I] iodo-2,3-dimethoxybenzamide (TDP 517) (proposed generic name, [123I]epidepride) is the iodine-123 substituted analogue of isoremoxipride (FLB 457), both of which are very potent dopamine D-2 antagonists (epidepride KD 0.024 nM). [123I] Epidepride was radioiodinated in 60-70% radiochemical yields in 35 min from the corresponding 5-(tributyltin) derivative using Na123I with a specific radioactivity of 3000 Ci/mmol, and oxidized in situ with chloramine-T. The aryltin precursor was prepared from non-labelled epidepride by palladium-catalyzed stannylation using bis(tri-n-butyltin) in triethylamine. Alternatively, using no carrier-added Na125I as the radioisotope, [125I] epidepride at 2000 Ci/mmol specific radioactivity was prepared in 86% radiochemical yield and 99% radiochemical purity after purification by reverse phase HPLC in ethanolic phosphate buffer. (author)

  15. Cadmium in insects after ash fertilization

    Institute of Scientific and Technical Information of China (English)

    Martin Lodenius; Jussi Josefsson; Kari Heli(o)vaara; Esa Tulisalo; Matti Nummelin


    Ash fertilization of forests returns nutrients to forest ecosystems and has a positive effect on soil pH.but it also may elevate Cd concentrations of forest biota.Cadmium concentrations of some forest insects(Formica ants.carabids and Coleopteran larvac from decaying wood)were investigated in southern Finland where two plots were fertilized with wood ash,while two other plots represented anfertilized control plots.In ants,mean Cd concentration was 3.6±1.4 mg/kg.with nest workers having significantly higher concen-trations than workers trapped in pitfall traps.Concentrations at fertilized and unfertilized plots were similar.In carabid beetles,the average Cd concentration of Carabus glabratus was 0.44±0.36 mg/kg.with no significant difference between control plots and fertilized plots.In another carabid beetle,Pterostichus niger,mean Cd concentration was higher at fertilized plots compared to control plots.We conclude that the variation of Cd concentra-tions in the insects studied is more efficiently controlled by species-specific differences than fertilization history of the forest floor.

  16. Thin-film cadmium telluride solar cells (United States)

    Chu, T. L.


    Cadmium telluride, with a room-temperature band-gap energy of 1.5 eV, is a promising thin-film photovoltaic material. The major objective of this research has been to demonstrate thin-film CdTe heterojunction solar cells with a total area greater than 1 sq cm and photovoltaic efficiencies of 13 percent or more. Thin-film p-CdTe/CdS/SnO2:F/glass solar cells with an AM1.5 efficiency of 10.5 percent have been reported previously. This report contains results of work done on: (1) the deposition, resistivity control, and characterization of p-CdTe films by the close-spaced sublimation process; (2) the deposition of large-band-gap window materials; (3) the electrical properties of CdS/CdTe heterojunctions; (4) the formation of stable, reproducible, ohmic contacts (such as p-HgTe) to p-CdTe; and (5) the preparation and evaluation of heterojunction solar cells.

  17. Cadmium uptake by rat red blood cells

    International Nuclear Information System (INIS)

    Rat red blood cells were employed to study the uptake of cadmium (109Cd). Suspensions of red blood cells were exposed to Cd concentrations (both bound and free) observed following in vivo Cd administration. Cd uptake was biphasic with an initial rapid phase (0C was one-fourth of that at 370C. The metabolic inhibitors: sodium fluoride (1mM), potassium cyanide (1mM) and carbonyl cyanide-m-chlorophenyl hydrazone (2μM) and the Na+-K+-ATPase inhibitor, ouabain (1mM) did not reduce Cd (50μM) uptake into red blood cells. This suggests that the uptake of Cd into red blood cells was not an active process. Incubation of Cd (10μM) with an equimolar concentration of Zn did not alter uptake of Cd into red blood cells, but at 5 and 10 times higher concentrations of Zn, Cd uptake was enhanced 5-fold. Mercury at one-tenth and equimolar concentrations of Cd increased Cd uptake by red blood cells 2-fold. N-Ethylmaleimide (0.5-5mM), which irreversibly inactivates membrane sulfhydryl groups, decreased Cd uptake. The data indicate that Cd uptake into rat red blood cells occurs by passive transport and that alterations of sulfhydryls of red blood cell membrane may modulate the process. (author)

  18. Cadmium accumulation and subcellular distribution in relation to cadmium chloride induced cytotoxicity in vitro

    International Nuclear Information System (INIS)

    A bovine kidney cell culture system was used to assess what relationship cadmium (Cd) uptake and subcellular distribution had to cadmium chloride induced cytotoxicity. Twenty-four hour incubation with 0.1-10 μM Cd elicited 0-90% cytotoxicity. Fifty percent cytotoxicity was estimated to result from 0.8 μM Cd. A concentration-related Cd accumulation paralleled the cytotoxicity profile. The time-course for Cd accumulation was linear for the first 6 h of exposure and plateaued by 18 h post-exposure. When the degree of cytotoxicity was compared with the cellular Cd burden at 24 h post-treatment a least-squares linear regression analysis (r=0.93) indicated a direct relationship. Subcellular distribution studies indicated greater than 90% Cd recovery from the soluble supernatant (105,000 g) at all levels of cytotoxicity studied. Metallothionein sequestered less than 25% of the cellular Cd. As a result of the correlation of the degree of cytotoxicity with the cellular Cd burden and the independence of subcellular distribution from cytotoxicity, a cumulative mechanism of toxicity for Cd in MDBK cells was suggested. (author)

  19. Cadmium accumulation characteristics and removal potentials of high cadmium accumulating rice line grown in cadmium-contaminated soils. (United States)

    Tang, Hao; Li, Tingxuan; Yu, Haiying; Zhang, Xizhou


    Phytoextraction is a promising technique to remove cadmium (Cd) from contaminated soils. In this research, the two different Cd accumulation rice lines of Lu527-8 (the high Cd accumulating rice line) and Lu527-4 (the normal rice line) were grown in soils with different Cd treatments (0, 5, 10, and 20 mg kg(-1) soil) to evaluate Cd accumulation characteristics and Cd removal potentials. When the concentration of Cd in soil increased, Lu527-8 showed less symptoms of phytotoxicity when compared to Lu527-4. Furthermore, Lu527-8 demonstrated greater shoot Cd accumulation (321.17-964.95 mg plant(-1)) than Lu527-4 (50.37-201.66 μg plant(-1)) at the jointing and filling stages. The soil available Cd content of Lu527-8 significantly decreased by 26.92-38.97 and 27.77-63.44 % at the jointing and filling stages, respectively. Meanwhile, the total Cd content in soil also reduced by 11.64-46.75 and 21.41-54.11 % at jointing and filling stages, respectively. When the Cd concentration in soil was 20 mg kg(-1), the Cd extraction rate in shoots of Lu527-8 reached 2.12 and 2.85 % which increased 10.60 and 6.48 times compared with that of Lu527-4 at the jointing and filling stages, respectively. In conclusion, this study demonstrates that Lu527-8 shows great abilities of Cd accumulation and Cd removal potential from contaminated soils with different Cd treatments and it is a promising species for phytoextraction of Cd-contaminated soils.

  20. Renal and blood pressure effects from environmental cadmium exposure in Thai children

    Energy Technology Data Exchange (ETDEWEB)

    Swaddiwudhipong, Witaya, E-mail: [Department of Community and Social Medicine, Mae Sot General Hospital, Tak 63110 (Thailand); Mahasakpan, Pranee [Department of Community and Social Medicine, Mae Sot General Hospital, Tak 63110 (Thailand); Jeekeeree, Wanpen [Department of Medical Technology, Mae Sot General Hospital, Tak 63110 (Thailand); Funkhiew, Thippawan [Department of Community and Social Medicine, Mae Sot General Hospital, Tak 63110 (Thailand); Sanjum, Rungaroon; Apiwatpaiboon, Thitikarn [Department of Medical Technology, Mae Sot General Hospital, Tak 63110 (Thailand); Phopueng, Ittipol [Department of Community and Social Medicine, Mae Sot General Hospital, Tak 63110 (Thailand)


    Very few studies have shown renal and blood pressure effects from environmental cadmium exposure in children. This population study examined associations between urinary cadmium excretion, a good biomarker of long-term cadmium exposure, and renal dysfunctions and blood pressure in environmentally exposed Thai children. Renal functions including urinary excretion of β{sub 2}-microglobulin, calcium (early renal effects), and total protein (late renal effect), and blood pressure were measured in 594 primary school children. Of the children studied, 19.0% had urinary cadmium ≥1 μg/g creatinine. The prevalence of urinary cadmium ≥1 μg/g creatinine was significantly higher in girls and in those consuming rice grown in cadmium-contaminated areas. The geometric mean levels of urinary β{sub 2}-microglobulin, calcium, and total protein significantly increased with increasing tertiles of urinary cadmium. The analysis did not show increased blood pressure with increasing tertiles of urinary cadmium. After adjusting for age, sex, and blood lead levels, the analysis showed significant positive associations between urinary cadmium and urinary β{sub 2}-microglobulin and urinary calcium, but not urinary total protein nor blood pressure. Our findings provide evidence that environmental cadmium exposure can affect renal functions in children. A follow-up study is essential to assess the clinical significance and progress of renal effects in these children. - Highlights: • Few studies show renal effects from environmental cadmium exposure in children. • We report renal and blood pressure effects from cadmium exposure in Thai children. • Urinary β{sub 2}-microglobulin and calcium increased with increasing urinary cadmium. • The study found no association between urinary cadmium levels and blood pressure. • Environmental cadmium exposure can affect renal functions in children.

  1. Renal and blood pressure effects from environmental cadmium exposure in Thai children

    International Nuclear Information System (INIS)

    Very few studies have shown renal and blood pressure effects from environmental cadmium exposure in children. This population study examined associations between urinary cadmium excretion, a good biomarker of long-term cadmium exposure, and renal dysfunctions and blood pressure in environmentally exposed Thai children. Renal functions including urinary excretion of β2-microglobulin, calcium (early renal effects), and total protein (late renal effect), and blood pressure were measured in 594 primary school children. Of the children studied, 19.0% had urinary cadmium ≥1 μg/g creatinine. The prevalence of urinary cadmium ≥1 μg/g creatinine was significantly higher in girls and in those consuming rice grown in cadmium-contaminated areas. The geometric mean levels of urinary β2-microglobulin, calcium, and total protein significantly increased with increasing tertiles of urinary cadmium. The analysis did not show increased blood pressure with increasing tertiles of urinary cadmium. After adjusting for age, sex, and blood lead levels, the analysis showed significant positive associations between urinary cadmium and urinary β2-microglobulin and urinary calcium, but not urinary total protein nor blood pressure. Our findings provide evidence that environmental cadmium exposure can affect renal functions in children. A follow-up study is essential to assess the clinical significance and progress of renal effects in these children. - Highlights: • Few studies show renal effects from environmental cadmium exposure in children. • We report renal and blood pressure effects from cadmium exposure in Thai children. • Urinary β2-microglobulin and calcium increased with increasing urinary cadmium. • The study found no association between urinary cadmium levels and blood pressure. • Environmental cadmium exposure can affect renal functions in children

  2. Analysis Of The Underpotential Deposition Of Cadmium On Copper

    Directory of Open Access Journals (Sweden)

    Kowalik R.


    Full Text Available In this study the process of deposition of cadmium on polycrystalline copper electrode in sulfate solution was investigated. The process of underpotential and bulk deposition was analyzed by classical electrochemical method: cyclic voltammetry(CV, anodic stripping voltammetry(ASV and electrochemical quartz crystal microbalance(EQCM. The obtained results were compared with electrochemical impedance spectroscopy(EIS measurements. CV, EQCM and EIS results suggest that the UPD of cadmium starts below potential −0.4 V vs Ag/AgCl. Additionally the stripping analysis indicates the formation of cadmium monolayer with different density of deposited atoms depending on the applied potential. The transition from UPD to bulk deposition occurs below potential −0,7 V.

  3. Effects of macromolecular chelators on intestinal cadmium absorption in mice

    Energy Technology Data Exchange (ETDEWEB)

    Andersen, O.; Nielsen, J.B.; Bulman, R.A.


    Suppression of absorption by macromolecular chelators have been sucessful with several metals. In this paper a series of immobilized chelators ranging from DTPA to S-containing soft bases have been synthetized and investigated for ability to suppress intestinal uptake of /sup 109/Cd/sup 2+/ in mice. Dextran-O-ethyl-mercaptan, xanthates derived from polysaccharides and polyvinyl alcohol, dithiocarbamates of polyethylene imine and aminoethyl cellulose, and DTPA immobilized on aminopropyl silica were all ineffective. DTPA immobilized on aminoethyl cellulose even enhanced the intestinal uptake. The macromolecular chelators were without extensive effect on organ distribution of absorbed cadmium, except for dithiocarbamate immobilized on polyethylene imine, which enhanced the deposition of cadmium in several organs including the brain. Although the results are discouragign, they indicate that desing and synthesis of immobilized vicinal dithio compounds may represent an avenue for development of non-absorbable chelators with high affinity for cadmium.

  4. Biosorption of Cadmium by Fungal Biomass of Aspergillus niger

    Institute of Scientific and Technical Information of China (English)



    Objective To investigate the removal of cadmium from aqueous solution by waste fungal biomass of Aspergillus niger, originated from citric acid fermentation industry. Methods Batch adsorption test was used to study the biosorption equilibrium and isotherm. The Cd2+ concentration was measured with atomic adsorption spectrophotometer (AAS) HITACHI 180-80. Results The biosorption achieved equilibrium within 30 min. The adsorption isotherm could be described by Freundlich adsorption model, and the constants KF and 1/n were determined to be 2.07 and 0.18, respectively, and the correlation efficiency was 0.97. The optimal pH for Cd adsorption was 6.0. The cadmium-laden biomass could be effectively regenerated using 0.1 N HCl. Conclusion The waste biomass of Aspergillus niger, a by-product of fermentation industry, is a potential biosorbent for the removal of cadmium from aqueous solution.

  5. Cadmium-induced oxidative stress in potato tuber

    Directory of Open Access Journals (Sweden)

    Andrzej Stroiński


    Full Text Available Short-term treatment of tuber discs of potato (Solanum tuberosum L. with cadmium chloride elevated the concentration of active oxygen species (.O-2, H202 and activated the antioxidative system. Two cultivars, Bintje and Bzura, susceptible and tolerant, respectively, to cadmium were examined. In more tolerant, control tissues the activity of ascorbic acid peroxidase (AAP and catalase (CAT was higher than in the sensitive ones. During first hours of stress, the inhibition of superoxide dismutase (SOD, CAT and AAP was observed and it comes from inactivation of enzymes by cadmium ions. A subsequent activity increase of the enzymes aroused earlier in tolerant tissues. It seems therefore, that tolerant tissues possess a more efficient antioxidative system.

  6. Antifungal activity of nicotine and its cadmium complex

    International Nuclear Information System (INIS)

    Nicotine and its metal complex; Cd(II)-nicotine were isolated from leaves of Nicotiana tabacum using various metal ions by the reported techniques and studied for their antifungal activities against fourteen different species of fungi. For comparative study, pure sample of nicotine and metal salt used for complexation; cadmium(II) iodide was also subjected to antifungal tests with the same species of fungus under similar conditions. Results indicated that nicotine is quite effective against the rare pathogenic and Non pathogenic fungi but comparatively less effective against Pathogenic fungi. Nicotine was found to be completely ineffective against the selected species of Occasional pathogenic fungi. Cadmium(II) iodide effectively inhibited Pathogenic and Non pathogenic fungi whereas relatively ineffective against the Occasional pathogenic and Rare pathogenic fungi. On the other hand, Cadmium(II) nicotine complex inhibited all the selected species of fungi except Fusarium solani. (author)


    Directory of Open Access Journals (Sweden)

    Pavol Trebichalský


    Full Text Available The work is to evaluate the extent of risk transfer of heavy metals from soil burdensome to their different levels of consumption of selected parts of the crop. The goal to be achieved in conditions of simulated vegetation pot experiments. To implement the experiment, we used the agricultural soil of land site Výčapy - Opatovce. The experiments use two types of leguminous plants: Faba beans (Faba vulgaris M., a variety MERLIN lentil dishes (Lens esculentum variety NELKA. In one experimental tank was weighed 5 kg of soil mixed with 1 kg of silica sand, and the bottom of the container we put a small drainage layer of gravel. Within each container, we applied the calculated dose of the basic fertilizer, as well as various amounts of soluble salts of cadmium observed. Crops are harvested when fully ripe and the  wet mineralization of plant samples was determined by heavy metals AAS method for device VARIAN 240FS. Significant ratio of cadmium is in the aboveground biomass of the legumes. Lentils take into aboveground biomass much more cadmium than  faba beans. The cadmium content in the first two variants is significantly lower than in the next two in both crops. We may conclude that the faba beans, and lentils to accumulate an increased amount of cadmium in soil in a relatively large amount of seeds. Although it is clear that Faba bean received cadmium content was compared with more lentils. Due to the significant accumulation of Cd by plants lentils and excessive production of the aboveground biomass is potentially usable lens as fytoremediation crop recovery for metalic polluted soils.doi:10.5219/221

  8. Cadmium effects and accumulation in cultures of Prorocentrum micans (dinophyta) (United States)

    Kayser, H.; Sperling, K.-R.


    Effects and accumulation of cadmium were studied in unialgal 10-1 batch-culture experiments with the dinoflagellate Prorocentrum micans Ehrenberg. Tests were made using sterile filtered North Sea water enriched with nitrate and phosphate only in order to avoid disturbances by complex formation. Cadmium was added to the cultures in amounts of 100 to 0.13 µg l-1. In one series it was added at the start of the experiments and in a second one after a growth period of 1 week. Addition of only 1.2 µg Cd l-1 reduces multiplication rates and maximum cell densities of the algae. Not until 0.4 µg Cd-1 does growth correspond to that of the controls. Cadmium concentrations were measured, after filtration, in the culture medium and in the biomass by means of flameless AAS. The cadmium content in algae increased from 2.7 µg g-1 (dry weight) in controls to 500 µg g-1 (dry weight) in media containing 100 µg Cd l-1. Uptake occurred rapidly during the first few days of the experiments, slowed down somewhat during exponential growth stage, and increased during decay of the cultures. Cadmium content of culture media remained nearly constant (Series 1) or decreased only slowly during experimental time (Series 2). The highest concentration factor was measured in the controls. It decreased with increasing metal concentration in the medium and increased with experimental time. Structural modifications of the cells were visible after Lugol fixation only, indicating brittleness of the cell walls. P. micans has shown to be extremely sensitive to cadmium and to accumulate this metal.

  9. Cadmium effects and accumulation in cultures of Prorocentrum micans (Dinophyta)

    Energy Technology Data Exchange (ETDEWEB)

    Kayser, H.; Sperling, K.R.


    Effects and accumulation of cadmium were studied in 10-l batch-culture experiments with the dinoflagellate Prorocentrum micans Ehrenberg. Tests were made using sterile filtered North Sea water enriched with nitrate and phosphate only in order to avoid disturbances by complex formation. Cadmium was added to the cultures in amounts of 100 to 0.13 l/sup -1/. In one series it was added at the start of the experiments and in a second one after a growth period of 1 week. Addition of only 1.2 Cd l/sup -1/ reduces multiplication rates and maximum cell densities of the algae. Not until 0.4 Cd l/sup -1/ does growth correspond to that of the controls. Cadmium concentrations were measured, after filtration, in the culture medium and the biomass by means of flameless AAS. The cadmium content in algae increased from 2.7 g/sup -1/ (dry weight) in controls to 500 g/sup -1/ (dry weight) in media containing 100 Cd l/sup -1/. Uptake occurred rapidly during the first few days of the experiments, slowed down somewhat during exponential growth stage, and increased during decay of the cultures. Cadmium content of culture media remained nearly constant or decreased only slowly during experimental time. The highest concentration factor was measured in the controls. It decreased with increasing metal concentration in the medium and increased with experimental time. Structural modifications of the cells were visible after Lugol fixation only, indicating brittleness of the cell walls. P. micans has shown to be extremely sensitive to cadmium and to accumulate this metal.

  10. Lead and Cadmium Content of Korbal Rice in Northern Iran

    Directory of Open Access Journals (Sweden)

    A Bakhtiarian


    Full Text Available Every year the entrance of factory wastes such as Shiraz Petrochemical Complex, Marvdasht sugar cube factory, and Charmineh factory, and other industrial units into the Kor and Sivand rivers and also the entrance of the Marvdasht and Zarghan city sewer system wastes into the Kor river and the use of their water in the cultivation of the rice has caused a significant increase in the lead and cadmium content of the grains of rice. To study the effect of the Kor river's pollution on the lead and cadmium content of the Korbal rice samples. The results of the study show that the lead and cadmium content of the grains of rice, 57 samples of 6 different types of rice were prepared in 19 different stations in Korbal region and also 18 samples of 6 different types of rice, cultivated with unpolluted water, were prepared in the National Institute of Rice Research (Gilan. A comparison of the pollution level of the Korbal and Gilan rice samples shows a significant difference and indicates the significant effect of the pollution of the river on the lead and cadmium content of the Korbal rice samples. The results of the study show that the lead and cadmium content of the hybrid, prolific, and late rice sample types were greater than that of unprolific and early types, such that the amount of these two elements were highest in the Hassani type (the lead content was 0.9625 ppm and the cadmium content was 0.0793 ppm, whereas the Gasroddashti type which blooms earlier and is long seeded has the lowest amount of these two elements.

  11. Cadmium toxicity to ringed seals (Phoca hispida): an epidemiological study of possible cadmium-induced nephropathy and osteodystrophy in ringed seals (Phoca hispida) from Qaanaaq in Northwest Greenland

    DEFF Research Database (Denmark)

    Sonne-Hansen, C; Dietz, R; Leifsson, P S;


    . Experience from cadmium-poisoned humans and laboratory mammals indicates that concentrations above 50-200 microg/g wet wt. may induce histopathological changes. Overall, 31 of the ringed seals had cadmium concentrations in the kidney cortex above 50 microg/g wet wt., 11 had concentrations above 100 and one......The Greenland marine food chains contain high levels of cadmium, mercury and selenium. Concentrations of cadmium in the kidney of ringed seals (Phoca hispida) from the municipalities of Qaanaaq and Upernavik (Northwest Greenland) are among the highest recorded in the Arctic. The purpose...... of the study was to determine whether cadmium-induced damage in the kidneys and the skeletal system could be detected among 100 ringed seals from Northwest Greenland. The cadmium concentrations in the kidney cortex ranged from 0 to 248 microg/g wet weight (mean=44.5, N=100) in the 99 kidneys examined...

  12. Effect of pH on cadmium biosorption by coconut copra meal

    International Nuclear Information System (INIS)

    Biosorption of cadmium ion by coconut copra meal, an agricultural waste product was investigated as a function of initial solution pH and initial cadmium concentration. Pseudo-second-order kinetic analyses were performed to determine the rate constant of biosorption, the equilibrium capacity, and initial biosorption rate. Cadmium biosorption by copra meal was found to be dependent on the initial solution pH and initial cadmium concentration. Ion exchange occurred in the initial biosorption period. In addition, mathematical relationships were drawn to relate the change in the solution hydrogen ion concentration with equilibrium biosorption capacity, initial cadmium concentration, and equilibrium biosorption capacity

  13. Contribution of an Auxin to the Uptake of Nickel and Cadmium in Maize Seedlings

    Institute of Scientific and Technical Information of China (English)



    Maize seedlings were cultured in nickel or cadmium contaminated sand treated with α-naphthylacetic acid (NAA). The effects of NAA on nickel and cadmium uptake in roots, shoots, and subcellular fractions (cell wall, nuclei and remained parts of seedling cells) were determined. The data showed growth promotion when NAA was applied at low concentrations and inhibition at high concentrations. Uptake of nickel and cadmium content increased concurrently in roots and shoots. In the subcellular fraction, nickel and cadmium was greatest in the cell wall. The changes in growth had greatest correlation with nickel and cadmium content in the subcellular fraction.

  14. Purification and characterization of a cadmium-induced metallothionein from the shore crab Carcinus maenas (L.)

    DEFF Research Database (Denmark)

    Pedersen, K L; Pedersen, S N; Højrup, P;


    Two metallothionein variants were purified from the midgut gland of crabs (Carcinus maenas) exposed to a high cadmium concentration (2 p.p.m.). One of the variants was purified from crabs exposed to a low cadmium concentration (0.5 p.p.m.). The purification method involved acetone precipitation...... from crabs exposed to the high cadmium concentration differed only by a single residue of methionine at the N-terminus. The single variant isolated from crabs exposed to the low cadmium concentration was the one without the N-terminal methionine, indicating that high cadmium concentrations either...

  15. Zinc-Nickel Codeposition in Sulfate Solution Combined Effect of Cadmium and Boric Acid

    Directory of Open Access Journals (Sweden)

    Y. Addi


    Full Text Available The combined effect of cadmium and boric acid on the electrodeposition of zinc-nickel from a sulfate has been investigated. The presence of cadmium ion decreases zinc in the deposit. In solution, cadmium inhibits the zinc ion deposition and suppresses it when deposition potential value is more negative than −1.2 V. Low concentration of CdSO4 reduces the anomalous nature of Zn-Ni deposit. Boric acid decreases current density and shifts potential discharge of nickel and hydrogen to more negative potential. The combination of boric acid and cadmium increases the percentage of nickel in the deposit. Boric acid and cadmium.

  16. Spectroscopic study of cadmium (II) complexes with heterocyclic dithiocarbamate ligands

    Energy Technology Data Exchange (ETDEWEB)

    Garcia-Fontan, S. (Departamento de Quimica Pura y Aplicada, Universidad de Vigo (Spain)); Rodriguez-Seoane, P. (Departamento de Quimica Pura y Aplicada, Universidad de Vigo (Spain)); Casas, J.S. (Departamento de Quimica Inorganica, Universidad de Santiago de Compostela (Spain)); Sordo, J. (Departamento de Quimica Inorganica, Universidad de Santiago de Compostela (Spain)); Jones, M.M. (Department of Chemistry and Center in Molecular Toxicology, Vanderbilt University, Nashville, TN (United States))


    Cadmium(II) dithiocarbamates Cd(dtc)[sub 2] (dtc=4-carboxamidopiperidine-1-carbodithioate, morpholine-1-carbodithioate or 4-(2-hydroxyethyl)piperazine-1-carbodithioate) and Cd(dtc)[sub 2].H[sub 2]O (dtc=4-hydroxypiperidine-1-carbodithioate)[r brace] have been prepared and characterized by thermal analysis and IR and NMR ([sup 13]C, [sup 113]Cd) spectrometry. Two of these ligands have previously been shown capable of removing cadmium from its aged in vivo storage sites. The use of solid state [sup 13]C NMR measurements to establish the coordination mode of the dithiocarbomate ligands is also examined and the difficulties which arise are discussed. (orig.)

  17. Synthesis and characterization of cadmium doped lead–borate glasses

    Indian Academy of Sciences (India)

    A A Alemi; H Sedghi; A R Mirmohseni; V Golsanamlu


    Cadmium doped lead–borate glasses were prepared from the melts in appropriate proportions of PbO2, H3BO3 and (15–40 mol%) CdO mixture in the temperature range 700–950°C. The infrared spectra of the glasses in the range 400–4000 cm-1 show their structures. No boroxol ring formation was observed in the structure of these glasses. Furthermore, doped cadmium atoms were not seen in tetrahedral coordination. But the conversion of three-fold to four-fold coordination of boron atoms in the structure of glasses was observed.

  18. Cadmium resistance from Staphylococcus aureus plasmid pI258 cadA gene results from a cadmium-efflux ATPase.


    Nucifora, G; Chu, L; Misra, T K; Silver, S


    Cadmium resistance specified by the cadA determinant of Staphylococcus aureus plasmid pI258 results from the functioning of a cadmium-efflux system. In the nucleotide sequence of the DNA fragment containing the cadA determinant, two open reading frames were identified. The larger one, corresponding to a predicted polypeptide of 727 amino acid residues, is necessary and sufficient for expression of cadmium resistance. Comparison of the CadA amino acid sequence with known protein sequences sugg...

  19. Biosorption of cadmium by endophytic fungus (EF) Microsphaeropsis sp. LSE10 isolated from cadmium hyperaccumulator Solanum nigrum L. (United States)

    Xiao, Xiao; Luo, Shenglian; Zeng, Guangming; Wei, Wanzhi; Wan, Yong; Chen, Liang; Guo, Hanjun; Cao, Zhe; Yang, Lixia; Chen, Jueliang; Xi, Qiang


    A novel technology to obtain highly efficient biosorbent from the endophytes of a hyperaccumulator is reported. This technology is more convenient than the traditional method of obtaining biosorbents by experimentally screening many types of biomass by trial and error. Using this technology, endophytic fungus (EF) LSE10 was isolated from the cadmium hyperaccumulator Solanum nigrum L. It was identified as Microsphaeropsis sp. When cultured in vitro, the biomass yield of this EF was more than twice that of none-endophytic fungus (NEF) Rhizopus cohnii. Subsequently, it was used as a biosorbent for biosorption of cadmium from the aqueous solution. The results showed that the maximum biosorption capacity was 247.5mg/g (2.2 mmol/g) which was much higher than those of other adsorbents, including biosorbents and activated carbon. Carboxyl, amino, sulphonate and hydroxyl groups on EF LSE10 surface were responsible for the biosorption of cadmium. PMID:19854641

  20. 19 CFR 123.64 - Baggage in transit through the United States between ports in Canada or in Mexico. (United States)


    ... between ports in Canada or in Mexico. 123.64 Section 123.64 Customs Duties U.S. CUSTOMS AND BORDER... MEXICO Baggage § 123.64 Baggage in transit through the United States between ports in Canada or in Mexico. (a) Procedure. Baggage in transit from point to point in Canada or Mexico through the United...

  1. 19 CFR 123.15 - Vehicles of foreign origin used between communities of the United States and Canada or Mexico. (United States)


    ... communities of the United States and Canada or Mexico. 123.15 Section 123.15 Customs Duties U.S. CUSTOMS AND... CANADA AND MEXICO International Traffic § 123.15 Vehicles of foreign origin used between communities of the United States and Canada or Mexico. Vehicles of foreign origin which are used for...

  2. 19 CFR 123.65 - Domestic baggage transiting Canada or Mexico between ports in the United States. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Domestic baggage transiting Canada or Mexico between ports in the United States. 123.65 Section 123.65 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Baggage § 123.65 Domestic baggage...

  3. 19 CFR 123.7 - Manifest used as an entry for unconditionally free merchandise value not over $250. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Manifest used as an entry for unconditionally free merchandise value not over $250. 123.7 Section 123.7 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO General Provisions § 123.7 Manifest used...

  4. 19 CFR 123.2 - Penalty for failure to report arrival or for proceeding without a permit. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Penalty for failure to report arrival or for proceeding without a permit. 123.2 Section 123.2 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO General Provisions § 123.2 Penalty for failure...

  5. 19 CFR 123.14 - Entry of foreign-based trucks, busses, and taxicabs in international traffic. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Entry of foreign-based trucks, busses, and taxicabs in international traffic. 123.14 Section 123.14 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO International Traffic § 123.14 Entry...

  6. 41 CFR 301-10.123 - When may I use other than coach-class airline accommodations? (United States)


    ... than coach-class airline accommodations? 301-10.123 Section 301-10.123 Public Contracts and Property... 10-TRANSPORTATION EXPENSES Common Carrier Transportation Airline Accommodations § 301-10.123 When may I use other than coach-class airline accommodations? Government travelers are required to...

  7. 14 CFR 382.123 - What are the requirements concerning priority cabin stowage for wheelchairs and other assistive... (United States)


    ... priority cabin stowage for wheelchairs and other assistive devices? 382.123 Section 382.123 Aeronautics and... NONDISCRIMINATION ON THE BASIS OF DISABILITY IN AIR TRAVEL Stowage of Wheelchairs, Other Mobility Aids, and Other Assistive Devices § 382.123 What are the requirements concerning priority cabin stowage for wheelchairs...

  8. Effects of cadmium on cork oak (Quercus suber L.) plants grown in hydroponics. (United States)

    Gogorcena, Yolanda; Larbi, Ajmi; Andaluz, Sofia; Carpena, Ramón O; Abadía, Anunciación; Abadía, Javier


    Cork oak (Quercus suber L.) is an autochthonous tree species that is being used for reforestation in heavy-metal-contaminated areas in Spain. A hydroponics experiment was carried out to characterize the effects of Cd on several morphological and physiological parameters in this species, including shoot length, nutrient concentrations and allocation in different organs, leaf pigment concentrations, photosynthetic efficiency, root ferric chelate reductase (FCR) activity and organic acid concentrations in xylem sap. Four different Cd treatments were applied, adding Cd chelated with EDTA or as chloride salt at two different concentrations (10 and 50 µM Cd). After 1 month of Cd treatment, plant growth was significantly inhibited in all treatments. Results indicate that Cd accumulates in all organs 7- to 500-fold when compared with control plants. The highest Cd concentration was found in the 50 µM CdCl(2) treatment, which led to concentrations of ~30, 123 and 1153 µg Cd g(-1) dry weight in leaves, stems and roots, respectively. In the strongest Cd treatments the concentrations of P and Ca decreased in some plant parts, whereas the Mn leaf concentrations decreased with three of the four Cd treatments applied. The concentrations of chlorophyll and carotenoids on an area basis decreased, whereas the (zeaxanthin plus antheraxanthin)/(total violaxanthin cycle carotenoids) ratio and the non-photochemical quenching increased significantly in all Cd treatments. Cadmium treatments caused significant increases in the activity of the enzyme FCR in roots and in the concentrations of organic acids in xylem sap. Some of the physiological changes found support the fact that Cd induces a deficiency of Fe in cork oak, although the plant Fe concentrations were not reduced significantly. At higher concentrations the effects of Cd were more pronounced, and were more marked when Cd was in the free ion form than when present in the form of Cd-EDTA. PMID:22121153

  9. Effects of cadmium on cork oak (Quercus suber L.) plants grown in hydroponics. (United States)

    Gogorcena, Yolanda; Larbi, Ajmi; Andaluz, Sofia; Carpena, Ramón O; Abadía, Anunciación; Abadía, Javier


    Cork oak (Quercus suber L.) is an autochthonous tree species that is being used for reforestation in heavy-metal-contaminated areas in Spain. A hydroponics experiment was carried out to characterize the effects of Cd on several morphological and physiological parameters in this species, including shoot length, nutrient concentrations and allocation in different organs, leaf pigment concentrations, photosynthetic efficiency, root ferric chelate reductase (FCR) activity and organic acid concentrations in xylem sap. Four different Cd treatments were applied, adding Cd chelated with EDTA or as chloride salt at two different concentrations (10 and 50 µM Cd). After 1 month of Cd treatment, plant growth was significantly inhibited in all treatments. Results indicate that Cd accumulates in all organs 7- to 500-fold when compared with control plants. The highest Cd concentration was found in the 50 µM CdCl(2) treatment, which led to concentrations of ~30, 123 and 1153 µg Cd g(-1) dry weight in leaves, stems and roots, respectively. In the strongest Cd treatments the concentrations of P and Ca decreased in some plant parts, whereas the Mn leaf concentrations decreased with three of the four Cd treatments applied. The concentrations of chlorophyll and carotenoids on an area basis decreased, whereas the (zeaxanthin plus antheraxanthin)/(total violaxanthin cycle carotenoids) ratio and the non-photochemical quenching increased significantly in all Cd treatments. Cadmium treatments caused significant increases in the activity of the enzyme FCR in roots and in the concentrations of organic acids in xylem sap. Some of the physiological changes found support the fact that Cd induces a deficiency of Fe in cork oak, although the plant Fe concentrations were not reduced significantly. At higher concentrations the effects of Cd were more pronounced, and were more marked when Cd was in the free ion form than when present in the form of Cd-EDTA.

  10. Concentration of cadmium in cacao beans and its relationship with soil cadmium in southern Ecuador

    Energy Technology Data Exchange (ETDEWEB)

    Chavez, E. [University of Florida, Institute of Food and Agricultural Science, Indian River Research and Education Center, Fort Pierce, FL 34945 (United States); Escuela Superior Politecnica del Litoral, Centro de Investigaciones Biotecnologicas del Ecuador, Guayaquil, Guayas (Ecuador); He, Z.L., E-mail: [University of Florida, Institute of Food and Agricultural Science, Indian River Research and Education Center, Fort Pierce, FL 34945 (United States); Stoffella, P.J. [University of Florida, Institute of Food and Agricultural Science, Indian River Research and Education Center, Fort Pierce, FL 34945 (United States); Mylavarapu, R.S. [University of Florida, Institute of Food and Agricultural Science, Soil and Water Science Department, Gainesville, FL 33611 (United States); Li, Y.C. [University of Florida, Institute of Food and Agricultural Science, Tropical Research and Education Center, Homestead, FL 33031 (United States); Moyano, B. [Escuela Superior Politecnica del Litoral, Centro de Investigaciones Biotecnologicas del Ecuador, Guayaquil, Guayas (Ecuador); Baligar, V.C. [United State Department of Agriculture, ARS, Beltsville, MD 20705 (United States)


    Cadmium (Cd) content in cacao beans above a critical level (0.6 mg kg{sup −1}) has raised concerns in the consumption of cacao-based chocolate. Little is available regarding Cd concentration in soil and cacao in Ecuador. The aim of this study was to determine the status of Cd in both, soils and cacao plants, in southern Ecuador. Soil samples were collected from 19 farms at 0–5, 5–15, 15–30, and 30–50 cm depths, whereas plant samples were taken from four nearby trees. Total recoverable and extractable Cd were measured at the different soil depths. Total recoverable Cd ranged from 0.88 to 2.45 and 0.06 to 2.59, averaged 1.54 and 0.85 mg kg{sup −1}, respectively in the surface and subsurface soils whereas the corresponding values for M3-extractable Cd were 0.08 to 1.27 and 0.02 to 0.33 with mean values of 0.40 and 0.10 mg kg{sup −1}. Surface soil in all sampling sites had total recoverable Cd above the USEPA critical level for agricultural soils (0.43 mg kg{sup −1}), indicating that Cd pollution occurs. Since both total recoverable and M3-extractable Cd significantly decreased depth wise, anthropogenic activities are more likely the source of contamination. Cadmium in cacao tissues decreased in the order of beans > shell > > leaves. Cadmium content in cacao beans ranged from 0.02 to 3.00, averaged 0.94 mg kg{sup −1}, and 12 out of 19 sites had bean Cd content above the critical level. Bean Cd concentration was highly correlated with M3- or HCl-extractable Cd at both the 0–5 and 5–15 cm depths (r = 0.80 and 0.82 for M3, and r = 0.78 and 0.82 for HCl; P < 0.01). These results indicate that accumulation of Cd in surface layers results in excessive Cd in cacao beans and M3- or HCl-extractable Cd are suitable methods for predicting available Cd in the studied soils. - Highlights: • > 60% of the studied sites had a Cd content in cacao beans above the critical level. • Bean Cd concentration was closely correlated with available Cd in soil. • Soil

  11. Concentration of cadmium in cacao beans and its relationship with soil cadmium in southern Ecuador

    International Nuclear Information System (INIS)

    Cadmium (Cd) content in cacao beans above a critical level (0.6 mg kg−1) has raised concerns in the consumption of cacao-based chocolate. Little is available regarding Cd concentration in soil and cacao in Ecuador. The aim of this study was to determine the status of Cd in both, soils and cacao plants, in southern Ecuador. Soil samples were collected from 19 farms at 0–5, 5–15, 15–30, and 30–50 cm depths, whereas plant samples were taken from four nearby trees. Total recoverable and extractable Cd were measured at the different soil depths. Total recoverable Cd ranged from 0.88 to 2.45 and 0.06 to 2.59, averaged 1.54 and 0.85 mg kg−1, respectively in the surface and subsurface soils whereas the corresponding values for M3-extractable Cd were 0.08 to 1.27 and 0.02 to 0.33 with mean values of 0.40 and 0.10 mg kg−1. Surface soil in all sampling sites had total recoverable Cd above the USEPA critical level for agricultural soils (0.43 mg kg−1), indicating that Cd pollution occurs. Since both total recoverable and M3-extractable Cd significantly decreased depth wise, anthropogenic activities are more likely the source of contamination. Cadmium in cacao tissues decreased in the order of beans > shell > > leaves. Cadmium content in cacao beans ranged from 0.02 to 3.00, averaged 0.94 mg kg−1, and 12 out of 19 sites had bean Cd content above the critical level. Bean Cd concentration was highly correlated with M3- or HCl-extractable Cd at both the 0–5 and 5–15 cm depths (r = 0.80 and 0.82 for M3, and r = 0.78 and 0.82 for HCl; P < 0.01). These results indicate that accumulation of Cd in surface layers results in excessive Cd in cacao beans and M3- or HCl-extractable Cd are suitable methods for predicting available Cd in the studied soils. - Highlights: • > 60% of the studied sites had a Cd content in cacao beans above the critical level. • Bean Cd concentration was closely correlated with available Cd in soil. • Soil Cd contamination is likely

  12. Concentration of cadmium in cacao beans and its relationship with soil cadmium in southern Ecuador. (United States)

    Chavez, E; He, Z L; Stoffella, P J; Mylavarapu, R S; Li, Y C; Moyano, B; Baligar, V C


    Cadmium (Cd) content in cacao beans above a critical level (0.6 mg kg(-1)) has raised concerns in the consumption of cacao-based chocolate. Little is available regarding Cd concentration in soil and cacao in Ecuador. The aim of this study was to determine the status of Cd in both, soils and cacao plants, in southern Ecuador. Soil samples were collected from 19 farms at 0-5, 5-15, 15-30, and 30-50 cm depths, whereas plant samples were taken from four nearby trees. Total recoverable and extractable Cd were measured at the different soil depths. Total recoverable Cd ranged from 0.88 to 2.45 and 0.06 to 2.59, averaged 1.54 and 0.85 mg kg(-1), respectively in the surface and subsurface soils whereas the corresponding values for M3-extractable Cd were 0.08 to 1.27 and 0.02 to 0.33 with mean values of 0.40 and 0.10 mg kg(-1). Surface soil in all sampling sites had total recoverable Cd above the USEPA critical level for agricultural soils (0.43 mg kg(-1)), indicating that Cd pollution occurs. Since both total recoverable and M3-extractable Cd significantly decreased depth wise, anthropogenic activities are more likely the source of contamination. Cadmium in cacao tissues decreased in the order of beans>shell>leaves. Cadmium content in cacao beans ranged from 0.02 to 3.00, averaged 0.94 mg kg(-1), and 12 out of 19 sites had bean Cd content above the critical level. Bean Cd concentration was highly correlated with M3- or HCl-extractable Cd at both the 0-5 and 5-15 cm depths (r=0.80 and 0.82 for M3, and r=0.78 and 0.82 for HCl; Pbeans and M3- or HCl-extractable Cd are suitable methods for predicting available Cd in the studied soils.

  13. Cadmium potentiates toxicity of cypermethrin in zebrafish. (United States)

    Yang, Ye; Ye, Xiaoqing; He, Buyuan; Liu, Jing


    Co-occurrence of pesticides such as synthetic pyrethroids and metals in aquatic ecosystems raises concerns over their combined ecological effects. Cypermethrin, 1 of the top 5 synthetic pyrethroids in use, has been extensively detected in surface water. Cadmium (Cd) has been recognized as 1 of the most toxic metals and is a common contaminant in the aquatic system. However, little information is available regarding their joint toxicity. In the present study, combined toxicity of cypermethrin and Cd and the underlying mechanisms were investigated. Zebrafish embryos and adults were exposed to the individual contaminant or binary mixtures. Co-exposure to cypermethrin and Cd produced synergistic effects on the occurrence of crooked body, pericardial edema, and noninflation of swim bladder. The addition of Cd significantly potentiated cypermethrin-induced spasms and caused more oxidative stress in zebrafish larvae. Cypermethrin-mediated induction of transcription levels and catalytic activities of cytochrome P450 (CYP) enzyme were significantly down-regulated by Cd in both zebrafish larvae and adults. Chemical analytical data showed that in vitro elimination of cypermethrin by CYP1A1 was inhibited by Cd. The addition of Cd caused an elevation of in vivo cypermethrin residue levels in the mixture-exposed adult zebrafish. These results suggest that the enhanced toxicity of cypermethrin in the presence of Cd results from the inhibitory effects of Cd on CYP-mediated biotransformation of this pesticide. The authors' findings provide a deeper understanding of the mechanistic basis accounting for the joint toxicity of cypermethrin and Cd. PMID:26267556

  14. Potentiation of cadmium nephrotoxicity by acetaminophen

    Energy Technology Data Exchange (ETDEWEB)

    Bernard, A.M.; Russis, R. de; Ouled Amor, A.; Lauwerys, R.R.


    The possible interactions between acetaminophen and cadmium (Cd) on the kidney were investigated in female Sprague-Dawley rats. Acetaminophen was administered in the food at an average dose of 900 mg/kg and Cd in drinking water at the concentration of 200 ppm. The treatment with acetaminophen and Cd lasted 2 and 10 months, respectively. No interaction between Cd and acetaminophen was observed during the period of their concomitant administration: the increase in albuminuria caused by Cd and acetaminophen was additive, while the tubular impairment caused by acetaminophen (increased ..beta../sub 2/-microglobulinuria and decreased kidney concentrating ability) was not exacerbated by Cd. None of these treatments affected the glomerular filtration rate. Four months after the end of acetaminophen treatment, the renal changes had almost completely disappeared in the rats which had received the analgesic alone. Those continously exposed to Cd had developed slight tubular damage, as evidenced by an increased urinary excretion of ..beta../sub 2/-microglobulin and ..beta..-N-acetylglucosaminidase. By contrast, rats pretreated with acetaminophen for 2 months and exposed to Cd showed a marked increase in urinary excretion of albumin and ..beta../sub 2/-microglobulin, suggesting an interaction between both treatments. At the end of the study, only the interaction with ..beta../sub 2/-microglobulin excretion was still evident; that with the urinary excretion of ..beta..-N-acetylglucosaminidase and albumin having been masked by the chronic progessive nephrosis affecting most animals at that stage. As acetaminophen had no effect on the renal accumulation of Cd, it may be concluded that pretreatment with this analygesic at a dose causing slight tubular dysfunction renders rat kidney more sensitive to the nephrotoxic action of Cd. This observation may be of clinical relevance for population groups occupationally or environmentally exposed to Cd.

  15. [Physiological response and bioaccumulation of Panax notoginseng to cadmium under hydroponic]. (United States)

    Li, Zi-wei; Yang, Ye; Cui, Xiu-ming; Liao, Pei-ran; Ge, Jin; Wang, Cheng-xiao; Yang, Xiao-yan; Liu, Da-hui


    The physiological response and bioaccumulation of 2-year-old Panax notoginseng to cadmium stress was investigated under a hydroponic experiment with different cadmium concentrations (0, 2.5, 5, 10 μmol · L(-1)). Result showed that low concentration (2.5 μmol · L(-1)) of cadmium could stimulate the activities of SOD, POD, APX in P. notoginseng, while high concentration (10 μmol · L(-1)) treatment made activities of antioxidant enzyme descended obviously. But, no matter how high the concentration of cadmium was, the activities of CAT were inhibited. The Pn, Tr, Gs in P. notoginseng decreased gradually with the increase of cadmium concentration, however Ci showed a trend from rise to decline. The enrichment coefficients of different parts in P. notoginseng ranked in the order of hair root > root > rhizome > leaf > stem, and all enrichment coefficients decreased with the increase of concentration of cadmium treatments; while the cadmium content in different parts of P. notoginseng and the transport coefficients rose. To sum up, cadmium could affect antioxidant enzyme system and photosynthetic system of P. notoginseng; P. notoginseng had the ability of cadmium enrichment, so we should plant it in suitable place reduce for reducing the absorption of cadmium; and choose medicinal parts properly to lessen cadmium intake. PMID:26677685

  16. Thin-film cadmium telluride photovoltaics: ES and H issues, solutions, and perspectives

    International Nuclear Information System (INIS)

    Photovoltaics (PV) is a growing business worldwide, with new technologies evolving towards potentially large-volume production. PV use produces no emissions, thus offsetting many potential environmental problems. However, the new PV technologies also bring unfamiliar environment, safety, and health (ES and H) challenges that require innovative solutions. This is a summary of the issues, solutions, and perspectives associated with the use of cadmium in one of the new and important PV technologies: thin-film, cadmium telluride (CdTe) PV, which is being developed and commercialized by several companies including Solar Cells Inc. (Toledo, Ohio), BP Solar (Fairfield, California), and Matsushita (Japan). The principal ES and H issue for thin-film cadmium telluride PV is the potential introduction of cadmium--a toxic heavy metal--into the air or water. The amount of cadmium in thin-film PV, however, is quite small--one nickel cadmium flashlight battery has about as much cadmium (7 g) as a square meter of PV module using current technology--and a typical cordless power tool will have 5--10 batteries. CdTe modules are also very well sealed, limiting the chance of release. Nonetheless, minimizing the amount of cadmium in cadmium telluride modules and preventing the introduction of that cadmium into the environment is a top priority for National Renewable Energy Laboratory researchers and cadmium telluride PV manufacturers

  17. Reduced cadmium-induced cytotoxicity in cultured liver cells following 5-azacytidine pretreatment

    Energy Technology Data Exchange (ETDEWEB)

    Waalkes, M.P.; Wilson, M.J.; Poirier, L.A.


    Recent work indicated that administration of the pyrimidine analog 5-azacytidine (AZA), either to cells in culture or to rats, results in an enhancement of expression of the metallothionein (MT) gene. Since MT is thought to play a central role in the detoxification of cadmium, the present study was designed to assess the effect of AZA pretreatment on cadmium cytotoxicity. Cultured rat liver cells in log phase of growth were first exposed to AZA (8 microM). Forty-eight hours later, cadmium was added. A modest increase in MT amounts over control was detected after AZA treatment alone. Cadmium alone resulted in a 10-fold increase in MT concentrations. The combination of AZA pretreatment followed by cadmium exposure caused a 23-fold increase in MT concentrations over control. Treatment with the DNA synthesis inhibitor hydroxyurea (HU) eliminated the enhancing effect of AZA pretreatment on cadmium induction of MT, indicating that cell division is required. AZA-pretreated cells were also harvested and incubated in suspension with cadmium for 0 to 90 min. AZA-pretreated cells showed marked reductions in cadmium-induced cytotoxicity as reflected by reduced intracellular potassium loss, glutamic-oxaloacetic transaminase loss, and lipid peroxidation following cadmium exposure. Results suggest that AZA pretreatment induces tolerance to cadmium cytotoxicity which appears to be due to an increased capacity to synthesize MT rather than high quantities of preexisting MT at the time of cadmium exposure.

  18. Reduced cadmium-induced cytotoxicity in cultured liver cells following 5-azacytidine pretreatment

    International Nuclear Information System (INIS)

    Recent work indicated that administration of the pyrimidine analog 5-azacytidine (AZA), either to cells in culture or to rats, results in an enhancement of expression of the metallothionein (MT) gene. Since MT is thought to play a central role in the detoxification of cadmium, the present study was designed to assess the effect of AZA pretreatment on cadmium cytotoxicity. Cultured rat liver cells in log phase of growth were first exposed to AZA (8 microM). Forty-eight hours later, cadmium was added. A modest increase in MT amounts over control was detected after AZA treatment alone. Cadmium alone resulted in a 10-fold increase in MT concentrations. The combination of AZA pretreatment followed by cadmium exposure caused a 23-fold increase in MT concentrations over control. Treatment with the DNA synthesis inhibitor hydroxyurea (HU) eliminated the enhancing effect of AZA pretreatment on cadmium induction of MT, indicating that cell division is required. AZA-pretreated cells were also harvested and incubated in suspension with cadmium for 0 to 90 min. AZA-pretreated cells showed marked reductions in cadmium-induced cytotoxicity as reflected by reduced intracellular potassium loss, glutamic-oxaloacetic transaminase loss, and lipid peroxidation following cadmium exposure. Results suggest that AZA pretreatment induces tolerance to cadmium cytotoxicity which appears to be due to an increased capacity to synthesize MT rather than high quantities of preexisting MT at the time of cadmium exposure

  19. Dietary intake and urinary level of cadmium and breast cancer risk: A meta-analysis. (United States)

    Lin, Jinbo; Zhang, Fang; Lei, Yixiong


    Cadmium, a human carcinogenic heavy metal, has been reported to be associated with breast cancer risk; however, the results from the epidemiological studies are not always consistent. The objective of this study was to quantitatively summarize the current evidence for the relationship between cadmium exposure and breast cancer risk using meta-analysis methods. Six studies determining the dietary cadmium intake level and five studies evaluating the urinary cadmium level were identified in a systematic search of MEDLINE and PubMed databases, and the associations between these levels and breast cancer risk were analysed. The pooled estimates under the random-effects model suggested that higher urinary cadmium levels were associated with an increased risk for breast cancer (highest versus lowest quantile, pooled odds ratio [OR]=2.24, 95% confidence interval [95%CI]=1.49-3.35) and a 1μg/g creatinine increase in urinary cadmium led to a 1.02-fold increment of breast cancer (pooled OR=2.02, 95%CI=1.34-3.03); however, pooled estimates for dietary cadmium intake found no significant association between cadmium exposure and breast cancer risk (highest versus lowest quantile, pooled relative risk [RR]=1.01, 95%CI=0.89-1.15). These results suggest that cadmium exposure may lead to an increased risk of breast cancer, and urinary cadmium levels can serve as a reliable biomarker for long-term cadmium exposure and may predict the breast cancer risk.

  20. [Physiological response and bioaccumulation of Panax notoginseng to cadmium under hydroponic]. (United States)

    Li, Zi-wei; Yang, Ye; Cui, Xiu-ming; Liao, Pei-ran; Ge, Jin; Wang, Cheng-xiao; Yang, Xiao-yan; Liu, Da-hui


    The physiological response and bioaccumulation of 2-year-old Panax notoginseng to cadmium stress was investigated under a hydroponic experiment with different cadmium concentrations (0, 2.5, 5, 10 μmol · L(-1)). Result showed that low concentration (2.5 μmol · L(-1)) of cadmium could stimulate the activities of SOD, POD, APX in P. notoginseng, while high concentration (10 μmol · L(-1)) treatment made activities of antioxidant enzyme descended obviously. But, no matter how high the concentration of cadmium was, the activities of CAT were inhibited. The Pn, Tr, Gs in P. notoginseng decreased gradually with the increase of cadmium concentration, however Ci showed a trend from rise to decline. The enrichment coefficients of different parts in P. notoginseng ranked in the order of hair root > root > rhizome > leaf > stem, and all enrichment coefficients decreased with the increase of concentration of cadmium treatments; while the cadmium content in different parts of P. notoginseng and the transport coefficients rose. To sum up, cadmium could affect antioxidant enzyme system and photosynthetic system of P. notoginseng; P. notoginseng had the ability of cadmium enrichment, so we should plant it in suitable place reduce for reducing the absorption of cadmium; and choose medicinal parts properly to lessen cadmium intake.

  1. (123)I-Meta-iodobenzylguanidine Sympathetic Imaging: Standardization and Application to Neurological Diseases. (United States)

    Nakajima, Kenichi; Yamada, Masahito


    (123)I-meta-iodobenzylguanidine (MIBG) has become widely applied in Japan since its introduction to clinical cardiology and neurology practice in the 1990s. Neurological studies found decreased cardiac uptake of (123)I-MIBG in Lewy-body diseases including Parkinson's disease and dementia with Lewy bodies. Thus, cardiac MIBG uptake is now considered a biomarker of Lewy body diseases. Although scintigraphic images of (123)I-MIBG can be visually interpreted, an average count ratio of heart-to-mediastinum (H/M) has commonly served as a semi-quantitative marker of sympathetic activity. Since H/M ratios significantly vary according to acquisition and processing conditions, quality control should be appropriate, and quantitation should be standardized. The threshold H/M ratio for differentiating Lewy-body disease is 2.0-2.1, and was based on standardized H/M ratios to comparable values of medium-energy collimators. Parkinson's disease can be separated from various types of parkinsonian syndromes using cardiac (123)I-MIBG, whereas activity is decreased on images of Lewy-body diseases using both (123)I-ioflupane for the striatum and (123)I-MIBG. Despite being a simple index, the H/M ratio of (123)I-MIBG uptake is reproducible and can serve as an effective tool to support a diagnosis of Lewy-body diseases in neurological practice. PMID:27689024

  2. Prolonged lung retention of 123I-IMP in pulmonary disease

    International Nuclear Information System (INIS)

    The accumulation of venously injected 123I-IMP in the lung was studied. At 30 and 50 min after the injection of the 1.5 mCi 123I-IMP, the concentration of 123I-IMP in the broncho-alveolar lavage fluid were much higher than in the blood. It was considered that 123I-IMP was transported into the alveolar spaces and was absorbed by the alveolar cells. The half time (T1/2) of the 123I-IMP release from the lung at 10 and 25 min immediately after the injection was calculated. In normal subjects the T1/2 ranged between 25 and 44 min and was prolonged in subjects with pulmonary fibrosis, sarcoidosis, and allergic alveolitis. It was considered that the retention of 123I-IMP was related not only to the endothelial cells, but also to the alveolar cells. It was considered that the analysis of the lung release of 123I-IMP forms a new lung dysfunction index. (orig.)

  3. 123I-Meta-iodobenzylguanidine Sympathetic Imaging: Standardization and Application to Neurological Diseases (United States)

    Yamada, Masahito


    123I-meta-iodobenzylguanidine (MIBG) has become widely applied in Japan since its introduction to clinical cardiology and neurology practice in the 1990s. Neurological studies found decreased cardiac uptake of 123I-MIBG in Lewy-body diseases including Parkinson's disease and dementia with Lewy bodies. Thus, cardiac MIBG uptake is now considered a biomarker of Lewy body diseases. Although scintigraphic images of 123I-MIBG can be visually interpreted, an average count ratio of heart-to-mediastinum (H/M) has commonly served as a semi-quantitative marker of sympathetic activity. Since H/M ratios significantly vary according to acquisition and processing conditions, quality control should be appropriate, and quantitation should be standardized. The threshold H/M ratio for differentiating Lewy-body disease is 2.0-2.1, and was based on standardized H/M ratios to comparable values of medium-energy collimators. Parkinson's disease can be separated from various types of parkinsonian syndromes using cardiac 123I-MIBG, whereas activity is decreased on images of Lewy-body diseases using both 123I-ioflupane for the striatum and 123I-MIBG. Despite being a simple index, the H/M ratio of 123I-MIBG uptake is reproducible and can serve as an effective tool to support a diagnosis of Lewy-body diseases in neurological practice. PMID:27689024

  4. Ecological toxicity of reactive X-3B red dye and cadmium acting on wheat (Triticum aestivum)

    Institute of Scientific and Technical Information of China (English)


    Ecological toxicity of reactive X-3B red dye and cadmium in both their single form and their combined form on wheat was studied using the experimental method of seed and root exposure. The single-factor exposure indicated that the inhibitory rate of wheat root elongation was significantly increased with the increase in the concentration of the dye in the cultural solution, although seed germination of wheat was not sensitive to the dye. The toxicity of cadmium was greatly higher than that of the dye, but low concentration cadmium (< 40 mg/L) could promote the germination of wheat seed. Interactive effects of the dye and cadmium on wheat were complicated. There was no significant correlation between the inhibitory rate of seed germination and the concentrations of the dye and cadmium. Low concentration cadmium could strengthen the toxicity of the dye acting on root elongation. On the contrary, high concentration cadmium could weaken the toxicity of the dye acting on root elongation.

  5. Dissolution ad uptake of cadmium from dental gold solder alloy implants

    International Nuclear Information System (INIS)

    Pure metallic cadmium was irradiated by means of thermal neutrons. The irradiated cadmium (115Cd) was placed in bags of gold foil and the bags were implanted subcutaneously in the neck region of mice. Two and 3 d respectively after implantation the mice were killed, the bags removed and the animals subjected to whole-body autoradiography. The autoradiograms revealed an uptake of 115Cd in liver and kidney. In another experiment specimens of a cadmium-containing dental gold solder alloy, a cadmium-free dental casting gold alloy and soldered assemblies made of these two alloys were implanted subcutaneously in the neck region of mice. The animals were killed after 6 months; cadmium analysis showed significant increases in the cadmium concentration in liver and kidney of those mice which had been given implants of gold solder alloy. The study clearly shows that due to electrochemical corrosion cadmium can be released from implants and accumulated in the kidneys and the liver. (author)

  6. Cardiac Iodine-123 metaiodobenzylguanidine (123I-MIBG) scintigraphy parameter predicts cardiac and cerebrovascular events in type 2 diabetic patients without structural heart disease

    International Nuclear Information System (INIS)

    Cardiac iodine-123 metaiodobenzylguanidine (123I-MIBG) scintigraphy is an established method of assessment of cardiovascular sympathetic function. The aim of the present study was to investigate the long-term cardiovascular predictive value of cardiac 123I-MIBG scintigraphy parameters in Japanese type 2 diabetic patients without structural heart disease. Cardiac 123I-MIBG scintigraphy in 108 patients with type 2 diabetes who did not have structural heart disease, was evaluated. The washout rate (WR) was considered enhanced if it was ≥40%. Accurate follow-up information for 4.6 years was obtained in 54 enhanced WR patients (27 male; mean age, 61±11 years) and in 54 sex- and age-matched preserved WR patients (27 male; mean age, 61±10 years). Major adverse cardiac and cerebrovascular events (MACCE) were investigated. During follow-up, 10 enhanced WR patients developed MACCE including cardiac death, coronary revascularization, stroke, and congestive heart failure, while MACCE occurred in only 3 male patients. The Kaplan-Meier curves indicated that enhanced WR patients had higher incidence of MACCE than those with preserved WR (P123I-MIBG scintigraphy at baseline has long-term cardiovascular predictive value in Japanese patients with type 2 diabetes without structural heart disease. (author)

  7. Potential use of iodine-123 metaiodobenzylguanidine radioaerosol as a marker of pulmonary neuroadrenergic function

    International Nuclear Information System (INIS)

    In this study we performed: (1) a chromatographic study of nebulized 123I-MIBG; (2) a quantitative evaluation of the lung distribution of 123I-MIBG radioaerosol in normal subjects as compared with that of technetium-99m diethylene triamine penta-acetic acid (99mTc-DTPA) and (3) an assessment of 123I-MIBG lung clearance both under control conditions and after pharmacologically induced beta-blockade, again compared with 99mTc-DTPA. For these purposes, eight normal subjects were divided randomly into an ''MIBG group'' and a ''DTPA group'' (four subjects each) and submitted to three scintigraphic studies each: a baseline study, and studies after the administration of a low (80 mg) and a high (160 mg) dose of propranolol. Radiochemical purity of nebulized 123I-MIBG ranged between 97.18% and 98.70%. The lung distribution of 123I-MIBG, as judged by the aerosol penetration index, was identical to that of 99mTc-DTPA under all study conditions. The 123I-MIBG clearance rate was slower than that of 99mTc-DTPA under baseline conditions (135±32 min vs 69±27 min, P99mTc-DTPA clearance did not change. The following conclusions were drawn: (1) the nebulization does not affect the radiochemical purity of 123I-MIBG; (2) the lung distribution of 123I-MIBG is homogeneous in normal subjects; (3) the pulmonary clearance of 123I-MIBG reflects the functional status of the neuroadrenergic system of the lungs. Thus this scintigraphic method is suitable for research and perhaps for future clinical use. (orig.). With 2 figs., 3 tabs

  8. SPECT imaging using [{sup 123}I]{beta}-CIT and [{sup 123}I]IBF in extrapyramidal diseases

    Energy Technology Data Exchange (ETDEWEB)

    Sasaki, Takahiro; Amano, Takahiro; Hashimoto, Jun; Itoh, Yoshiaki; Muramatsu, Kazuhiro; Kubo, Atsushi; Fukuuchi, Yasuo [Keio Univ., Tokyo (Japan). School of Medicine


    Imaging of dopaminergic function is useful in the investigation of patients with Parkinson disease (iPD) and other extrapyramidal diseases. Using agents that bind to dopamine transporters ([{sup 123}I]{beta}-CIT) and receptors ([{sup 123}I]IBF SPECT), we investigated SPECT in 9 healthy volunteers and 24 patients for dopamine transporters as well as 15 patients for dopamine receptors. In {beta}-CIT SPECT studies, we examined 17 iPD patients (63.3{+-}9.9 y/o), 3 multiple system atrophy (MSA) patients (olivopontocerebellar atrophy (OPCA) type) (64.0{+-}8.0 y/o), 2 vascular parkinsonism (VP) patients (71.0{+-}0.0 y/o), 1 progressive supranuclear palsy (PSP) patient (69 y/o), 1 cortico-basal degeneration (CBD) patient (50 y/o) and nine healthy controls (39.1{+-}9.3 y/o). For IBF SPECT studies 11 iPD patients (60.6{+-}10.9 y/o), 3 MSA patients (2 OPCA type (50.5{+-}3.5 y/o) and 1 striatonigral degeneration (SND) type (65 y/o)) and 1 PSP patient (60 y/o) underwent SPECT scans after the injection of [{sup 123}I]IBF. The specific to nonspecific striatal ratio (St/Oc-1), ratio of putaminal uptake to caudatal uptake (Pu/Ca), and asymmetry indices (AI) were estimated. {beta}-CIT studies showed ST/Oc-1 as follows; iPD: 2.66{+-}1.09 (n=17), VP: 5.73 and 7.39, MSA: 1.84{+-}0.46 (n=3), PSP: 2.34, CBD: 2.16. In all extrapyramidal diseases except VP, St/Oc-1 ratios were significantly lower than those in normal volunteers (6.46{+-}1.08) (p<0.01). Also in early-phase iPD patients (Yahr I-II), St/Oc-1 (3.16{+-}1.49: n=4) was significantly lower than those in normal volunteers (p<0.01). In IBF studies, St/Oc-1 ratios were significantly higher in early-phase (Yahr I-II) iPD patients (1.82{+-}0.25: n=5) than those in late-phase (Yahr III-IV) iPD patients (1.38{+-}0.32: n=6) (p<0.05). The Pu/Ca ratios in iPD patients (1.12{+-}0.13) and MSA (OPCA type) patients (0.95{+-}0.05) were higher than that in MSA (SND type) patient (0.78) and were lower than that in PSP patient (1.55). In conclusion

  9. sup 123 I-IMP-SPECT in vascular dementia

    Energy Technology Data Exchange (ETDEWEB)

    Namura, Yasuhiro; Miyoshi, Toshihiko; Shio, Hideo; Yamaguchi, Shinya; Kimura, Jun (Kyoto Univ. (Japan). Hospital)


    Cerebral blood flow (CBF) was studied by N-isopropyl-p-{sup 123}I-iodoamphetamine (IMP)-single photon emission computed tomography (SPECT) in patients with vascular dementia. Patients were divided by CT/MRI findings into multiple or localized type and cortical or subcortical type. Of patients with multiple lesions in the cortex, the reduction of CBF was noted in several cortex corresponding to CT/MRI findings. Patients in this group had a high incidence of aphasia, agraphia, dyscalculia, and amnesia. Patients with multiple lesions in the white matter and basal ganglia were subdivided into 3 groups by clinical manifestations. CBF in those with dementia showed generalized reduction in all cerebral cortex and especially in bilateral frontal regions. CBF in those with slightly impaired mentality was almost normal. In another group with pseudobulbar palsy and/or extrapyramidal sings, CBF was reduced intermediately only in bilateral frontal regions. Typical symptoms in demented patients were apathy, emotional lability, and forgetfulness. In those with the localized type, CBF was reduced in cerebral cortical areas correlating with the impaired mental functions. (author).

  10. Peripheral giant cell granuloma: A review of 123 cases

    Directory of Open Access Journals (Sweden)

    Niloofar Shadman


    Full Text Available Background: Peripheral giant cell granuloma is one of the reactive hyperplastic lesions of the oral cavity, which originates from the periosteum or periodontal membrane following local irritation or chronic trauma. The purpose of this study was to present the clinical characteristics of peripheral gi-ant cell granuloma in a group of Iranian population. Methods: A series of 123 consecutive confirmed cases of peripheral giant cell granuloma after biopsy were evaluated. Age, sex, anatomic location, consistency, etiologic factor, pain and bleeding history, color, surface texture, and pedicle situation were recorded and were analyzed by chi-square test and values were considered to be significant if P < 0.05. Results: Age ranged from 6 to 75 years (mean 33 years. Women affected more than men (M/F 1:1.1. Peripheral giant cell granuloma was seen in the mandible more than in the maxilla and in the anterior region more than in the posterior region. In most cases, lesions were pink, pedunculated and had non-ulcerated surface. In less than half of the cases, there was no history of bleeding and also pain was rarely reported. Calculus was the most common etiologic factor. Conclusion: The results confirmed that the clinical features of peripheral giant cell granuloma in a group of Iranian population are almost similar to those reported by other investigators.

  11. 123I-IMP-SPECT in vascular dementia

    International Nuclear Information System (INIS)

    Cerebral blood flow (CBF) was studied by N-isopropyl-p-123I-iodoamphetamine (IMP)-single photon emission computed tomography (SPECT) in patients with vascular dementia. Patients were divided by CT/MRI findings into multiple or localized type and cortical or subcortical type. Of patients with multiple lesions in the cortex, the reduction of CBF was noted in several cortex corresponding to CT/MRI findings. Patients in this group had a high incidence of aphasia, agraphia, dyscalculia, and amnesia. Patients with multiple lesions in the white matter and basal ganglia were subdivided into 3 groups by clinical manifestations. CBF in those with dementia showed generalized reduction in all cerebral cortex and especially in bilateral frontal regions. CBF in those with slightly impaired mentality was almost normal. In another group with pseudobulbar palsy and/or extrapyramidal sings, CBF was reduced intermediately only in bilateral frontal regions. Typical symptoms in demented patients were apathy, emotional lability, and forgetfulness. In those with the localized type, CBF was reduced in cerebral cortical areas correlating with the impaired mental functions. (author)

  12. Adrenocortical Carcinoma: False Positive in an I-123 Metaiodobenzylguanidine Scan

    Energy Technology Data Exchange (ETDEWEB)

    Rey, Cristina Rodriguez; Candil, Aida Ortega; Galvan, Eliseo Vano; Martin, Maria Nieves Cabrera; Delgado, Jose Luis Carreras [Clinico San Carlos Hospital, Madrid (Spain)


    A 55-year-old man with a personal his history of left pheochromocytoma 2 years previously presented with an abdominal ultrasound showed a large left upper quadrant solid mass (calipers), with heterogeneous echogenicity and central cystic degeneration areas or necrosis. F-18 Fluorodeoxyglucose (FDG) positron emission tomography (PET)/CT was performed as ACC was suspected. ACC is an uncommon malignant neoplasm of unknown cause; however, smoking and oral contraceptives may be risk factors. Patients usually present with advanced-stage disease and have poor prognosis, with a 2-year recurrence rate that ranges form 73 to 86 %. An MIBG scan was performed after injection of 185 MBq of I-123 MIBG intravenously. Single photon emission tomography (SPECT)/CT scan showed abnormal isotope accumulation in the tumor region. The patient underwent total resection of the tumor. The histology was of ACC, with areas of necrosis and cystic areas, so the result of the MIBG scan was a false positive. Authors divided false-positive MIBG studies into three categories. The first category is neuroendocrine lesions other than pheochromocytomas (tumors of the APUD series). the second category consists in adrenal lesions other than pheochromocytomas (adenomas, ACC) the reasons for this abnormal uptake are unclear. The third category consists of tracer uptake adjacent to the adrenal due to abnormalities in the route of excretion.

  13. A New Klebsiella planticola Strain (Cd-1) Grows Anaerobically at High Cadmium Concentrations and Precipitates Cadmium Sulfide


    Sharma, Pramod K.; Balkwill, David L.; Frenkel, Anatoly; Vairavamurthy, Murthy A.


    Heavy metal resistance by bacteria is a topic of much importance to the bioremediation of contaminated soils and sediments. We report here the isolation of a highly cadmium-resistant Klebsiella planticola strain, Cd-1, from reducing salt marsh sediments. The strain grows in up to 15 mM CdCl2 under a wide range of NaCl concentrations and at acidic or neutral pH. In growth medium amended with thiosulfate, it precipitated significant amounts of cadmium sulfide (CdS), as confirmed by x-absorption...

  14. Changes in Tissue Metals After Cadmium Intoxication and Intervention With Chlorpromazine in Male Rats 

    Institute of Scientific and Technical Information of China (English)



    Cadmium(Cd),one of the most dangerous heavy metals,has a very similar ionic radius to calcium(Ca),The interference of cadmium in calcium homeostasis may play an important role in cadmium toxicity.Recent reports indicate that calmodulin(CaM) inhibitors such as trifluoperazine and chlorpromazine(CPZ) could protect rodents against cadmium toxicity,It was also reported that pretreatment of mice with zine(Zn)could reduce the adverse effects induced by cadmium.The aim of this study is to determine whether Cd changes the balance of other essential metals such as Zn and copper(Cu) in rat tissues,and whether CPZ can reverse these changes which are induced by cadmium intoxication.Adult male Sprague-Dawley(SD) rats were injected intraperitoneally(ip) with cadmium chloride(CdCl2)(0.2,0.4,0.8mg Cd/kg body wight) alone and 0.4mg Cd/kg in association with CPZ(5mg/kg) daily for a week.The control animals were injected with normal saline only.The results showed that the cadmium content in the liver,kidney,and testis increased significantly with a dose-response relationship.Cadmium treatment markedly increased the Zn and Ca content in some of the tissues,Hepatic and renal metallothionein(MT) increased significantly after cadmium intoxication,CPZ treatment,howerver,reduced cadmium content in liver,but not blood and kidney.CPZ seemed to decrease the content of MT in liver and significantly increase the amounts of MT in kidney.These data suggest that the intervention of cadmium with tissue essential metals may play a role in cadium toxicity in rats,and calmodulin inhibitors to some extent can reduce the adverse effect of cadmium by decreasing the cadmium load in tissues and reversing the unbalance of essetial metals.

  15. Thin films and solar cells of cadmium telluride and cadmium zinc telluride

    Energy Technology Data Exchange (ETDEWEB)

    Ferekides, C.S.


    The objectives of this dissertation are to investigate (1) the metalorganic chemical vapor deposition (MOCVD) and properties of cadmium telluride (CdTe) and cadmium zinc telluride (Cd(1-x)Zn(z)Te) films and junctions, and their potential application to solar cells, and (2) the fabrication and characterization of CdTe solar cells by the close spaced sublimation (CSS) technique. CdTe and Cd(1-x)Zn(x)Te films have been deposited by MOCVD on a variety of substrates at 300-400 C.The effect of the deposition parameters and post deposition heat treatments on the electrical, optical, and structural properties have been investigated. Heterojunctions of the configuration CdTe/transparent conducting semiconductor (TCS) and Cd(1-x)Zn(x)Te/TCS have been prepared and characterized. CdTe(MOCVD)/CdS and Cd(1-x)Zn(x)Te(E sub g = 1.65eV)/Cd(1-x)Zn(x)S solar cells with efficiencies of 9.9 percent and 2.4 percent, respectively have been fabricated. The as-deposited CdTe(MOCVD)/CdS junctions exhibited high dark current densities due to deflects at the interface associated with small grain size. No effective post-deposition heat treatment has been developed. CdTe/CdS solar cells have also been fabricated by the close spaced sublimation (CSS). Significant improvements in material and processing have been made, and in collaboration with fellow researchers an AM1.5 conversion efficiency of 13.4 percent has been demonstrated, the highest efficiency ever measured for such devices. The highest conversion efficiency for the CdTe(CSS)/CdS solar cell was achieved by reaching high open-circuit voltages and fill factors, while the short-circuit current densities were moderate. These results indicate that further improvements to increase the short-circuit current densities can result in conversion efficiencies over 15 percent.

  16. Future trends in soil cadmium concentration under current cadmium fluxes to European agricultural soils. (United States)

    Six, L; Smolders, E


    The gradual increase of soil cadmium concentrations in European soils during the 20th century has prompted environmental legislation to limit soil cadmium (Cd) accumulation. Mass balances (input-output) reflecting the period 1980-1995 predicted larger Cd inputs via phosphate (P) fertilizers and atmospheric deposition than outputs via crop uptake and leaching. This study updates the Cd mass balance for the agricultural top soils of EU-27+Norway (EU-27+1). Over the past 15 years, the use of P fertilizers in the EU-27+1 has decreased by 40%. The current mean atmospheric deposition of Cd in EU is 0.35 g Cd ha(-1) yr(-1), this is strikingly smaller than values used in the previous EU mass balances (~3 g Cd ha(-1) yr(-1)). Leaching of Cd was estimated with most recent data of soil solution Cd concentrations in 151 soils, which cover the range of European soil properties. No significant time trends were found in the data of net applications of Cd via manure, compost, sludge and lime, all being small sources of Cd at a large scale. Modelling of the future long-term changes in soil Cd concentrations in agricultural top soils under cereal or potato culture predicts soil Cd concentrations to decrease by 15% over the next 100 years in an average scenario, with decreasing trends in some scenarios being more prevalent than increasing trends in other scenarios. These Cd balances have reverted from the general positive balances estimated 10 or more years ago. Uncertainty analysis suggests that leaching is the most uncertain relative to other fluxes.

  17. [{sup 123}I]IPCIT and [{sup 123}I]{beta}-CIT as SPECT tracers for the dopamine transporter A comparative analysis in nonhuman primates

    Energy Technology Data Exchange (ETDEWEB)

    Scanley, B.E. E-mail:; Gandelman, M.S.; Laruelle, M.; Al-Tikriti, M.S.; Baldwin, R.M.; Zoghbi, S.S.; Hoffer, P.B.; Wang, S.; Neumeyer, J.L.; Innis, R.B


    [{sup 123}I]2{beta}-Carbomethoxy-3{beta}-(4-iodophenyl)tropane ([{sup 123}I]{beta}-CIT) and its isopropylester analog [{sup 123}I]IPCIT, both of which are phenyltropane derivatives of cocaine with high affinity for the dopamine (DA) transporter, were compared using single photon emission computed tomography in nonhuman primates. Although IPCIT is significantly more selective for the DA transporter than {beta}-CIT, striatal distribution volumes of specifically bound tracer were similar for both tracers. Compartmental modeling results were compared with a simple peak equilibrium method used previously by this group. The peak equilibrium method is shown to overestimate striatal distribution volumes, primarily due to a difference in the calculated time of peak specific uptake.

  18. Lead and cadmium in wild birds in southeastern Spain

    Energy Technology Data Exchange (ETDEWEB)

    Garcia-Fernandez, A.J.; Sanchez-Garcia, J.A.; Luna, A. [Univ. of Murcia (Spain); Jimenez-Montalban, P. [Regional Environmental Agency, Murcia (Spain). Centro de Recuperacion de Fauna Silvestre El Valle


    The main purpose of this study was to monitor exposure to lead and cadmium in wild birds in Murcia, a southeastern region of Spain on the Mediterranean coast. This region lies on one of the African-European flyways. Samples of liver, kidney, brain, bone, and whole blood from several species of wild birds were obtained during 1993. The authors found a clear relationship between cadmium and lead concentrations in birds and their feedings habits. Vultures (Gyps fulvus) had the highest concentrations of lead (mean 40 {micro}g/dl in blood), and seagulls (Larus argentatus and Larus ridibundus) the highest concentrations of cadmium (mean 4.43 {micro}g/g in kidney). Insectivores had high concentrations of both metals, and diurnal and nocturnal raptors showed the lowest tissue concentrations. The findings that tissue and blood concentrations were generally not elevated suggests environmental (rather than acute) exposure. Birds from more industrialized areas of the region studied here had higher concentrations of both lead and cadmium.

  19. Nickel cadmium batteries. Citations from the NTIS data base (United States)

    Cavagnaro, D. M.


    The design, fabrication, components, testing, and assembly of nickel cadmium batteries are covered in the bibliography. The majority of these citations deal with the development of power supplies for aircraft and spacecraft. This updated bibliography contains 135 abstracts, 19 of which are new entries to the previous edition.

  20. A method for partitioning cadmium bioaccumulated in small aquatic organisms

    Energy Technology Data Exchange (ETDEWEB)

    Siriwardena, S.N.; Rana, K.J.; Baird, D.J. [Univ. of Stirling (United Kingdom). Institute of Aquaculture


    A series of laboratory experiments was conducted to evaluate bioaccumulation and surface adsorption of aqueous cadmium (Cd) by sac-fry of the African tilapia Oreochromis niloticus. In the first experiment, the design consisted of two cadmium treatments: 15 {micro}g Cd{center_dot}L{sup {minus}1} in dilution water and a Cd-ethylenediaminetetraacetic acid (Cd-EDTA) complex at 15 {micro}m{center_dot}L{sup {minus}1}, and a water-only control. There were five replicates per treatment and 40 fish per replicate. It was found that EDTA significantly reduced the bioaccumulation of cadmium by tilapia sac-fry by 34%. Based on the results, a second experiment was conducted to evaluate four procedures: a no-rinse control; rinsing in EDTA; rinsing in distilled water; and rinsing in 5% nitric acid, for removing surface-bound Cd from exposed sac-fry. In this experiment, 30 fish in each of five replicates were exposed to 15 {micro}g Cd{center_dot}L{sup {minus}1} for 72 h, processed through the rinse procedures, and analyzed for total Cd. The EDTA rinse treatment significantly reduced (p<0.05) Cd concentrations of the exposed fish relative to those receiving no rinse. It was concluded that the EDTA rinse technique may be useful in studies evaluating the partitioning of surface-bound and accumulated cadmium in small aquatic organisms.

  1. Exposure determinants of cadmium in European mothers and their children

    DEFF Research Database (Denmark)

    Berglund, Marika; Larsson, Kristin; Grandér, Margaretha;


    The metal cadmium (Cd) is a widespread environmental pollutant with documented adverse effects on the kidneys and bones from long-term environmental exposure, but with insufficiently elucidated public health consequences such as risk of cardiovascular disease, hormone-related cancer in adults and...

  2. GEMAS: Geochemical Distribution of Cadmium in European Soil (United States)

    Birke, Manfred; Reimann, Clemens; Demetriades, Alecos; Dinelli, Enrico; Halamić, Josip; Rauch, Uwe; Gosar, Mateja; Ladenberger, Anna; Klos, Volodymyr; De Vivo, Benedetto


    Cadmium concentrations are reported for the urbanisation and use of fertilisers. The median value of Cd in the mobile metal ion (MMI®) extraction of Ap soil samples is 0.054 mg/kg. The Cd distribution pattern of MMI® extracts shows a zone of relatively high values throughout central Europe, which can be linked to agricultural land use (input of Cd via fertlisers).

  3. Plant science: the key to preventing slow cadmium poisoning

    NARCIS (Netherlands)

    Clemens, S.; Aarts, M.G.M.; Thomine, S.; Verbruggen, N.


    Practically all human populations are environmentally exposed to cadmium (Cd), mostly through plant-derived food. A growing body of epidemiological evidence suggests that there is no margin of safety between current Cd exposure levels and the threshold for adverse health effects and, hence, there is

  4. The cadmium content in bone of osteoporotic patients

    International Nuclear Information System (INIS)

    There are about 50 elements in the human body. A half of them is the essential elements in the organism. The residual elements except main constituents are called the essential trace elements for the organism. Trace elements in human body are very important for physical reactions of life. There is an osteoporosis that is one of the old person's disease. The osteoporosis happened by changing some physical nature of bone with aging. Or hormone imbalance and deficiency of calcium intake degenerated the bone in quality, too. The trace elements in human organ tissues and human bone tissues were determined to make clear distribution of trace elements in the human body by neutron activation analysis. Very much cadmium was found in human bones of osteoporotic patients. Why the high concentration of cadmium present in the bone tissues? Cadmium accumulates in it for long term of years. The Cd rich bone easily damaged by very weak impact. The normal bone mainly formed by Ca-hydroxyapatite with some connective protein tissues. Cadmium containing one formed by the hydroxyapatite, too. There is no apparent change in the nature and crystalline change. (author)

  5. Separator Qualification for Aerospace Nickel-cadmium Cells (United States)

    Milden, M. J.


    The development plans for a new separator for nickel cadmium (NiCd) cells is described. Research includes acceptance testing, operation in a charge/discharge characterization matrix, and life testing in low earth orbit (LEO) and geosynchronous (GEO) orbit under real time and accelerated conditions.

  6. Cadmium and zinc relationships in kidney cortex, liver, and pancreas

    Energy Technology Data Exchange (ETDEWEB)

    Elinder, C.G.; Piscator, M.; Linnman, L.


    Zinc and cadmium have been determined in kidney cortex, liver, and pancreas from 292 subjects autopsied in Stockholm, Sweden. In the liver and pancreas zinc was found to have a normal frequency distribution, average 45.3 and 26.9 wet wt, respectively. The concentrations of zinc in these two organs were constant regardless of age at death. Zinc was shown to accumulate with age in the kidney cortex in a way similar to cadmium, and had a log-normal distribution. The calculation of the regression line between individual cadmium concentrations below 60 and zinc concentrations gave a slope constant of 0.61 (Y/sub Zn/ = 0.61 X/sub Cd/ + 24.4), which corresponds to a nearly equimolar increase of zinc. The concentrations of ''physiological zinc,'' i.e., total zinc minus the zinc related to cadmium, were normally distributed (anti x = 24.6 Zn/g) and did not change with age. Furthermore, data on dry weight/wet weight ratios and ash weight/dry weight ratios in relation to age are presented.

  7. Tribological performance of organic cadmium compound as lubricant additive

    Institute of Scientific and Technical Information of China (English)

    HU Jian-qiang; XIE Feng; ZHU Huan-qin; ZHEN Fa-zheng; YAO Jun-bing


    The oil-soluble cadmium dipropyldithiophosphate additive was synthesized. A four-ball tester was used to evaluate the tribological performance of the additive in a mineral oil under different loads and lubricant grease synthesized compared with some commercial additives. The results show that it exhibits excellent antiwear and load-carrying capacities and is better than other additives. The surface analytical tools such as scanning electron microscope (SEM) with energy dispersive X-ray (EDX), X-ray photoelectron spectrometer (XPS) were used to investigate the topography, the compositions, and chemical states of some typical elements on the rubbing surface of worn scar.Smooth and light topography of worn scar further confirms that the additive shows good antiwear capacities. The results of EDX and XPS analyses indicate that tribochemical mixed protective films consisting of atomic cadmium, sulphides, sulphates and phosphates are formed on the rubbing surface, which contribute to improving the tribological properties of lubricant and grease. Particularly, the soft cadmium film formed plays an important role in improving antiwear properties of oils. Finally, antiwear mechanism of the additive and formation scheme of atomic cadmium was proposed.

  8. in situ immobilization of Cadmium and zinc in contaminated soils

    NARCIS (Netherlands)

    Osté, L.A.


    Keywords: beringite, cadmium, DOC, DOM, earthworms, immobilization, leaching, lime, manganese oxides, metal binding, metal uptake, organic matter partitioning, pH, soil contamination, remediation, sorption, Swiss chard, zeolites, zinc.It is generally assumed that a decrease in metal c

  9. Nuclear toxicology file: the cadmium: mechanisms to elucidate

    International Nuclear Information System (INIS)

    Spread in the environment by the human activities, the cadmium is a toxic and mutagen metal and its mechanisms of toxicity are still badly understood. We review here the molecular mechanisms of the transport, the toxicity and the detoxication of this metal by relying us on the cellular model of baker's yeast. (N.C.)

  10. Differents remediation methodos for lead, chromium and cadmium contaminated soils

    International Nuclear Information System (INIS)

    The usage of phosphates in the remediation of plots contaminated with heavy metals appears to be a good strategy to lessen the danger of these metals. This study analyses the effect of the mobilization of: Lead, chromium and cadmium by utilizing diverse forms of phosphates in contaminated soils of three different origins with ph modification and without it

  11. Cadmium translocation and accumulation in developing barley grains

    DEFF Research Database (Denmark)

    Chen, Fei; Wu, Feibo; Dong, Jing;


     Soil cadmium (Cd) contamination has posed a serious problem for safe food production and become a potential agricultural and environmental hazard worldwide. In order to study the transport of Cd into the developing grains, detached ears of two-rowed barley cv. ZAU 3 were cultured in Cd stressed...

  12. Determination of lead and cadmium in biological materials

    International Nuclear Information System (INIS)

    Sampling techniques and experience, and decomposition methods are presented. The processes used in flameless atomic absorption spectrometry (including the method using automatic insertion of samples), pulse polarography and isotope dilution mass spectrometry are described. Finally, the results of lead and cadmium measurements in bovine liver, blood, urine and hair samples are reported and discussed with a comparison of methods in some cases

  13. A major gene for grain cadmium accumulation in oat


    Tanhuanpää, Pirjo; Kalendar, Ruslan; Schulman, Alan; Kiviharju, Elina


    A population of 150 F2 plants was derived from a cross between two spring oat individuals, one from cv. Aslak (Boreal Plant Breeding LTd., Finland) and the other from cv. Salo (Svalöf-Weibull AB, Sweden). Cadmium was tested by inductively coupled plasma mass spectrometry (ICP-MS) method.

  14. Lead, mercury, and cadmium in breast milk

    Directory of Open Access Journals (Sweden)

    Kadriye Yurdakök


    Full Text Available Toxic heavy metals are the major source of environmental pollution in this new millennium. Lead, mercury, and cadmium are the most common toxic heavy metals in the environment. There is no known function of these toxic heavy metals in the human body. In females, toxic heavy metals can be accumulated in maternal body before pregnancy and may be transferred to fetus through placenta and later, via breast milk. Lead previously accumulated in maternal bones can be mobilized along with calcium in order to meet increased calcium needs of the fetus in pregnant women and for the calcium needs in human milk during lactation. Human fetus and infants are susceptible to heavy metal toxicity passing through placenta and breastmilk due to rapid growth and development of organs and tissues, especially central nervous system. However most of the damage is already done by the time the infant is born. Intrauterine lead exposure can cause growth retardation, cognitive dysfunction, low IQ scores on ability tests, and low performance in school. Biological samples, such as umbilical cord blood and breast milk, and less commonly infant hair, are used for biomonitoring of intra-uterine exposure to these toxic chemicals. Although toxic metals and other pollutants may be excreted into breast milk, their effects are unknown and this topic is subject of a growing body of research. Despite the possibility of harm from environmental contaminants in breast milk, breastfeeding is still recommended as the best infant feeding method. In fact, the species-specific components present in breast milk protect infants against infections; promote immune and neurologic system development; and may decrease the risk of disease, including allergies, obesity, insulin-dependent diabetes mellitus, inflammatory bowel disease, and sudden infant death syndrome. Breastfeeding also facilitates maternal-infant attachment. The potential risk of environmental contaminants that can be transferred from

  15. Uptake of cadmium by Pseudokirchneriella supcapitata

    Directory of Open Access Journals (Sweden)

    Magela Paula Casiraghi


    Full Text Available In this work the microalgae Pseudokirchneriella supcapitata was used for the removal of the cadmium in liquids. The accumulations of metal ions by the alga occur in two stages: a very fast absorption (passive adsorption proceeded by a slower absorption (activate absorption. A mathematical model based on the surface absorption and on the transport into the interior of the cellular membrane was developed. The simulation model kinetic parameters were experimentally obtained. Through the results observed, the mathematical model was shown to be suitable when compared to the experimental results, confirming the validation of the mathematical model.Neste trabalho utilizou-se a microalga Pseudokirchneriella supcapitata para a remoção do cádmio em líquidos. A metodologia consistiu de três conjuntos de experimentos: o primeiro conjunto teve como objetivo a avaliação do crescimento da alga, o segundo foi à avaliação da remoção de cádmio e o terceiro a avaliação do crescimento da alga sendo adicionado o cádmio junto com o inóculo no tempo igual a zero, também foi avaliada a remoção de cádmio neste terceiro experimento. O acúmulo de íons metálicos pela alga ocorre em duas etapas: uma absorção muito rápida (adsorção passiva seguida por uma absorção mais lenta (absorção ativa Desenvolveu-se um modelo matemático baseado na absorção da superfície e no transporte para o interior da membrana celular. A obtenção dos parâmetros cinéticos do modelo de simulação foi obtida experimentalmente. Pelos resultados observados o modelo matemático proposto mostrou-se adequado quando comparado aos resultados experimentais, confirmando a validação do modelo matemático proposto.

  16. Is rhamnolipid biosurfactant useful in cadmium phytoextraction?

    Energy Technology Data Exchange (ETDEWEB)

    Wen, Jia; Stacey, Samuel P. [Adelaide Univ., Glen Osmond, SA (Australia). Soil and Land Systems; McLaughlin, Mike J. [Adelaide Univ., Glen Osmond, SA (Australia). Soil and Land Systems; CSIRO Land and Water, Agricultural Sustainable Flagship, Environmental Biogeochemistry Program, Waite Campus, Urrbrae, SA (Australia); Kirby, Jason K. [CSIRO Land and Water, Agricultural Sustainable Flagship, Environmental Biogeochemistry Program, Waite Campus, Urrbrae, SA (Australia)


    Successful chelant-assisted phytoextraction requires application of an eco-friendly metal-complexing agent which enhances metal uptake but does not pose a significant risk of off-site movement of metals. Rhamnolipid biosurfactant has been used to enhance cadmium (Cd) removal from contaminated soil by washing. It has a strong affinity for Cd compared to some other hazardous metals, suggesting that rhamnolipid could be useful in Cd phytoextraction. This study investigated the potential use of rhamnolipid to enhance Cd phytoextraction. Adsorption patterns of rhamnolipid in soils were investigated by batch adsorption experiments. Hydrophobicity of rhamnolipid-metal complexes were determined by assessing partitioning in an octanol/water system. Phytotoxicity of rhamnolipid to maize (Zea mays) and chelant-assisted phytoextraction efficiency of maize and sunflower (Helianthus annuus) were determined in pot experiments. The results showed that rhamnolipid was prone to adsorb strongly to soil at low application rates (0.1-1.7 mM) possibly due to its hydrophobic interactions with soil organic matter, hence reducing its capacity to complex and transport metals to plant roots. Rhamnolipid mobility increased (i.e. decreased soil phase partitioning) at elevated concentrations ({proportional_to}4.4 mM), which increased soil solution Cd concentrations possibly due to its reduced hydrophobic nature. The use of rhamnolipid at concentrations >4.4 mM severely reduced maize biomass yield, reducing the potential for chelant-assisted phytoextraction. At lower concentrations of rhamnolipid (0.02-1.4 mmol/kg), there was insignificant enhancement of Cd accumulation by plant (Z. mays and H. annuus) shoots, likely through strong retention of the chelant (or Cd-associated rhamnolipid) on soil surfaces. High rates of rhamnolipid addition to soils in this study caused severe phytotoxicity to maize and sunflower. Lower rates of rhamnolipid addition to soils in this study did not improve Cd

  17. Low level exposure to cadmium increases the risk of chronic kidney disease: analysis of the NHANES 1999-2006

    Directory of Open Access Journals (Sweden)

    Sturniolo Antonio


    Full Text Available Abstract Background Environmental factors have been associated with the outbreak of chronic kidney disease (CKD. We evaluated the association of Cadmium (Cd exposure with the risk of CKD in U.S. adults who participated in the 1999-2006 National Health and Nutrition Examination Surveys (NHANES. Methods 5426 subjects ≥ 20 years were stratified for values of urinary and blood Cd and a multivariate logistic regression was performed to test the association between blood and urinary Cd, CKD and albuminuria (ALB after adjustment for age, gender, race/ethnicity, body mass index and smoking habits. Results Subjects with urinary Cd > 1 mcg/g and subjects with blood Cd > 1 mcg/L showed a higher association with ALB (OR 1.63, 95% CI 1.23, 2.16; P = 0.001. Subjects with blood Cd > 1 mcg/L showed a higher association with both CKD (OR 1.48, 95% CI 1.01, 2.17; P = 0.046 and ALB (OR 1.41, 95% CI 1.10, 1.82; P = 0.007. An interaction effect on ALB was found for high levels of urinary and blood Cd (P = 0.014. Conclusions Moderately high levels of urinary and blood Cd are associated with a higher proportion of CKD and ALB in the United States population.

  18. Spectroscopy of exotic 121,123,125Ag produced in fragmentation reactions

    International Nuclear Information System (INIS)

    Excited states in the neutron-rich 121,123,125Ag were studied via the fragmentation of a 136Xe beam at 120MeV/nucleon in a thick 9Be target. The levels in 121Ag were populated in the β decay of 121Pd while those assigned to 123,125Ag were identified via isomer spectroscopy. The transitions identified in 121Ag are consistent with the γ -rays reported in 117,119Ag. The newly observed transitions were placed in the level schemes of 123,125Ag based on the analysis of γ - γ coincidences and the systematics. We attribute the onset of isomerism in the 123,125Ag isotopes to the drop in energy of the negative-parity levels similar to the 5 - state in the even-even Cd cores. The proposed level scheme for 125Ag is well described by the NuShellX shell model calculations. (orig.)

  19. Imaging tissue hypoxia: clinical and pre-clinical experience with {sup 123}IAZA

    Energy Technology Data Exchange (ETDEWEB)

    Wiebe, L.I. [University of Alberta, Edmonton (Canada). Noujaim Institute for Pharmaceutical Oncology Research, Faculty of Pharmacy and Pharmaceutical Sciences


    The molecular mechanisms that underline the selective binding of iodazomycin arabinoside, IAZA, and related nitromidazoles are reviewed as a basis for interpretation of preclinical and clinical data for hypoxic binding of radioiodinated IAZA. Clinical data are presented for {sup 123}IAZA uptake in a number of pathologies including metastatic tumours, peripheral vascular disease in diabetes, muscle stress and rheumatoid arthritis. The results of studies to determine the influence of tumour type on uptake of {sup 123} I-IAZA in patients with a variety of deep-seated solid tumours will be presented. Correlations of hypoxia-dependent binding with {sup 99m}Tc-HMPAO perfusion images will be reviewed and early correlations of uptake to treatment response in cancer will be presented. Unusual features of {sup 123}I-IAZA biodistribution will also be discussed together with detailed pharmacokinetic and radiation dosimetry data for `2{sup 123}I- IAZA in normal volunteers 27 refs., 1 fig.

  20. Riik annab e-teenuste arenduseks 123 miljonit / Eva Kübar

    Index Scriptorium Estoniae

    Kübar, Eva


    Koostöös Euroopa Regionaalarengu Fondiga annab riik järgmise kolme aasta jooksul e-teenuste arendamiseks 123 miljonit krooni, suurimate projektide raames digitaliseeritakse kodanike isiku- ja meditsiinilised andmed. Lisa: Suurimad rahasaajad